1IVRA

Structure of aspartate aminotransferase
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
401
structure length
401
Chain Sequence
SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aspartate aminotransferase complexed with erythro-beta-hydroxyaspartate: crystallographic and spectroscopic identification of the carbinolamine intermediate.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Aminotransferase
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 136
structure length 401
sequence length 401
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1996-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1ivrA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1ivrA01
1ZOBA 1TATA 3E2FA 1ZODA 4ATQA 1KMJA 1ORDA 2AATA 1AMAA 3E2ZB 3LV2A 3MEBA 1WYTB 2VGZA 3TQXA 1ASFA 2D63A 4O6ZA 4W91A 4ZWMA 3HQTA 4IW7A 5D95A 2OQXA 3LG0A 3FQAA 2DGKA 3TFTA 4WB0B 2CFBA 3ASBA 5EAAA 3CQ6A 4XJMA 4EU1A 1QGNA 2HP2A 1MAQA 3HVYA 4JF0A 5E5IA 4JF1A 4IYOA 5M46A 3FD0A 4R8DA 5HDMA 4E3QA 1FG7A 1D7SA 4MY5A 5EUNA 4OCAA 4BMKA 3HDOA 4ADEA 4AO9A 2HOZA 2VMSA 1N31A 1QJ3A 1UU2A 2YRIA 4RITA 4RKCA 3H7FA 2AY4A 4EFFA 3DODA 2Z1YA 4XK1A 1V2EA 2R2NA 1G4VA 1WKGA 4N0WA 4RJ0A 4CVQA 3KGXA 1AMQA 1YIYA 3HLMA 3JWBA 1ASCA 1AHYA 3WCNA 2BWOA 1C0NA 2AY5A 2ZYJA 2EO5A 3EI9A 4B98A 4WXFA 2Z9XA 1ASBA 3EZSA 1ASMA 3L44A 3PAAA 3Q8NA 1S0AA 3MAFA 3OKSA 3AENB 3B1EA 3EI7A 2QB2A 2VMVA 1S09A 2GQNA 1IVRA 1CQ7A 2YKVA 4GRXA 4JEXA 4JE5A 1M0PA 3RCHB 2FNUA 1SPAA 1ZC9A 3W1IA 1C7OA 1IUGA 3FDDA 2BIGA 2FNIA 2AY8A 1MLYA 2WKAA 3IF2A 4FFCA 2W7MA 1PMOA 2ZY3A 2BI3A 1BW0A 3AEJA 3USFA 1TOJA 2CJGA 4OBUA 3ZZKA 3LVMA 1BJOB 3BWOA 2AEVA 3NYTA 3PIUA 4UHNA 3JZLA 4F5JA 4GDYA 4GEBA 5FT5A 1AMRA 1C4KA 3AEMA 2DKJA 3LWSA 4CXRA 5DX5A 2AY3A 2ZY2A 3FZ6A 4XEWA 1X28A 5G0AA 1LW5A 3B8XA 5IWQA 3KE3A 3H14A 2HP1A 4OC9A 1M4NA 4L0OA 1P3WA 4EB7A 3WGBA 1C7NA 1E5EA 2D64A 4H51A 1AIBA 2FN6A 1DGEA 1LS3A 1KKPA 1LKCA 2EZ1A 1XEYA 3AEPA 3RBLA 4GE4A 2OATA 4WBTA 4PIWA 2ZY4A 3II0A 2PO3A 2Z1ZA 3GWPA 3BS8A 4Q75A 4A0HA 4AH3A 4MKKA 3A9XA 4UHOA 2DKBA 2D65A 4ADCA 2Z67A 3EZ1A 2HUIA 2QBTA 1G4XA 1ASAA 3HT4A 4JE5D 3WCOA 1X29A 4LW2A 3LVJA 3QHXA 3M5UA 2QMAA 3CBFA 1J32A 4A6RA 2VMXA 2FM1A 4IXOA 4WB0A 2QA3A 1W7MA 2W7HA 3ASAA 2BI2A 3GBXA 4F5MA 3HBXA 7AATA 1KMKA 5LH9A 2BI1A 2VI8A 1LC5A 1I41A 4KAMA 2WK9A 1YNUA 1LC8A 2VIAA 1JG8A 3NU7A 4WYGA 1GDEA 1B4XA 1DTYA 2O0RA 2GSAA 4P3MA 5E4ZA 5K8BA 2VMTA 3L8AA 2Z9VA 1TOKA 3G8MA 1VJOA 2V1PA 1PG8A 3FRKA 4MQRA 3BB8A 4LNMA 5EIGB 4XJOA 1BJWA 1D2FA 2DR1A 2JG2A 4Q6RA 2ORDA 4UQVA 4W1WA 3MKJA 3ATHA 3N75A 5F8VA 1QITA 2AY9A 2X8UA 4GE7A 1AHXA 5TF5A 1EQBA 1OHYA 3NYSA 3A9ZA 3NRAA 1AAWA 3WX9A 1MDZA 2FQ6A 2FYFA 4F5LA 3ZRRA 4RLGA 2CB1A 4ZAHA 3FCRA 4IXSA 1GEXA 3DRDA 3E77A 8AATA 3LVLB 2OKJA 4F5KA 4OT8A 2ZY5A 1CJ0A 3FQ7A 3FZ8A 2X3LA 4OYTA 2YKUA 5G2PA 1TOIA 4R5ZA 2ZSMA 1PFFA 4DGTA 2VGSA 1WSTA 4BQ0A 1DKAA 5BJ4A 1C9CA 2D66A 4F5GA 4LC3A 3AEJC 3GETA 4XAUA 2CSTA 4ZWVA 4N0BA 2CH2A 1WYUA 4ZLVA 2JJGA 1UU1A 1UU0A 5G09A 4F4EA 4F5FA 4RM1A 4A0RA 1IAYA 1N2TA 4NOGA 2W8UA 1G7WA 1YJZA 3ZRQA 1BJNA 3AEMC 5FT8A 2AY6A 3GZDC 4A6UA 1V2DA 1B5PA 4MQQA 3AV7A 2AY1A 3EI8A 3NUBA 9AATA 1S08A 1ASGA 1AJSA 3JTXA 1U08A 3IHJA 3BV0A 4UHMA 1IAXA 3MC6A 3PJ0A 4AZKA 3EI5A 3VK3A 1J04A 1EJIA 1W7NA 2YOBA 4WYAA 5EAVA 4ZSWA 4GE9A 3UAKA 3ZRPA 1YJSA 1GC0A 4JEVA 1G7XA 2YCTA 1I43A 4AZJA 4A00A 4Y0DA 1Z7DA 2VLHA 3OP7A 5JAYA 4ZDLA 2BI9A 4IY7A 2R5EA 1C7GA 2YCNA 4JEZA 4XJPA 3W1HA 1S06A 5EFSA 3N0LA 5HHYA 4ADBA 3TFUA 1ARSA 4W8IA 4ZM3A 1BS0A 2YHKA 4JEWA 1AHEA 1D7UA 3FZ7A 2EGYA 4Q76A 4KYOA 3AOWA 1RVYA 4A0FA 4Y0IA 2ZJGA 1CQ8A 3B1DA 1IJIA 2R0TA 3FTBA 2W7FA 1TOGA 3I16A 2E7IA 1IX8A 5DB5A 3QPGA 2BI5A 3KGWA 1MDOA 2EPJA 2D7YA 1AAMA 2PB2A 2YRRA 2F8JA 3FFRA 1M32A 3GJUA 4WLJA 1O61A 1GEWA 4PFFA 3CQ5A 1WYVA 2AY7A 1BKGA 4QGRA 2VMNA 2W7EA 2C44A 3A8UX 3UE8A 2VMRA 5G4JA 1KL1A 4WYCA 1O69A 1SFFA 2YKYA 1AKBA 2BIAA 4GSAA 3WGCA 3GR9A 2VGTA 2EH6A 3AENA 3FVXA 5EUDA 2VMQA 3DXVA 1AKCA 1ELQA 1WYVB 2VIBA 2C7TA 3PA9A 3WY7A 2BIEA 1MAPA 3DXWA 3QGUA 2VMYA 4IX8A 5G4IA 4WLHA 2JJHA 2W7GA 4I8AA 4WD2A 1CL1A 1JS6A 1VEFA 2W7JA 3G7QA 4E1OA 4PVFA 1GBNA 3AEOA 2Z61A 2VMUA 2X5FA 3PD6B 2CJHA 1ASLA 3N5MA 3F9TA 3K28A 3K7YA 1M0OA 3COGA 4M2MA 2ZSLA 4TV7A 2HOYA 1OHWA 2CH1A 4OMAA 3CAIA 1AKAA 1GC4A 4ZDOA 1FG3A 3FSLA 3EIBA 1OHVA 2HUUA 4MKJA 1SZSA 2VMOA 4ADDA 1BJ4A 3NUIA 3T32A 3NX3A 1WYUB 1DJUA 4WYFA 1YOOA 1MDXA 1AY8A 5M49A 4E3RA 1B9HA 1KKJA 4U1TA 1W3UA 2W8TA 4Q31A 1GC3A 3KKIA 1B8GA 2BYJA 1X2AA 2OGAA 1IX6A 4W1XA 3HL2A 5DJ9A 3A9YA 1AHGA 5BJ3A 5AX8A 1LK9A 1AX4A 2NMPA 3TCMA 3ZZJA 5J8QA 1OXPA 1ECXA 3RI6A 4R5FA 1RV3A 1ELUA 2CTZA 2VMWA 4RIZA 1BQDA 4W5KA 1GEYA 1IBJA 5M4DA 3JWAA 4MQPA 2O7CA 3P1TA 3E2ZA 3WKSA 1AICA 3FVSA 3QBOA 2HOXA 2DGMA 1TARA 2D5YA 2WK8A 4OTLA 4CBRA 1I29A 1T3IA 2VYCA 2AEUA 3JU7A 4HVKA 3HMUA 4ISYA 4CXQA 4ITXA 1S07A 5F9SA 5FT4A 3E6GA 2VMPA 1AY5A 4TN4A 5HXXA 1O4SA 2XH1A 2GMUA 1ASDA 1MLZA 2W8VA 2C0RA 2ZP7A 2W7KA 3PGYA 4IYOB 1I48A 4WXGA 4WXBA 3QN6A 3DZZA 4DQ6A 1M7YA 4WP0A 1ARHA 1M6SA 4JEYA 5LHAA 4KXKA 3PDXA 2CY8A 2D61A 2CJDA 1GC2A 2HUFA 1V2FA 3BN1A 3D6KA 2HZPA 3BCAA 3GZCA 4K2BA 2O1BA 1N8PA 1WYTA 3DR7A 4IXZA 3VP6A 1CZEA 1M0NA 2W8WA 3I5TA 3ISLA 4R2NA 2D7ZA 3BCBA 4RAEA 1MGVA 3BWNA 4LNJA 3VK2A 3NYUA 2OKKA 4A72A 2BYLA 1TOEA 2QLRA 1BT4A 1QZ9A 4AOAA 1OATA 3FQ8A 5D5SA 2W7LA 3AATA 2EZ2A 4A6TA 1D7VA 1V72A 1EG5A 3VOMA 3DC1A 3E9KA 4W1VA 4OBVA 2E54A 1SZKA 1LC7A 3R9AA 1PMMA 1Z3ZA 2BKWA 3B46A 3F6TA 3WLXA 4M2KA 1BJOA 4FL0A 2GB3A 3MAUA 2YCPA 2VGUA 2Z9WA 1QIRA 3RUYA 3ELEA 3LY1A 4ZDPA 4LNLA 4XJLA 3DR4A 4E77A 4BA5A 3UWCA 4EB5A 3FKDA 4B9BA 4HF8A 2X5DA 4P7YA 3FFHA 3CQ4A 2BHXA 3RBFA 4LW4A 3RQ1A 1AIAA 3PPLA 3FVUA 4DBCA 2Z9UA 3E2YA 1SZUA 3NTJA 2E7UA 1KL2A 2TPLA 2HORA 3BC8A 3I4JA 3R4TA 2ZC0A 5EQCA 2W7IA 3EUCA 3WZFA 1SF2A 1E5FA 3NNKA 4PFNA 1CS1A 1AHFA 1H0CA 1CQ6A 4WYEA 2PB0A 3FDBA 2JJFA 1JF9A 3F0HA 2JISA 1XI9A 4ZASA 2VI9A 1CL2A 3MADA 4J8LA 3ELPA 