5KTBA

Structure of a complex between s. cerevisiae csm1 and mam1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
151
Chain Sequence
LLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSDYSIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular architecture of the yeast monopolin complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords Monopolin complex subunit CSM1
total genus 51
structure length 151
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5ktbA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ktbA02
3U59A 3N4SA 5BVZA 3BATA 3VP8A 3HRNA 3N7NA 3U1AA 3N4RA 3BASA 3U1CA 1NKNA 1X79B 4O9BA 5BU8B 2POHA 3OJAB 4ZKPA 5BU5A 3N4XA 3C9IA 4I1LA 1WT6A 2JEEA 4N3YB 4ZKUA 3P8CD 1IC2A 2FXMA 3VP9A 5KTBA 4N78D 4GIFA
chains in the Genus database with same CATH superfamily
1H0TB 2QJYC 1YNUA 3HD7C 1Q7YQ 3BWOA 3CPWO 2E76B 1LTJB 1T2KC 2EO5A 4ZDOA 4QGRA 1T8ZA 2M3BA 4IW7A 2I8DA 1WKHA 3BCCD 1W2BO 3H1HJ 1WYUA 5HDMA 1T3UA 1M7YA 2GUSA 3HMUA 3BCCG 4GOEA 2HZPA 4DQ6A 1EXIA 1YIZA 3UAKA 4ISYA 4WWIA 1HF9A 2I1JA 5M1BA 1WYTB 1SLQA 4H13D 1N73A 2BWPA 4Z1MH 3WKSA 3N7NA 1SQXJ 1SQPD 3TSIA 1FU1A 3OP7A 1DKAA 1M0OA 3COGA 1M1KQ 3N5MA 5HXXA 2C9LY 5G4JA 5DJUB 2FYUK 2Y0DA 5APUA 3VK3A 1ZP0C 3WUUA 1ZR2A 3HQTA 1L0LG 1L0LE 3FVSA 3O6QA 1T3JA 4BQ0A 3A9YA 3Q5SA 3KGWA 3B71A 1EDIA 2D2CD 3R9AA 2K88A 5K5GB 3TCMA 3B5NA 1IJDB 3G3ZA 1BQDA 2AXCA 3MC6A 4RJTA 1JUNA 5BU5A 4U3FE 2H89C 4JYCA 3HT4A 1DD3A 2HUUA 1N8RQ 2G8YA 3L70E 2IYOA 4AO9A 2FY8A 3A0BH 4CBSA 3MZWB 1PPJE 1QL2A 1NTMG 5CBNA 2DGLA 2QRXA 1OVVA 3TF5A 4AZJA 1LJ2A 4WB4A 4XJPA 4PFFA 3V5BA 3BWNA 2HUFA 2O1BA 1SQBK 2KZIA 2JJHA 3LV2A 3LVMA 2NPSA 3FWLA 1YQ4C 4P7YA 1G2CA 2C0RA 3L75G 2Y9YA 1NTZG 2GMSA 