5KTBA

Structure of a complex between s. cerevisiae csm1 and mam1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
151
Chain Sequence
LLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSDYSIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Monopolin complex subunit CSM1
publication title Molecular architecture of the yeast monopolin complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 151
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5ktbA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ktbA02
4I1LA 1WT6A 3VP8A 3U59A 3N7NA 4GIFA 4ZKUA 3HRNA 3N4RA 5BVZA 2POHA 2FXMA 3C9IA 3P8CD 4N78D 5BU5A 4N3YB 3BASA 2JEEA 3VP9A 3BATA 1X79B 3N4XA 3N4SA 3OJAB 3U1AA 4O9BA 5KTBA 1IC2A 4ZKPA 5BU8B 1NKNA 3U1CA
chains in the Genus database with same CATH superfamily
4F5HA 3CCLP 4F4EA 3TGUJ 2G3AA 4O6ZA 3TCMA 3ZZJA 1T3JA 3GLMA 5C6UA 2DKJA 3TFTA 3OA7A 2X5DA 1QGNA 3P6KA 3RBFA 3GSBA 2E5TA 2VMSA 3RK3C 5M4BA 1SPAA 1C7OA 3DRDA 1EQ7A 3GJUA 4O9BA 2IBZE 3RI6A 1NTKE 1XTGB 1PGQA 1AV1A 2FY8A 1QITA 5GTIE 2CH2A 3ATHA 1D7RA 3RCHB 3GF7A 1LC8A 1DGEA 1ZMEC 3CXHD 1EQBA 3LW5H 5DJ1A 3AENB 4A6RA 1CI6B 4N78D 3H1LJ 1RQVA 2B9BA 1BQAA 2HP2A 3P32A 2M3EA 3D71A 3G8MA 3Q5SA 1MDOA 1JB0J 1EZVE 4OBUA 2A06D 1ZRTE 1FAVA 1X2AA 1IBJA 3WUVA 1QGKB 1N8PA 1NTME 4C7RA 2BIGA 2EZ2A 3W1IA 1KILB 3A9YA 2O3JA 2JJEA 1SQBJ 4ASWA 1ASAA 1NVOA 2FYUK 1ASDA 2K9YA 3G4SP 3BCCE 3FVSA 1HTLC 4WP0A 1SZKA 3H1HG 2DR1A 1OHYA 3EZ1A 2BIEA 1WKGA 3JSVC 3AEGC 3ZDMA 1SQQD 4CPGA 1WYUA 4LW4A 4PJ0H 3VK3A 3II6A 1QEXA 3WUTA 1FZAA 3BC8A 1LT9C 1AJRA 3DU4A 1YJZA 1BGYD 5CBNA 1JY3N 5G09A 3L70D 1L0LD 3I5TA 3EZSA 2BI5A 1KYOH 2W7DA 1JM0A 1KZUB 2ZC0A 1GL2A 3MAFA 1BE3J 4F5FA 3MUDC 4OT8A 1W7LA 3H25A 1M0NA 2O1BA 4F5LA 1FG7A 4TN4A 2ZYAA 2JO1A 1PFIA 2YIUB 1BSHA 3WGBA 1KORA 4UB8E 5CBOA 3TGUD 1B4XA 2O1JA 3QH9A 4WXGA 5EFWB 1UU1A 5AW8B 3PHLA 1AX4A 2YO2A 5F9SA 1LTSC 3OJAB 5AVQB 1L0ND 3K40A 4K2BA 3V2RA 2PB2A 1JY3O 2UWJE 3KE3A 3EIBA 2K1AA 3IHJA 3V5BA 1L0LG 1CSBA 1NU1K 4IXZA 1GL2D 1YTZI 4K2MA 2OTKE 2HR3A 2CPBA 3B5NA 2VI8A 4CVQA 3PA9A 3E2YA 1IFMA 3M0DA 4BWNA 3RK2C 3H1HE 4GDYA 3FTBA 2LKMA 5AVSB 1WYVB 1KQGB 2RH0A 2VGSA 2CJGA 1IK7A 3H1LD 3E7KA 2OTJP 1PIXA 2W6JH 3HD7B 4MQRA 1N7LA 2A06E 4GIFA 2CB1A 4PD4D 4WY4A 2AXTE 5APXA 3M9BA 1HF9A 1E5WA 4U1TA 3MHVA 2B88A 3AE5C 3G71P 2R5BA 1NWQA 3AOVA 2KK7A 4UB6H 2FYUJ 1SFCA 1NYHA 2WK8A 1K04A 1SQXK 4ITXA 4D6TJ 1FDOA 2R5CA 4H13D 3FKDA 4WLJA 1JY2P 2W83C 5KAIE 2HOYA 3TNUA 3R4TA 3JZLA 3FZ8A 4WB4A 2D61A 2Y0EA 1YITP 3CPWO 2ZT9B 1TPLA 4WY4D 2JG2A 2ZY5A 1BGYE 5CJ0A 1NKNA 3WCNA 1L0LE 2G6WA 4PV1D 1S5LX 1SFCD 3H32A 5AVUB 3DR4A 2QB3A 1PMOA 2Z1ZA 3RK3B 3EI7A 1BE3D 1SQBG 1M0QA 2M3BA 3HVYA 3RL0D 3QN6A 3RBLA 1PGJA 3TGUE 1MLZA 4U7JA 3N4XA 4KXKA 2KLVA 4UOYA 2L5GB 1JS6A 2BEZF 1RVUA 2BASA 1LT1A 4KT0J 3HUSA 5FT4A 1FDIA 2OATA 2VIBA 2AEVA 1BQDA 2KFPA 2VI9A 1S5LH 3PTZA 2ZYJA 3NYUA 1NU1J 2D66A 3QHXA 2Z9VA 2PGDA 2R5DA 4GRXA 3HTKA 2Y9YA 1LP1A 1GC2A 4R4LA 1BJOB 1XTCC 2NMPA 1SQPK 3GR9A 5BU8B 1BCCG 3RUYA 2VGUA 2XH1A 2CH1A 2Q7WA 4MQQA 3EFFK 3H1LE 3TFUA 2AEMA 3CCQP 2AY7A 3V2NA 3ZRQA 4A72A 3N4RA 3ZZKA 2EZ1A 3NFQA 3P1TA 4LGDE 1GEWA 5B66E 3NRAA 3L72J 2W6AA 2WKAA 1H89A 3AEEC 3B1CA 3NX3A 4JEXA 2VMZA 1O61A 4ZASA 2XV5A 1SQXJ 1S2EA 2FYUD 2E75D 1LT9B 1SQBE 2W90A 2ZAEB 5DJUB 1N31A 3ACZA 5G0AA 1IFPA 1GEYA 1CQ8A 5FT5A 2LR2A 1QX8A 5DB5A 4LC3A 3B5NC 3C1LA 1FZCA 1P84I 2VGVA 1E79H 1JEKA 1N73A 9AATA 1C0NA 1AY4A 5H2FE 5B5EH 1AKBA 4R4MA 2OYHC 4IX8A 5FT8A 4CBSA 2HPCB 1QLED 1GDTA 4W7ZA 2ZSLA 3VMYA 4OCAA 3KGXA 3MTUE 2VMQA 1X9VA 2FYUG 1BE3E 1E5FA 5EIGA 3DYDA 3G3ZA 2WMMA 3NXSA 4JEVA 4MKJA 1SFCC 1OW6A 3HE5B 1KYOD 1DTYA 4D6TG 4Z1MH 2D7YA 1KKJA 3W1JA 4RKUJ 4MN4C 2BI9A 1PP9D 1S4XA 2FFDA 1AVOA 1Q86Q 4KYOA 3JWAA 3MC6A 4WB0B 3RK2B 2R2NA 2VLFA 3COGA 3CQ6A 4LLHA 3AELA 2C0RA 1MV8A 5KJ7A 1NU1D 3GMAA 1SQPJ 1JTHA 3FGAD 4L74A 3OW2O 1BSNA 3AEOA 1D7SA 3Q2YA 2ZSMA 3CX5H 5C39A 5EUDA 3GHGB 3WMM0 2CY8A 3AE2C 1S1CX 2C44A 2M5AB 2OYOA 3CX5I 4PFFA 4RJ0A 3EI8A 3AE7C 2KS1B 3MIWA 2ZJSE 3FRKA 3R9AA 1S72P 3A9ZA 1AA0A 1YNUA 4WYEA 2VLHA 1U08A 2WSFH 1CJ0A 2AY2A 2O1KA 3L72D 1PGOA 1J2JB 1I43A 2H88C 1R5SA 4C7NB 2ZYDA 4H0LD 1TOIA 3NNKA 4F5JA 1S9KD 5KJ7D 1LTAC 4L75A 1NU1G 1SVVA 2FYUE 1FC4A 1T8ZA 4WD2A 2EYQA 1SQXD 2Z1YA 1K73Q 1G4VA 3VYIA 3BV0A 2JEEA 1O69A 4D6TE 1X79B 3LVJA 2OKJA 1LJ2A 1KTMA 3EI9A 1SF2A 1YJ9P 1S09A 2X5FA 3SFDC 1W3UA 1KILE 2HORA 1H88A 1TATA 3AEBC 1FZFA 2N1TC 1YJSA 3H1JG 2IFNA 1BKGA 1G1JA 2QVAA 1OWAA 4XE5B 1DD4A 5CCGA 1H1CA 4KAMA 1GC0A 2BEQD 3S9OA 2JWAA 3BVHA 4AOAA 2GB3A 1VF5C 1SQXG 1NAFA 2P58A 1YIZA 1KYOE 3WX9A 3W68A 4Q75A 3QM2A 2R32A 2XZRA 2OYIA 3MGNA 2WSEH 2DKBA 4HKZH 2BI3A 3ZRRA 2Q6QA 2HFED 1NTKD 3G9RA 3ISLA 1UU0A 1T3IA 2EGYA 1FZCC 4XEWA 1V72A 5KTBA 2WSCH 1SP4A 3MAFB 1RE3A 2BWOA 2VMXA 1W7MA 3A8UX 1N73C 1NU1E 3FVUA 4UHMA 2HOXA 5AX8A 2ZXEB 3SWYA 4I7ZC 1JOCA 3VMXA 1KC8Q 1DH3A 3NYTA 4WYGA 3HQTA 1ZC9A 2W7JA 1JCDA 2HOZA 1YIJP 4I8AA 1FZGA 4CXQA 1VDFA 3NDNA 1DJUA 4ZWMA 1ZXGA 3L71G 3NYSA 1NTMD 2CFBA 4Y0HA 1VQ5P 3K28A 1BJWA 5APSA 2ZVOB 3F9TA 2RMZA 2R5EA 3L72E 5AW6B 1L4AA 2YOBA 1LWUA 2E76D 1OXZA 3UIAA 3B5NB 3M9QA 4ZAHA 3MC6C 2Q1KA 1B9HA 3UE8A 4AYCA 2WSFJ 1MLYA 1ZOYC 1KB9H 2O01H 1SQXE 2IZ0A 4UHOA 3JCUE 1SQPG 2E74C 2CSTA 4OTLA 3O8ZA 2WPRA 5KJ7C 2OYHB 1M0OA 4N0WA 3T32A 4UB6E 3HL2A 1KB9I 2C9NY 3ABVC 1EXJA 3CQ5A 1ZOBA 5CCHC 3E2ZB 1VQLP 3CQ4A 3HT4A 4MSOA 1YQ3C 1DIPA 1MAPA 1OATA 2W8VA 1Z3ZA 1B5OA 1L4AD 3LVMA 1GZLA 4M3LA 2A1VA 1TOJA 1GTWA 1AMSA 1AJSB 4NOGA 1KN7A 3ITKA 1JG8A 5KAFH 2JR8A 4IXSA 2DW3A 1OMIA 1YQ4C 1S0AA 3AE3C 1ZODA 3VOPA 3TNUB 5KLIB 2IDBA 1RE4A 3DC1A 2BHXA 2GQNA 2YMYA 3Q5PA 4RO0A 1LTJA 1URQC 2JJLA 4RJTA 3BCBA 2W8TA 1YHQP 3B1EA 4H44B 4JF7A 2FKIA 5AW0B 4W1XA 4BHDA 1MUUA 4KJMA 2EPJA 3PRJA 3N7NA 2WSEJ 2ZY4A 2CK3H 3WCOA 4XJMA 1AIBA 5J8QA 3CLQA 5AVVB 3H1HD 1OIPA 3CCRP 3CCVP 2WT7A 3MAUA 1SQPE 2WSCJ 1S5LE 3AEPA 4E1OA 5CCGC 1WRGA 1SQVK 3CMAP 4IFDK 3PJ0A 3PGYA 3CD6P 2GUSA 2P1JA 4Y28J 1QJ3A 1J1DC 1YTZT 4OH8B 1IJDB 4BRYB 1ECXA 3FQ8A 1KMIZ 3S1KA 8AATA 2LXCB 4F5KA 2JJFA 2BI1A 1H0TA 3L75J 1NAYA 4ZDLA 4JF0A 3KHUA 1HBWA 3HTKB 2WITA 1JO5A 2YCPA 4TT3H 4EOTA 2HZPA 1RF1A 3K7YA 5G4JA 4DZOA 1NGMB 1UKJA 1N2TA 2BYJA 2VMWA 4HH2A 1EDJA 3E1RA 2W7FA 1W5CE 2FN6A 2N1TB 1MDXA 3L73J 3VMZA 2V7QJ 1AHFA 3JC22 2KI7B 3H9XA 2KNCA 1G7XA 3UWCA 2C0WA 2O01J 1KL1A 1VQ4P 5DJTB 1IO4A 1MGVA 5APVA 3D70A 2VMYA 2QJKC 1MFZA 3W67A 3NUIA 2D64A 1LTGC 1VF5B 1GW4A 2PFXA 1M1JB 3FX0A 3DODA 1BCCJ 2Q9IA 3FVXA 2W7GA 4XJOA 4WLHA 1H0CA 5B5EE 4ADEA 1NOHA 1BDCA 3VOMA 1L4AC 3A9XA 4DQ6A 5IWQA 4K3AA 1GW3A 2DGLA 5TISH 2VMUA 2KB7P 1M0PA 1N73B 3Q5RA 1C4KA 4RKDA 2VMTA 4IYOA 4C46A 3PDBA 4R5FA 3PH0A 4MQPA 3M06A 3QWOC 1AHXA 5E4ZA 4GEBA 4OWFA 4ADCA 4IL6X 2AY4A 4A6TA 2I8DA 1EJIA 2DGKA 3L74J 3Q3DA 3CMEP 3B1DA 2N9YB 1QZ9A 1DGDA 3M0AA 2EO5A 5EIGB 1C9CA 3BCAA 3RGUA 2D2CD 4IY7A 4ATQA 1QJ5A 3E1IA 2G7JA 5EUNA 1SQVJ 3H1KJ 3I5CA 3FQAA 4LNMA 1JCCA 3LW5J 4R8DA 1L2PA 4M2JA 4F5MA 1LTTC 3QGUA 1ASGA 3KZIH 1HJBA 1JY2N 1M4NA 3AEAC 3AECC 4NPEA 4IL6H 1TASA 1LW4A 1NJIQ 3CCJP 3VN0A 1XEYA 4ADDA 2E74B 3S4RA 1M56D 1HJ0A 3CCUP 1RH5B 1LTJC 3HMUA 1EDLA 1NKZB 3WU2H 1VQ8P 1SQBD 1IFJA 1N7SA 1YJWP 5AW7B 1CS1A 4W5KA 1YJNP 2GMSA 1C7GA 2CANA 2AEFA 3K5BA 4Y0DA 3LIEA 1FBMA 3EQ2A 2NPSD 2BIAA 1WYTB 1GU5A 2IZ1A 2D5YA 4MKKA 2RN0A 3L73D 3F5HA 4AZKA 1ZW0A 5E3KA 4EIJA 1PMMA 1DEEG 2XU6A 5GTHH 4PFNA 1JY2O 1DJEA 1CZEA 3PD6B 5EUEA 1B5PA 3FSLA 1EDKA 3JWBA 2W6BA 3CL3D 3N0LA 1JS3A 2A45H 3CCMP 3A0HE 3G7QA 2WPSA 1FOSE 5CHXA 2JISA 3L75G 1HGVA 1N7SD 2AATA 2FNUA 2A45I 1URQB 1BCCD 5AW5B 1ASMA 2AEUA 1AMAA 1X22A 4ZSWA 4PIWA 4ZMDA 4OGQD 1NHLA 1RF1C 1VQMP 3HBXA 4DJGA 3L73G 2QJPC 3II0A 3RCHA 1BW0A 1TOEA 4ZSYA 4ZWVA 4W1WA 1KFNA 2JJHA 