2BWNA 1ARGA 3LVKA 1GD9A 4BA4A 2RFVA 3PDBB 1FC4A 4TMRA 3TATA 5I92A 2VGVA 1TPLA 1JS3A 2YKXA 3DU4A 2JJEA 2R5CB 3QI6A 1RV4A 4WYDA 4ZM4A 4U2HA 4F5HA 1AJSB 3EI6A 4ATPA 2JGTA 1B5OA 2VMZA 1ASNA 1Y4IA 3PDBA 3GSBA 3GZDA 5G2QA 3NDNA 3W1JA 1SVVA 1H1CA 3K40A 4M2JA 2VGWA 1DJ9A 1O62A 2AY2A 1ASEA 2Z20A 1QISA 1ARTA 2BWPA 2CINA 3WKRA 3JW9A 3MBBA 2E7JA 2V0YA 2VLFA 3MC6C 2G6WA 2CANA 4EMYA 1YAAA 4BHDA 4RKDA 1DFOA 4F5IA 1IX7A 1LW4A 1VP4A 1YJYA 4K2MA 1RVUA 4Y0HA 2C81A 4ITGA 5FT6A 3AOVA 3AELA 1BQAA 3DYDA 2QB3A 3BCXA 1ARIA 1UKJA 2W7DA 1QJ5A 2Q7WA 3G0TA 4MSOA 2ZUKA 1W7LA 1YIZA 4ZSYA 1WKHA 2XBNA 3NU8A 2DOUA 5M4BA 1OXOA 1AJRA 1TASA 2W8JA 3ACZA 3BWNC 5C6UA 1GCKA 3B1CA 2DGLA 5E3KA 2GMSA 5EUEA 3EIAA 1B9IA 4K2IA 1AY4A 3PD6A 5DJ1A 1CZCA 4J5UA 4UOYA 3VAXA 4A0GA 3RCHA 3P6KA 1M0QA 3QM2A 3VK4A 1W23A 2WK7A 5EIGA 4MGRA 4AO4A 1DGDA 3ECDA 1X0MA 2R5CA 3MAFB 2OGEA 4RJYA 1AMSA 1DJEA 1D7RA 4XQ2A 3A2BA 4CBSA
chains in the Genus database with same CATH superfamily
1ZOBA 1TATA 3N4XA 3E2FA 1ZODA 4ATQA 1KMJA 1ORDA 2AATA 1AMAA 3E2ZB 3LV2A 3MEBA 1WYTB 2VGZA 3TQXA 1ASFA 2D63A 4O6ZA 4W91A 4ZWMA 3HQTA 4IW7A 5D95A 2OQXA 3LG0A 3FQAA 2DGKA 3TFTA 4WB0B 2CFBA 3ASBA 5EAAA 3CQ6A 4XJMA 4EU1A 1QGNA 2HP2A 1MAQA 3HVYA 4JF0A 5E5IA 4JF1A 4IYOA 5M46A 3FD0A 4R8DA 5HDMA 4E3QA 1FG7A 1D7SA 4MY5A 5EUNA 4OCAA 4BMKA 3HDOA 4ADEA 4AO9A 2HOZA 2VMSA 1N31A 1QJ3A 1UU2A 2YRIA 4RITA 2FKIA 4RKCA 3H7FA 2AY4A 4EFFA 3DODA 2Z1YA 4XK1A 1V2EA 2R2NA 1G4VA 1WKGA 4N0WA 4RJ0A 4CVQA 3KGXA 1AMQA 1YIYA 3HLMA 3JWBA 1ASCA 1AHYA 3WCNA 2BWOA 1C0NA 2AY5A 2ZYJA 2EO5A 3EI9A 4B98A 4WXFA 2Z9XA 1ASBA 3EZSA 1ASMA 3L44A 3PAAA 3Q8NA 1S0AA 3MAFA 3OKSA 3AENB 3B1EA 3EI7A 2QB2A 2VMVA 1S09A 2GQNA 1IVRA 1CQ7A 2YKVA 4GRXA 4JEXA 4JE5A 1M0PA 3RCHB 2FNUA 1SPAA 1ZC9A 3W1IA 1C7OA 1IUGA 3FDDA 2BIGA 2FNIA 2AY8A 1MLYA 2WKAA 3IF2A 4FFCA 2W7MA 1PMOA 2ZY3A 2BI3A 1BW0A 3AEJA 3USFA 1TOJA 2CJGA 4OBUA 3ZZKA 3LVMA 1BJOB 3BWOA 2AEVA 3NYTA 3PIUA 4UHNA 3JZLA 4F5JA 3N7NA 4GDYA 4GEBA 5FT5A 1AMRA 1C4KA 3AEMA 2DKJA 3LWSA 4CXRA 5DX5A 2AY3A 2ZY2A 3FZ6A 4XEWA 1X28A 5G0AA 1LW5A 3B8XA 5IWQA 3KE3A 3H14A 2HP1A 4OC9A 1M4NA 4L0OA 1P3WA 4EB7A 3WGBA 1C7NA 1E5EA 2D64A 4H51A 1AIBA 2FN6A 1DGEA 1LS3A 1KKPA 1LKCA 2EZ1A 1XEYA 3AEPA 3RBLA 4GE4A 2OATA 4WBTA 4PIWA 2ZY4A 3II0A 2PO3A 2Z1ZA 1KAFA 3GWPA 3BS8A 4Q75A 4A0HA 4AH3A 4MKKA 3A9XA 4UHOA 2DKBA 2D65A 4ADCA 2Z67A 3EZ1A 2HUIA 2QBTA 1G4XA 1ASAA 3HT4A 4JE5D 3WCOA 1X29A 4LW2A 3LVJA 3QHXA 3M5UA 2QMAA 3CBFA 1J32A 4A6RA 2VMXA 2FM1A 4IXOA 4WB0A 2QA3A 1W7MA 2W7HA 3ASAA 2BI2A 3GBXA 4F5MA 3HBXA 7AATA 1KMKA 5LH9A 2BI1A 2VI8A 1LC5A 1I41A 4KAMA 2WK9A 1YNUA 1LC8A 2VIAA 1JG8A 3NU7A 4WYGA 1GDEA 1B4XA 1DTYA 2O0RA 2GSAA 4P3MA 5E4ZA 5K8BA 2VMTA 3L8AA 2Z9VA 1TOKA 3G8MA 1VJOA 2V1PA 1PG8A 3FRKA 4MQRA 3BB8A 4LNMA 5EIGB 4XJOA 1BJWA 1D2FA 2DR1A 2JG2A 4Q6RA 2ORDA 4UQVA 4W1WA 3MKJA 3ATHA 3N75A 5F8VA 1QITA 2AY9A 2X8UA 4GE7A 1AHXA 5TF5A 1EQBA 1OHYA 3NYSA 3A9ZA 3NRAA 1AAWA 3WX9A 1MDZA 2FQ6A 2FYFA 4F5LA 3ZRRA 4RLGA 2CB1A 4ZAHA 3FCRA 4IXSA 1GEXA 3DRDA 3E77A 8AATA 3LVLB 2OKJA 4F5KA 4OT8A 2ZY5A 1CJ0A 3FQ7A 3FZ8A 3N4RA 2X3LA 4OYTA 2YKUA 5G2PA 1TOIA 4R5ZA 2ZSMA 5KTBA 1PFFA 4DGTA 2VGSA 1WSTA 4BQ0A 1DKAA 5BJ4A 1C9CA 2D66A 4F5GA 4LC3A 3AEJC 3GETA 4XAUA 2CSTA 4ZWVA 2EYQA 4N0BA 2CH2A 1WYUA 4ZLVA 2JJGA 1UU1A 1UU0A 5G09A 4F4EA 4F5FA 4RM1A 4A0RA 1IAYA 1N2TA 4NOGA 2W8UA 1G7WA 1YJZA 3ZRQA 1BJNA 3AEMC 5FT8A 2AY6A 3GZDC 4A6UA 1V2DA 1B5PA 4MQQA 3AV7A 2AY1A 3EI8A 3NUBA 9AATA 1S08A 1ASGA 4H63Q 1AJSA 3JTXA 1U08A 3IHJA 3BV0A 4UHMA 1IAXA 3MC6A 3PJ0A 4K05A 4AZKA 3EI5A 3VK3A 1J04A 1EJIA 1W7NA 2YOBA 4WYAA 5EAVA 4ZSWA 4GE9A 3UAKA 3ZRPA 1YJSA 1GC0A 4JEVA 1G7XA 2YCTA 1I43A 4AZJA 4A00A 4Y0DA 1Z7DA 2VLHA 3OP7A 5JAYA 4ZDLA 2BI9A 4IY7A 2R5EA 1C7GA 2YCNA 4JEZA 4XJPA 3W1HA 1S06A 5EFSA 3N0LA 5HHYA 4ADBA 3TFUA 1ARSA 4W8IA 4ZM3A 1BS0A 2YHKA 4JEWA 1AHEA 1D7UA 3FZ7A 2EGYA 4Q76A 4KYOA 3AOWA 1RVYA 4A0FA 4Y0IA 2ZJGA 1CQ8A 3B1DA 1IJIA 2R0TA 3FTBA 2W7FA 1TOGA 3I16A 2E7IA 1IX8A 5DB5A 3QPGA 2BI5A 3KGWA 1MDOA 2EPJA 2D7YA 1AAMA 2PB2A 2YRRA 2F8JA 3FFRA 1M32A 3GJUA 4WLJA 2KFPA 1O61A 1GEWA 4PFFA 3CQ5A 1WYVA 2AY7A 1BKGA 4QGRA 2VMNA 2W7EA 2C44A 3A8UX 3UE8A 2VMRA 5G4JA 1KL1A 4WYCA 1O69A 1SFFA 2YKYA 1AKBA 2BIAA 4GSAA 3WGCA 3GR9A 2VGTA 2EH6A 3AENA 3FVXA 5EUDA 2VMQA 3DXVA 1AKCA 1ELQA 1WYVB 2VIBA 2C7TA 3PA9A 3WY7A 2BIEA 1MAPA 3DXWA 3QGUA 2VMYA 4IX8A 5G4IA 4WLHA 2JJHA 2W7GA 4I8AA 4WD2A 1CL1A 1JS6A 1VEFA 2W7JA 3G7QA 4E1OA 4PVFA 1GBNA 3AEOA 2Z61A 2VMUA 2X5FA 3PD6B 2CJHA 1ASLA 3N5MA 3F9TA 3K28A 3K7YA 1M0OA 3COGA 4M2MA 2ZSLA 4TV7A 2HOYA 1OHWA 2CH1A 4OMAA 3CAIA 1AKAA 1GC4A 4ZDOA 1FG3A 3FSLA 3EIBA 1OHVA 2HUUA 4MKJA 1SZSA 2VMOA 4ADDA 1BJ4A 2A1VA 3NUIA 3T32A 3NX3A 1WYUB 1DJUA 4WYFA 1YOOA 1MDXA 1AY8A 5M49A 4E3RA 1B9HA 1KKJA 4U1TA 1W3UA 2W8TA 4Q31A 1GC3A 3KKIA 1B8GA 2BYJA 1X2AA 2OGAA 3H9XA 1IX6A 4W1XA 3HL2A 5DJ9A 3A9YA 1AHGA 5BJ3A 5AX8A 1LK9A 1AX4A 2NMPA 3TCMA 3ZZJA 5J8QA 1OXPA 1ECXA 3RI6A 4R5FA 1RV3A 1ELUA 2CTZA 2VMWA 4RIZA 1BQDA 4W5KA 1GEYA 1IBJA 5M4DA 3JWAA 4MQPA 2O7CA 3P1TA 3E2ZA 3N4SA 3WKSA 1AICA 3FVSA 3QBOA 2HOXA 2DGMA 1TARA 2D5YA 2WK8A 4OTLA 4CBRA 1I29A 1T3IA 2VYCA 2AEUA 3JU7A 4HVKA 3HMUA 4ISYA 4CXQA 4ITXA 1S07A 5F9SA 5FT4A 3E6GA 2VMPA 1AY5A 4TN4A 5HXXA 1O4SA 2XH1A 2GMUA 1ASDA 1MLZA 2W8VA 2C0RA 2ZP7A 2W7KA 3PGYA 4IYOB 1I48A 4WXGA 4WXBA 3QN6A 3DZZA 4DQ6A 1M7YA 4WP0A 1ARHA 1M6SA 4JEYA 5LHAA 4KXKA 3PDXA 2CY8A 2D61A 2CJDA 1GC2A 2HUFA 1V2FA 3BN1A 3D6KA 2HZPA 3BCAA 3GZCA 4K2BA 2O1BA 1N8PA 1WYTA 3DR7A 4IXZA 3VP6A 1CZEA 1M0NA 2W8WA 3I5TA 3ISLA 4R2NA 2D7ZA 3BCBA 4RAEA 1MGVA 3BWNA 4LNJA 3VK2A 3NYUA 2OKKA 4A72A 2BYLA 1TOEA 2QLRA 1BT4A 1QZ9A 4AOAA 1OATA 3FQ8A 5D5SA 2W7LA 3AATA 2EZ2A 4A6TA 1D7VA 1V72A 1EG5A 3VOMA 3DC1A 3E9KA 4W1VA 4OBVA 2E54A 1SZKA 1LC7A 3R9AA 1PMMA 1Z3ZA 2BKWA 3B46A 3F6TA 3WLXA 4M2KA 1BJOA 4FL0A 2GB3A 3MAUA 2YCPA 2VGUA 2Z9WA 1QIRA 3RUYA 3ELEA 3LY1A 4ZDPA 4LNLA 4XJLA 3DR4A 4E77A 4BA5A 3UWCA 4EB5A 3FKDA 