1M8OB 1DJ9A 1OVRA 3IFMA 5AW1B 1LWUC 5EFSA 1P3WA 2LXBA 3S4RA 1HJBA 4GSAA 5EFWB 2BHXA 4Q76A 2KB7P 3AELA 3E2FA 1J04A 3N4XA 1LT9B 2BIAA 1G7WA 4QMAA 5KLIC 3HD7D 1NTKG 4CXRA 4L0OA 4UHOA 2CTZA 1EDLA 3AE8C 2I1KA 4WBTA 3G6EP 3QI6A 4ZMDA 1YJSA 1L4AC 2VMNA 2OYHC 4MKJA 2WSEH 3H1IJ 3PAAA 3PD6B 5EQCA 3FGAD 1J1DC 3DODA 3RBFA 1FC2C 1SPAA 2OYHB 2VMRA 1XEYA 3AENB 2NPSC 1Y4IA 5DJ1A 1L0LD 4MSOA 4ZAHA 2Y0CA 1K9MQ 2E7UA 2WSSH 3A2AA 1B9IA 2Z61A 5M4BA 1KL2A 1PP9D 4RJ0A 3PHLA 2X8UA 1BJNA 1GL2A 3DXWA 1WYVB 4TMRA 2QBTA 2IBZD 2QJPB 2D64A 2JDIH 4M2MA 3ASBA 2F8JA 2V7QJ 4M3LA 3RK3C 1RVUA 3DC1A 1W5CE 1VEFA 3PGYA 1AVYA 2BYJA 1AY5A 3MBBA 4K2MA 3M91A 5AW5B 2W7HA 3M0DA 4PIWA 1BKGA 2EH6A 3FVUA 1K04A 3B8XA 1ZV8A 1EDKA 2W7DA 3USSA 4OBVA 2ZUKA 1JY3P 5F8VA 3ZZKA 4PD4D 2Z20A 4LC1A 4H0LD 1Z7DA 2CFBA 5G4IA 4E3QA 2Z1YA 2KP8A 1EJIA 1FDIA 4A00A 5C6UA 2AEFA 2WB6A 3LWSA 1ARGA 1BT4A 1QX8A 1SQQG 2KNCB 2Z9VA 4XJOA 2XBNA 3JTXA 1FZEA 1KQFB 1NKZB 1N7LA 1LW4A 2PO3A 3Q5PA 3L72D 4MN4C 3A5TA 2Z5IA 1AKCA 1V2FA 4L75A 1O69A 4IL6E 4K05A 3LIDA 1WYTA 4EI2A 1JTHA 2Z5HA 5TF5A 1LK9A 1SZSA 2BEZF 1KQSO 1QVFO 1JY3N 1GD2E 1EZVG 5H2FE 4L74A 1ZOBA 4IXOA 3PTZA 4IFDK 1SZKA 2BWNA 2KI7B 1HGVA 1W3UA 2K9JA 1G1IA 3BCCE 2HPCB 1KORA 1FZFA 4UB6H 1S9KE 1OXPA 3KQGA 3HE4B 3P32A 1E5WA 1ASMA 1FBMA 3NU8A 1CW5A 1QL1A 2C9NY 4WXGA 3HE4A 2E7JA 2WSFJ 1D7UA 2WTYA 1SQXK 3U1CA 3FVXA 1PPJD 1J32A 1GTWA 2VIBA 3VP6A 2FN6A 2XNXA 2QEXP 1N86A 3FQ8A 5I92A 1GDEA 1ECXA 3WMM0 1TU3F 1SF2A 1G7XA 1UKJA 3A0HE 3CX5I 1RE4C 3LVKA 3G0TA 2QSRA 4WY4A 3RL0C 2PAJA 1B5OA 1LS3A 1YJZA 4LW4A 2WWWA 2N1TC 2A06G 3NYSA 1KYOI 2R3SA 4YPCA 4F5LA 1NTMJ 1XTGB 1S5LE 1T3IA 1VQOP 2QM7A 2O0RA 5AVVB 1SQQJ 5CBOA 4I1LA 3GMAA 4CXQA 2B9BA 1SQXD 8AATA 