3AENA 1YJYA 1AMQA 1VPCA 1CI6A 4LNLA 2Z9XA 4N3YB 2OGAA 2BI2A 1SS1A 1ZV8A 4XJPA 4RM1A 2PB0A 1R8EA 3CC4P 2IBZI 5L8RJ 5E79E 4ISYA 2AY8A 1D2FA 5APQA 1IAXA 3JTXA 3FD0A 2N9BA 2ZYGA 1GU4A 1GL2C 2AY3A 1TOGA 2H7HA 1KILA 1SQVD 2FXMA 3H1KD 3LVLB 2HODB 3H1JJ 1J1EC 4GOFA 1KFMA 1M7LA 1FE6A 1PGPA 2XKMA 1YBKA 1EZVI 3RBZA 3VP6A 3EFGA 4JF1A 1AQTA 2WK9A 3PJSK 2OQQA 2W8ZA 1NH4A 1R5LA 3L75E 2VMRA 5AW3B 1W23A 3RQ1A 4E3QA 1P84H 3I55P 1FZEA 1JUNA 1D7UA 3H1IG 1GMJA 2D7ZA 2GUVA 3L74G 4D6TD 2QJKB 1FG3A 4XQ2A 3M5UA 1JMMA 1USDA 1KILD 3M0DC 1CW5A 3AATA 3L73E 4DCKA 1SQVG 3H1KG 3GWPA 4TLFA 1Q7YQ 1XI9A 4H13C 2B87B 1KB9E 4A7PA 3HE4B 1GDEA 3AEMA 3A5TA 3AE1C 4IXOA 2XNXA 4AO4A 2Q3IA 4WY4C 3E2FA 3QPGA 1NTZK 3CWBJ 3KXDA 4IW7A 1BCCE 1G2CB 4WYDA 4PV1C 3FZ7A 3PLNA 2M8RA 2JWDA 2D65A 1ARHA 3FDDA 1X28A 2O01N 3RL0g 3L71J 1N7SC 3GZDA 2HYNA 3T97B 1KMJA 3O6QB 1GBNA 1WMKA 3CAIA 2VMNA 2M0BA 3RL0C 4F5GA 3SSUA 2BCCJ 3USSA 4OGQC 1WYVA 1ELUA 3L35A 2Z4EA 5DX5A 1ORDA 2GA1A 1QL2A 4AUWA 2QA3A 3CI9A 3HD7A 4RITA 1YOOA 1VQOP 1M6SA 1LC7A 4EB7A 1RF0A 3CXHH 1TARA 3AE6C 1YIYA 3L74E 2W7MA 4R2NA 3RBXA 2TPLA 1AVYA 2YKVA 4JEWA 1Y8AA 3I4JA 2P7JA 2O0RA 3CXHI 2Z9WA 1M57D 1SQVE 3H1KE 1S06A 5JAYA 2R3CA 2R0TA 3BATA 1Q82Q 4FL0A 3IFMA 3VMAA 2AXTH 3H1JD 2K3RA 1GD9A 2CINA 4B98A 5CJ4A 2FBWC 2KSEA 3FCRA 2YHKA 1PG8A 3HUSC 2CTZA 1LC5A 1GD2E 3HRNA 3HD7D 3NU8A 3WKRA 5AW2B 2W7LA 4U3FJ 1T2KD 3FQ7A 3V4WA 1OVRA 3MZWB 3PDXA 1KQSO 3ELPA 1CZCA 5KAIH 1TOKA 2KUBA 3KPEA 3M91A 2E75C 2FYNC 2YKXA 4E77A 2HUIA 1FOSF 4RJYA 3C9IA 5APTA 1SQQK 1KILC 5K8BA 1AHGA 4PJ0E 1N8RQ 1OVVA 2VMPA 1NTZJ 3PIUA 3D6ZA 2QJPB 3H6PA 2ZT9D 4YXWH 3CWBD 3NU7A 1S3JA 1WYUB 1Q2NA 2PO3A 4Q76A 1KV4A 2ZY2A 1V2FA 1DX7A 4BQ0A 2P67A 2OTLP 1JMBA 2ZXXA 2VYCA 3L71D 1FDMA 4WYAA 1S07A 3I56P 2FYFA 1BJOA 3RK3D 4H63Q 3A7OA 3N4SA 1Q90D 2WWWA 3CCEP 4TMRA 1M7YA 2BCCD 3IF4A 1GL2B 1USEA 2YKPA 4GODA 3VP8A 2AEJA 2YKQA 1L0NK 2VRSA 2CJDA 3C8VA 2BYLA 1J1EB 1SQPD 1DEBA 1ASBA 2ZY3A 3CWBG 2V1PA 2XDJA 2A45G 5KKZC 2V4HA 4EB5A 2F8JA 2HG5D 3DXWA 2FM1A 4PD4H 5B66H 1LT9A 3H1JE 2ZP7A 5KLVK 1PFFA 5F8VA 4W8IA 3L37A 2LXBA 1ARSA 2FFDC 2BCCG 1BJNA 3P8MC 4PD4I 2CJHA 2Z61A 1D7VA 5M4DA 2IPPA 3KZIE 1LGHB 1VQKP 2IYPA 2JKVA 2VGTA 2K9JA 4H13B 4U3FD 4IL6E 3Q8NA 3EIAA 3CCSP 1QL1A 4WYCA 2QSRA 2Z5HA 4H0LC 4GE7A 2YKYA 3V6IA 4WXBA 4LW2A 2YCNA 3HD7C 2I1KA 4GDOA 2C9LY 2FXOA 1AHEA 4L0OA 1T2KC 2HPCA 3EI6A 1HUCA 1RF0C 3WU2E 1KMKA 4WY4B 4QGRA 1P84D 2FKWB 4CBRA 2JP3A 3LY1A 3GW6A 1HGZA 1KQFB 5H2FH 2K37A 2KZIA 1SZUA 1SQQJ 3R4YA 3P8CE 4GSAA 1LS3A 2C81A 4U2HA 4PV1B 4JEYA 3VAXA 1BDDA 1SFCB 1RV3A 4WBTA 3HE5A 1IC2A 4IOIH 2ZFCA 4ATPA 2Q7CA 2YCTA 2Z20A 1PPJG 2OGEA 5GTHE 5AVZB 1TU3F 2J5UA 4ADBA 4OC9A 2R5CB 1NTZD 3NTNA 3L70J 3RL0B 1CZQA 4WB0A 1VQ6P 3CWBE 4U3FG 3FXDA 2FYZA 2ZJGA 3BB8A 5TF5A 3L71E 5TJHA 3FWLA 3BCCG 3RK3E 1SFFA 1E5EA 1O62A 3GHGA 2QEXP 2AY5A 2BWNA 3N75A 2BCCE 2W8WA 5AVTB 3H32B 1CQ7A 4RLGA 4M2KA 2M5AA 1L0NJ 4B9BA 5EQCA 3M9HA 1B8GA 1ASLA 4EI2A 2X3LA 3A0BH 2KS1A 1NTZG 3RK2D 3IR9A 1IAYA 1U7MA 1AY8A 5G2QA 3KYQA 3HUSB 3F0HA 4C7NA 4ASVA 3P7KA 3CX5D 3PP5A 4XJLA 4P3MA 1FC2C 5KLVJ 2HP1A 3GETA 1C7NA 3B8XA 4K05A 4P7YA 2KSJA 3BS8A 2QM7A 2E7UA 1IFNA 2H8PD 1LP1B 1W2EA 2OYIC 1PPJE 1AFOA 1QISA 2E75B 1RQUA 1KD1Q 4K35A 2P10A 3ASAA 1IX8A 2FYNB 2QE7H 2KXPB 3ECDA 3WZFA 5D5SA 3B46A 1MKMA 2QJYC 1VQ9P 1UU2A 4U3FE 4RKCA 2E76C 1RE3C 3L36A 4AZJA 2GSAA 1VEFA 3L4FA 3ELEA 1IFIA 2WTYA 4NPFX 4XK1A 2KIKA 3L44A 3NTJA 2E54A 1P84E 1ZR4A 2YKOA 1GCKA 2E42A 3U1AA 3SFEC 3GG2A 1M1KQ 5AW9B 1I41A 4FFCA 4GE4A 2B89A 2DGMA 3U59A 5BJ4A 1B9IA 2G8YA 3MEBA 1JNMA 1DKAA 1FZBA 1DD3A 5AVWB 1OVUA 3CC2P 1CQ6A 2A06G 5G2PA 3EI5A 4K2IA 4KHXA 1NTZE 5BU5A 2AY6A 4QMAA 1LWUC 1ZP0C 1FZCB 3E9KA 4DGTA 1U7JA 4UHNA 1IFDA 1IJIA 4F5IA 1G4XA 2WPQA 3L8AA 5EAVA 4OMAA 3VK4A 1KKPA 4I7ZB 1KYOI 3GF3A 3G0TA 1RHZB 5APYA 4UQVA 1V2EA 3FFRA 7AATA 3VTPC 3QBOA 1MDZA 3ASBA 4GE9A 3H1IJ 1JY3P 1LTIC 1V2DA 1SQQG 5KKZB 4E3RA 3NUBA 1QVGO 4LNJA 2QM8A 2O7CA 2P2UA 3W1HA 3IAOA 4AQRD 2IX7C 1N2DC 1VQ7P 1U57A 1BGYG 2NPSA 1SVFA 1G7WA 2J59M 3LWSA 2E5YA 4WVZA 4YPCA 1MAQA 2OARA 3L70G 1ASFA 2FFDB 3NMDA 5AVXB 1OXOA 2QBTA 2WSSH 3OKSA 3CX5E 1DJ9A 1LW5A 3AEJA 5D95A 2D63A 3CXHE 3EWKA 1X29A 1RE4C 4OBVA 1ASCA 4AH3A 4ZNCA 4N78E 2K88A 5KLVD 3HLMA 5K5GB 4H0LB 2VMOA 1LK9A 3L75D 3TGUG 4ZKPA 4Q31A 1JTHB 1FS0E 2OYHA 3E2ZA 1Y47A 2FQ6A 3GHGC 1L0NG 3BCXA 3B71A 3KQGA 2VGZA 3JCUH 2MJZA 2Y9ZA 1X8YA 2WQYC 3AE9C 4NPDA 2JDIH 2QSIA 1OZHA 2Q3EA 3AOWA 1OHVA 1ARGA 4EYYQ 1AJSA 3B5ND 2KP8A 1KB9D 1WKHA 5AW1B 3U1CA 3G6EP 1EXIA 1IUGA 2IFMA 5AVRB 1K9MQ 4EFFA 4HVKA 4HYTB 1DFOA 5KLVG 1SQQE 2FXPA 2KYVA 3H1LG 4GOEA 1YYCA 2YRRA 2WZ7A 4HJGH 1ASEA 1GC4A 3I16A 1IZNB 3TYYA 3TQXA 3L70E 2XNDH 3DR7A 3DXVA 3D6YA 1H8AA 4J5UA 3GBXA 1WT6A 1EC5A 2HLOA 1FJPA 4L73A 2NRGA 4W7YA 2W7KA 1UIIA 4ITGA 1GK4A 1VQPP 3BWNA 3WGCA 1ARTA 3MD0A 3BASA 1LKCA 5GTIH 1PP9J 1J04A 4A6UA 2X8UA 4XAUA 4A0RA 3H1ID 4PVFA 2JJGA 2WPVB 5AVYB 4Y0IA 1J1DB 1L0NE 1BJ4A 3L74D 1BS0A 1P3WA 3OAKA 1NTKK 4BRYA 1G1IA 2PRRA 4GKGA 1K8AQ 3IN6A 5M1BA 2GM4A 4H44D 2AY1A 3BN1A 5BJ3A 4DOJA 4JYBA 5APWA 4HB1A 2OYIB 2D2CC 4WXFA 2E7IA 1M8OB 4BA4A 1VP4A 5HDMA 2QJYB 1BE3G 1Z56A 2I1JA 2FNIA 2YXRB 2E76B 3E6GA 5KLVE 1JF9A 2N1TA 2W8JA 1AY5A 4A0HA 2KOGA 2IYOA 4ZDPA 3V2QA 3AE8C 4XFJA 1CL1A 1NTMK 4PD4E 1QIRA 3WKSA 3TATA 4A00A 3KDPB 2SPZA 3PPLA 4W80A 2AXCA 3MBBA 2W8UA 3SWFA 1IVRA 1M1JA 2Z5IA 1K05A 4JQ0D 5EFSA 2RFVA 1ARIA 3BRVB 1SLQA 1W2BO 2QLRA 5HHYA 4Q6RA 2NPSC 1L4AB 2KLUA 1LWUB 4DT0A 5BVZA 2H89C 2N1TD 3MKJA 3USFA 2Y0DA 4I6MC 3AEJC 1PZQA 1RY3A 4W1VA 2WVRA 3PAAA 2K9JB 1GC3A 2QA4P 3B4SA 4UB8H 1HH0A 4B86A 1I48A 2BKWA 3LV2A 3Q1MA 3GZCA 1VF5D 4WWIA 1QVFO 2YO3A 1T6AA 2JGTA 1J32A 1O4SA 2POHA 3N5MA 5KAFE 4LC1A 1BT4A 4BA5A 1EG5A 3FZ6A 1AAMA 2OGUA 2L91A 4BXLA 1ZR2A 3H7FA 4EDFA 2C7TA 3LIDA 2W7HA 4Y99C 4I1LA 2XBNA 2DOUA 2CPSA 4L76A 3V2PA 3H1IE 2RKLA 1D7MA 3A3YB 1GEXA 1NTKJ 2PAJA 3CC7P 2HUFA 4I2LC 3QI6A 1Y9BA 2QRXA 1IX7A 5KLIC 1RV4A 1VL2A 2AY9A 1LTJB 1HWTC 1T3UA 3FFHA 2WK7A 1AAWA 1ZLLA 4OYTA 1X0TA 5CCHA 4EU1A 5E5IA 3TDKA 1Y4IA 3A0BE 4XA4A 3LVKA 3TSIA 4H44C 3FXEA 4BMKA 5G4IA 3MP7B 2QB2A 2ORDA 1OXPA 3A2BA 1WYTA 2C0XA 2WT7B 3AE4C 4YXDC 1S08A 1NTMJ 2QMAA 3BWNC 1OW8A 1AJYA 1PP9G 3F6TA 2YNYA 3PD6A 1Z7DA 4GT1A 5APUA 1AMRA 4WBAA 1ZN5A 2E74D 1Q81Q 3FWNA 3BCCJ 2MKVA 3HDOA 4IFMA 3AV7A 1AQ5A 2PP6A 2QIWA 1FJKA 3B8EB 5CCHD 2ZUKA 4AO9A 2E7JA 2YMKA 3P8CD 1H0TB 1URQA 5DJ9A 1OX3A 4ZDOA 4JEZA 2VMVA 3A0HH 4IFFA 3TK1A 1AHYA 1IX6A 1RF1B 4H51A 2W27A 1MZ9A 4RAEA 5HXXA 2E43A 2H43A 4A0GA 4JBZA 3WLXA 1KAFA 1L0LK 4JYCA 1I29A 3TF5A 1A02F 2YRIA 4EMYA 2KNCB 3L72G 2NZ2A 3AEFC 1ELQA 2QG4A 5CMZA 4R5ZA 4WYFA 1AIAA 2BWPA 1SZSA 4ZM3A 3A2AA 4M2MA 2KZJA 1URQD 4W91A 1X0MA 2R44A 1OW7A 1IK9A 3AEDC 4OVNF 1M32A 1M1JC 5TISE 5AW4B 3D6KA 5M49A 3MADA 3BRTB 4HF8A 1PP9E 2HODA 3AEMC 2D2CB 2YIUC 5E79H 2IBZD 4ZLVA 1NO4A 2Q5UA 5EAAA 2Z9UA 4MY5A 4N6JA 3H1HJ 1RVYA 5CCGD 3R2PA 4JPZB 4IYOB 3JW9A 3PDBB 3KGWA 5M46A 1YAAA 4YTPC 4ZKUA 3E77A 1ASNA 3WY7A 3GZDC 4RIZA 1EZVD 1PPJD 1VJOA 1YI2P 1ZRTD 3FDBA 2J58A 1HVVA 3KKIA 4DBCA 1LTBC 2V0YA 3EUCA 3SWKA 3ZRPA 3MUDA 1W7NA 4A0FA 1KL2A 1EDIA 2B87A 2NPSB 2ZVNB 3HE4A 2IBZG 3WUUA 1MFTA 1NTKG 1KQLA 4ZM4A 2OQXA 4CXRA 3UAKA 1M90Q 1AICA 2WB6A 3LG0A 1S9KE 1SQBK 2R3SA 2V7QH 5FT6A 3BCCD 1CL2A 2VIAA 3CBFA 1N86A 1PL5A 2OKKA 2YKUA 2ITAA 1OHWA 4J8LA 1PV3A 1G2CA 2YXQB 3V4QA 1UIXA 2EH6A 3VK2A 1EZVG 4RESB 1N7SB 1BGYJ 1AKAA 2GMUA 5I92A 3BWOA 1LNQA 3T97A 1AKCA 3O6QA 1L0LJ 3DZZA 1GK6A 2W7IA 1FU1A 1NTMG 4OGQB 1A02J 2W7EA 1OFCX 3F89A 2HUUA 2Y0CA 3VP9A 4Y99B 2VGWA 3OP7A 1WSTA 2ZT9C 1VQNP
chains in the Genus database with same CATH topology