4B9BA 4HF8A 2X5DA 4P7YA 3FFHA 3CQ4A 2BHXA 3RBFA 4LW4A 3RQ1A 1AIAA 3PPLA 3FVUA 4DBCA 2Z9UA 3E2YA 1SZUA 3NTJA 2E7UA 1KL2A 2TPLA 2HORA 3BC8A 3I4JA 3R4TA 2ZC0A 5EQCA 2W7IA 3EUCA 3WZFA 1SF2A 1E5FA 3NNKA 4PFNA 1CS1A 1AHFA 1H0CA 1CQ6A 4WYEA 2PB0A 3FDBA 2JJFA 1JF9A 3F0HA 2JISA 1XI9A 4ZASA 2VI9A 1CL2A 3MADA 4J8LA 3ELPA 2BWNA 1ARGA 3LVKA 1GD9A 4BA4A 2RFVA 3PDBB 1FC4A 4TMRA 3TATA 5I92A 2VGVA 1TPLA 1JS3A 2YKXA 3DU4A 2JJEA 2R5CB 3QI6A 1RV4A 4WYDA 4ZM4A 4U2HA 4F5HA 1AJSB 3EI6A 4ATPA 2JGTA 1B5OA 2VMZA 1ASNA 1Y4IA 3PDBA 3GSBA 3GZDA 5G2QA 3NDNA 3W1JA 1SVVA 1H1CA 3K40A 4M2JA 2VGWA 1DJ9A 1O62A 2AY2A 1ASEA 2Z20A 1QISA 1ARTA 2BWPA 2CINA 3WKRA 3JW9A 3MBBA 2E7JA 2V0YA 2VLFA 3MC6C 2G6WA 2CANA 4EMYA 1YAAA 4BHDA 4RKDA 1DFOA 4F5IA 1IX7A 2WB6A 1LW4A 1VP4A 1YJYA 4K2MA 1RVUA 4Y0HA 2C81A 4ITGA 5FT6A 3AOVA 3AELA 1BQAA 3DYDA 2QB3A 3BCXA 1ARIA 1UKJA 2W7DA 1QJ5A 2Q7WA 3G0TA 4MSOA 2ZUKA 1W7LA 1YIZA 4ZSYA 1WKHA 2XBNA 3NU8A 2DOUA 5M4BA 1OXOA 1AJRA 1TASA 2W8JA 3ACZA 3BWNC 5C6UA 1GCKA 3B1CA 2DGLA 5E3KA 2GMSA 5EUEA 3EIAA 1B9IA 4K2IA 1AY4A 3PD6A 5DJ1A 1CZCA 4J5UA 4UOYA 3VAXA 4A0GA 2QSRA 3RCHA 3P6KA 1M0QA 3QM2A 3VK4A 1W23A 2WK7A 2G7JA 5EIGA 4MGRA 4AO4A 1DGDA 3ECDA 1X0MA 2R5CA 3MAFB 2OGEA 4RJYA 1AMSA 1DJEA 1D7RA 4XQ2A 3A2BA 4CBSA
chains in the Genus database with same CATH topology
1ZOBA 1TATA 3N4XA 3E2FA 1ZODA 4ATQA 1KMJA 1ORDA 2AATA 1AMAA 3E2ZB 3LV2A 3MEBA 1WYTB 2VGZA 3TQXA 1ASFA 2D63A 4O6ZA 4W91A 4ZWMA 3HQTA 4IW7A 5D95A 2OQXA 3LG0A 3FQAA 2DGKA 3TFTA 4WB0B 2CFBA 3ASBA 5EAAA 3CQ6A 4XJMA 4EU1A 1QGNA 2HP2A 1MAQA 3HVYA 4JF0A 5E5IA 4JF1A 4IYOA 5M46A 3FD0A 4R8DA 5HDMA 4E3QA 1FG7A 1D7SA 4MY5A 5EUNA 4OCAA 4BMKA 3HDOA 4ADEA 4AO9A 2HOZA 2VMSA 1N31A 1QJ3A 1UU2A 2YRIA 4RITA 2FKIA 4RKCA 3H7FA 2AY4A 4EFFA 3DODA 2Z1YA 4XK1A 1V2EA 2R2NA 1G4VA 1WKGA 4N0WA 4RJ0A 4CVQA 3KGXA 1AMQA 1YIYA 3HLMA 3JWBA 1ASCA 1AHYA 3WCNA 2BWOA 1C0NA 2AY5A 2ZYJA 2EO5A 3EI9A 4B98A 4WXFA 2Z9XA 1ASBA 3EZSA 1ASMA 3L44A 3PAAA 3Q8NA 1S0AA 3MAFA 3OKSA 3AENB 3B1EA 3EI7A 2QB2A 2VMVA 1S09A 2GQNA 1IVRA 1CQ7A 2YKVA 4GRXA 4JEXA 4JE5A 1M0PA 3RCHB 2FNUA 1SPAA 1ZC9A 3W1IA 1C7OA 1IUGA 3FDDA 2BIGA 2FNIA 2AY8A 1MLYA 2WKAA 3IF2A 4FFCA 2W7MA 1PMOA 2ZY3A 2BI3A 1BW0A 3AEJA 3USFA 1TOJA 2CJGA 4OBUA 3ZZKA 3LVMA 1BJOB 3BWOA 2AEVA 3NYTA 3PIUA 4UHNA 3JZLA 4F5JA 3N7NA 4GDYA 4GEBA 5FT5A 1AMRA 1C4KA 3AEMA 2DKJA 3LWSA 4CXRA 5DX5A 2AY3A 2ZY2A 3FZ6A 4XEWA 1X28A 5G0AA 1LW5A 3B8XA 5IWQA 3KE3A 3H14A 2HP1A 4OC9A 1M4NA 4L0OA 1P3WA 4EB7A 3WGBA 1C7NA 1E5EA 2D64A 4H51A 1AIBA 2FN6A 1DGEA 1LS3A 1KKPA 1LKCA 2EZ1A 1XEYA 3AEPA 3RBLA 4GE4A 2OATA 4WBTA 4PIWA 2ZY4A 3II0A 2PO3A 2Z1ZA 3GWPA 3BS8A 4Q75A 4A0HA 4AH3A 4MKKA 3A9XA 4UHOA 2DKBA 2D65A 4ADCA 2Z67A 3EZ1A 2HUIA 2QBTA 1G4XA 1ASAA 3HT4A 4JE5D 3WCOA 1X29A 4LW2A 3LVJA 3QHXA 3M5UA 2QMAA 3CBFA 1J32A 4A6RA 2VMXA 2FM1A 4IXOA 4WB0A 2QA3A 1W7MA 2W7HA 3ASAA 2BI2A 3GBXA 4F5MA 3HBXA 7AATA 1KMKA 5LH9A 2BI1A 2VI8A 1LC5A 1I41A 4KAMA 2WK9A 1YNUA 1LC8A 2VIAA 1JG8A 3NU7A 4WYGA 1GDEA 1B4XA 1DTYA 2O0RA 2GSAA 4P3MA 5E4ZA 5K8BA 2VMTA 3L8AA 2Z9VA 1TOKA 3G8MA 1VJOA 2V1PA 1PG8A 3FRKA 4MQRA 3BB8A 4LNMA 5EIGB 4XJOA 1BJWA 1D2FA 2DR1A 2JG2A 4Q6RA 2ORDA 4UQVA 4W1WA 3MKJA 3ATHA 3N75A 5F8VA 1QITA 2AY9A 2X8UA 4GE7A 1AHXA 5TF5A 1EQBA 1OHYA 3NYSA 3A9ZA 3NRAA 1AAWA 3WX9A 1MDZA 2FQ6A 2FYFA 4F5LA 3ZRRA 4RLGA 2CB1A 4ZAHA 3FCRA 4IXSA 1GEXA 3DRDA 3E77A 8AATA 3LVLB 2OKJA 4F5KA 4OT8A 2ZY5A 1CJ0A 3FQ7A 3FZ8A 3N4RA 2X3LA 4OYTA 2YKUA 5G2PA 1TOIA 4R5ZA 2ZSMA 5KTBA 1PFFA 4DGTA 2VGSA 1WSTA 4BQ0A 1DKAA 5BJ4A 1C9CA 2D66A 4F5GA 4LC3A 3AEJC 3GETA 4XAUA 2CSTA 4ZWVA 2EYQA 4N0BA 2CH2A 1WYUA 4ZLVA 2JJGA 1UU1A 1UU0A 5G09A 4F4EA 4F5FA 4RM1A 4A0RA 1IAYA 1N2TA 4NOGA 2W8UA 1G7WA 1YJZA 3ZRQA 1BJNA 3AEMC 5FT8A 2AY6A 3GZDC 4A6UA 1V2DA 1B5PA 4MQQA 3AV7A 2AY1A 3EI8A 3NUBA 9AATA 1S08A 1ASGA 4H63Q 1AJSA 3JTXA 1U08A 3IHJA 3BV0A 4UHMA 1IAXA 3MC6A 3PJ0A 4K05A 4AZKA 3EI5A 3VK3A 1J04A 1EJIA 1W7NA 2YOBA 4WYAA 5EAVA 4ZSWA 4GE9A 3UAKA 3ZRPA 1YJSA 1GC0A 4JEVA 1G7XA 2YCTA 1I43A 4AZJA 4A00A 4Y0DA 1Z7DA 2VLHA 3OP7A 5JAYA 4ZDLA 2BI9A 4IY7A 2R5EA 1C7GA 2YCNA 4JEZA 4XJPA 3W1HA 1S06A 5EFSA 3N0LA 5HHYA 4ADBA 3TFUA 1ARSA 4W8IA 4ZM3A 1BS0A 2YHKA 4JEWA 1AHEA 1D7UA 3FZ7A 2EGYA 4Q76A 4KYOA 3AOWA 1RVYA 4A0FA 4Y0IA 2ZJGA 1CQ8A 3B1DA 1IJIA 2R0TA 3FTBA 2W7FA 1TOGA 3I16A 2E7IA 1IX8A 5DB5A 3QPGA 2BI5A 3KGWA 1MDOA 2EPJA 2D7YA 1AAMA 2PB2A 2YRRA 2F8JA 3FFRA 1M32A 3GJUA 4WLJA 2KFPA 1O61A 1GEWA 4PFFA 3CQ5A 1WYVA 2AY7A 1BKGA 4QGRA 2VMNA 2W7EA 2C44A 3A8UX 3UE8A 2VMRA 5G4JA 1KL1A 4WYCA 1O69A 1SFFA 2YKYA 1AKBA 2BIAA 4GSAA 3WGCA 3GR9A 2VGTA 2EH6A 3AENA 3FVXA 5EUDA 2VMQA 3DXVA 1AKCA 1ELQA 1WYVB 2VIBA 2C7TA 3PA9A 3WY7A 2BIEA 1MAPA 3DXWA 3QGUA 2VMYA 4IX8A 5G4IA 4WLHA 2JJHA 2W7GA 4I8AA 4WD2A 1CL1A 1JS6A 1VEFA 2W7JA 3G7QA 4E1OA 4PVFA 1GBNA 3AEOA 2Z61A 2VMUA 2X5FA 3PD6B 2CJHA 1ASLA 3N5MA 3F9TA 3K28A 3K7YA 1M0OA 3COGA 4M2MA 2ZSLA 4TV7A 2HOYA 1OHWA 2CH1A 4OMAA 3CAIA 1AKAA 1GC4A 4ZDOA 1FG3A 3FSLA 3EIBA 1OHVA 2HUUA 4MKJA 1SZSA 2VMOA 4ADDA 1BJ4A 2A1VA 3NUIA 3T32A 3NX3A 1WYUB 1DJUA 4WYFA 1YOOA 1MDXA 1AY8A 5M49A 4E3RA 1B9HA 1KKJA 4U1TA 1W3UA 2W8TA 4Q31A 1GC3A 3KKIA 1B8GA 2BYJA 1X2AA 2OGAA 3H9XA 1IX6A 4W1XA 3HL2A 5DJ9A 3A9YA 1AHGA 5BJ3A 5AX8A 1LK9A 1AX4A 2NMPA 3TCMA 3ZZJA 5J8QA 1OXPA 1ECXA 3RI6A 4R5FA 1RV3A 1ELUA 2CTZA 2VMWA 4RIZA 1BQDA 4W5KA 1GEYA 1IBJA 5M4DA 3JWAA 4MQPA 2O7CA 3P1TA 3E2ZA 3N4SA 3WKSA 1AICA 3FVSA 3QBOA 2HOXA 2DGMA 1TARA 2D5YA 2WK8A 4OTLA 4CBRA 1I29A 1T3IA 2VYCA 2AEUA 3JU7A 4HVKA 3HMUA 4ISYA 4CXQA 4ITXA 1S07A 5F9SA 5FT4A 3E6GA 2VMPA 1AY5A 4TN4A 5HXXA 1O4SA 2XH1A 2GMUA 1ASDA 1MLZA 2W8VA 2C0RA 2ZP7A 2W7KA 3PGYA 4IYOB 1I48A 4WXGA 4WXBA 3QN6A 3DZZA 4DQ6A 1M7YA 4WP0A 1ARHA 1M6SA 4JEYA 5LHAA 4KXKA 3PDXA 2CY8A 2D61A 2CJDA 1GC2A 2HUFA 1V2FA 3BN1A 3D6KA 2HZPA 3BCAA 3GZCA 4K2BA 2O1BA 1N8PA 1WYTA 3DR7A 4IXZA 3VP6A 1CZEA 1M0NA 2W8WA 3I5TA 3ISLA 4R2NA 2D7ZA 3BCBA 4RAEA 1MGVA 3BWNA 4LNJA 3VK2A 3NYUA 2OKKA 