3SFDC 1MFZA 3H1LG 3OA7A 2KS1B 2VMXA 4IXZA 2QM8A 2YCTA 3P8CE 1JCDA 2XDJA 1PMOA 2RMZA 1K05A 3QH9A 5AVUB 1EG5A 4N0WA 2AY9A 1GD9A 4ADBA 2VMWA 3W67A 4MQQA 3ZRQA 3EI7A 1PGQA 1YJ9P 2ITAA 4N6JA 4H0LC 5D5SA 3KE3A 1LTIC 2R32A 3V2PA 3VMYA 1VQPP 2YRRA 4MQRA 3CCQP 3FRKA 2AY2A 2R2NA 3S9OA 3KXDA 1URQD 2W8WA 4CBRA 4AO4A 1AICA 2OQQA 3KZIH 3OAKA 2IFMA 1SQPG 3GLMA 1X8YA 1NTKE 1OWAA 4ZWVA 3W1IA 5CCHA 1H1CA 2A06D 2DOUA 2K37A 1JY2O 2DKBA 1NTZD 3G8MA 1KC8Q 2BI5A 1SFCB 3FFRA 3RK3E 2NZ2A 1N2TA 1KYOD 1Z56A 1EDJA 4GE9A 2HPCA 2GSAA 4I7ZC 2D65A 4HYTB 5AVTB 2HLOA 4AQRD 1FS0E 3BC8A 1EXJA 1B8GA 1LT1A 1BDCA 1NYHA 2WT7A 2IYPA 5DB5A 5KLVE 1IFNA 1K8AQ 2OATA 3GF7A 2OGUA 5HHYA 2RH0A 3NRAA 2PP6A 3CI9A 3B1DA 2WK8A 2H8PD 4BRYA 5E5IA 4A6TA 2WSEJ 1JG8A 1DEEG 4PV1B 4OGQC 1OATA 1N8PA 1NTZK 2E75D 3L4FA 4H44D 3JWBA 3H1LJ 1GU5A 1EC5A 3AEGC 1SFFA 5AW3B 2W7KA 5AW9B 2YOBA 1AHGA 2E7IA 2WVRA 1DX7A 1FZCC 3PA9A 3H1KG 1LP1A 2BWOA 2D2CC 3FXEA 2KSJA 3D6ZA 3I4JA 2OYOA 2AEUA 1EZVE 1FC4A 3ELEA 3EQ2A 3BCCJ 1M0QA 2C7TA 3V4QA 2POHA 2Q9IA 2E42A 3SWKA 1QVGO 2KZJA 2CH1A 1S9KD 1G1JA 1R5LA 3PPLA 1QLED 3NYUA 3P1TA 2NPSD 2HR3A 3AECC 1JOCA 2KOGA 1L0ND 2Q6QA 3CXHD 2HP1A 4ATQA 1MGVA 2WSCJ 5G09A 2XU6A 2ZYJA 2YXQB 1KTMA 4OVNF 1X29A 3N75A 5AVZB 1ASEA 1AJRA 2QA3A 5G2QA 4ADDA 1KB9D 1AV1A 1PGOA 2C44A 1M56D 1XTCC 3WGCA 3CX5H 3B8EB 1ZW0A 3A0BE 4I2LC 4JF7A 4KYOA 5KJ7C 1JO5A 3HD7A 2ZJGA 1I48A 3CLQA 1EQ7A 4WY4C 4WLJA 1QZ9A 1IX7A 2OKJA 3FZ8A 1LWUB 4ZSWA 2W6BA 3K40A 1MUUA 4JEYA 4WLHA 2KFPA 3VYIA 1EQBA 1O62A 4RKCA 3V2RA 2X5DA 5E79E 1BGYE 4NOGA 2K3RA 2YO3A 1FOSF 2WZ7A 4MKKA 4N3YB 3R2PA 1AHEA 2EZ2A 4YTPC 1MKMA 1N2DC 3HTKB 2JKVA 4GT1A 3TDKA 2YKVA 2R3CA 4E3RA 2R0TA 1SQVG 4E1OA 4BWNA 2PB0A 2AY7A 3GJUA 