4F5HA 4F4EA 4O6ZA 3TCMA 3ZZJA 1T3JA 5C6UA 2DKJA 3TFTA 3OA7A 2X5DA 1QGNA 3P6KA 3RBFA 3GSBA 2VMSA 3RK3C 5M4BA 1SPAA 1C7OA 3DRDA 1EQ7A 3GJUA 4O9BA 3RI6A 1XTGB 1QITA 2CH2A 3ATHA 1D7RA 3RCHB 1LC8A 1DGEA 1EQBA 3LW5H 5DJ1A 3AENB 4A6RA 1CI6B 4N78D 1BQAA 2HP2A 3P32A 3G8MA 1MDOA 4OBUA 1FAVA 1X2AA 1IBJA 1N8PA 4C7RA 2BIGA 2EZ2A 3W1IA 1KILB 3A9YA 2JJEA 1ASAA 2FYUK 1ASDA 3FVSA 1HTLC 4WP0A 1SZKA 2DR1A 1OHYA 3EZ1A 2BIEA 1WKGA 1WYUA 4LW4A 3VK3A 3II6A 1FZAA 3BC8A 1LT9C 1AJRA 3DU4A 1YJZA 1JY3N 5G09A 3I5TA 3EZSA 2BI5A 2W7DA 1KZUB 2ZC0A 1GL2A 3MAFA 4F5FA 4OT8A 1W7LA 1M0NA 2O1BA 4F5LA 1FG7A 4TN4A 1PFIA 3WGBA 1B4XA 2O1JA 4WXGA 1UU1A 5AW8B 1AX4A 2YO2A 5F9SA 1LTSC 3OJAB 5AVQB 3K40A 4K2BA 3V2RA 2PB2A 1JY3O 3KE3A 3EIBA 3IHJA 3V5BA 1CSBA 1NU1K 4IXZA 1GL2D 1YTZI 4K2MA 2CPBA 3B5NA 2VI8A 4CVQA 3PA9A 3E2YA 1IFMA 3M0DA 3RK2C 4GDYA 3FTBA 2LKMA 5AVSB 1WYVB 2VGSA 2CJGA 4MQRA 3HD7B 1N7LA 4GIFA 2CB1A 4WY4A 5APXA 3M9BA 1E5WA 4U1TA 2R5BA 1NWQA 3AOVA 1SFCA 2WK8A 1SQXK 4ITXA 2R5CA 3FKDA 4WLJA 1JY2P 2HOYA 3TNUA 3R4TA 3JZLA 3FZ8A 4WB4A 2D61A 1TPLA 4WY4D 2JG2A 2ZY5A 5CJ0A 1NKNA 3WCNA 2G6WA 1SFCD 3H32A 5AVUB 3DR4A 2QB3A 1PMOA 2Z1ZA 3RK3B 3EI7A 1M0QA 2M3BA 3HVYA 3RL0D 3QN6A 3RBLA 1MLZA 3N4XA 4KXKA 2KLVA 4UOYA 2L5GB 1JS6A 1RVUA 2BASA 3HUSA 5FT4A 2OATA 2VIBA 2AEVA 1BQDA 2KFPA 2VI9A 2ZYJA 3NYUA 2D66A 3QHXA 2Z9VA 2R5DA 4GRXA 3HTKA 1GC2A 1BJOB 1XTCC 2NMPA 1SQPK 3GR9A 5BU8B 3RUYA 2VGUA 2XH1A 2CH1A 2Q7WA 4MQQA 3TFUA 2AY7A 3V2NA 3ZRQA 4A72A 3N4RA 3ZZKA 2EZ1A 3NFQA 3P1TA 4LGDE 1GEWA 3NRAA 2W6AA 2WKAA 1H89A 3B1CA 3NX3A 4JEXA 2VMZA 1O61A 4ZASA 2XV5A 1LT9B 1N31A 3ACZA 5G0AA 1GEYA 1CQ8A 5FT5A 5DB5A 4LC3A 3B5NC 1FZCA 2VGVA 1N73A 9AATA 1C0NA 1AY4A 1AKBA 2OYHC 4IX8A 5FT8A 4CBSA 2HPCB 1GDTA 4W7ZA 2ZSLA 3VMYA 4OCAA 3KGXA 3MTUE 2VMQA 1X9VA 1E5FA 5EIGA 3DYDA 3G3ZA 3NXSA 4JEVA 4MKJA 1SFCC 3HE5B 1DTYA 2D7YA 1KKJA 3W1JA 2BI9A 2FFDA 4KYOA 3JWAA 3MC6A 4WB0B 3RK2B 2R2NA 2VLFA 3COGA 3CQ6A 4LLHA 3AELA 2C0RA 1MV8A 5KJ7A 1JTHA 3AEOA 1D7SA 2ZSMA 5EUDA 3GHGB 3WMM0 2CY8A 2C44A 4PFFA 4RJ0A 3EI8A 3MIWA 3FRKA 3R9AA 3A9ZA 1YNUA 4WYEA 2VLHA 1U08A 2WSFH 1CJ0A 2AY2A 2O1KA 1J2JB 1I43A 3NNKA 4C7NB 1TOIA 4F5JA 1S9KD 5KJ7D 1LTAC 1SVVA 1FC4A 1T8ZA 4WD2A 2EYQA 2Z1YA 1G4VA 3VYIA 3BV0A 2JEEA 1O69A 1X79B 3LVJA 2OKJA 3EI9A 1SF2A 1S09A 2X5FA 1W3UA 2HORA 1H88A 1TATA 1FZFA 2N1TC 1YJSA 2IFNA 1BKGA 1G1JA 1OWAA 4XE5B 5CCGA 1H1CA 4KAMA 1GC0A 3BVHA 4AOAA 2GB3A 1NAFA 1YIZA 3WX9A 4Q75A 3QM2A 2R32A 2XZRA 2OYIA 3MGNA 2WSEH 2DKBA 2BI3A 3ZRRA 2HFED 3ISLA 1UU0A 1T3IA 2EGYA 1FZCC 4XEWA 1V72A 5KTBA 2WSCH 1SP4A 3MAFB 1RE3A 2BWOA 2VMXA 1W7MA 3A8UX 1N73C 4UHMA 3FVUA 2HOXA 5AX8A 2ZXEB 3SWYA 1JOCA 3VMXA 1DH3A 3NYTA 4WYGA 3HQTA 1ZC9A 2W7JA 1JCDA 2HOZA 4I8AA 1FZGA 4CXQA 1VDFA 3NDNA 1DJUA 4ZWMA 3NYSA 2CFBA 4Y0HA 3K28A 1BJWA 5APSA 3F9TA 2R5EA 5AW6B 1L4AA 2YOBA 1LWUA 1OXZA 3UIAA 3B5NB 3M9QA 4ZAHA 3MC6C 1B9HA 3UE8A 4AYCA 1MLYA 2O01H 4UHOA 2CSTA 4OTLA 3O8ZA 2WPRA 5KJ7C 2OYHB 1M0OA 4N0WA 3T32A 3HL2A 2C9NY 3CQ5A 1ZOBA 5CCHC 3E2ZB 3CQ4A 3HT4A 4MSOA 1MAPA 1OATA 2W8VA 1Z3ZA 1B5OA 1L4AD 3LVMA 1GZLA 4M3LA 2A1VA 1TOJA 1GTWA 1AMSA 1AJSB 4NOGA 1JG8A 4IXSA 1S0AA 1ZODA 3VOPA 3TNUB 1RE4A 3DC1A 2BHXA 2GQNA 2YMYA 1LTJA 1URQC 2JJLA 3BCBA 2W8TA 3B1EA 2FKIA 4JF7A 4W1XA 5AW0B 4BHDA 1MUUA 2EPJA 3N7NA 2ZY4A 3WCOA 4XJMA 1AIBA 5J8QA 3CLQA 5AVVB 2WT7A 3MAUA 3AEPA 4E1OA 5CCGC 1WRGA 1SQVK 4IFDK 3PJ0A 3PGYA 2GUSA 2P1JA 1QJ3A 1J1DC 1YTZT 4OH8B 1IJDB 1ECXA 3FQ8A 8AATA 4F5KA 2JJFA 2BI1A 4ZDLA 4JF0A 1HBWA 3HTKB 2WITA 1JO5A 2YCPA 4EOTA 2HZPA 1RF1A 3K7YA 5G4JA 4DZOA 1UKJA 1N2TA 2BYJA 2VMWA 4HH2A 2W7FA 2FN6A 2N1TB 1MDXA 3VMZA 1AHFA 3H9XA 1G7XA 3UWCA 2C0WA 1KL1A 1IO4A 1MGVA 5APVA 2VMYA 1MFZA 3NUIA 2D64A 1LTGC 1GW4A 1M1JB 3DODA 2Q9IA 3FVXA 2W7GA 4XJOA 4WLHA 1H0CA 4ADEA 1NOHA 3VOMA 1L4AC 3A9XA 4DQ6A 5IWQA 1GW3A 2DGLA 2VMUA 2KB7P 1M0PA 1N73B 1C4KA 4RKDA 2VMTA 4IYOA 4C46A 3PDBA 4R5FA 4MQPA 3M06A 1AHXA 5E4ZA 4GEBA 4ADCA 2AY4A 4A6TA 1EJIA 2DGKA 3B1DA 1QZ9A 1DGDA 3M0AA 2EO5A 5EIGB 1C9CA 3BCAA 4IY7A 4ATQA 1QJ5A 3E1IA 2G7JA 5EUNA 3I5CA 3FQAA 4LNMA 1JCCA 4R8DA 4M2JA 4F5MA 1LTTC 3QGUA 1ASGA 1HJBA 1JY2N 1M4NA 1TASA 1LW4A 3VN0A 1XEYA 4ADDA 1LTJC 3HMUA 1NKZB 1IFJA 1N7SA 5AW7B 1CS1A 4W5KA 2GMSA 1C7GA 2CANA 4Y0DA 3LIEA 1FBMA 3EQ2A 2NPSD 2BIAA 1WYTB 1GU5A 2D5YA 4MKKA 4AZKA 5E3KA 4EIJA 1PMMA 2XU6A 4PFNA 1JY2O 1DJEA 1CZEA 3PD6B 5EUEA 1B5PA 3FSLA 3JWBA 2W6BA 3CL3D 3N0LA 1JS3A 2A45H 3G7QA 2WPSA 1FOSE 5CHXA 2JISA 1HGVA 1N7SD 2AATA 2FNUA 2A45I 1URQB 5AW5B 1ASMA 2AEUA 1AMAA 4ZSWA 4PIWA 1NHLA 1RF1C 3HBXA 3II0A 3RCHA 1BW0A 1TOEA 4ZSYA 4ZWVA 4W1WA 1KFNA 2JJHA 3AENA 1YJYA 1AMQA 1VPCA 1CI6A 4LNLA 2Z9XA 4N3YB 2OGAA 2BI2A 1ZV8A 4XJPA 4RM1A 2PB0A 4ISYA 2AY8A 1D2FA 5APQA 1IAXA 3JTXA 3FD0A 2N9BA 1GL2C 1GU4A 2AY3A 1TOGA 2H7HA 1KILA 2FXMA 3LVLB 2HODB 1J1EC 1KFMA 1M7LA 2XKMA 3VP6A 3EFGA 4JF1A 2WK9A 1NH4A 2VMRA 5AW3B 1W23A 3RQ1A 4E3QA 1FZEA 1JUNA 1D7UA 2D7ZA 2GUVA 1FG3A 4XQ2A 3M5UA 1JMMA 1KILD 3M0DC 1CW5A 3AATA 3GWPA 1XI9A 3HE4B 1GDEA 3AEMA 3A5TA 4IXOA 2XNXA 4AO4A 2Q3IA 4WY4C 3E2FA 3QPGA 1NTZK 4IW7A 1G2CB 4WYDA 3FZ7A 2M8RA 2D65A 1ARHA 3FDDA 1X28A 1N7SC 3GZDA 2HYNA 1KMJA 1GBNA 3CAIA 2VMNA 3RL0C 4F5GA 1WYVA 1ELUA 3L35A 2Z4EA 5DX5A 1ORDA 1QL2A 4AUWA 2QA3A 3CI9A 3HD7A 4RITA 1YOOA 1M6SA 1LC7A 4EB7A 1RF0A 1TARA 1YIYA 2W7MA 4R2NA 2TPLA 2YKVA 4JEWA 3I4JA 2P7JA 2O0RA 2Z9WA 1S06A 5JAYA 2R3CA 2R0TA 3BATA 4FL0A 3IFMA 1GD9A 2CINA 4B98A 5CJ4A 3FCRA 2YHKA 1PG8A 3HUSC 2CTZA 1LC5A 1GD2E 3HRNA 3HD7D 3NU8A 3WKRA 5AW2B 2W7LA 1T2KD 3FQ7A 3V4WA 3PDXA 3ELPA 1CZCA 1TOKA 3M91A 3KPEA 2YKXA 4E77A 2HUIA 1FOSF 4RJYA 3C9IA 5APTA 1SQQK 1KILC 5K8BA 1AHGA 2VMPA 3PIUA 3H6PA 3NU7A 1WYUB 2PO3A 4Q76A 2ZY2A 1V2FA 1DX7A 4BQ0A 2P67A 2VYCA 4WYAA 1FDMA 1S07A 2FYFA 1BJOA 3RK3D 4H63Q 3A7OA 3N4SA 2WWWA 4TMRA 1M7YA 1GL2B 2YKPA 3VP8A 2YKQA 1L0NK 2VRSA 2CJDA 2BYLA 1J1EB 1DEBA 1ASBA 2ZY3A 2V1PA 2XDJA 2A45G 4EB5A 2F8JA 2HG5D 3DXWA 2FM1A 1LT9A 2ZP7A 5KLVK 1PFFA 5F8VA 4W8IA 3L37A 1ARSA 2FFDC 1BJNA 3P8MC 2CJHA 2Z61A 1D7VA 5M4DA 2IPPA 1LGHB 2VGTA 3Q8NA 3EIAA 1QL1A 4WYCA 2QSRA 2Z5HA 4GE7A 2YKYA 4WXBA 4LW2A 2YCNA 3HD7C 2I1KA 2C9LY 1AHEA 4L0OA 1T2KC 2HPCA 3EI6A 1HUCA 1RF0C 1KMKA 4WY4B 4QGRA 2FKWB 4CBRA 3LY1A 1HGZA 1SZUA 3P8CE 4GSAA 1LS3A 2C81A 4U2HA 4JEYA 3VAXA 1SFCB 1RV3A 4WBTA 3HE5A 1IC2A 2ZFCA 4ATPA 2Q7CA 2YCTA 2Z20A 2OGEA 5AVZB 4ADBA 4OC9A 2R5CB 3NTNA 3RL0B 1CZQA 4WB0A 2FYZA 2ZJGA 3BB8A 5TF5A 1SFFA 1E5EA 1O62A 3GHGA 2AY5A 2BWNA 3N75A 2W8WA 3H32B 5AVTB 1CQ7A 4RLGA 4M2KA 4B9BA 5EQCA 3M9HA 1B8GA 1ASLA 2X3LA 3RK2D 3IR9A 1IAYA 1AY8A 5G2QA 3KYQA 3HUSB 3F0HA 4C7NA 3P7KA 3PP5A 4XJLA 4P3MA 2HP1A 3GETA 1C7NA 3B8XA 4K05A 4P7YA 2KSJA 3BS8A 2QM7A 2E7UA 1IFNA 2H8PD 1W2EA 2OYIC 1AFOA 1QISA 3ASAA 1IX8A 3ECDA 3WZFA 5D5SA 3B46A 1UU2A 4RKCA 3L36A 1RE3C 4AZJA 2GSAA 1VEFA 3L4FA 3ELEA 1IFIA 2WTYA 4XK1A 3L44A 3NTJA 2E54A 1ZR4A 2YKOA 1GCKA 2E42A 3U1AA 5AW9B 1I41A 4FFCA 4GE4A 2DGMA 3U59A 5BJ4A 1B9IA 3MEBA 1JNMA 1DKAA 1FZBA 5AVWB 1CQ6A 5G2PA 3EI5A 4K2IA 4KHXA 5BU5A 2AY6A 1LWUC 1FZCB 3E9KA 4DGTA 4UHNA 1IFDA 1IJIA 4F5IA 1G4XA 2WPQA 3L8AA 5EAVA 4OMAA 3VK4A 1KKPA 3G0TA 5APYA 4UQVA 1V2EA 3FFRA 7AATA 3VTPC 3QBOA 1MDZA 3ASBA 4GE9A 1JY3P 1LTIC 1V2DA 4E3RA 3NUBA 4LNJA 2QM8A 2O7CA 2P2UA 3W1HA 4AQRD 2IX7C 1N2DC 2NPSA 1SVFA 1G7WA 2J59M 3LWSA 1MAQA 2OARA 1ASFA 2FFDB 3NMDA 5AVXB 1OXOA 2QBTA 3OKSA 1DJ9A 1LW5A 3AEJA 5D95A 2D63A 1X29A 1RE4C 4OBVA 1ASCA 4AH3A 4N78E 3HLMA 2VMOA 1LK9A 4ZKPA 4Q31A 1JTHB 2OYHA 3E2ZA 2FQ6A 3GHGC 3BCXA 3KQGA 2VGZA 2MJZA 1X8YA 3AOWA 1OHVA 1ARGA 1AJSA 3B5ND 2KP8A 1WKHA 5AW1B 3U1CA 1IUGA 2IFMA 5AVRB 4EFFA 4HVKA 4HYTB 1DFOA 2KYVA 1YYCA 2YRRA 2WZ7A 1ASEA 1GC4A 3I16A 3TYYA 3TQXA 3DR7A 3DXVA 1H8AA 4J5UA 3GBXA 1WT6A 2HLOA 1FJPA 4W7YA 2W7KA 4ITGA 1GK4A 3BWNA 3WGCA 1ARTA 3MD0A 3BASA 1LKCA 1J04A 