4A72A 2BYLA 1TOEA 2QLRA 1BT4A 1QZ9A 4AOAA 1OATA 3FQ8A 5D5SA 2W7LA 3AATA 2EZ2A 4A6TA 1D7VA 1V72A 1EG5A 3VOMA 3DC1A 3E9KA 4W1VA 4OBVA 2E54A 1SZKA 1LC7A 3R9AA 1PMMA 1Z3ZA 2BKWA 3B46A 3F6TA 3WLXA 4M2KA 1BJOA 4FL0A 2GB3A 3MAUA 2YCPA 2VGUA 2Z9WA 1QIRA 3RUYA 3ELEA 3LY1A 4ZDPA 4LNLA 4XJLA 3DR4A 4E77A 4BA5A 3UWCA 4EB5A 3FKDA 4B9BA 4HF8A 2X5DA 4P7YA 3FFHA 3CQ4A 2BHXA 3RBFA 4LW4A 3RQ1A 1AIAA 3PPLA 3FVUA 4DBCA 2Z9UA 3E2YA 1SZUA 3NTJA 2E7UA 1KL2A 2TPLA 2HORA 3BC8A 3I4JA 3R4TA 2ZC0A 5EQCA 2W7IA 3EUCA 3WZFA 1SF2A 1E5FA 3NNKA 4PFNA 1CS1A 1AHFA 1H0CA 1CQ6A 4WYEA 2PB0A 3FDBA 2JJFA 1JF9A 3F0HA 2JISA 1XI9A 4ZASA 2VI9A 1CL2A 3MADA 4J8LA 3ELPA 2BWNA 1ARGA 3LVKA 1GD9A 4BA4A 2RFVA 3PDBB 1FC4A 4TMRA 3TATA 5I92A 2VGVA 1TPLA 1JS3A 2YKXA 3DU4A 2JJEA 2R5CB 3QI6A 1RV4A 4WYDA 4ZM4A 4U2HA 4F5HA 1AJSB 3EI6A 4ATPA 2JGTA 1B5OA 2VMZA 1ASNA 1Y4IA 3PDBA 3GSBA 3GZDA 5G2QA 3NDNA 3W1JA 1SVVA 1H1CA 3K40A 4M2JA 2VGWA 1DJ9A 1O62A 2AY2A 1ASEA 2Z20A 1QISA 1ARTA 2BWPA 2CINA 3WKRA 3JW9A 3MBBA 2E7JA 2V0YA 2VLFA 3MC6C 2G6WA 2CANA 4EMYA 1YAAA 4BHDA 4RKDA 1DFOA 4F5IA 1IX7A 2WB6A 1LW4A 1VP4A 1YJYA 4K2MA 1RVUA 4Y0HA 2C81A 4ITGA 5FT6A 3AOVA 3AELA 1BQAA 3DYDA 2QB3A 3BCXA 1ARIA 1UKJA 2W7DA 1QJ5A 2Q7WA 3G0TA 4MSOA 2ZUKA 1W7LA 1YIZA 4ZSYA 1WKHA 2XBNA 3NU8A 2DOUA 5M4BA 1OXOA 1AJRA 1TASA 2W8JA 3ACZA 3BWNC 5C6UA 1GCKA 3B1CA 2DGLA 5E3KA 2GMSA 5EUEA 3EIAA 1B9IA 4K2IA 1AY4A 3PD6A 5DJ1A 1CZCA 4J5UA 4UOYA 3VAXA 4A0GA 2QSRA 3RCHA 3P6KA 1M0QA 3QM2A 3VK4A 1W23A 2WK7A 2G7JA 5EIGA 4MGRA 4AO4A 1DGDA 3ECDA 1X0MA 2R5CA 3MAFB 2OGEA 4RJYA 1AMSA 1DJEA 1D7RA 4XQ2A 3A2BA 4CBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOB A;  1TAT A;  3E2F A;  1ZOD A;  4ATQ A;  1KMJ A;  1ORD A;  2AAT A;  1AMA A;  3E2Z B;  3LV2 A;  3MEB A;  1WYT B;  2VGZ A;  3TQX A;  1ASF A;  2D63 A;  4O6Z A;  4W91 A;  4ZWM A;  3HQT A;  4IW7 A;  5D95 A;  2OQX A;  3LG0 A;  3FQA A;  2DGK A;  3TFT A;  4WB0 B;  2CFB A;  3ASB A;  5EAA A;  3CQ6 A;  4XJM A;  4EU1 A;  1QGN A;  2HP2 A;  1MAQ A;  3HVY A;  4JF0 A;  5E5I A;  4JF1 A;  4IYO A;  5M46 A;  3FD0 A;  4R8D A;  5HDM A;  4E3Q A;  1FG7 A;  1D7S A;  4MY5 A;  5EUN A;  4OCA A;  4BMK A;  3HDO A;  4ADE A;  4AO9 A;  2HOZ A;  2VMS A;  1N31 A;  1QJ3 A;  1UU2 A;  2YRI A;  4RIT A;  4RKC A;  3H7F A;  2AY4 A;  4EFF A;  3DOD A;  2Z1Y A;  4XK1 A;  1V2E A;  2R2N A;  1G4V A;  1WKG A;  4N0W A;  4RJ0 A;  4CVQ A;  3KGX A;  1AMQ A;  1YIY A;  3HLM A;  3JWB A;  1ASC A;  1AHY A;  3WCN A;  2BWO A;  1C0N A;  2AY5 A;  2ZYJ A;  2EO5 A;  3EI9 A;  4B98 A;  4WXF A;  2Z9X A;  1ASB A;  3EZS A;  1ASM A;  3L44 A;  3PAA A;  3Q8N A;  1S0A A;  3MAF A;  3OKS A;  3AEN B;  3B1E A;  3EI7 A;  2QB2 A;  2VMV A;  1S09 A;  2GQN A;  1IVR A;  1CQ7 A;  2YKV A;  4GRX A;  4JEX A;  4JE5 A;  1M0P A;  3RCH B;  2FNU A;  1SPA A;  1ZC9 A;  3W1I A;  1C7O A;  1IUG A;  3FDD A;  2BIG A;  2FNI A;  2AY8 A;  1MLY A;  2WKA A;  3IF2 A;  4FFC A;  2W7M A;  1PMO A;  2ZY3 A;  2BI3 A;  1BW0 A;  3AEJ A;  3USF A;  1TOJ A;  2CJG A;  4OBU A;  3ZZK A;  3LVM A;  1BJO B;  3BWO A;  2AEV A;  3NYT A;  3PIU A;  4UHN A;  3JZL A;  4F5J A;  4GDY A;  4GEB A;  5FT5 A;  1AMR A;  1C4K A;  3AEM A;  2DKJ A;  3LWS A;  4CXR A;  5DX5 A;  2AY3 A;  2ZY2 A;  3FZ6 A;  4XEW A;  1X28 A;  5G0A A;  1LW5 A;  3B8X A;  5IWQ A;  3KE3 A;  3H14 A;  2HP1 A;  4OC9 A;  1M4N A;  4L0O A;  1P3W A;  4EB7 A;  3WGB A;  1C7N A;  1E5E A;  2D64 A;  4H51 A;  1AIB A;  2FN6 A;  1DGE A;  1LS3 A;  1KKP A;  1LKC A;  2EZ1 A;  1XEY A;  3AEP A;  3RBL A;  4GE4 A;  2OAT A;  4WBT A;  4PIW A;  2ZY4 A;  3II0 A;  2PO3 A;  2Z1Z A;  3GWP A;  3BS8 A;  4Q75 A;  4A0H A;  4AH3 A;  4MKK A;  3A9X A;  4UHO A;  2DKB A;  2D65 A;  4ADC A;  2Z67 A;  3EZ1 A;  2HUI A;  2QBT A;  1G4X A;  1ASA A;  3HT4 A;  4JE5 D;  3WCO A;  1X29 A;  4LW2 A;  3LVJ A;  3QHX A;  3M5U A;  2QMA A;  3CBF A;  1J32 A;  4A6R A;  2VMX A;  2FM1 A;  4IXO A;  4WB0 A;  2QA3 A;  1W7M A;  2W7H A;  3ASA A;  2BI2 A;  3GBX A;  4F5M A;  3HBX A;  7AAT A;  1KMK A;  5LH9 A;  2BI1 A;  2VI8 A;  1LC5 A;  1I41 A;  4KAM A;  2WK9 A;  1YNU A;  1LC8 A;  2VIA A;  1JG8 A;  3NU7 A;  4WYG A;  1GDE A;  1B4X A;  1DTY A;  2O0R A;  2GSA A;  4P3M A;  5E4Z A;  5K8B A;  2VMT A;  3L8A A;  2Z9V A;  1TOK A;  3G8M A;  1VJO A;  2V1P A;  1PG8 A;  3FRK A;  4MQR A;  3BB8 A;  4LNM A;  5EIG B;  4XJO A;  1BJW A;  1D2F A;  2DR1 A;  2JG2 A;  4Q6R A;  2ORD A;  4UQV A;  4W1W A;  3MKJ A;  3ATH A;  3N75 A;  5F8V A;  1QIT A;  2AY9 A;  2X8U A;  4GE7 A;  1AHX A;  5TF5 A;  1EQB A;  1OHY A;  3NYS A;  3A9Z A;  3NRA A;  1AAW A;  3WX9 A;  1MDZ A;  2FQ6 A;  2FYF A;  4F5L A;  3ZRR A;  4RLG A;  2CB1 A;  4ZAH A;  3FCR A;  4IXS A;  1GEX A;  3DRD A;  3E77 A;  8AAT A;  3LVL B;  2OKJ A;  4F5K A;  4OT8 A;  2ZY5 A;  1CJ0 A;  3FQ7 A;  3FZ8 A;  2X3L A;  4OYT A;  2YKU A;  5G2P A;  1TOI A;  4R5Z A;  2ZSM A;  1PFF A;  4DGT A;  2VGS A;  1WST A;  4BQ0 A;  1DKA A;  5BJ4 A;  1C9C A;  2D66 A;  4F5G A;  4LC3 A;  3AEJ C;  3GET A;  4XAU A;  2CST A;  4ZWV A;  4N0B A;  2CH2 A;  1WYU A;  4ZLV A;  2JJG A;  1UU1 A;  1UU0 A;  5G09 A;  4F4E A;  4F5F A;  4RM1 A;  4A0R A;  1IAY A;  1N2T A;  4NOG A;  2W8U A;  1G7W A;  1YJZ A;  3ZRQ A;  1BJN A;  3AEM C;  5FT8 A;  2AY6 A;  3GZD C;  4A6U A;  1V2D A;  1B5P A;  4MQQ A;  3AV7 A;  2AY1 A;  3EI8 A;  3NUB A;  9AAT A;  1S08 A;  1ASG A;  1AJS A;  3JTX A;  1U08 A;  3IHJ A;  3BV0 A;  4UHM A;  1IAX A;  3MC6 A;  3PJ0 A;  4AZK A;  3EI5 A;  3VK3 A;  1J04 A;  1EJI A;  1W7N A;  2YOB A;  4WYA A;  5EAV A;  4ZSW A;  4GE9 A;  3UAK A;  3ZRP A;  1YJS A;  1GC0 A;  4JEV A;  1G7X A;  2YCT A;  1I43 A;  4AZJ A;  4A00 A;  4Y0D A;  1Z7D A;  2VLH A;  3OP7 A;  5JAY A;  4ZDL A;  2BI9 A;  4IY7 A;  2R5E A;  1C7G A;  2YCN A;  4JEZ A;  4XJP A;  3W1H A;  1S06 A;  5EFS A;  3N0L A;  5HHY A;  4ADB A;  3TFU A;  1ARS A;  4W8I A;  4ZM3 A;  1BS0 A;  2YHK A;  4JEW A;  1AHE A;  1D7U A;  3FZ7 A;  2EGY A;  4Q76 A;  4KYO A;  3AOW A;  