1N7SD 1VJOA 4KXKA 4JF0A 1YTZI 2WT7B 1AIBA 1KB9E 3B5NB 3EI8A 4UQVA 1JB0J 1LTJA 2K9YA 4OBUA 3IHJA 3L75D 3NTNA 1W7NA 3A0HH 1OMIA 1QEXA 1VDFA 3PRJA 2M8RA 3JZLA 1CI6B 3VK2A 3E2ZA 2HOXA 4ZNCA 3L74E 2VMQA 3P8MC 1P84E 3SFEC 3T32A 1NTKD 2CH2A 4U2HA 1CZQA 2OKKA 2E74D 1M1JA 2AY5A 2N1TB 1JMBA 1HBWA 3HE5A 3L73E 2OTJP 2HODA 4C7RA 4XAUA 4U7JA 7AATA 1PIXA 2QJKB 3CMEP 1JMMA 1M0PA 2FYUG 3L71E 2XNDH 3D6KA 3SWYA 2B88A 1X79B 2BI2A 2FKIA 2IPPA 4AYCA 1JTHB 4OT8A 4LNLA 1RF0A 5CMZA 1KMIZ 1SQXG 1CS1A 2VMPA 4FFCA 4JEVA 3HBXA 4NPFX 2P58A 3TFTA 1MLYA 4FL0A 1OHWA 1YI2P 5AW4B 4UHNA 3TYYA 4M2KA 1NOHA 2WPRA 1RQVA 3GHGC 1YTZT 4EYYQ 1M90Q 1HWTC 1BDDA 1SQBD 2KNCA 4LLHA 2VLHA 3EZSA 2WPVB 2R5EA 1OHYA 1GC4A 2W7LA 5KTBA 2TPLA 4TN4A 5KAFH 3AENA 4ZDLA 1DFOA 2H7HA 1KD1Q 4AH3A 3CMAP 1JNMA 2L91A 1AHXA 1AJSB 2BI1A 1OW7A 1VQ8P 1ZMEC 3ACZA 1U7MA 3G7QA 2E75B 1IO4A 4XE5B 1FJPA 5EUDA 1AMSA 1BCCE 2FKWB 2ZP7A 1NU1J 1H8AA 4IYOA 1N7SA 3AOWA 1BCCD 3TGUG 2B87A 3HLMA 3W68A 3E1RA 2DR1A 3M9QA 4EB7A 2ZT9C 4EOTA 1KB9H 5AX8A 4JEWA 3ABVC 2VRSA 3L72J 1M0NA 2GUVA 1TOKA 5AVYB 3L71J 3RBXA 1X22A 2EYQA 4WB0B 2FYUJ 4PD4H 1S5LX 1ZOYC 4ITXA 1OZHA 1OXZA 3ECDA 1TARA 1BSNA 1VF5B 2ZAEB 2FFDA 2DGMA 3WCOA 4LNMA 3RL0g 1BSHA 2D7ZA 1X0MA 3EI5A 1AAWA 2Q3IA 2AY1A 5L8RJ 1LTBC 1MAPA 2VGVA 3EFFK 4BHDA 1JY2P 5BU8B 1ZR4A 4JYBA 1VQ7P 3H1KD 4JPZB 4RESB 4DCKA 1HJ0A 1T6AA 2VI8A 1VQ6P 4ASVA 1RY3A 4KAMA 2N9YB 3USFA 1ASBA 3QN6A 1DIPA 1ARTA 1BE3J 2E5YA 1HUCA 1IVRA 3QHXA 3DR7A 2NPSB 2KLVA 4GDYA 3VK4A 1IFMA 3H1HD 5E4ZA 1YBKA 4IL6X 3VN0A 4R5ZA 2HFED 2E74C 3KHUA 2JWDA 1VQLP 1J1EC 1N73C 2OARA 1MFTA 1EZVI 2CANA 3U59A 3VMAA 2Y0EA 3L8AA 3VMXA 3ZZJA 3GBXA 1UIIA 1ASGA 3QPGA 1W7LA 1DEBA 4J5UA 4W1WA 2IBZI 2BIEA 2FYUD 