4A6UA 2X8UA 4XAUA 4A0RA 4PVFA 2JJGA 5AVYB 4Y0IA 1J1DB 1BJ4A 1BS0A 1P3WA 3OAKA 1NTKK 1G1IA 4GKGA 2GM4A 2AY1A 3BN1A 5BJ3A 4DOJA 4JYBA 5APWA 2OYIB 4WXFA 2E7IA 4BA4A 1VP4A 5HDMA 1Z56A 2I1JA 2FNIA 3E6GA 1JF9A 2N1TA 2W8JA 1AY5A 4A0HA 2KOGA 4ZDPA 3V2QA 1CL1A 1NTMK 1QIRA 3WKSA 3TATA 4A00A 3KDPB 3PPLA 4W80A 3MBBA 2W8UA 3SWFA 1IVRA 1M1JA 2Z5IA 5EFSA 2RFVA 1ARIA 3BRVB 1SLQA 5HHYA 2QLRA 4Q6RA 2NPSC 1L4AB 1LWUB 5BVZA 2N1TD 3MKJA 3USFA 4I6MC 3AEJC 1RY3A 4W1VA 3PAAA 1GC3A 1HH0A 4B86A 1I48A 2BKWA 3LV2A 3GZCA 2YO3A 2JGTA 1J32A 1O4SA 2POHA 3N5MA 4LC1A 1BT4A 4BA5A 1EG5A 3FZ6A 1AAMA 1ZR2A 3H7FA 2C7TA 3LIDA 2W7HA 4Y99C 4I1LA 2XBNA 2DOUA 2CPSA 3V2PA 3A3YB 1GEXA 2PAJA 2HUFA 4I2LC 3QI6A 1IX7A 1RV4A 2AY9A 1LTJB 1HWTC 1T3UA 3FFHA 2WK7A 1AAWA 1ZLLA 4OYTA 5CCHA 4EU1A 5E5IA 1Y4IA 4XA4A 3LVKA 3TSIA 4BMKA 5G4IA 2QB2A 2ORDA 1OXPA 3A2BA 1WYTA 2C0XA 2WT7B 1S08A 2QMAA 3BWNC 3F6TA 2YNYA 3PD6A 1Z7DA 4GT1A 5APUA 1AMRA 4WBAA 1ZN5A 3HDOA 4IFMA 3AV7A 1AQ5A 2PP6A 1FJKA 3B8EB 5CCHD 2ZUKA 4AO9A 2E7JA 4ZDOA 3P8CD 5DJ9A 1URQA 4JEZA 2VMVA 4IFFA 3TK1A 1AHYA 1IX6A 1RF1B 4H51A 2W27A 1MZ9A 4RAEA 5HXXA 2E43A 2H43A 4A0GA 3WLXA 1L0LK 4JYCA 1I29A 1A02F 2YRIA 4EMYA 1ELQA 5CMZA 4R5ZA 4WYFA 1AIAA 2BWPA 1SZSA 4ZM3A 3A2AA 4M2MA 1URQD 4W91A 1X0MA 1IK9A 1M32A 1M1JC 5AW4B 3D6KA 5M49A 3MADA 3BRTB 4HF8A 2HODA 3AEMC 4ZLVA 1NO4A 2Q5UA 5EAAA 2Z9UA 4MY5A 4N6JA 1RVYA 5CCGD 3R2PA 4IYOB 3JW9A 3PDBB 3KGWA 5M46A 1YAAA 4ZKUA 3E77A 1ASNA 3WY7A 3GZDC 4RIZA 1VJOA 3FDBA 2J58A 1HVVA 3KKIA 4DBCA 1LTBC 2V0YA 3EUCA 3ZRPA 3MUDA 1W7NA 4A0FA 1KL2A 2NPSB 3HE4A 1KQLA 4ZM4A 2OQXA 4CXRA 3UAKA 1AICA 2WB6A 3LG0A 1S9KE 1SQBK 5FT6A 1CL2A 2VIAA 3CBFA 1N86A 2OKKA 2YKUA 1OHWA 4J8LA 1G2CA 3V4QA 2EH6A 3VK2A 4RESB 1N7SB 1AKAA 2GMUA 5I92A 3BWOA 3T97A 1AKCA 3DZZA 1GK6A 2W7IA 1FU1A 1A02J 2W7EA 2HUUA 3VP9A 4Y99B 2VGWA 3OP7A 1WSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1L A;  1WT6 A;  3VP8 A;  3U59 A;  3N7N A;  4GIF A;  4ZKU A;  3HRN A;  3N4R A;  5BVZ A;  2POH A;  2FXM A;  3C9I A;  3P8C D;  4N78 D;  5BU5 A;  4N3Y B;  3BAS A;  2JEE A;  3VP9 A;  3BAT A;  1X79 B;  3N4X A;  3N4S A;  3OJA B;  3U1A A;  4O9B A;  5KTB A;  1IC2 A;  4ZKP A;  5BU8 B;  1NKN A;  3U1C A; 
#chains in the Genus database with same CATH topology
 4F5H A;  3CCL P;  4F4E A;  3TGU J;  2G3A A;  4O6Z A;  3TCM A;  3ZZJ A;  1T3J A;  3GLM A;  5C6U A;  2DKJ A;  3TFT A;  3OA7 A;  2X5D A;  1QGN A;  3P6K A;  3RBF A;  3GSB A;  2E5T A;  2VMS A;  3RK3 C;  5M4B A;  1SPA A;  1C7O A;  3DRD A;  1EQ7 A;  3GJU A;  4O9B A;  2IBZ E;  3RI6 A;  1NTK E;  1XTG B;  1PGQ A;  1AV1 A;  2FY8 A;  1QIT A;  5GTI E;  2CH2 A;  3ATH A;  1D7R A;  3RCH B;  3GF7 A;  1LC8 A;  1DGE A;  1ZME C;  3CXH D;  1EQB A;  3LW5 H;  5DJ1 A;  3AEN B;  4A6R A;  1CI6 B;  4N78 D;  3H1L J;  1RQV A;  2B9B A;  1BQA A;  2HP2 A;  3P32 A;  2M3E A;  3D71 A;  3G8M A;  3Q5S A;  1MDO A;  1JB0 J;  1EZV E;  4OBU A;  2A06 D;  1ZRT E;  1FAV A;  1X2A A;  1IBJ A;  3WUV A;  1QGK B;  1N8P A;  1NTM E;  4C7R A;  2BIG A;  2EZ2 A;  3W1I A;  1KIL B;  3A9Y A;  2O3J A;  2JJE A;  1SQB J;  4ASW A;  1ASA A;  1NVO A;  2FYU K;  1ASD A;  2K9Y A;  3G4S P;  3BCC E;  3FVS A;  1HTL C;  4WP0 A;  1SZK A;  3H1H G;  2DR1 A;  1OHY A;  3EZ1 A;  2BIE A;  1WKG A;  3JSV C;  3AEG C;  3ZDM A;  1SQQ D;  4CPG A;  1WYU A;  4LW4 A;  4PJ0 H;  3VK3 A;  3II6 A;  1QEX A;  3WUT A;  1FZA A;  3BC8 A;  1LT9 C;  1AJR A;  3DU4 A;  1YJZ A;  1BGY D;  5CBN A;  1JY3 N;  5G09 A;  3L70 D;  1L0L D;  3I5T A;  3EZS A;  2BI5 A;  1KYO H;  2W7D A;  1JM0 A;  1KZU B;  2ZC0 A;  1GL2 A;  3MAF A;  1BE3 J;  4F5F A;  3MUD C;  4OT8 A;  1W7L A;  3H25 A;  1M0N A;  2O1B A;  4F5L A;  1FG7 A;  4TN4 A;  2ZYA A;  2JO1 A;  1PFI A;  2YIU B;  1BSH A;  3WGB A;  1KOR A;  4UB8 E;  5CBO A;  3TGU D;  1B4X A;  2O1J A;  3QH9 A;  4WXG A;  5EFW B;  1UU1 A;  5AW8 B;  3PHL A;  1AX4 A;  2YO2 A;  5F9S A;  1LTS C;  3OJA B;  5AVQ B;  1L0N D;  3K40 A;  4K2B A;  3V2R A;  2PB2 A;  1JY3 O;  2UWJ E;  3KE3 A;  3EIB A;  2K1A A;  3IHJ A;  3V5B A;  1L0L G;  1CSB A;  1NU1 K;  4IXZ A;  1GL2 D;  1YTZ I;  4K2M A;  2OTK E;  2HR3 A;  2CPB A;  3B5N A;  2VI8 A;  4CVQ A;  3PA9 A;  3E2Y A;  1IFM A;  3M0D A;  4BWN A;  3RK2 C;  3H1H E;  4GDY A;  3FTB A;  2LKM A;  5AVS B;  1WYV B;  1KQG B;  2RH0 A;  2VGS A;  2CJG A;  1IK7 A;  3H1L D;  3E7K A;  2OTJ P;  1PIX A;  2W6J H;  3HD7 B;  4MQR A;  1N7L A;  2A06 E;  4GIF A;  2CB1 A;  4PD4 D;  4WY4 A;  2AXT E;  5APX A;  3M9B A;  1HF9 A;  1E5W A;  4U1T A;  3MHV A;  2B88 A;  3AE5 C;  3G71 P;  2R5B A;  1NWQ A;  3AOV A;  2KK7 A;  4UB6 H;  2FYU J;  1SFC A;  1NYH A;  2WK8 A;  1K04 A;  1SQX K;  4ITX A;  4D6T J;  1FDO A;  2R5C A;  4H13 D;  3FKD A;  4WLJ A;  1JY2 P;  2W83 C;  5KAI E;  2HOY A;  3TNU A;  3R4T A;  3JZL A;  3FZ8 A;  4WB4 A;  2D61 A;  2Y0E A;  1YIT P;  3CPW O;  2ZT9 B;  1TPL A;  4WY4 D;  2JG2 A;  2ZY5 A;  1BGY E;  5CJ0 A;  1NKN A;  3WCN A;  1L0L E;  2G6W A;  4PV1 D;  1S5L X;  1SFC D;  3H32 A;  5AVU B;  3DR4 A;  2QB3 A;  1PMO A;  2Z1Z A;  3RK3 B;  3EI7 A;  1BE3 D;  1SQB G;  1M0Q A;  2M3B A;  3HVY A;  3RL0 D;  3QN6 A;  3RBL A;  1PGJ A;  3TGU E;  1MLZ A;  4U7J A;  3N4X A;  4KXK A;  2KLV A;  4UOY A;  2L5G B;  1JS6 A;  2BEZ F;  1RVU A;  2BAS A;  1LT1 A;  4KT0 J;  3HUS A;  5FT4 A;  1FDI A;  2OAT A;  2VIB A;  2AEV A;  1BQD A;  2KFP A;  2VI9 A;  1S5L H;  3PTZ A;  2ZYJ A;  3NYU A;  1NU1 J;  2D66 A;  3QHX A;  2Z9V A;  2PGD A;  2R5D A;  4GRX A;  3HTK A;  2Y9Y A;  1LP1 A;  1GC2 A;  4R4L A;  1BJO B;  1XTC C;  2NMP A;  1SQP K;  3GR9 A;  5BU8 B;  1BCC G;  3RUY A;  2VGU A;  2XH1 A;  2CH1 A;  2Q7W A;  4MQQ A;  3EFF K;  3H1L E;  3TFU A;  2AEM A;  3CCQ P;  2AY7 A;  3V2N A;  3ZRQ A;  4A72 A;  3N4R A;  3ZZK A;  2EZ1 A;  3NFQ A;  3P1T A;  4LGD E;  1GEW A;  5B66 E;  3NRA A;  3L72 J;  2W6A A;  2WKA A;  1H89 A;  3AEE C;  3B1C A;  3NX3 A;  4JEX A;  2VMZ A;  1O61 A;  4ZAS A;  2XV5 A;  1SQX J;  1S2E A;  2FYU D;  2E75 D;  1LT9 B;  1SQB E;  2W90 A;  2ZAE B;  5DJU B;  1N31 A;  3ACZ A;  5G0A A;  1IFP A;  1GEY A;  1CQ8 A;  5FT5 A;  2LR2 A;  1QX8 A;  5DB5 A;  4LC3 A;  3B5N C;  3C1L A;  1FZC A;  1P84 I;  2VGV A;  1E79 H;  1JEK A;  1N73 A;  9AAT A;  1C0N A;  1AY4 A;  5H2F E;  5B5E H;  1AKB A;  4R4M A;  2OYH C;  4IX8 A;  5FT8 A;  4CBS A;  2HPC B;  1QLE D;  1GDT A;  4W7Z A;  2ZSL A;  3VMY A;  4OCA A;  3KGX A;  3MTU E;  2VMQ A;  1X9V A;  2FYU G;  1BE3 E;  1E5F A;  5EIG A;  3DYD A;  3G3Z A;  2WMM A;  3NXS A;  4JEV A;  4MKJ A;  1SFC C;  1OW6 A;  3HE5 B;  1KYO D;  1DTY A;  4D6T G;  4Z1M H;  2D7Y A;  1KKJ A;  3W1J A;  4RKU J;  4MN4 C;  2BI9 A;  1PP9 D;  1S4X A;  2FFD A;  1AVO A;  1Q86 Q;  4KYO A;  3JWA A;  3MC6 A;  4WB0 B;  3RK2 B;  2R2N A;  2VLF A;  3COG A;  3CQ6 A;  4LLH A;  3AEL A;  2C0R A;  1MV8 A;  5KJ7 A;  1NU1 D;  3GMA A;  1SQP J;  1JTH A;  3FGA D;  4L74 A;  3OW2 O;  1BSN A;  3AEO A;  1D7S A;  3Q2Y A;  2ZSM A;  3CX5 H;  5C39 A;  5EUD A;  3GHG B;  3WMM 0;  2CY8 A;  3AE2 C;  1S1C X;  2C44 A;  2M5A B;  2OYO A;  3CX5 I;  4PFF A;  4RJ0 A;  3EI8 A;  3AE7 C;  2KS1 B;  3MIW A;  2ZJS E;  3FRK A;  3R9A A;  1S72 P;  3A9Z A;  1AA0 A;  1YNU A;  4WYE A;  2VLH A;  1U08 A;  2WSF H;  1CJ0 A;  2AY2 A;  2O1K A;  3L72 D;  1PGO A;  1J2J B;  1I43 A;  2H88 C;  1R5S A;  4C7N B;  2ZYD A;  4H0L D;  1TOI A;  3NNK A;  4F5J A;  1S9K D;  5KJ7 D;  1LTA C;  4L75 A;  1NU1 G;  1SVV A;  2FYU E;  1FC4 A;  1T8Z A;  4WD2 A;  2EYQ A;  1SQX D;  2Z1Y A;  1K73 Q;  1G4V A;  3VYI A;  3BV0 A;  2JEE A;  1O69 A;  4D6T E;  1X79 B;  3LVJ A;  2OKJ A;  1LJ2 A;  1KTM A;  3EI9 A;  1SF2 A;  1YJ9 P;  1S09 A;  2X5F A;  3SFD C;  1W3U A;  1KIL E;  2HOR A;  1H88 A;  1TAT A;  3AEB C;  1FZF A;  2N1T C;  1YJS A;  3H1J