1RVY A;  4A0F A;  4Y0I A;  2ZJG A;  1CQ8 A;  3B1D A;  1IJI A;  2R0T A;  3FTB A;  2W7F A;  1TOG A;  3I16 A;  2E7I A;  1IX8 A;  5DB5 A;  3QPG A;  2BI5 A;  3KGW A;  1MDO A;  2EPJ A;  2D7Y A;  1AAM A;  2PB2 A;  2YRR A;  2F8J A;  3FFR A;  1M32 A;  3GJU A;  4WLJ A;  1O61 A;  1GEW A;  4PFF A;  3CQ5 A;  1WYV A;  2AY7 A;  1BKG A;  4QGR A;  2VMN A;  2W7E A;  2C44 A;  3A8U X;  3UE8 A;  2VMR A;  5G4J A;  1KL1 A;  4WYC A;  1O69 A;  1SFF A;  2YKY A;  1AKB A;  2BIA A;  4GSA A;  3WGC A;  3GR9 A;  2VGT A;  2EH6 A;  3AEN A;  3FVX A;  5EUD A;  2VMQ A;  3DXV A;  1AKC A;  1ELQ A;  1WYV B;  2VIB A;  2C7T A;  3PA9 A;  3WY7 A;  2BIE A;  1MAP A;  3DXW A;  3QGU A;  2VMY A;  4IX8 A;  5G4I A;  4WLH A;  2JJH A;  2W7G A;  4I8A A;  4WD2 A;  1CL1 A;  1JS6 A;  1VEF A;  2W7J A;  3G7Q A;  4E1O A;  4PVF A;  1GBN A;  3AEO A;  2Z61 A;  2VMU A;  2X5F A;  3PD6 B;  2CJH A;  1ASL A;  3N5M A;  3F9T A;  3K28 A;  3K7Y A;  1M0O A;  3COG A;  4M2M A;  2ZSL A;  4TV7 A;  2HOY A;  1OHW A;  2CH1 A;  4OMA A;  3CAI A;  1AKA A;  1GC4 A;  4ZDO A;  1FG3 A;  3FSL A;  3EIB A;  1OHV A;  2HUU A;  4MKJ A;  1SZS A;  2VMO A;  4ADD A;  1BJ4 A;  3NUI A;  3T32 A;  3NX3 A;  1WYU B;  1DJU A;  4WYF A;  1YOO A;  1MDX A;  1AY8 A;  5M49 A;  4E3R A;  1B9H A;  1KKJ A;  4U1T A;  1W3U A;  2W8T A;  4Q31 A;  1GC3 A;  3KKI A;  1B8G A;  2BYJ A;  1X2A A;  2OGA A;  1IX6 A;  4W1X A;  3HL2 A;  5DJ9 A;  3A9Y A;  1AHG A;  5BJ3 A;  5AX8 A;  1LK9 A;  1AX4 A;  2NMP A;  3TCM A;  3ZZJ A;  5J8Q A;  1OXP A;  1ECX A;  3RI6 A;  4R5F A;  1RV3 A;  1ELU A;  2CTZ A;  2VMW A;  4RIZ A;  1BQD A;  4W5K A;  1GEY A;  1IBJ A;  5M4D A;  3JWA A;  4MQP A;  2O7C A;  3P1T A;  3E2Z A;  3WKS A;  1AIC A;  3FVS A;  3QBO A;  2HOX A;  2DGM A;  1TAR A;  2D5Y A;  2WK8 A;  4OTL A;  4CBR A;  1I29 A;  1T3I A;  2VYC A;  2AEU A;  3JU7 A;  4HVK A;  3HMU A;  4ISY A;  4CXQ A;  4ITX A;  1S07 A;  5F9S A;  5FT4 A;  3E6G A;  2VMP A;  1AY5 A;  4TN4 A;  5HXX A;  1O4S A;  2XH1 A;  2GMU A;  1ASD A;  1MLZ A;  2W8V A;  2C0R A;  2ZP7 A;  2W7K A;  3PGY A;  4IYO B;  1I48 A;  4WXG A;  4WXB A;  3QN6 A;  3DZZ A;  4DQ6 A;  1M7Y A;  4WP0 A;  1ARH A;  1M6S A;  4JEY A;  5LHA A;  4KXK A;  3PDX A;  2CY8 A;  2D61 A;  2CJD A;  1GC2 A;  2HUF A;  1V2F A;  3BN1 A;  3D6K A;  2HZP A;  3BCA A;  3GZC A;  4K2B A;  2O1B A;  1N8P A;  1WYT A;  3DR7 A;  4IXZ A;  3VP6 A;  1CZE A;  1M0N A;  2W8W A;  3I5T A;  3ISL A;  4R2N A;  2D7Z A;  3BCB A;  4RAE A;  1MGV A;  3BWN A;  4LNJ A;  3VK2 A;  3NYU A;  2OKK A;  4A72 A;  2BYL A;  1TOE A;  2QLR A;  1BT4 A;  1QZ9 A;  4AOA A;  1OAT A;  3FQ8 A;  5D5S A;  2W7L A;  3AAT A;  2EZ2 A;  4A6T A;  1D7V A;  1V72 A;  1EG5 A;  3VOM A;  3DC1 A;  3E9K A;  4W1V A;  4OBV A;  2E54 A;  1SZK A;  1LC7 A;  3R9A A;  1PMM A;  1Z3Z A;  2BKW A;  3B46 A;  3F6T A;  3WLX A;  4M2K A;  1BJO A;  4FL0 A;  2GB3 A;  3MAU A;  2YCP A;  2VGU A;  2Z9W A;  1QIR A;  3RUY A;  3ELE A;  3LY1 A;  4ZDP A;  4LNL A;  4XJL A;  3DR4 A;  4E77 A;  4BA5 A;  3UWC A;  4EB5 A;  3FKD A;  4B9B A;  4HF8 A;  2X5D A;  4P7Y A;  3FFH A;  3CQ4 A;  2BHX A;  3RBF A;  4LW4 A;  3RQ1 A;  1AIA A;  3PPL A;  3FVU A;  4DBC A;  2Z9U A;  3E2Y A;  1SZU A;  3NTJ A;  2E7U A;  1KL2 A;  2TPL A;  2HOR A;  3BC8 A;  3I4J A;  3R4T A;  2ZC0 A;  5EQC A;  2W7I A;  3EUC A;  3WZF A;  1SF2 A;  1E5F A;  3NNK A;  4PFN A;  1CS1 A;  1AHF A;  1H0C A;  1CQ6 A;  4WYE A;  2PB0 A;  3FDB A;  2JJF A;  1JF9 A;  3F0H A;  2JIS A;  1XI9 A;  4ZAS A;  2VI9 A;  1CL2 A;  3MAD A;  4J8L A;  3ELP A;  2BWN A;  1ARG A;  3LVK A;  1GD9 A;  4BA4 A;  2RFV A;  3PDB B;  1FC4 A;  4TMR A;  3TAT A;  5I92 A;  2VGV A;  1TPL A;  1JS3 A;  2YKX A;  3DU4 A;  2JJE A;  2R5C B;  3QI6 A;  1RV4 A;  4WYD A;  4ZM4 A;  4U2H A;  4F5H A;  1AJS B;  3EI6 A;  4ATP A;  2JGT A;  1B5O A;  2VMZ A;  1ASN A;  1Y4I A;  3PDB A;  3GSB A;  3GZD A;  5G2Q A;  3NDN A;  3W1J A;  1SVV A;  1H1C A;  3K40 A;  4M2J A;  2VGW A;  1DJ9 A;  1O62 A;  2AY2 A;  1ASE A;  2Z20 A;  1QIS A;  1ART A;  2BWP A;  2CIN A;  3WKR A;  3JW9 A;  3MBB A;  2E7J A;  2V0Y A;  2VLF A;  3MC6 C;  2G6W A;  2CAN A;  4EMY A;  1YAA A;  4BHD A;  4RKD A;  1DFO A;  4F5I A;  1IX7 A;  1LW4 A;  1VP4 A;  1YJY A;  4K2M A;  1RVU A;  4Y0H A;  2C81 A;  4ITG A;  5FT6 A;  3AOV A;  3AEL A;  1BQA A;  3DYD A;  2QB3 A;  3BCX A;  1ARI A;  1UKJ A;  2W7D A;  1QJ5 A;  2Q7W A;  3G0T A;  4MSO A;  2ZUK A;  1W7L A;  1YIZ A;  4ZSY A;  1WKH A;  2XBN A;  3NU8 A;  2DOU A;  5M4B A;  1OXO A;  1AJR A;  1TAS A;  2W8J A;  3ACZ A;  3BWN C;  5C6U A;  1GCK A;  3B1C A;  2DGL A;  5E3K A;  2GMS A;  5EUE A;  3EIA A;  1B9I A;  4K2I A;  1AY4 A;  3PD6 A;  5DJ1 A;  1CZC A;  4J5U A;  4UOY A;  3VAX A;  4A0G A;  3RCH A;  3P6K A;  1M0Q A;  3QM2 A;  3VK4 A;  1W23 A;  2WK7 A;  5EIG A;  4MGR A;  4AO4 A;  1DGD A;  3ECD A;  1X0M A;  2R5C A;  3MAF B;  2OGE A;  4RJY A;  1AMS A;  1DJE A;  1D7R A;  4XQ2 A;  3A2B A;  4CBS A; 
#chains in the Genus database with same CATH topology
 1ZOB A;  1TAT A;  3N4X A;  3E2F A;  1ZOD A;  4ATQ A;  1KMJ A;  1ORD A;  2AAT A;  1AMA A;  3E2Z B;  3LV2 A;  3MEB A;  1WYT B;  2VGZ A;  3TQX A;  1ASF A;  2D63 A;  4O6Z A;  4W91 A;  4ZWM A;  3HQT A;  4IW7 A;  5D95 A;  2OQX A;  3LG0 A;  3FQA A;  2DGK A;  3TFT A;  4WB0 B;  2CFB A;  3ASB A;  5EAA A;  3CQ6 A;  4XJM A;  4EU1 A;  1QGN A;  2HP2 A;  1MAQ A;  3HVY A;  4JF0 A;  5E5I A;  4JF1 A;  4IYO A;  5M46 A;  3FD0 A;  4R8D A;  5HDM A;  4E3Q A;  1FG7 A;  1D7S A;  4MY5 A;  5EUN A;  4OCA A;  4BMK A;  3HDO A;  4ADE A;  4AO9 A;  2HOZ A;  2VMS A;  1N31 A;  1QJ3 A;  1UU2 A;  2YRI A;  4RIT A;  2FKI A;  4RKC A;  3H7F A;  2AY4 A;  4EFF A;  3DOD A;  2Z1Y A;  4XK1 A;  1V2E A;  2R2N A;  1G4V A;  1WKG A;  4N0W A;  4RJ0 A;  4CVQ A;  3KGX A;  1AMQ A;  1YIY A;  3HLM A;  3JWB A;  1ASC A;  1AHY A;  3WCN A;  2BWO A;  1C0N A;  2AY5 A;  2ZYJ A;  2EO5 A;  3EI9 A;  4B98 A;  4WXF A;  2Z9X A;  1ASB A;  3EZS A;  1ASM A;  3L44 A;  3PAA