4B86A 2CJHA 2ZYGA 1A02J 1MAQA 5EAAA 4B98A 1Q82Q 3GZDA 2WKAA 3EWKA 4BMKA 1SQBJ 1BCCG 1SQPK 2IBZE 2O01N 1WYUB 5B5EE 2E76D 1IAYA 4Y0IA 2A45H 1OW6A 2PB2A 1ARHA 3MUDA 4C7NA 3L72G 4U1TA 1VP4A 2FYUE 2Z1ZA 3RK3B 5G2PA 1M1JB 4IOIH 2ZC0A 1KAFA 2B87B 1P84I 2E5TA 1OIPA 3A2BA 2AXTE 1OW8A 2YRIA 1GW4A 3CAIA 1L0NK 1SQXE 2G7JA 2JEEA 3V4WA 3EFGA 1YAAA 3EIAA 2D66A 1YITP 2YCPA 2ZY4A 4AUWA 1OHVA 1GK6A 2ZYAA 3MC6C 1JF9A 1ZXGA 2WSCH 1FAVA 1PG8A 1KMJA 1U08A 3QWOC 1NTZJ 5DX5A 4OYTA 1DD4A 1AY8A 3RQ1A 1S08A 1ZN5A 1M32A 1PFFA 3CCEP 1KQLA 1FG7A 1WSTA 1E5EA 3AEOA 5AW7B 1L4AA 1C0NA 4WYGA 4D6TE 1LGHB 5FT8A 4XFJA 2E74B 2HOZA 3ISLA 2CB1A 4W80A 2Q1KA 3E2YA 1SQVE 3FZ6A 3H1HE 2N1TA 3L75E 3Q2YA 1SQQD 5BJ3A 3F9TA 3L74G 2G3AA 1ASCA 3HVYA 4WP0A 3P7KA 3DR4A 5CCGA 3L71G 2RKLA 1W7MA 3KZIE 4DBCA 1AQTA 3VMZA 1ZODA 2VMOA 3MADA 3AE4C 4RKUJ 3I5CA 2ZY2A 2BASA 3VP8A 1IK7A 4F5MA 5IWQA 3E77A 2LR2A 2KS1A 1CQ6A 2IZ1A 3RCHA 5EUEA 2WMMA 1PFIA 1D7RA 4BA5A 3HTKA 1QISA 1RHZB 3S1KA 4Y0HA 3BWNC 2JP3A 2UWJE 2W7FA 1VF5C 2W8ZA 5B66E 2PGDA 1MZ9A 4DGTA 2O1KA 1LT9A 2GM4A 5TJHA 2FFDB 3HDOA 4JBZA 4XJMA 4BRYB 1M57D 3L70G 1L0NE 3ITKA 3CBFA 4OH8B 1LNQA 4U3FG 2VGWA 2IX7C 2P1JA 2JR8A 2OYHA 1H0CA 1UIXA 1VQNP 1ASDA 1I29A 1GL2B 1KV4A 1T2KD 3FZ7A 3FFHA 2FXPA 3JWAA 1SQVJ 3L74D 1CI6A 1GDTA 1MDXA 1IX6A 1CSBA 3L44A 4MY5A 1CL1A 3H25A 1NGMB 3GSBA 5CCHD 1DGDA 2NMPA 2GMUA 4ZDPA 1RE3A 3JW9A 1ORDA 4TT3H 3E1IA 3MHVA 4BA4A 3CCSP 2ZFCA 2Y9ZA 4RM1A 1W23A 3I56P 3GHGB 1V2DA 2QG4A 1PZQA 1WT6A 3BB8A 1KYOH 2O3JA 4LW2A 3WCNA 1ASFA 3CXHE 4UB8H 1KMKA 1PP9J 4K2IA 1TASA 2GQNA 1JCCA 3EZ1A 3WX9A 3PDBA 3M06A 3DRDA 3H1JJ 4UB6E 1LW5A 3CC7P 5EIGA 1NHLA 4ZKPA 1RF1C 1E79H 1S2EA 3RL0D 4LNJA 3AE9C 1CZEA 1R8EA 3C8VA 3IAOA 