G;  2IFN A;  1BKG A;  1G1J A;  2QVA A;  1OWA A;  4XE5 B;  1DD4 A;  5CCG A;  1H1C A;  4KAM A;  1GC0 A;  2BEQ D;  3S9O A;  2JWA A;  3BVH A;  4AOA A;  2GB3 A;  1VF5 C;  1SQX G;  1NAF A;  2P58 A;  1YIZ A;  1KYO E;  3WX9 A;  3W68 A;  4Q75 A;  3QM2 A;  2R32 A;  2XZR A;  2OYI A;  3MGN A;  2WSE H;  2DKB A;  4HKZ H;  2BI3 A;  3ZRR A;  2Q6Q A;  2HFE D;  1NTK D;  3G9R A;  3ISL A;  1UU0 A;  1T3I A;  2EGY A;  1FZC C;  4XEW A;  1V72 A;  5KTB A;  2WSC H;  1SP4 A;  3MAF B;  1RE3 A;  2BWO A;  2VMX A;  1W7M A;  3A8U X;  1N73 C;  1NU1 E;  3FVU A;  4UHM A;  2HOX A;  5AX8 A;  2ZXE B;  3SWY A;  4I7Z C;  1JOC A;  3VMX A;  1KC8 Q;  1DH3 A;  3NYT A;  4WYG A;  3HQT A;  1ZC9 A;  2W7J A;  1JCD A;  2HOZ A;  1YIJ P;  4I8A A;  1FZG A;  4CXQ A;  1VDF A;  3NDN A;  1DJU A;  4ZWM A;  1ZXG A;  3L71 G;  3NYS A;  1NTM D;  2CFB A;  4Y0H A;  1VQ5 P;  3K28 A;  1BJW A;  5APS A;  2ZVO B;  3F9T A;  2RMZ A;  2R5E A;  3L72 E;  5AW6 B;  1L4A A;  2YOB A;  1LWU A;  2E76 D;  1OXZ A;  3UIA A;  3B5N B;  3M9Q A;  4ZAH A;  3MC6 C;  2Q1K A;  1B9H A;  3UE8 A;  4AYC A;  2WSF J;  1MLY A;  1ZOY C;  1KB9 H;  2O01 H;  1SQX E;  2IZ0 A;  4UHO A;  3JCU E;  1SQP G;  2E74 C;  2CST A;  4OTL A;  3O8Z A;  2WPR A;  5KJ7 C;  2OYH B;  1M0O A;  4N0W A;  3T32 A;  4UB6 E;  3HL2 A;  1KB9 I;  2C9N Y;  3ABV C;  1EXJ A;  3CQ5 A;  1ZOB A;  5CCH C;  3E2Z B;  1VQL P;  3CQ4 A;  3HT4 A;  4MSO A;  1YQ3 C;  1DIP A;  1MAP A;  1OAT A;  2W8V A;  1Z3Z A;  1B5O A;  1L4A D;  3LVM A;  1GZL A;  4M3L A;  2A1V A;  1TOJ A;  1GTW A;  1AMS A;  1AJS B;  4NOG A;  1KN7 A;  3ITK A;  1JG8 A;  5KAF H;  2JR8 A;  4IXS A;  2DW3 A;  1OMI A;  1YQ4 C;  1S0A A;  3AE3 C;  1ZOD A;  3VOP A;  3TNU B;  5KLI B;  2IDB A;  1RE4 A;  3DC1 A;  2BHX A;  2GQN A;  2YMY A;  3Q5P A;  4RO0 A;  1LTJ A;  1URQ C;  2JJL A;  4RJT A;  3BCB A;  2W8T A;  1YHQ P;  3B1E A;  4H44 B;  4JF7 A;  2FKI A;  5AW0 B;  4W1X A;  4BHD A;  1MUU A;  4KJM A;  2EPJ A;  3PRJ A;  3N7N A;  2WSE J;  2ZY4 A;  2CK3 H;  3WCO A;  4XJM A;  1AIB A;  5J8Q A;  3CLQ A;  5AVV B;  3H1H D;  1OIP A;  3CCR P;  3CCV P;  2WT7 A;  3MAU A;  1SQP E;  2WSC J;  1S5L E;  3AEP A;  4E1O A;  5CCG C;  1WRG A;  1SQV K;  3CMA P;  4IFD K;  3PJ0 A;  3PGY A;  3CD6 P;  2GUS A;  2P1J A;  4Y28 J;  1QJ3 A;  1J1D C;  1YTZ T;  4OH8 B;  1IJD B;  4BRY B;  1ECX A;  3FQ8 A;  1KMI Z;  3S1K A;  8AAT A;  2LXC B;  4F5K A;  2JJF A;  2BI1 A;  1H0T A;  3L75 J;  1NAY A;  4ZDL A;  4JF0 A;  3KHU A;  1HBW A;  3HTK B;  2WIT A;  1JO5 A;  2YCP A;  4TT3 H;  4EOT A;  2HZP A;  1RF1 A;  3K7Y A;  5G4J A;  4DZO A;  1NGM B;  1UKJ A;  1N2T A;  2BYJ A;  2VMW A;  4HH2 A;  1EDJ A;  3E1R A;  2W7F A;  1W5C E;  2FN6 A;  2N1T B;  1MDX A;  3L73 J;  3VMZ A;  2V7Q J;  1AHF A;  3JC2 2;  2KI7 B;  3H9X A;  2KNC A;  1G7X A;  3UWC A;  2C0W A;  2O01 J;  1KL1 A;  1VQ4 P;  5DJT B;  1IO4 A;  1MGV A;  5APV A;  3D70 A;  2VMY A;  2QJK C;  1MFZ A;  3W67 A;  3NUI A;  2D64 A;  1LTG C;  1VF5 B;  1GW4 A;  2PFX A;  1M1J B;  3FX0 A;  3DOD A;  1BCC J;  2Q9I A;  3FVX A;  2W7G A;  4XJO A;  4WLH A;  1H0C A;  5B5E E;  4ADE A;  1NOH A;  1BDC A;  3VOM A;  1L4A C;  3A9X A;  4DQ6 A;  5IWQ A;  4K3A A;  1GW3 A;  2DGL A;  5TIS H;  2VMU A;  2KB7 P;  1M0P A;  1N73 B;  3Q5R A;  1C4K A;  4RKD A;  2VMT A;  4IYO A;  4C46 A;  3PDB A;  4R5F A;  3PH0 A;  4MQP A;  3M06 A;  3QWO C;  1AHX A;  5E4Z A;  4GEB A;  4OWF A;  4ADC A;  4IL6 X;  2AY4 A;  4A6T A;  2I8D A;  1EJI A;  2DGK A;  3L74 J;  3Q3D A;  3CME P;  3B1D A;  2N9Y B;  1QZ9 A;  1DGD A;  3M0A A;  2EO5 A;  5EIG B;  1C9C A;  3BCA A;  3RGU A;  2D2C D;  4IY7 A;  4ATQ A;  1QJ5 A;  3E1I A;  2G7J A;  5EUN A;  1SQV J;  3H1K J;  3I5C A;  3FQA A;  4LNM A;  1JCC A;  3LW5 J;  4R8D A;  1L2P A;  4M2J A;  4F5M A;  1LTT C;  3QGU A;  1ASG A;  3KZI H;  1HJB A;  1JY2 N;  1M4N A;  3AEA C;  3AEC C;  4NPE A;  4IL6 H;  1TAS A;  1LW4 A;  1NJI Q;  3CCJ P;  3VN0 A;  1XEY A;  4ADD A;  2E74 B;  3S4R A;  1M56 D;  1HJ0 A;  3CCU P;  1RH5 B;  1LTJ C;  3HMU A;  1EDL A;  1NKZ B;  3WU2 H;  1VQ8 P;  1SQB D;  1IFJ A;  1N7S A;  1YJW P;  5AW7 B;  1CS1 A;  4W5K A;  1YJN P;  2GMS A;  1C7G A;  2CAN A;  2AEF A;  3K5B A;  4Y0D A;  3LIE A;  1FBM A;  3EQ2 A;  2NPS D;  2BIA A;  1WYT B;  1GU5 A;  2IZ1 A;  2D5Y A;  4MKK A;  2RN0 A;  3L73 D;  3F5H A;  4AZK A;  1ZW0 A;  5E3K A;  4EIJ A;  1PMM A;  1DEE G;  2XU6 A;  5GTH H;  4PFN A;  1JY2 O;  1DJE A;  1CZE A;  3PD6 B;  5EUE A;  1B5P A;  3FSL A;  1EDK A;  3JWB A;  2W6B A;  3CL3 D;  3N0L A;  1JS3 A;  2A45 H;  3CCM P;  3A0H E;  3G7Q A;  2WPS A;  1FOS E;  5CHX A;  2JIS A;  3L75 G;  1HGV A;  1N7S D;  2AAT A;  2FNU A;  2A45 I;  1URQ B;  1BCC D;  5AW5 B;  1ASM A;  2AEU A;  1AMA A;  1X22 A;  4ZSW A;  4PIW A;  4ZMD A;  4OGQ D;  1NHL A;  1RF1 C;  1VQM P;  3HBX A;  4DJG A;  3L73 G;  2QJP C;  3II0 A;  3RCH A;  1BW0 A;  1TOE A;  4ZSY A;  4ZWV A;  4W1W A;  1KFN A;  2JJH A;  3AEN A;  1YJY A;  1AMQ A;  1VPC A;  1CI6 A;  4LNL A;  2Z9X A;  4N3Y B;  2OGA A;  2BI2 A;  1SS1 A;  1ZV8 A;  4XJP A;  4RM1 A;  2PB0 A;  1R8E A;  3CC4 P;  2IBZ I;  5L8R J;  5E79 E;  4ISY A;  2AY8 A;  1D2F A;  5APQ A;  1IAX A;  3JTX A;  3FD0 A;  2N9B A;  2ZYG A;  1GU4 A;  1GL2 C;  2AY3 A;  1TOG A;  2H7H A;  1KIL A;  1SQV D;  2FXM A;  3H1K D;  3LVL B;  2HOD B;  3H1J J;  1J1E C;  4GOF A;  1KFM A;  1M7L A;  1FE6 A;  1PGP A;  2XKM A;  1YBK A;  1EZV I;  3RBZ A;  3VP6 A;  3EFG A;  4JF1 A;  1AQT A;  2WK9 A;  3PJS K;  2OQQ A;  2W8Z A;  1NH4 A;  1R5L A;  3L75 E;  2VMR A;  5AW3 B;  1W23 A;  3RQ1 A;  4E3Q A;  1P84 H;  3I55 P;  1FZE A;  1JUN A;  1D7U A;  3H1I G;  1GMJ A;  2D7Z A;  2GUV A;  3L74 G;  4D6T D;  2QJK B;  1FG3 A;  4XQ2 A;  3M5U A;  1JMM A;  1USD A;  1KIL D;  3M0D C;  1CW5 A;  3AAT A;  3L73 E;  4DCK A;  1SQV G;  3H1K G;  3GWP A;  4TLF A;  1Q7Y Q;  1XI9 A;  4H13 C;  2B87 B;  1KB9 E;  4A7P A;  3HE4 B;  1GDE A;  3AEM A;  3A5T A;  3AE1 C;  4IXO A;  2XNX A;  4AO4 A;  2Q3I A;  4WY4 C;  3E2F A;  3QPG A;  1NTZ K;  3CWB J;  3KXD A;  4IW7 A;  1BCC E;  1G2C B;  4WYD A;  4PV1 C;  3FZ7 A;  3PLN A;  2M8R A;  2JWD A;  2D65 A;  1ARH A;  3FDD A;  1X28 A;  2O01 N;  3RL0 g;  3L71 J;  1N7S C;  3GZD A;  2HYN A;  3T97 B;  1KMJ A;  3O6Q B;  1GBN A;  1WMK A;  3CAI A;  2VMN A;  2M0B A;  3RL0 C;  4F5G A;  3SSU A;  2BCC J;  3USS A;  4OGQ C;  1WYV A;  1ELU A;  3L35 A;  2Z4E A;  5DX5 A;  1ORD A;  2GA1 A;  1QL2 A;  4AUW A;  2QA3 A;  3CI9 A;  3HD7 A;  4RIT A;  1YOO A;  1VQO P;  1M6S A;  1LC7 A;  4EB7 A;  1RF0 A;  3CXH H;  1TAR A;  3AE6 C;  1YIY A;  3L74 E;  2W7M A;  4R2N A;  3RBX A;  2TPL A;  1AVY A;  2YKV A;  4JEW A;  1Y8A A;  3I4J A;  2P7J A;  2O0R A;  3CXH I;  2Z9W A;  1M57 D;  1SQV E;  3H1K E;  1S06 A;  5JAY A;  2R3C A;  2R0T A;  3BAT A;  1Q82 Q;  4FL0 A;  3IFM A;  3VMA A;  2AXT H;  3H1J D;  2K3R A;  1GD9 A;  2CIN A;  4B98 A;  5CJ4 A;  2FBW C;  2KSE A;  3FCR A;  2YHK A;  1PG8 A;  3HUS C;  2CTZ A;  1LC5 A;  1GD2 E;  3HRN A;  3HD7 D;  3NU8 A;  3WKR A;  5AW2 B;  2W7L A;  4U3F J;  1T2K D;  3FQ7 A;  3V4W A;  1OVR A;  3MZW B;  3PDX A;  1KQS O;  3ELP A;  1CZC A;  5KAI H;  1TOK A;  2KUB A;  3KPE A;  3M91 A;  2E75 C;  2FYN C;  2YKX A;  4E77 A;  2HUI A;  1FOS F;  4RJY A;  3C9I A;  5APT A;  1SQQ K;  1KIL C;  5K8B A;  1AHG A;  4PJ0 E;  1N8R Q;  1OVV A;  2VMP A;  1NTZ J;  3PIU A;  3D6Z A;  2QJP B;  3H6P A;  2ZT9 D;  4YXW H;  3CWB D;  3NU7 A;  1S3J A;  1WYU B;  1Q2N A;  2PO3 A;  4Q76 A;  1KV4 A;  2ZY2 A;  1V2F A;  1DX7 A;  4BQ0 A;  2P67 A;  2OTL P;  1JMB A;  2ZXX A;  2VYC A;  3L71 D;  1FDM A;  4WYA A;  1S07 A;  3I56 P;  2FYF A;  1BJO A;  3RK3 D;  4H63 Q;  3A7O A;  3N4S A;  1Q90 D;  2WWW A;  3CCE P;  4TMR A;  1M7Y A;  2BCC D;  3IF4 A;  1GL2 B;  1USE A;  2YKP A;  