A;  3Q8N A;  1S0A A;  3MAF A;  3OKS A;  3AEN B;  3B1E A;  3EI7 A;  2QB2 A;  2VMV A;  1S09 A;  2GQN A;  1IVR A;  1CQ7 A;  2YKV A;  4GRX A;  4JEX A;  4JE5 A;  1M0P A;  3RCH B;  2FNU A;  1SPA A;  1ZC9 A;  3W1I A;  1C7O A;  1IUG A;  3FDD A;  2BIG A;  2FNI A;  2AY8 A;  1MLY A;  2WKA A;  3IF2 A;  4FFC A;  2W7M A;  1PMO A;  2ZY3 A;  2BI3 A;  1BW0 A;  3AEJ A;  3USF A;  1TOJ A;  2CJG A;  4OBU A;  3ZZK A;  3LVM A;  1BJO B;  3BWO A;  2AEV A;  3NYT A;  3PIU A;  4UHN A;  3JZL A;  4F5J A;  3N7N A;  4GDY A;  4GEB A;  5FT5 A;  1AMR A;  1C4K A;  3AEM A;  2DKJ A;  3LWS A;  4CXR A;  5DX5 A;  2AY3 A;  2ZY2 A;  3FZ6 A;  4XEW A;  1X28 A;  5G0A A;  1LW5 A;  3B8X A;  5IWQ A;  3KE3 A;  3H14 A;  2HP1 A;  4OC9 A;  1M4N A;  4L0O A;  1P3W A;  4EB7 A;  3WGB A;  1C7N A;  1E5E A;  2D64 A;  4H51 A;  1AIB A;  2FN6 A;  1DGE A;  1LS3 A;  1KKP A;  1LKC A;  2EZ1 A;  1XEY A;  3AEP A;  3RBL A;  4GE4 A;  2OAT A;  4WBT A;  4PIW A;  2ZY4 A;  3II0 A;  2PO3 A;  2Z1Z A;  1KAF A;  3GWP A;  3BS8 A;  4Q75 A;  4A0H A;  4AH3 A;  4MKK A;  3A9X A;  4UHO A;  2DKB A;  2D65 A;  4ADC A;  2Z67 A;  3EZ1 A;  2HUI A;  2QBT A;  1G4X A;  1ASA A;  3HT4 A;  4JE5 D;  3WCO A;  1X29 A;  4LW2 A;  3LVJ A;  3QHX A;  3M5U A;  2QMA A;  3CBF A;  1J32 A;  4A6R A;  2VMX A;  2FM1 A;  4IXO A;  4WB0 A;  2QA3 A;  1W7M A;  2W7H A;  3ASA A;  2BI2 A;  3GBX A;  4F5M A;  3HBX A;  7AAT A;  1KMK A;  5LH9 A;  2BI1 A;  2VI8 A;  1LC5 A;  1I41 A;  4KAM A;  2WK9 A;  1YNU A;  1LC8 A;  2VIA A;  1JG8 A;  3NU7 A;  4WYG A;  1GDE A;  1B4X A;  1DTY A;  2O0R A;  2GSA A;  4P3M A;  5E4Z A;  5K8B A;  2VMT A;  3L8A A;  2Z9V A;  1TOK A;  3G8M A;  1VJO A;  2V1P A;  1PG8 A;  3FRK A;  4MQR A;  3BB8 A;  4LNM A;  5EIG B;  4XJO A;  1BJW A;  1D2F A;  2DR1 A;  2JG2 A;  4Q6R A;  2ORD A;  4UQV A;  4W1W A;  3MKJ A;  3ATH A;  3N75 A;  5F8V A;  1QIT A;  2AY9 A;  2X8U A;  4GE7 A;  1AHX A;  5TF5 A;  1EQB A;  1OHY A;  3NYS A;  3A9Z A;  3NRA A;  1AAW A;  3WX9 A;  1MDZ A;  2FQ6 A;  2FYF A;  4F5L A;  3ZRR A;  4RLG A;  2CB1 A;  4ZAH A;  3FCR A;  4IXS A;  1GEX A;  3DRD A;  3E77 A;  8AAT A;  3LVL B;  2OKJ A;  4F5K A;  4OT8 A;  2ZY5 A;  1CJ0 A;  3FQ7 A;  3FZ8 A;  3N4R A;  2X3L A;  4OYT A;  2YKU A;  5G2P A;  1TOI A;  4R5Z A;  2ZSM A;  5KTB A;  1PFF A;  4DGT A;  2VGS A;  1WST A;  4BQ0 A;  1DKA A;  5BJ4 A;  1C9C A;  2D66 A;  4F5G A;  4LC3 A;  3AEJ C;  3GET A;  4XAU A;  2CST A;  4ZWV A;  2EYQ A;  4N0B A;  2CH2 A;  1WYU A;  4ZLV A;  2JJG A;  1UU1 A;  1UU0 A;  5G09 A;  4F4E A;  4F5F A;  4RM1 A;  4A0R A;  1IAY A;  1N2T A;  4NOG A;  2W8U A;  1G7W A;  1YJZ A;  3ZRQ A;  1BJN A;  3AEM C;  5FT8 A;  2AY6 A;  3GZD C;  4A6U A;  1V2D A;  1B5P A;  4MQQ A;  3AV7 A;  2AY1 A;  3EI8 A;  3NUB A;  9AAT A;  1S08 A;  1ASG A;  4H63 Q;  1AJS A;  3JTX A;  1U08 A;  3IHJ A;  3BV0 A;  4UHM A;  1IAX A;  3MC6 A;  3PJ0 A;  4K05 A;  4AZK A;  3EI5 A;  3VK3 A;  1J04 A;  1EJI A;  1W7N A;  2YOB A;  4WYA A;  5EAV A;  4ZSW A;  4GE9 A;  3UAK A;  3ZRP A;  1YJS A;  1GC0 A;  4JEV A;  1G7X A;  2YCT A;  1I43 A;  4AZJ A;  4A00 A;  4Y0D A;  1Z7D A;  2VLH A;  3OP7 A;  5JAY A;  4ZDL A;  2BI9 A;  4IY7 A;  2R5E A;  1C7G A;  2YCN A;  4JEZ A;  4XJP A;  3W1H A;  1S06 A;  5EFS A;  3N0L A;  5HHY A;  4ADB A;  3TFU A;  1ARS A;  4W8I A;  4ZM3 A;  1BS0 A;  2YHK A;  4JEW A;  1AHE A;  1D7U A;  3FZ7 A;  2EGY A;  4Q76 A;  4KYO A;  3AOW A;  1RVY A;  4A0F A;  4Y0I A;  2ZJG A;  1CQ8 A;  3B1D A;  1IJI A;  2R0T A;  3FTB A;  2W7F A;  1TOG A;  3I16 A;  2E7I A;  1IX8 A;  5DB5 A;  3QPG A;  2BI5 A;  3KGW A;  1MDO A;  2EPJ A;  2D7Y A;  1AAM A;  2PB2 A;  2YRR A;  2F8J A;  3FFR A;  1M32 A;  3GJU A;  4WLJ A;  2KFP A;  1O61 A;  1GEW A;  4PFF A;  3CQ5 A;  1WYV A;  2AY7 A;  1BKG A;  4QGR A;  2VMN A;  2W7E A;  2C44 A;  3A8U X;  3UE8 A;  2VMR A;  5G4J A;  1KL1 A;  4WYC A;  1O69 A;  1SFF A;  2YKY A;  1AKB A;  2BIA A;  4GSA A;  3WGC A;  3GR9 A;  2VGT A;  2EH6 A;  3AEN A;  3FVX A;  5EUD A;  2VMQ A;  3DXV A;  1AKC A;  1ELQ A;  1WYV B;  2VIB A;  2C7T A;  3PA9 A;  3WY7 A;  2BIE A;  1MAP A;  3DXW A;  3QGU A;  2VMY A;  4IX8 A;  5G4I A;  4WLH A;  2JJH A;  2W7G A;  4I8A A;  4WD2 A;  1CL1 A;  1JS6 A;  1VEF A;  2W7J A;  3G7Q A;  4E1O A;  4PVF A;  1GBN A;  3AEO A;  2Z61 A;  2VMU A;  2X5F A;  3PD6 B;  2CJH A;  1ASL A;  3N5M A;  3F9T A;  3K28 A;  3K7Y A;  1M0O A;  3COG A;  4M2M A;  2ZSL A;  4TV7 A;  2HOY A;  1OHW A;  2CH1 A;  4OMA A;  3CAI A;  1AKA A;  1GC4 A;  4ZDO A;  1FG3 A;  3FSL A;  3EIB A;  1OHV A;  2HUU A;  4MKJ A;  1SZS A;  2VMO A;  4ADD A;  1BJ4 A;  2A1V A;  3NUI A;  3T32 A;  3NX3 A;  1WYU B;  1DJU A;  4WYF A;  1YOO A;  1MDX A;  1AY8 A;  5M49 A;  4E3R A;  1B9H A;  1KKJ A;  4U1T A;  1W3U A;  2W8T A;  4Q31 A;  1GC3 A;  3KKI A;  1B8G A;  2BYJ A;  1X2A A;  2OGA A;  3H9X A;  1IX6 A;  4W1X A;  3HL2 A;  5DJ9 A;  3A9Y A;  1AHG A;  5BJ3 A;  5AX8 A;  1LK9 A;  1AX4 A;  2NMP A;  3TCM A;  3ZZJ A;  5J8Q A;  1OXP A;  1ECX A;  3RI6 A;  4R5F A;  1RV3 A;  1ELU A;  2CTZ A;  2VMW A;  4RIZ A;  1BQD A;  4W5K A;  1GEY A;  1IBJ A;  5M4D A;  3JWA A;  4MQP A;  2O7C A;  3P1T A;  3E2Z A;  3N4S A;  3WKS A;  1AIC A;  3FVS A;  3QBO A;  2HOX A;  2DGM A;  1TAR A;  2D5Y A;  2WK8 A;  4OTL A;  4CBR A;  1I29 A;  1T3I A;  2VYC A;  2AEU A;  3JU7 A;  4HVK A;  3HMU A;  4ISY A;  4CXQ A;  4ITX A;  1S07 A;  5F9S A;  5FT4 A;  3E6G A;  2VMP A;  1AY5 A;  4TN4 A;  5HXX A;  1O4S A;  2XH1 A;  2GMU A;  1ASD A;  1MLZ A;  2W8V A;  2C0R A;  2ZP7 A;  2W7K A;  3PGY A;  4IYO B;  1I48 A;  4WXG A;  4WXB A;  3QN6 A;  3DZZ A;  4DQ6 A;  1M7Y A;  4WP0 A;  1ARH A;  1M6S A;  4JEY A;  5LHA A;  4KXK A;  3PDX A;  2CY8 A;  2D61 A;  2CJD A;  1GC2 A;  2HUF A;  1V2F A;  3BN1 A;  3D6K A;  2HZP A;  3BCA A;  3GZC A;  4K2B A;  2O1B A;  1N8P A;  1WYT A;  3DR7 A;  4IXZ A;  3VP6 A;  1CZE A;  1M0N A;  2W8W A;  3I5T A;  3ISL A;  4R2N A;  2D7Z A;  3BCB A;  4RAE A;  1MGV A;  3BWN A;  4LNJ A;  3VK2 A;  3NYU