4WD2A 2MJZA 5FT4A 2QE7H 1NJIQ 4PFNA 1FJKA 4N78E 3RGUA 5M4DA 1YYCA 2AY3A 1BE3E 3FDBA 3AE2C 3BRTB 2P67A 1SQVD 3CWBD 4L73A 5CCGC 2HP2A 3I55P 1SFCD 2AEVA 5KKZB 1GC0A 5KJ7A 2YKYA 3FKDA 2CPBA 3PP5A 3AV7A 4A0RA 1URQB 1AKAA 1BJOB 1PL5A 1D7SA 4GEBA 4M2JA 3K7YA 4JEZA 1L2PA 3F0HA 3G4SP 1QIRA 5AW8B 3TQXA 4W1VA 3N4RA 3B4SA 2VMSA 3BASA 1GK4A 3CWBE 3H1KJ 5TISH 2P10A 2W90A 1X0TA 2YIUB 3FX0A 3UIAA 2QIWA 2J59M 4HJGH 1IJIA 2W7GA 2PRRA 2Z9XA 1WKGA 1GL2D 1HVVA 1VQMP 4IL6H 4IX8A 1QGKB 3I5TA 2VMTA 3RUYA 1MDZA 1PV3A 4XK1A 3E2ZB 3RI6A 4WYDA 2KK7A 2W7MA 4UOYA 1KFNA 1BJ4A 1FOSE 4F5GA 3H1LE 2ZXXA 5GTIH 5APSA 2ORDA 3CC4P 1TOIA 3NNKA 3RK2C 4RIZA 3MUDC 4ADCA 3L75J 1GMJA 4RAEA 1HH0A 3L73J 3NUIA 1BE3D 2FQ6A 4HF8A 4EB5A 3KDPB 3H6PA 2BCCE 1AA0A 3AOVA 1NU1D 2YIUC 4P3MA 1YOOA 3NX3A 2KUBA 3BS8A 1KILD 3WY7A 1JM0A 3OW2O 2OYIC 1RF0C 3E9KA 3D6YA 4IFMA 4XJLA 2OGAA 5KLVJ 2A45G 1JS3A 3RK3D 2ZVOB 3EUCA 5AW0B 3PDBB 2AEJA 2W6JH 1FZBA 3HL2A 4XQ2A 4A72A 3Q1MA 2OGEA 2R44A 3WUTA 3RBZA 2QB3A 4OGQD 3FSLA 2ZY5A 4CPGA 2D63A 1ELUA 4H44C 3TNUA 2VGZA 3FWNA 1G4XA 1PGPA 1VPCA 3L72E 2VI9A 2DW3A 1ELQA 1BGYJ 3DZZA 2D7YA 4PJ0H 1AKBA 2A06E 2X5FA 3R4TA 4ZKUA 5KJ7D 1OVUA 1PPJG 2ZT9D 2YCNA 2V0YA 5BVZA 5AVXB 3R4YA 5CCHC 1H88A 2W27A 2ZY3A 3IR9A 1BJOA 2OTLP 5EUNA 1L0LJ 1ZLLA 4AZKA 2DGKA 9AATA 1DGEA 2QSIA 4Y28J 1RF1B 2XV5A 1GEXA 4U3FJ 1W2EA 3E7KA 1JY2N 4PJ0E 1CZCA 5APXA 2OQXA 4C7NB 1PMMA 1C7NA 2RN0A 3JCUH 2XH1A 4DOJA 1J1EB 1UU1A 2P7JA 1NKNA 3H1IG 1AHFA 4ZSYA 2O1JA 1FZCA 1A02F 1TOJA 3FTBA 3NTJA 5KAFE 3FQAA 3CWBJ 3II0A 2B89A 2K1AA 3H1IE 2R5CA 3DYDA 1S4XA 3GG2A 2EPJA 2L5GB 1X2AA 2FFDC 3DU4A 4WYCA 1UU2A 4RO0A 3TGUE 3L73D 4Q31A 3NU7A 1ASAA 3PDXA 3A7OA 4JF1A 2LXCB 3CX5E 1JY3O 2Z4EA 2X3LA 4E77A 