4GOD A;  3VP8 A;  2AEJ A;  2YKQ A;  1L0N K;  2VRS A;  2CJD A;  3C8V A;  2BYL A;  1J1E B;  1SQP D;  1DEB A;  1ASB A;  2ZY3 A;  3CWB G;  2V1P A;  2XDJ A;  2A45 G;  5KKZ C;  2V4H A;  4EB5 A;  2F8J A;  2HG5 D;  3DXW A;  2FM1 A;  4PD4 H;  5B66 H;  1LT9 A;  3H1J E;  2ZP7 A;  5KLV K;  1PFF A;  5F8V A;  4W8I A;  3L37 A;  2LXB A;  1ARS A;  2FFD C;  2BCC G;  1BJN A;  3P8M C;  4PD4 I;  2CJH A;  2Z61 A;  1D7V A;  5M4D A;  2IPP A;  3KZI E;  1LGH B;  1VQK P;  2IYP A;  2JKV A;  2VGT A;  2K9J A;  4H13 B;  4U3F D;  4IL6 E;  3Q8N A;  3EIA A;  3CCS P;  1QL1 A;  4WYC A;  2QSR A;  2Z5H A;  4H0L C;  4GE7 A;  2YKY A;  3V6I A;  4WXB A;  4LW2 A;  2YCN A;  3HD7 C;  2I1K A;  4GDO A;  2C9L Y;  2FXO A;  1AHE A;  4L0O A;  1T2K C;  2HPC A;  3EI6 A;  1HUC A;  1RF0 C;  3WU2 E;  1KMK A;  4WY4 B;  4QGR A;  1P84 D;  2FKW B;  4CBR A;  2JP3 A;  3LY1 A;  3GW6 A;  1HGZ A;  1KQF B;  5H2F H;  2K37 A;  2KZI A;  1SZU A;  1SQQ J;  3R4Y A;  3P8C E;  4GSA A;  1LS3 A;  2C81 A;  4U2H A;  4PV1 B;  4JEY A;  3VAX A;  1BDD A;  1SFC B;  1RV3 A;  4WBT A;  3HE5 A;  1IC2 A;  4IOI H;  2ZFC A;  4ATP A;  2Q7C A;  2YCT A;  2Z20 A;  1PPJ G;  2OGE A;  5GTH E;  5AVZ B;  1TU3 F;  2J5U A;  4ADB A;  4OC9 A;  2R5C B;  1NTZ D;  3NTN A;  3L70 J;  3RL0 B;  1CZQ A;  4WB0 A;  1VQ6 P;  3CWB E;  4U3F G;  3FXD A;  2FYZ A;  2ZJG A;  3BB8 A;  5TF5 A;  3L71 E;  5TJH A;  3FWL A;  3BCC G;  3RK3 E;  1SFF A;  1E5E A;  1O62 A;  3GHG A;  2QEX P;  2AY5 A;  2BWN A;  3N75 A;  2BCC E;  2W8W A;  5AVT B;  3H32 B;  1CQ7 A;  4RLG A;  4M2K A;  2M5A A;  1L0N J;  4B9B A;  5EQC A;  3M9H A;  1B8G A;  1ASL A;  4EI2 A;  2X3L A;  3A0B H;  2KS1 A;  1NTZ G;  3RK2 D;  3IR9 A;  1IAY A;  1U7M A;  1AY8 A;  5G2Q A;  3KYQ A;  3HUS B;  3F0H A;  4C7N A;  4ASV A;  3P7K A;  3CX5 D;  3PP5 A;  4XJL A;  4P3M A;  1FC2 C;  5KLV J;  2HP1 A;  3GET A;  1C7N A;  3B8X A;  4K05 A;  4P7Y A;  2KSJ A;  3BS8 A;  2QM7 A;  2E7U A;  1IFN A;  2H8P D;  1LP1 B;  1W2E A;  2OYI C;  1PPJ E;  1AFO A;  1QIS A;  2E75 B;  1RQU A;  1KD1 Q;  4K35 A;  2P10 A;  3ASA A;  1IX8 A;  2FYN B;  2QE7 H;  2KXP B;  3ECD A;  3WZF A;  5D5S A;  3B46 A;  1MKM A;  2QJY C;  1VQ9 P;  1UU2 A;  4U3F E;  4RKC A;  2E76 C;  1RE3 C;  3L36 A;  4AZJ A;  2GSA A;  1VEF A;  3L4F A;  3ELE A;  1IFI A;  2WTY A;  4NPF X;  4XK1 A;  2KIK A;  3L44 A;  3NTJ A;  2E54 A;  1P84 E;  1ZR4 A;  2YKO A;  1GCK A;  2E42 A;  3U1A A;  3SFE C;  3GG2 A;  1M1K Q;  5AW9 B;  1I41 A;  4FFC A;  4GE4 A;  2B89 A;  2DGM A;  3U59 A;  5BJ4 A;  1B9I A;  2G8Y A;  3MEB A;  1JNM A;  1DKA A;  1FZB A;  1DD3 A;  5AVW B;  1OVU A;  3CC2 P;  1CQ6 A;  2A06 G;  5G2P A;  3EI5 A;  4K2I A;  4KHX A;  1NTZ E;  5BU5 A;  2AY6 A;  4QMA A;  1LWU C;  1ZP0 C;  1FZC B;  3E9K A;  4DGT A;  1U7J A;  4UHN A;  1IFD A;  1IJI A;  4F5I A;  1G4X A;  2WPQ A;  3L8A A;  5EAV A;  4OMA A;  3VK4 A;  1KKP A;  4I7Z B;  1KYO I;  3GF3 A;  3G0T A;  1RHZ B;  5APY A;  4UQV A;  1V2E A;  3FFR A;  7AAT A;  3VTP C;  3QBO A;  1MDZ A;  3ASB A;  4GE9 A;  3H1I J;  1JY3 P;  1LTI C;  1V2D A;  1SQQ G;  5KKZ B;  4E3R A;  3NUB A;  1QVG O;  4LNJ A;  2QM8 A;  2O7C A;  2P2U A;  3W1H A;  3IAO A;  4AQR D;  2IX7 C;  1N2D C;  1VQ7 P;  1U57 A;  1BGY G;  2NPS A;  1SVF A;  1G7W A;  2J59 M;  3LWS A;  2E5Y A;  4WVZ A;  4YPC A;  1MAQ A;  2OAR A;  3L70 G;  1ASF A;  2FFD B;  3NMD A;  5AVX B;  1OXO A;  2QBT A;  2WSS H;  3OKS A;  3CX5 E;  1DJ9 A;  1LW5 A;  3AEJ A;  5D95 A;  2D63 A;  3CXH E;  3EWK A;  1X29 A;  1RE4 C;  4OBV A;  1ASC A;  4AH3 A;  4ZNC A;  4N78 E;  2K88 A;  5KLV D;  3HLM A;  5K5G B;  4H0L B;  2VMO A;  1LK9 A;  3L75 D;  3TGU G;  4ZKP A;  4Q31 A;  1JTH B;  1FS0 E;  2OYH A;  3E2Z A;  1Y47 A;  2FQ6 A;  3GHG C;  1L0N G;  3BCX A;  3B71 A;  3KQG A;  2VGZ A;  3JCU H;  2MJZ A;  2Y9Z A;  1X8Y A;  2WQY C;  3AE9 C;  4NPD A;  2JDI H;  2QSI A;  1OZH A;  2Q3E A;  3AOW A;  1OHV A;  1ARG A;  4EYY Q;  1AJS A;  3B5N D;  2KP8 A;  1KB9 D;  1WKH A;  5AW1 B;  3U1C A;  3G6E P;  1EXI A;  1IUG A;  2IFM A;  5AVR B;  1K9M Q;  4EFF A;  4HVK A;  4HYT B;  1DFO A;  5KLV G;  1SQQ E;  2FXP A;  2KYV A;  3H1L G;  4GOE A;  1YYC A;  2YRR A;  2WZ7 A;  4HJG H;  1ASE A;  1GC4 A;  3I16 A;  1IZN B;  3TYY A;  3TQX A;  3L70 E;  2XND H;  3DR7 A;  3DXV A;  3D6Y A;  1H8A A;  4J5U A;  3GBX A;  1WT6 A;  1EC5 A;  2HLO A;  1FJP A;  4L73 A;  2NRG A;  4W7Y A;  2W7K A;  1UII A;  4ITG A;  1GK4 A;  1VQP P;  3BWN A;  3WGC A;  1ART A;  3MD0 A;  3BAS A;  1LKC A;  5GTI H;  1PP9 J;  1J04 A;  4A6U A;  2X8U A;  4XAU A;  4A0R A;  3H1I D;  4PVF A;  2JJG A;  2WPV B;  5AVY B;  4Y0I A;  1J1D B;  1L0N E;  1BJ4 A;  3L74 D;  1BS0 A;  1P3W A;  3OAK A;  1NTK K;  4BRY A;  1G1I A;  2PRR A;  4GKG A;  1K8A Q;  3IN6 A;  5M1B A;  2GM4 A;  4H44 D;  2AY1 A;  3BN1 A;  5BJ3 A;  4DOJ A;  4JYB A;  5APW A;  4HB1 A;  2OYI B;  2D2C C;  4WXF A;  2E7I A;  1M8O B;  4BA4 A;  1VP4 A;  5HDM A;  2QJY B;  1BE3 G;  1Z56 A;  2I1J A;  2FNI A;  2YXR B;  2E76 B;  3E6G A;  5KLV E;  1JF9 A;  2N1T A;  2W8J A;  1AY5 A;  4A0H A;  2KOG A;  2IYO A;  4ZDP A;  3V2Q A;  3AE8 C;  4XFJ A;  1CL1 A;  1NTM K;  4PD4 E;  1QIR A;  3WKS A;  3TAT A;  4A00 A;  3KDP B;  2SPZ A;  3PPL A;  4W80 A;  2AXC A;  3MBB A;  2W8U A;  3SWF A;  1IVR A;  1M1J A;  2Z5I A;  1K05 A;  4JQ0 D;  5EFS A;  2RFV A;  1ARI A;  3BRV B;  1SLQ A;  1W2B O;  2QLR A;  5HHY A;  4Q6R A;  2NPS C;  1L4A B;  2KLU A;  1LWU B;  4DT0 A;  5BVZ A;  2H89 C;  2N1T D;  3MKJ A;  3USF A;  2Y0D A;  4I6M C;  3AEJ C;  1PZQ A;  1RY3 A;  4W1V A;  2WVR A;  3PAA A;  2K9J B;  1GC3 A;  2QA4 P;  3B4S A;  4UB8 H;  1HH0 A;  4B86 A;  1I48 A;  2BKW A;  3LV2 A;  3Q1M A;  3GZC A;  1VF5 D;  4WWI A;  1QVF O;  2YO3 A;  1T6A A;  2JGT A;  1J32 A;  1O4S A;  2POH A;  3N5M A;  5KAF E;  4LC1 A;  1BT4 A;  4BA5 A;  1EG5 A;  3FZ6 A;  1AAM A;  2OGU A;  2L91 A;  4BXL A;  1ZR2 A;  3H7F A;  4EDF A;  2C7T A;  3LID A;  2W7H A;  4Y99 C;  4I1L A;  2XBN A;  2DOU A;  2CPS A;  4L76 A;  3V2P A;  3H1I E;  2RKL A;  1D7M A;  3A3Y B;  1GEX A;  1NTK J;  2PAJ A;  3CC7 P;  2HUF A;  4I2L C;  3QI6 A;  1Y9B A;  2QRX A;  1IX7 A;  5KLI C;  1RV4 A;  1VL2 A;  2AY9 A;  1LTJ B;  1HWT C;  1T3U A;  3FFH A;  2WK7 A;  1AAW A;  1ZLL A;  4OYT A;  1X0T A;  5CCH A;  4EU1 A;  5E5I A;  3TDK A;  1Y4I A;  3A0B E;  4XA4 A;  3LVK A;  3TSI A;  4H44 C;  3FXE A;  4BMK A;  5G4I A;  3MP7 B;  2QB2 A;  2ORD A;  1OXP A;  3A2B A;  1WYT A;  2C0X A;  2WT7 B;  3AE4 C;  4YXD C;  1S08 A;  1NTM J;  2QMA A;  3BWN C;  1OW8 A;  1AJY A;  1PP9 G;  3F6T A;  2YNY A;  3PD6 A;  1Z7D A;  4GT1 A;  5APU A;  1AMR A;  4WBA A;  1ZN5 A;  2E74 D;  1Q81 Q;  3FWN A;  3BCC J;  2MKV A;  3HDO A;  4IFM A;  3AV7 A;  1AQ5 A;  2PP6 A;  2QIW A;  1FJK A;  3B8E B;  5CCH D;  2ZUK A;  4AO9 A;  2E7J A;  2YMK A;  3P8C D;  1H0T B;  1URQ A;  5DJ9 A;  1OX3 A;  4ZDO A;  4JEZ A;  2VMV A;  3A0H H;  4IFF A;  3TK1 A;  1AHY A;  1IX6 A;  1RF1 B;  4H51 A;  2W27 A;  1MZ9 A;  4RAE A;  5HXX A;  2E43 A;  2H43 A;  4A0G A;  4JBZ A;  3WLX A;  1KAF A;  1L0L K;  4JYC A;  1I29 A;  3TF5 A;  1A02 F;  2YRI A;  4EMY A;  2KNC B;  3L72 G;  2NZ2 A;  3AEF C;  1ELQ A;  2QG4 A;  5CMZ A;  4R5Z A;  4WYF A;  1AIA A;  2BWP A;  1SZS A;  4ZM3 A;  3A2A A;  4M2M A;  2KZJ A;  1URQ D;  4W91 A;  1X0M A;  2R44 A;  1OW7 A;  1IK9 A;  3AED C;  4OVN F;  1M32 A;  1M1J C;  5TIS E;  5AW4 B;  3D6K A;  5M49 A;  3MAD A;  3BRT B;  4HF8 A;  1PP9 E;  2HOD A;  3AEM C;  2D2C B;  2YIU C;  5E79 H;  2IBZ D;  4ZLV A;  1NO4 A;  2Q5U A;  5EAA A;  2Z9U A;  4MY5 A;  4N6J A;  3H1H J;  1RVY A;  5CCG D;  3R2P A;  4JPZ B;  4IYO B;  3JW9 A;  3PDB B;  3KGW A;  5M46 A;  1YAA A;  4YTP C;  4ZKU A;  3E77 A;  1ASN A;  3WY7 A;  3GZD C;  4RIZ A;  1EZV D;  1PPJ D;  1VJO A;  1YI2 P;  1ZRT D;  3FDB A;  2J58 A;  1HVV A;  3KKI A;  4DBC A;  1LTB C;  2V0Y A;  3EUC A;  3SWK A;  3ZRP A;  3MUD A;  1W7N A;  4A0F A;  1KL2 A;  1EDI A;  2B87 A;  2NPS B;  2ZVN B;  3HE4 A;  2IBZ G;  3WUU A;  1MFT A;  1NTK G;  1KQL A;  4ZM4 A;  2OQX A;  4CXR A;  3UAK A;  1M90 Q;  1AIC A;  2WB6 A;  3LG0 A;  1S9K E;  1SQB K;  2R3S A;  2V7Q H;  5FT6 A;  3BCC D;  1CL2 A;  2VIA A;  3CBF A;  1N86 A;  1PL5 A;  2OKK A;  2YKU A;  2ITA A;  1OHW A;  4J8L A;  1PV3 A;  1G2C A;  2YXQ B;  3V4Q A;  1UIX A;  2EH6 A;  3VK2 A;  1EZV G;  4RES B;  1N7S B;  1BGY J;  1AKA A;  2GMU A;  5I92 A;  3BWO A;  1LNQ A;  3T97 A;  1AKC A;  3O6Q A;  1L0L J;  3DZZ A;  1GK6 A;  2W7I A;  1FU1 A;  1NTM G;  4OGQ B;  1A02 J;  2W7E A;  1OFC X;  3F89 A;  2HUU A;  2Y0C A;  3VP9 A;  4Y99 B;  2VGW A;  3OP7 A;  1WST A;  2ZT9 C;  1VQN P; 