A;  2OKK A;  4A72 A;  2BYL A;  1TOE A;  2QLR A;  1BT4 A;  1QZ9 A;  4AOA A;  1OAT A;  3FQ8 A;  5D5S A;  2W7L A;  3AAT A;  2EZ2 A;  4A6T A;  1D7V A;  1V72 A;  1EG5 A;  3VOM A;  3DC1 A;  3E9K A;  4W1V A;  4OBV A;  2E54 A;  1SZK A;  1LC7 A;  3R9A A;  1PMM A;  1Z3Z A;  2BKW A;  3B46 A;  3F6T A;  3WLX A;  4M2K A;  1BJO A;  4FL0 A;  2GB3 A;  3MAU A;  2YCP A;  2VGU A;  2Z9W A;  1QIR A;  3RUY A;  3ELE A;  3LY1 A;  4ZDP A;  4LNL A;  4XJL A;  3DR4 A;  4E77 A;  4BA5 A;  3UWC A;  4EB5 A;  3FKD A;  4B9B A;  4HF8 A;  2X5D A;  4P7Y A;  3FFH A;  3CQ4 A;  2BHX A;  3RBF A;  4LW4 A;  3RQ1 A;  1AIA A;  3PPL A;  3FVU A;  4DBC A;  2Z9U A;  3E2Y A;  1SZU A;  3NTJ A;  2E7U A;  1KL2 A;  2TPL A;  2HOR A;  3BC8 A;  3I4J A;  3R4T A;  2ZC0 A;  5EQC A;  2W7I A;  3EUC A;  3WZF A;  1SF2 A;  1E5F A;  3NNK A;  4PFN A;  1CS1 A;  1AHF A;  1H0C A;  1CQ6 A;  4WYE A;  2PB0 A;  3FDB A;  2JJF A;  1JF9 A;  3F0H A;  2JIS A;  1XI9 A;  4ZAS A;  2VI9 A;  1CL2 A;  3MAD A;  4J8L A;  3ELP A;  2BWN A;  1ARG A;  3LVK A;  1GD9 A;  4BA4 A;  2RFV A;  3PDB B;  1FC4 A;  4TMR A;  3TAT A;  5I92 A;  2VGV A;  1TPL A;  1JS3 A;  2YKX A;  3DU4 A;  2JJE A;  2R5C B;  3QI6 A;  1RV4 A;  4WYD A;  4ZM4 A;  4U2H A;  4F5H A;  1AJS B;  3EI6 A;  4ATP A;  2JGT A;  1B5O A;  2VMZ A;  1ASN A;  1Y4I A;  3PDB A;  3GSB A;  3GZD A;  5G2Q A;  3NDN A;  3W1J A;  1SVV A;  1H1C A;  3K40 A;  4M2J A;  2VGW A;  1DJ9 A;  1O62 A;  2AY2 A;  1ASE A;  2Z20 A;  1QIS A;  1ART A;  2BWP A;  2CIN A;  3WKR A;  3JW9 A;  3MBB A;  2E7J A;  2V0Y A;  2VLF A;  3MC6 C;  2G6W A;  2CAN A;  4EMY A;  1YAA A;  4BHD A;  4RKD A;  1DFO A;  4F5I A;  1IX7 A;  2WB6 A;  1LW4 A;  1VP4 A;  1YJY A;  4K2M A;  1RVU A;  4Y0H A;  2C81 A;  4ITG A;  5FT6 A;  3AOV A;  3AEL A;  1BQA A;  3DYD A;  2QB3 A;  3BCX A;  1ARI A;  1UKJ A;  2W7D A;  1QJ5 A;  2Q7W A;  3G0T A;  4MSO A;  2ZUK A;  1W7L A;  1YIZ A;  4ZSY A;  1WKH A;  2XBN A;  3NU8 A;  2DOU A;  5M4B A;  1OXO A;  1AJR A;  1TAS A;  2W8J A;  3ACZ A;  3BWN C;  5C6U A;  1GCK A;  3B1C A;  2DGL A;  5E3K A;  2GMS A;  5EUE A;  3EIA A;  1B9I A;  4K2I A;  1AY4 A;  3PD6 A;  5DJ1 A;  1CZC A;  4J5U A;  4UOY A;  3VAX A;  4A0G A;  2QSR A;  3RCH A;  3P6K A;  1M0Q A;  3QM2 A;  3VK4 A;  1W23 A;  2WK7 A;  2G7J A;  5EIG A;  4MGR A;  4AO4 A;  1DGD A;  3ECD A;  1X0M A;  2R5C A;  3MAF B;  2OGE A;  4RJY A;  1AMS A;  1DJE A;  1D7R A;  4XQ2 A;  3A2B A;  4CBS A; 
#chains in the Genus database with same CATH homology
 1ZOB A;  1TAT A;  3N4X A;  3E2F A;  1ZOD A;  4ATQ A;  1KMJ A;  1ORD A;  2AAT A;  1AMA A;  3E2Z B;  3LV2 A;  3MEB A;  1WYT B;  2VGZ A;  3TQX A;  1ASF A;  2D63 A;  4O6Z A;  4W91 A;  4ZWM A;  3HQT A;  4IW7 A;  5D95 A;  2OQX A;  3LG0 A;  3FQA A;  2DGK A;  3TFT A;  4WB0 B;  2CFB A;  3ASB A;  5EAA A;  3CQ6 A;  4XJM A;  4EU1 A;  1QGN A;  2HP2 A;  1MAQ A;  3HVY A;  4JF0 A;  5E5I A;  4JF1 A;  4IYO A;  5M46 A;  3FD0 A;  4R8D A;  5HDM A;  4E3Q A;  1FG7 A;  1D7S A;  4MY5 A;  5EUN A;  4OCA A;  4BMK A;  3HDO A;  4ADE A;  4AO9 A;  2HOZ A;  2VMS A;  1N31 A;  1QJ3 A;  1UU2 A;  2YRI A;  4RIT A;  2FKI A;  4RKC A;  3H7F A;  2AY4 A;  4EFF A;  3DOD A;  2Z1Y A;  4XK1 A;  1V2E A;  2R2N A;  1G4V A;  1WKG A;  4N0W A;  4RJ0 A;  4CVQ A;  3KGX A;  1AMQ A;  1YIY A;  3HLM A;  3JWB A;  1ASC A;  1AHY A;  3WCN A;  2BWO A;  1C0N A;  2AY5 A;  2ZYJ A;  2EO5 A;  3EI9 A;  4B98 A;  4WXF A;  2Z9X A;  1ASB A;  3EZS A;  1ASM A;  3L44 A;  3PAA A;  3Q8N A;  1S0A A;  3MAF A;  3OKS A;  3AEN B;  3B1E A;  3EI7 A;  2QB2 A;  2VMV A;  1S09 A;  2GQN A;  1IVR A;  1CQ7 A;  2YKV A;  4GRX A;  4JEX A;  4JE5 A;  1M0P A;  3RCH B;  2FNU A;  1SPA A;  1ZC9 A;  3W1I A;  1C7O A;  1IUG A;  3FDD A;  2BIG A;  2FNI A;  2AY8 A;  1MLY A;  2WKA A;  3IF2 A;  4FFC A;  2W7M A;  1PMO A;  2ZY3 A;  2BI3 A;  1BW0 A;  3AEJ A;  3USF A;  1TOJ A;  2CJG A;  4OBU A;  3ZZK A;  3LVM A;  1BJO B;  3BWO A;  2AEV A;  3NYT A;  3PIU A;  4UHN A;  3JZL A;  4F5J A;  3N7N A;  4GDY A;  4GEB A;  5FT5 A;  1AMR A;  1C4K A;  3AEM A;  2DKJ A;  3LWS A;  4CXR A;  5DX5 A;  2AY3 A;  2ZY2 A;  3FZ6 A;  4XEW A;  1X28 A;  5G0A A;  1LW5 A;  3B8X A;  5IWQ A;  3KE3 A;  3H14 A;  2HP1 A;  4OC9 A;  1M4N A;  4L0O A;  1P3W A;  4EB7 A;  3WGB A;  1C7N A;  1E5E A;  2D64 A;  4H51 A;  1AIB A;  2FN6 A;  1DGE A;  1LS3 A;  1KKP A;  1LKC A;  2EZ1 A;  1XEY A;  3AEP A;  3RBL A;  4GE4 A;  2OAT A;  4WBT A;  4PIW A;  2ZY4 A;  3II0 A;  2PO3 A;  2Z1Z A;  3GWP A;  3BS8 A;  4Q75 A;  4A0H A;  4AH3 A;  4MKK A;  3A9X A;  4UHO A;  2DKB A;  2D65 A;  4ADC A;  2Z67 A;  3EZ1 A;  2HUI A;  2QBT A;  1G4X A;  1ASA A;  3HT4 A;  4JE5 D;  3WCO A;  1X29 A;  4LW2 A;  3LVJ A;  3QHX A;  3M5U A;  2QMA A;  3CBF A;  1J32 A;  4A6R A;  2VMX A;  2FM1 A;  4IXO A;  4WB0 A;  2QA3 A;  1W7M A;  2W7H A;  3ASA A;  2BI2 A;  3GBX A;  4F5M A;  3HBX A;  7AAT A;  1KMK A;  5LH9 A;  2BI1 A;  2VI8 A;  1LC5 A;  1I41 A;  4KAM A;  2WK9 A;  1YNU A;  1LC8 A;  2VIA A;  1JG8 A;  3NU7 A;  4WYG A;  1GDE A;  1B4X A;  1DTY A;  2O0R A;  2GSA A;  4P3M A;  5E4Z A;  5K8B A;  2VMT A;  3L8A A;  2Z9V A;  1TOK A;  3G8M A;  1VJO A;  2V1P A;  1PG8 A;  3FRK A;  4MQR A;  3BB8 A;  4LNM A;  5EIG B;  4XJO A;  1BJW A;  1D2F A;  2DR1 A;  2JG2 A;  4Q6R A;  2ORD A;  4UQV A;  4W1W A;  3MKJ A;  3ATH A;  3N75 A;  5F8V A;  1QIT A;  2AY9 A;  2X8U A;  4GE7 A;  1AHX A;  5TF5 A;  1EQB A;  1OHY A;  3NYS A;  3A9Z A;  3NRA A;  1AAW A;  3WX9 A;  1MDZ A;  2FQ6 A;  2FYF A;  4F5L A;  3ZRR A;  4RLG A;  2CB1 A;  4ZAH A;  3FCR A;  4IXS A;  1GEX A;  3DRD A;  3E77 A;  8AAT A;  3LVL B;  2OKJ A;  4F5K A;  4OT8 A;  2ZY5 A;  1CJ0 A;  3FQ7 A;  3FZ8 A;  3N4R A;  2X3L A;  4OYT A;  2YKU A;  5G2P A;  1TOI A;  4R5Z A;  2ZSM A;  5KTB A;  1PFF A;  4DGT A;  2VGS A;  1WST A;  4BQ0 A;  1DKA A;  5BJ4 A;  1C9C A;  2D66 A;  4F5G A;  4LC3 A;  3AEJ C;  3GET A;  4XAU A;  2CST A;  4ZWV A;  2EYQ A;  4N0B A;  2CH2 A;  1WYU A;  4ZLV A;  2JJG A;  