3BCXA 3VAXA 1IFPA 3LIEA 4JQ0D 2FYFA 3G9RA 1KILB 1NU1K 1U57A 3H1JD 1SFCC 2KSEA 1VQ4P 3MP7B 3L70J 4Y99C 5APTA 5CHXA 3T97A 3LVJA 4K2BA 1J2JB 4YXWH 2A45I 4PV1D 1N7SC 3HRNA 4H13C 2BKWA 1FG3A 5FT5A 2N9BA 1H89A 2BCCD 4H13B 1LWUA 1IFJA 1LKCA 1BGYD 4GKGA 2N1TD 3H1JE 3H9XA 5KAIE 3QM2A 1B4XA 1JS6A 3N0LA 3F5HA 5D95A 1N31A 2FYNC 1Q81Q 2E76C 3H1KE 1C4KA 4GRXA 1BCCJ 1KB9I 3TFUA 3W1JA 4Q75A 1X28A 5M49A 1VQKP 1Y8AA 1KILC 4EU1A 4GE7A 1ARSA 2JWAA 3V2NA 3M0DC 2QLRA 1IK9A 3KKIA 1E5FA 4WB0A 2FBWC 3O8ZA 4Y99B 3MAFA 2Q3EA 5APVA 4EFFA 3CXHI 3GR9A 2YNYA 1H0TA 3DXVA 4AOAA 2W6AA 1GBNA 3RK2D 4WYAA 3FD0A 3D71A 2V1PA 1RF1A 3HUSA 2JGTA 1WYVA 1KILA 3LW5H 4K35A 3LVLB 1KYOE 3U1AA 5KKZC 3TATA 3PH0A 1L0NJ 1NH4A 4OTLA 2J58A 1P84D 1CQ8A 1NTZE 5AVSB 2YKXA 2IFNA 4A0FA 2BCCG 3PJ0A 3BN1A 3MKJA 3H32A 2C0WA 2C0XA 3NMDA 1LTAC 3AEPA 4Q6RA 3MD0A 1SVFA 1AJSA 1IFIA 1YJWP 1SZUA 1Q2NA 2FM1A 3CL3D 1D2FA 2CJDA 3ZRRA 2QA4P 1R5SA 1M6SA 1M1JC 3B1CA 3SSUA 5KLVK 2VGSA 1V72A 1QGNA 1NTMK 3IN6A 4LC3A 3KYQA 5KLVD 2H43A 2QB2A 2KYVA 2FXMA 2GB3A 4IXSA 4GIFA 3WU2E 3MAFB 3HD7B 4OGQB 4ZASA 3B46A 5GTHE 4A6UA 1YQ3C 3Q5RA 1C7OA 2SPZA 3WUVA 3NUBA 3OKSA 3AEMA 3CX5D 1GW3A 3CWBG 1N73B 4XEWA 1AMRA 1AY4A 2AATA 3QGUA 2AY4A 4DJGA 3GWPA 1NTME 1USEA 4H63Q 1ZC9A 4F5KA 3N4SA 4GDOA 3V2QA 3MAUA 1RV3A 3JCUE 1URQA 1SQBG 3HE5B 3B1EA 3AEMC 1M4NA 3V6IA 2Q5UA 2WK7A 4F5FA 4U3FD 1C9CA 4JEXA 1U7JA 4HVKA 1MDOA 4XA4A 3VTPC 5APWA 1NTMD 3O6QB 4A6RA 3AEJC 3AE1C 5E3KA 1AX4A 3GETA 1AVOA 2ZXEB 1LTGC 3RK2B 1RE4A 2KXPB 2A1VA 3A8UX 1CJ0A 2KIKA 4H51A 1L0NG 2R5BA 5CCGD 5EAVA 3CC2P 1FE6A 2BIGA 1UU0A 4RITA 2Q7WA 4F4EA 1KZUB 5AW2B 4WYFA 2FYZA 4DT0A 2JO1A 2BCCJ 3W1HA 1P84H 3AE3C 2W8TA 1AMQA 2WSFH 1QJ3A 1S07A 1O4SA 5EIGB 