#chains in the Genus database with same CATH homology
 4F5H A;  4F4E A;  4O6Z A;  3TCM A;  3ZZJ A;  1T3J A;  5C6U A;  2DKJ A;  3TFT A;  3OA7 A;  2X5D A;  1QGN A;  3P6K A;  3RBF A;  3GSB A;  2VMS A;  3RK3 C;  5M4B A;  1SPA A;  1C7O A;  3DRD A;  1EQ7 A;  3GJU A;  4O9B A;  3RI6 A;  1XTG B;  1QIT A;  2CH2 A;  3ATH A;  1D7R A;  3RCH B;  1LC8 A;  1DGE A;  1EQB A;  3LW5 H;  5DJ1 A;  3AEN B;  4A6R A;  1CI6 B;  4N78 D;  1BQA A;  2HP2 A;  3P32 A;  3G8M A;  1MDO A;  4OBU A;  1FAV A;  1X2A A;  1IBJ A;  1N8P A;  4C7R A;  2BIG A;  2EZ2 A;  3W1I A;  1KIL B;  3A9Y A;  2JJE A;  1ASA A;  2FYU K;  1ASD A;  3FVS A;  1HTL C;  4WP0 A;  1SZK A;  2DR1 A;  1OHY A;  3EZ1 A;  2BIE A;  1WKG A;  1WYU A;  4LW4 A;  3VK3 A;  3II6 A;  1FZA A;  3BC8 A;  1LT9 C;  1AJR A;  3DU4 A;  1YJZ A;  1JY3 N;  5G09 A;  3I5T A;  3EZS A;  2BI5 A;  2W7D A;  1KZU B;  2ZC0 A;  1GL2 A;  3MAF A;  4F5F A;  4OT8 A;  1W7L A;  1M0N A;  2O1B A;  4F5L A;  1FG7 A;  4TN4 A;  1PFI A;  3WGB A;  1B4X A;  2O1J A;  4WXG A;  1UU1 A;  5AW8 B;  1AX4 A;  2YO2 A;  5F9S A;  1LTS C;  3OJA B;  5AVQ B;  3K40 A;  4K2B A;  3V2R A;  2PB2 A;  1JY3 O;  3KE3 A;  3EIB A;  3IHJ A;  3V5B A;  1CSB A;  1NU1 K;  4IXZ A;  1GL2 D;  1YTZ I;  4K2M A;  2CPB A;  3B5N A;  2VI8 A;  4CVQ A;  3PA9 A;  3E2Y A;  1IFM A;  3M0D A;  3RK2 C;  4GDY A;  3FTB A;  2LKM A;  5AVS B;  1WYV B;  2VGS A;  2CJG A;  4MQR A;  3HD7 B;  1N7L A;  4GIF A;  2CB1 A;  4WY4 A;  5APX A;  3M9B A;  1E5W A;  4U1T A;  2R5B A;  1NWQ A;  3AOV A;  1SFC A;  2WK8 A;  1SQX K;  4ITX A;  2R5C A;  3FKD A;  4WLJ A;  1JY2 P;  2HOY A;  3TNU A;  3R4T A;  3JZL A;  3FZ8 A;  4WB4 A;  2D61 A;  1TPL A;  4WY4 D;  2JG2 A;  2ZY5 A;  5CJ0 A;  1NKN A;  3WCN A;  2G6W A;  1SFC D;  3H32 A;  5AVU B;  3DR4 A;  2QB3 A;  1PMO A;  2Z1Z A;  3RK3 B;  3EI7 A;  1M0Q A;  2M3B A;  3HVY A;  3RL0 D;  3QN6 A;  3RBL A;  1MLZ A;  3N4X A;  4KXK A;  2KLV A;  4UOY A;  2L5G B;  1JS6 A;  1RVU A;  2BAS A;  3HUS A;  5FT4 A;  2OAT A;  2VIB A;  2AEV A;  1BQD A;  2KFP A;  2VI9 A;  2ZYJ A;  3NYU A;  2D66 A;  3QHX A;  2Z9V A;  2R5D A;  4GRX A;  3HTK A;  1GC2 A;  1BJO B;  1XTC C;  2NMP A;  1SQP K;  3GR9 A;  5BU8 B;  3RUY A;  2VGU A;  2XH1 A;  2CH1 A;  2Q7W A;  4MQQ A;  3TFU A;  2AY7 A;  3V2N A;  3ZRQ A;  4A72 A;  3N4R A;  3ZZK A;  2EZ1 A;  3NFQ A;  3P1T A;  4LGD E;  1GEW A;  3NRA A;  2W6A A;  2WKA A;  1H89 A;  3B1C A;  3NX3 A;  4JEX A;  2VMZ A;  1O61 A;  4ZAS A;  2XV5 A;  1LT9 B;  1N31 A;  3ACZ A;  5G0A A;  1GEY A;  1CQ8 A;  5FT5 A;  5DB5 A;  4LC3 A;  3B5N C;  1FZC A;  2VGV A;  1N73 A;  9AAT A;  1C0N A;  1AY4 A;  1AKB A;  2OYH C;  4IX8 A;  5FT8 A;  4CBS A;  2HPC B;  1GDT A;  4W7Z A;  2ZSL A;  3VMY A;  4OCA A;  3KGX A;  3MTU E;  2VMQ A;  1X9V A;  1E5F A;  5EIG A;  3DYD A;  3G3Z A;  3NXS A;  4JEV A;  4MKJ A;  1SFC C;  3HE5 B;  1DTY A;  2D7Y A;  1KKJ A;  3W1J A;  2BI9 A;  2FFD A;  4KYO A;  3JWA A;  3MC6 A;  4WB0 B;  3RK2 B;  2R2N A;  2VLF A;  3COG A;  3CQ6 A;  4LLH A;  3AEL A;  2C0R A;  1MV8 A;  5KJ7 A;  1JTH A;  3AEO A;  1D7S A;  2ZSM A;  5EUD A;  3GHG B;  3WMM 0;  2CY8 A;  2C44 A;  4PFF A;  4RJ0 A;  3EI8 A;  3MIW A;  3FRK A;  3R9A A;  3A9Z A;  1YNU A;  4WYE A;  2VLH A;  1U08 A;  2WSF H;  1CJ0 A;  2AY2 A;  2O1K A;  1J2J B;  1I43 A;  3NNK A;  4C7N B;  1TOI A;  4F5J A;  1S9K D;  5KJ7 D;  1LTA C;  1SVV A;  1FC4 A;  1T8Z A;  4WD2 A;  2EYQ A;  2Z1Y A;  1G4V A;  3VYI A;  3BV0 A;  2JEE A;  1O69 A;  1X79 B;  3LVJ A;  2OKJ A;  3EI9 A;  1SF2 A;  1S09 A;  2X5F A;  1W3U A;  2HOR A;  1H88 A;  1TAT A;  1FZF A;  2N1T C;  1YJS A;  2IFN A;  1BKG A;  1G1J A;  1OWA A;  4XE5 B;  5CCG A;  1H1C A;  4KAM A;  1GC0 A;  3BVH A;  4AOA A;  2GB3 A;  1NAF A;  1YIZ A;  3WX9 A;  4Q75 A;  3QM2 A;  2R32 A;  2XZR A;  2OYI A;  3MGN A;  2WSE H;  2DKB A;  2BI3 A;  3ZRR A;  2HFE D;  3ISL A;  1UU0 A;  1T3I A;  2EGY A;  1FZC C;  4XEW A;  1V72 A;  5KTB A;  2WSC H;  1SP4 A;  3MAF B;  1RE3 A;  2BWO A;  2VMX A;  1W7M A;  3A8U X;  1N73 C;  4UHM A;  3FVU A;  2HOX A;  5AX8 A;  2ZXE B;  3SWY A;  1JOC A;  3VMX A;  1DH3 A;  3NYT A;  4WYG A;  3HQT A;  1ZC9 A;  2W7J A;  1JCD A;  2HOZ A;  4I8A A;  1FZG A;  4CXQ A;  1VDF A;  3NDN A;  1DJU A;  4ZWM A;  3NYS A;  2CFB A;  4Y0H A;  3K28 A;  1BJW A;  5APS A;  3F9T A;  2R5E A;  5AW6 B;  1L4A A;  2YOB A;  1LWU A;  1OXZ A;  3UIA A;  3B5N B;  3M9Q A;  4ZAH A;  3MC6 C;  1B9H A;  3UE8 A;  4AYC A;  1MLY A;  2O01 H;  4UHO A;  2CST A;  4OTL A;  3O8Z A;  2WPR A;  5KJ7 C;  2OYH B;  1M0O A;  4N0W A;  3T32 A;  3HL2 A;  2C9N Y;  3CQ5 A;  1ZOB A;  5CCH C;  3E2Z B;  3CQ4 A;  3HT4 A;  4MSO A;  1MAP A;  1OAT A;  2W8V A;  1Z3Z A;  1B5O A;  1L4A D;  3LVM A;  1GZL A;  4M3L A;  2A1V A;  1TOJ A;  1GTW A;  1AMS A;  1AJS B;  4NOG A;  1JG8 A;  4IXS A;  1S0A A;  1ZOD A;  3VOP A;  3TNU B;  1RE4 A;  3DC1 A;  2BHX A;  2GQN A;  2YMY A;  1LTJ A;  1URQ C;  2JJL A;  3BCB A;  2W8T A;  3B1E A;  2FKI A;  4JF7 A;  4W1X A;  5AW0 B;  4BHD A;  1MUU A;  2EPJ A;  3N7N A;  2ZY4 A;  3WCO A;  4XJM A;  1AIB A;  5J8Q A;  3CLQ A;  5AVV B;  2WT7 A;  3MAU A;  3AEP A;  4E1O A;  5CCG C;  1WRG A;  1SQV K;  4IFD K;  3PJ0 A;  3PGY A;  2GUS A;  2P1J A;  1QJ3 A;  1J1D C;  1YTZ T;  4OH8 B;  1IJD B;  1ECX A;  3FQ8 A;  8AAT A;  4F5K A;  2JJF A;  2BI1 A;  4ZDL A;  4JF0 A;  1HBW A;  3HTK B;  2WIT A;  1JO5 A;  2YCP A;  4EOT A;  2HZP A;  1RF1 A;  3K7Y A;  5G4J A;  4DZO A;  1UKJ A;  1N2T A;  2BYJ A;  2VMW A;  4HH2 A;  2W7F A;  2FN6 A;  2N1T B;  1MDX A;  3VMZ A;  1AHF A;  3H9X A;  1G7X A;  3UWC A;  2C0W A;  1KL1 A;  1IO4 A;  1MGV A;  5APV A;  2VMY A;  1MFZ A;  3NUI A;  2D64 A;  1LTG C;  1GW4 A;  1M1J B;  3DOD A;  2Q9I A;  3FVX A;  2W7G A;  4XJO A;  4WLH A;  1H0C A;  4ADE A;  1NOH A;  3VOM A;  1L4A C;  3A9X A;  4DQ6 A;  5IWQ A;  1GW3 A;  2DGL A;  2VMU A;  2KB7 P;  1M0P A;  1N73 B;  1C4K A;  4RKD A;  2VMT A;  4IYO A;  4C46 A;  3PDB A;  4R5F A;  4MQP A;  3M06 A;  1AHX A;  5E4Z A;  4GEB A;  4ADC A;  2AY4 A;  4A6T A;  1EJI A;  2DGK A;  3B1D A;  1QZ9 A;  1DGD A;  3M0A A;  2EO5 A;  5EIG B;  1C9C A;  3BCA A;  4IY7 A;  4ATQ A;  1QJ5 A;  3E1I A;  2G7J A;  5EUN A;  3I5C A;  3FQA A;  4LNM A;  1JCC A;  4R8D A;  4M2J A;  4F5M A;  1LTT C;  3QGU A;  1ASG A;  1HJB A;  1JY2 N;  1M4N A;  1TAS A;  1LW4 A;  3VN0 A;  1XEY A;  4ADD A;  1LTJ C;  3HMU A;  1NKZ B;  1IFJ A;  1N7S A;  5AW7 B;  1CS1 A;  4W5K A;  2GMS A;  1C7G A;  2CAN A;  4Y0D A;  3LIE A;  1FBM A;  3EQ2 A;  2NPS D;  2BIA A;  1WYT B;  1GU5 A;  2D5Y A;  4MKK A;  4AZK A;  5E3K A;  4EIJ A;  1PMM A;  2XU6 A;  4PFN A;  1JY2 O;  1DJE A;  1CZE A;  3PD6 B;  5EUE A;  1B5P A;  3FSL A;  3JWB A;  2W6B A;  3CL3 D;  3N0L A;  1JS3 A;  2A45 H;  3G7Q A;  2WPS A;  1FOS E;  5CHX A;  2JIS A;  1HGV A;  1N7S D;  2AAT A;  2FNU A;  2A45 I;  1URQ B;  5AW5 B;  1ASM A;  2AEU A;  1AMA A;  4ZSW A;  4PIW A;  1NHL A;  1RF1 