1UU1 A;  1UU0 A;  5G09 A;  4F4E A;  4F5F A;  4RM1 A;  4A0R A;  1IAY A;  1N2T A;  4NOG A;  2W8U A;  1G7W A;  1YJZ A;  3ZRQ A;  1BJN A;  3AEM C;  5FT8 A;  2AY6 A;  3GZD C;  4A6U A;  1V2D A;  1B5P A;  4MQQ A;  3AV7 A;  2AY1 A;  3EI8 A;  3NUB A;  9AAT A;  1S08 A;  1ASG A;  4H63 Q;  1AJS A;  3JTX A;  1U08 A;  3IHJ A;  3BV0 A;  4UHM A;  1IAX A;  3MC6 A;  3PJ0 A;  4K05 A;  4AZK A;  3EI5 A;  3VK3 A;  1J04 A;  1EJI A;  1W7N A;  2YOB A;  4WYA A;  5EAV A;  4ZSW A;  4GE9 A;  3UAK A;  3ZRP A;  1YJS A;  1GC0 A;  4JEV A;  1G7X A;  2YCT A;  1I43 A;  4AZJ A;  4A00 A;  4Y0D A;  1Z7D A;  2VLH A;  3OP7 A;  5JAY A;  4ZDL A;  2BI9 A;  4IY7 A;  2R5E A;  1C7G A;  2YCN A;  4JEZ A;  4XJP A;  3W1H A;  1S06 A;  5EFS A;  3N0L A;  5HHY A;  4ADB A;  3TFU A;  1ARS A;  4W8I A;  4ZM3 A;  1BS0 A;  2YHK A;  4JEW A;  1AHE A;  1D7U A;  3FZ7 A;  2EGY A;  4Q76 A;  4KYO A;  3AOW A;  1RVY A;  4A0F A;  4Y0I A;  2ZJG A;  1CQ8 A;  3B1D A;  1IJI A;  2R0T A;  3FTB A;  2W7F A;  1TOG A;  3I16 A;  2E7I A;  1IX8 A;  5DB5 A;  3QPG A;  2BI5 A;  3KGW A;  1MDO A;  2EPJ A;  2D7Y A;  1AAM A;  2PB2 A;  2YRR A;  2F8J A;  3FFR A;  1M32 A;  3GJU A;  4WLJ A;  2KFP A;  1O61 A;  1GEW A;  4PFF A;  3CQ5 A;  1WYV A;  2AY7 A;  1BKG A;  4QGR A;  2VMN A;  2W7E A;  2C44 A;  3A8U X;  3UE8 A;  2VMR A;  5G4J A;  1KL1 A;  4WYC A;  1O69 A;  1SFF A;  2YKY A;  1AKB A;  2BIA A;  4GSA A;  3WGC A;  3GR9 A;  2VGT A;  2EH6 A;  3AEN A;  3FVX A;  5EUD A;  2VMQ A;  3DXV A;  1AKC A;  1ELQ A;  1WYV B;  2VIB A;  2C7T A;  3PA9 A;  3WY7 A;  2BIE A;  1MAP A;  3DXW A;  3QGU A;  2VMY A;  4IX8 A;  5G4I A;  4WLH A;  2JJH A;  2W7G A;  4I8A A;  4WD2 A;  1CL1 A;  1JS6 A;  1VEF A;  2W7J A;  3G7Q A;  4E1O A;  4PVF A;  1GBN A;  3AEO A;  2Z61 A;  2VMU A;  2X5F A;  3PD6 B;  2CJH A;  1ASL A;  3N5M A;  3F9T A;  3K28 A;  3K7Y A;  1M0O A;  3COG A;  4M2M A;  2ZSL A;  4TV7 A;  2HOY A;  1OHW A;  2CH1 A;  4OMA A;  3CAI A;  1AKA A;  1GC4 A;  4ZDO A;  1FG3 A;  3FSL A;  3EIB A;  1OHV A;  2HUU A;  4MKJ A;  1SZS A;  2VMO A;  4ADD A;  1BJ4 A;  2A1V A;  3NUI A;  3T32 A;  3NX3 A;  1WYU B;  1DJU A;  4WYF A;  1YOO A;  1MDX A;  1AY8 A;  5M49 A;  4E3R A;  1B9H A;  1KKJ A;  4U1T A;  1W3U A;  2W8T A;  4Q31 A;  1GC3 A;  3KKI A;  1B8G A;  2BYJ A;  1X2A A;  2OGA A;  3H9X A;  1IX6 A;  4W1X A;  3HL2 A;  5DJ9 A;  3A9Y A;  1AHG A;  5BJ3 A;  5AX8 A;  1LK9 A;  1AX4 A;  2NMP A;  3TCM A;  3ZZJ A;  5J8Q A;  1OXP A;  1ECX A;  3RI6 A;  4R5F A;  1RV3 A;  1ELU A;  2CTZ A;  2VMW A;  4RIZ A;  1BQD A;  4W5K A;  1GEY A;  1IBJ A;  5M4D A;  3JWA A;  4MQP A;  2O7C A;  3P1T A;  3E2Z A;  3N4S A;  3WKS A;  1AIC A;  3FVS A;  3QBO A;  2HOX A;  2DGM A;  1TAR A;  2D5Y A;  2WK8 A;  4OTL A;  4CBR A;  1I29 A;  1T3I A;  2VYC A;  2AEU A;  3JU7 A;  4HVK A;  3HMU A;  4ISY A;  4CXQ A;  4ITX A;  1S07 A;  5F9S A;  5FT4 A;  3E6G A;  2VMP A;  1AY5 A;  4TN4 A;  5HXX A;  1O4S A;  2XH1 A;  2GMU A;  1ASD A;  1MLZ A;  2W8V A;  2C0R A;  2ZP7 A;  2W7K A;  3PGY A;  4IYO B;  1I48 A;  4WXG A;  4WXB A;  3QN6 A;  3DZZ A;  4DQ6 A;  1M7Y A;  4WP0 A;  1ARH A;  1M6S A;  4JEY A;  5LHA A;  4KXK A;  3PDX A;  2CY8 A;  2D61 A;  2CJD A;  1GC2 A;  2HUF A;  1V2F A;  3BN1 A;  3D6K A;  2HZP A;  3BCA A;  3GZC A;  4K2B A;  2O1B A;  1N8P A;  1WYT A;  3DR7 A;  4IXZ A;  3VP6 A;  1CZE A;  1M0N A;  2W8W A;  3I5T A;  3ISL A;  4R2N A;  2D7Z A;  3BCB A;  4RAE A;  1MGV A;  3BWN A;  4LNJ A;  3VK2 A;  3NYU A;  2OKK A;  4A72 A;  2BYL A;  1TOE A;  2QLR A;  1BT4 A;  1QZ9 A;  4AOA A;  1OAT A;  3FQ8 A;  5D5S A;  2W7L A;  3AAT A;  2EZ2 A;  4A6T A;  1D7V A;  1V72 A;  1EG5 A;  3VOM A;  3DC1 A;  3E9K A;  4W1V A;  4OBV A;  2E54 A;  1SZK A;  1LC7 A;  3R9A A;  1PMM A;  1Z3Z A;  2BKW A;  3B46 A;  3F6T A;  3WLX A;  4M2K A;  1BJO A;  4FL0 A;  2GB3 A;  3MAU A;  2YCP A;  2VGU A;  2Z9W A;  1QIR A;  3RUY A;  3ELE A;  3LY1 A;  4ZDP A;  4LNL A;  4XJL A;  3DR4 A;  4E77 A;  4BA5 A;  3UWC A;  4EB5 A;  3FKD A;  4B9B A;  4HF8 A;  2X5D A;  4P7Y A;  3FFH A;  3CQ4 A;  2BHX A;  3RBF A;  4LW4 A;  3RQ1 A;  1AIA A;  3PPL A;  3FVU A;  4DBC A;  2Z9U A;  3E2Y A;  1SZU A;  3NTJ A;  2E7U A;  1KL2 A;  2TPL A;  2HOR A;  3BC8 A;  3I4J A;  3R4T A;  2ZC0 A;  5EQC A;  2W7I A;  3EUC A;  3WZF A;  1SF2 A;  1E5F A;  3NNK A;  4PFN A;  1CS1 A;  1AHF A;  1H0C A;  1CQ6 A;  4WYE A;  2PB0 A;  3FDB A;  2JJF A;  1JF9 A;  3F0H A;  2JIS A;  1XI9 A;  4ZAS A;  2VI9 A;  1CL2 A;  3MAD A;  4J8L A;  3ELP A;  2BWN A;  1ARG A;  3LVK A;  1GD9 A;  4BA4 A;  2RFV A;  3PDB B;  1FC4 A;  4TMR A;  3TAT A;  5I92 A;  2VGV A;  1TPL A;  1JS3 A;  2YKX A;  3DU4 A;  2JJE A;  2R5C B;  3QI6 A;  1RV4 A;  4WYD A;  4ZM4 A;  4U2H A;  4F5H A;  1AJS B;  3EI6 A;  4ATP A;  2JGT A;  1B5O A;  2VMZ A;  1ASN A;  1Y4I A;  3PDB A;  3GSB A;  3GZD A;  5G2Q A;  3NDN A;  3W1J A;  1SVV A;  1H1C A;  3K40 A;  4M2J A;  2VGW A;  1DJ9 A;  1O62 A;  2AY2 A;  1ASE A;  2Z20 A;  1QIS A;  1ART A;  2BWP A;  2CIN A;  3WKR A;  3JW9 A;  3MBB A;  2E7J A;  2V0Y A;  2VLF A;  3MC6 C;  2G6W A;  2CAN A;  4EMY A;  1YAA A;  4BHD A;  4RKD A;  1DFO A;  4F5I A;  1IX7 A;  2WB6 A;  1LW4 A;  1VP4 A;  1YJY A;  4K2M A;  1RVU A;  4Y0H A;  2C81 A;  4ITG A;  5FT6 A;  3AOV A;  3AEL A;  1BQA A;  3DYD A;  2QB3 A;  3BCX A;  1ARI A;  1UKJ A;  2W7D A;  1QJ5 A;  2Q7W A;  3G0T A;  4MSO A;  2ZUK A;  1W7L A;  1YIZ A;  4ZSY A;  1WKH A;  2XBN A;  3NU8 A;  2DOU A;  5M4B A;  1OXO A;  1AJR A;  1TAS A;  2W8J A;  3ACZ A;  3BWN C;  5C6U A;  1GCK A;  3B1C A;  2DGL A;  5E3K A;  2GMS A;  5EUE A;  3EIA A;  1B9I A;  4K2I A;  1AY4 A;  3PD6 A;  5DJ1 A;  1CZC A;  4J5U A;  4UOY A;  3VAX A;  4A0G A;  2QSR A;  3RCH A;  3P6K A;  1M0Q A;  3QM2 A;  3VK4 A;  1W23 A;  2WK7 A;  2G7J A;  5EIG A;  4MGR A;  4AO4 A;  1DGD A;  3ECD A;  1X0M A;  2R5C A;  3MAF B;  2OGE A;  4RJY A;  1AMS A;  1DJE A;  1D7R A;  4XQ2 A;  3A2B A;  4CBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...