C;  3HBX A;  3II0 A;  3RCH A;  1BW0 A;  1TOE A;  4ZSY A;  4ZWV A;  4W1W A;  1KFN A;  2JJH A;  3AEN A;  1YJY A;  1AMQ A;  1VPC A;  1CI6 A;  4LNL A;  2Z9X A;  4N3Y B;  2OGA A;  2BI2 A;  1ZV8 A;  4XJP A;  4RM1 A;  2PB0 A;  4ISY A;  2AY8 A;  1D2F A;  5APQ A;  1IAX A;  3JTX A;  3FD0 A;  2N9B A;  1GL2 C;  1GU4 A;  2AY3 A;  1TOG A;  2H7H A;  1KIL A;  2FXM A;  3LVL B;  2HOD B;  1J1E C;  1KFM A;  1M7L A;  2XKM A;  3VP6 A;  3EFG A;  4JF1 A;  2WK9 A;  1NH4 A;  2VMR A;  5AW3 B;  1W23 A;  3RQ1 A;  4E3Q A;  1FZE A;  1JUN A;  1D7U A;  2D7Z A;  2GUV A;  1FG3 A;  4XQ2 A;  3M5U A;  1JMM A;  1KIL D;  3M0D C;  1CW5 A;  3AAT A;  3GWP A;  1XI9 A;  3HE4 B;  1GDE A;  3AEM A;  3A5T A;  4IXO A;  2XNX A;  4AO4 A;  2Q3I A;  4WY4 C;  3E2F A;  3QPG A;  1NTZ K;  4IW7 A;  1G2C B;  4WYD A;  3FZ7 A;  2M8R A;  2D65 A;  1ARH A;  3FDD A;  1X28 A;  1N7S C;  3GZD A;  2HYN A;  1KMJ A;  1GBN A;  3CAI A;  2VMN A;  3RL0 C;  4F5G A;  1WYV A;  1ELU A;  3L35 A;  2Z4E A;  5DX5 A;  1ORD A;  1QL2 A;  4AUW A;  2QA3 A;  3CI9 A;  3HD7 A;  4RIT A;  1YOO A;  1M6S A;  1LC7 A;  4EB7 A;  1RF0 A;  1TAR A;  1YIY A;  2W7M A;  4R2N A;  2TPL A;  2YKV A;  4JEW A;  3I4J A;  2P7J A;  2O0R A;  2Z9W A;  1S06 A;  5JAY A;  2R3C A;  2R0T A;  3BAT A;  4FL0 A;  3IFM A;  1GD9 A;  2CIN A;  4B98 A;  5CJ4 A;  3FCR A;  2YHK A;  1PG8 A;  3HUS C;  2CTZ A;  1LC5 A;  1GD2 E;  3HRN A;  3HD7 D;  3NU8 A;  3WKR A;  5AW2 B;  2W7L A;  1T2K D;  3FQ7 A;  3V4W A;  3PDX A;  3ELP A;  1CZC A;  1TOK A;  3M91 A;  3KPE A;  2YKX A;  4E77 A;  2HUI A;  1FOS F;  4RJY A;  3C9I A;  5APT A;  1SQQ K;  1KIL C;  5K8B A;  1AHG A;  2VMP A;  3PIU A;  3H6P A;  3NU7 A;  1WYU B;  2PO3 A;  4Q76 A;  2ZY2 A;  1V2F A;  1DX7 A;  4BQ0 A;  2P67 A;  2VYC A;  4WYA A;  1FDM A;  1S07 A;  2FYF A;  1BJO A;  3RK3 D;  4H63 Q;  3A7O A;  3N4S A;  2WWW A;  4TMR A;  1M7Y A;  1GL2 B;  2YKP A;  3VP8 A;  2YKQ A;  1L0N K;  2VRS A;  2CJD A;  2BYL A;  1J1E B;  1DEB A;  1ASB A;  2ZY3 A;  2V1P A;  2XDJ A;  2A45 G;  4EB5 A;  2F8J A;  2HG5 D;  3DXW A;  2FM1 A;  1LT9 A;  2ZP7 A;  5KLV K;  1PFF A;  5F8V A;  4W8I A;  3L37 A;  1ARS A;  2FFD C;  1BJN A;  3P8M C;  2CJH A;  2Z61 A;  1D7V A;  5M4D A;  2IPP A;  1LGH B;  2VGT A;  3Q8N A;  3EIA A;  1QL1 A;  4WYC A;  2QSR A;  2Z5H A;  4GE7 A;  2YKY A;  4WXB A;  4LW2 A;  2YCN A;  3HD7 C;  2I1K A;  2C9L Y;  1AHE A;  4L0O A;  1T2K C;  2HPC A;  3EI6 A;  1HUC A;  1RF0 C;  1KMK A;  4WY4 B;  4QGR A;  2FKW B;  4CBR A;  3LY1 A;  1HGZ A;  1SZU A;  3P8C E;  4GSA A;  1LS3 A;  2C81 A;  4U2H A;  4JEY A;  3VAX A;  1SFC B;  1RV3 A;  4WBT A;  3HE5 A;  1IC2 A;  2ZFC A;  4ATP A;  2Q7C A;  2YCT A;  2Z20 A;  2OGE A;  5AVZ B;  4ADB A;  4OC9 A;  2R5C B;  3NTN A;  3RL0 B;  1CZQ A;  4WB0 A;  2FYZ A;  2ZJG A;  3BB8 A;  5TF5 A;  1SFF A;  1E5E A;  1O62 A;  3GHG A;  2AY5 A;  2BWN A;  3N75 A;  2W8W A;  3H32 B;  5AVT B;  1CQ7 A;  4RLG A;  4M2K A;  4B9B A;  5EQC A;  3M9H A;  1B8G A;  1ASL A;  2X3L A;  3RK2 D;  3IR9 A;  1IAY A;  1AY8 A;  5G2Q A;  3KYQ A;  3HUS B;  3F0H A;  4C7N A;  3P7K A;  3PP5 A;  4XJL A;  4P3M A;  2HP1 A;  3GET A;  1C7N A;  3B8X A;  4K05 A;  4P7Y A;  2KSJ A;  3BS8 A;  2QM7 A;  2E7U A;  1IFN A;  2H8P D;  1W2E A;  2OYI C;  1AFO A;  1QIS A;  3ASA A;  1IX8 A;  3ECD A;  3WZF A;  5D5S A;  3B46 A;  1UU2 A;  4RKC A;  3L36 A;  1RE3 C;  4AZJ A;  2GSA A;  1VEF A;  3L4F A;  3ELE A;  1IFI A;  2WTY A;  4XK1 A;  3L44 A;  3NTJ A;  2E54 A;  1ZR4 A;  2YKO A;  1GCK A;  2E42 A;  3U1A A;  5AW9 B;  1I41 A;  4FFC A;  4GE4 A;  2DGM A;  3U59 A;  5BJ4 A;  1B9I A;  3MEB A;  1JNM A;  1DKA A;  1FZB A;  5AVW B;  1CQ6 A;  5G2P A;  3EI5 A;  4K2I A;  4KHX A;  5BU5 A;  2AY6 A;  1LWU C;  1FZC B;  3E9K A;  4DGT A;  4UHN A;  1IFD A;  1IJI A;  4F5I A;  1G4X A;  2WPQ A;  3L8A A;  5EAV A;  4OMA A;  3VK4 A;  1KKP A;  3G0T A;  5APY A;  4UQV A;  1V2E A;  3FFR A;  7AAT A;  3VTP C;  3QBO A;  1MDZ A;  3ASB A;  4GE9 A;  1JY3 P;  1LTI C;  1V2D A;  4E3R A;  3NUB A;  4LNJ A;  2QM8 A;  2O7C A;  2P2U A;  3W1H A;  4AQR D;  2IX7 C;  1N2D C;  2NPS A;  1SVF A;  1G7W A;  2J59 M;  3LWS A;  1MAQ A;  2OAR A;  1ASF A;  2FFD B;  3NMD A;  5AVX B;  1OXO A;  2QBT A;  3OKS A;  1DJ9 A;  1LW5 A;  3AEJ A;  5D95 A;  2D63 A;  1X29 A;  1RE4 C;  4OBV A;  1ASC A;  4AH3 A;  4N78 E;  3HLM A;  2VMO A;  1LK9 A;  4ZKP A;  4Q31 A;  1JTH B;  2OYH A;  3E2Z A;  2FQ6 A;  3GHG C;  3BCX A;  3KQG A;  2VGZ A;  2MJZ A;  1X8Y A;  3AOW A;  1OHV A;  1ARG A;  1AJS A;  3B5N D;  2KP8 A;  1WKH A;  5AW1 B;  3U1C A;  1IUG A;  2IFM A;  5AVR B;  4EFF A;  4HVK A;  4HYT B;  1DFO A;  2KYV A;  1YYC A;  2YRR A;  2WZ7 A;  1ASE A;  1GC4 A;  3I16 A;  3TYY A;  3TQX A;  3DR7 A;  3DXV A;  1H8A A;  4J5U A;  3GBX A;  1WT6 A;  2HLO A;  1FJP A;  4W7Y A;  2W7K A;  4ITG A;  1GK4 A;  3BWN A;  3WGC A;  1ART A;  3MD0 A;  3BAS A;  1LKC A;  1J04 A;  4A6U A;  2X8U A;  4XAU A;  4A0R A;  4PVF A;  2JJG A;  5AVY B;  4Y0I A;  1J1D B;  1BJ4 A;  1BS0 A;  1P3W A;  3OAK A;  1NTK K;  1G1I A;  4GKG A;  2GM4 A;  2AY1 A;  3BN1 A;  5BJ3 A;  4DOJ A;  4JYB A;  5APW A;  2OYI B;  4WXF A;  2E7I A;  4BA4 A;  1VP4 A;  5HDM A;  1Z56 A;  2I1J A;  2FNI A;  3E6G A;  1JF9 A;  2N1T A;  2W8J A;  1AY5 A;  4A0H A;  2KOG A;  4ZDP A;  3V2Q A;  1CL1 A;  1NTM K;  1QIR A;  3WKS A;  3TAT A;  4A00 A;  3KDP B;  3PPL A;  4W80 A;  3MBB A;  2W8U A;  3SWF A;  1IVR A;  1M1J A;  2Z5I A;  5EFS A;  2RFV A;  1ARI A;  3BRV B;  1SLQ A;  5HHY A;  2QLR A;  4Q6R A;  2NPS C;  1L4A B;  1LWU B;  5BVZ A;  2N1T D;  3MKJ A;  3USF A;  4I6M C;  3AEJ C;  1RY3 A;  4W1V A;  3PAA A;  1GC3 A;  1HH0 A;  4B86 A;  1I48 A;  2BKW A;  3LV2 A;  3GZC A;  2YO3 A;  2JGT A;  1J32 A;  1O4S A;  2POH A;  3N5M A;  4LC1 A;  1BT4 A;  4BA5 A;  1EG5 A;  3FZ6 A;  1AAM A;  1ZR2 A;  3H7F A;  2C7T A;  3LID A;  2W7H A;  4Y99 C;  4I1L A;  2XBN A;  2DOU A;  2CPS A;  3V2P A;  3A3Y B;  1GEX A;  2PAJ A;  2HUF A;  4I2L C;  3QI6 A;  1IX7 A;  1RV4 A;  2AY9 A;  1LTJ B;  1HWT C;  1T3U A;  3FFH A;  2WK7 A;  1AAW A;  1ZLL A;  4OYT A;  5CCH A;  4EU1 A;  5E5I A;  1Y4I A;  4XA4 A;  3LVK A;  3TSI A;  4BMK A;  5G4I A;  2QB2 A;  2ORD A;  1OXP A;  3A2B A;  1WYT A;  2C0X A;  2WT7 B;  1S08 A;  2QMA A;  3BWN C;  3F6T A;  2YNY A;  3PD6 A;  1Z7D A;  4GT1 A;  5APU A;  1AMR A;  4WBA A;  1ZN5 A;  3HDO A;  4IFM A;  3AV7 A;  1AQ5 A;  2PP6 A;  1FJK A;  3B8E B;  5CCH D;  2ZUK A;  4AO9 A;  2E7J A;  4ZDO A;  3P8C D;  5DJ9 A;  1URQ A;  4JEZ A;  2VMV A;  4IFF A;  3TK1 A;  1AHY A;  1IX6 A;  1RF1 B;  4H51 A;  2W27 A;  1MZ9 A;  4RAE A;  5HXX A;  2E43 A;  2H43 A;  4A0G A;  3WLX A;  1L0L K;  4JYC A;  1I29 A;  1A02 F;  2YRI A;  4EMY A;  1ELQ A;  5CMZ A;  4R5Z A;  4WYF A;  1AIA A;  2BWP A;  1SZS A;  4ZM3 A;  3A2A A;  4M2M A;  1URQ D;  4W91 A;  1X0M A;  1IK9 A;  1M32 A;  1M1J C;  5AW4 B;  3D6K A;  5M49 A;  3MAD A;  3BRT B;  4HF8 A;  2HOD A;  3AEM C;  4ZLV A;  1NO4 A;  2Q5U A;  5EAA A;  2Z9U A;  4MY5 A;  4N6J A;  1RVY A;  5CCG D;  3R2P A;  4IYO B;  3JW9 A;  3PDB B;  3KGW A;  5M46 A;  1YAA A;  4ZKU A;  3E77 A;  1ASN A;  3WY7 A;  3GZD C;  4RIZ A;  1VJO A;  3FDB A;  2J58 A;  1HVV A;  3KKI A;  4DBC A;  1LTB C;  2V0Y A;  3EUC A;  3ZRP A;  3MUD A;  1W7N A;  4A0F A;  1KL2 A;  2NPS B;  3HE4 A;  1KQL A;  4ZM4 A;  2OQX A;  4CXR A;  3UAK A;  1AIC A;  2WB6 A;  3LG0 A;  1S9K E;  1SQB K;  5FT6 A;  1CL2 A;  2VIA A;  3CBF A;  1N86 A;  2OKK A;  2YKU A;  1OHW A;  4J8L A;  1G2C A;  3V4Q A;  2EH6 A;  3VK2 A;  4RES B;  1N7S B;  1AKA A;  2GMU A;  5I92 A;  3BWO A;  3T97 A;  1AKC A;  3DZZ A;  1GK6 A;  2W7I A;  1FU1 A;  1A02 J;  2W7E A;  2HUU A;  3VP9 A;  4Y99 B;  2VGW A;  3OP7 A;  1WST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...