2BYLA 1LTJC 3NYTA 4RJYA 2NRGA 4H0LB 4DZOA 2AY6A 3M0AA 3VOPA 2VGTA 2QJYB 3BATA 1S72P 4EDFA 1RE3C 1PP9G 4A0HA 3JSVC 1SQQE 2JJFA 3QBOA 2ZT9B 1AHYA 3M9BA 5M46A 4W1XA 4PD4I 4BXLA 1VQ9P 3PIUA 4R2NA 5AVRB 3IF4A 3L71D 4F5HA 3F89A 2CPSA 1CQ7A 3L70D 3AEBC 4NPEA 4GOFA 4UB8E 1VL2A 1B9HA 4R4MA 4RLGA 2YMYA 4N78D 2ZSLA 4OCAA 5APQA 4WBAA 1M7LA 2JG2A 1G2CB 2M5AB 1TOEA 3SWFA 5KLIB 4O9BA 1NVOA 1Y9BA 1J1DB 1NU1E 4ZWMA 4WXFA 4D6TJ 2W8UA 1JEKA 2HORA 1WMKA 3CCJP 2WK9A 4IYOB 4YXDC 5GTIE 1Q86Q 3GZDC 5DJ9A 2PFXA 2Z9UA 3ZRPA 3Q3DA 3WGBA 3UE8A 1Y47A 4ITGA 1VQ5P 4I6MC 3JC22 3KGXA 1S09A 3BCAA 4KHXA 2VGUA 2XZRA 2VMYA 1FZAA 2M0BA 2ZVNB 1SQQK 1BJWA 1S0AA 1DJEA 2W7EA 2HODB 3L37A 4R4LA 1TOGA 4F5IA 1ASNA 1VF5D 3AE6C 1O61A 5TISE 5B66H 1S5LH 1RV4A 4D6TG 1Q90D 2W7IA 2DKJA 4ASWA 1CL2A 3WZFA 1L0LK 2V7QH 5DJTB 1SP4A 4I8AA 3FXDA 2VIAA 1L4AD 3A9ZA 3M9HA 2M3EA 1TPLA 5BJ4A 1LC8A 1I41A 1GEWA 2JJLA 2K9JB 2BI3A 2WPSA 3VP9A 1SS1A 3PD6A 2JJEA 1OX3A 1NU1G 1GC3A 3AEEC 2JISA 1BE3G 1YIYA 2CY8A 2CK3H 2VYCA 3AEFC 2WQYC 2IBZG 2VMZA 2VMVA 1KN7A 2FXOA 1NO4A 3FDDA 1S1CX 4W91A 1DTYA 4Y0DA 3L35A 1ARIA 2CSTA 3H1JG 2ZSMA 4WYEA 1GC2A 2YMKA 4ATPA 3EIBA 3A3YB 4W7YA 1S3JA 3MGNA 3H1ID 3KPEA 2JJGA 3B5NC 1FDMA 2FYNB 1GEYA 1KFMA 2RFVA 3F6TA 4A7PA 1AMAA 3T97B 1YIJP 1KKPA 1SFCA 1LTSC 2D61A 2EGYA 4OC9A 1MLZA 2P2UA 1BGYG 2QMAA 4MQPA 1KQGB 1IUGA 1LP1B 4A0GA 1N7SB 4PD4E 3CCUP 2O01H 4C46A 2YXRB 4WVZA 2ZYDA 4R8DA 3TGUD 2V4HA 3PLNA 3LY1A 3UWCA 1PP9E 2AXTH 2AY8A 2VLFA 3WKRA 3MEBA 1GZLA 3MTUE 1BQAA 3RCHB 3GZCA 2G6WA 2YO2A 3CCRP 3AEAC 4UHMA 2VMUA 5B5EH 1KL1A 3WU2H 4HB1A 4H44B 4D6TD 1IC2A 3VOMA 3BRVB 2R5CB 1LC7A 1TATA 1IX8A 1SQPJ 3LG0A 4ZM4A 4L76A 1AFOA 5J8QA 4O6ZA 1SQBE 2HG5D 2HYNA 4OMAA 4B9BA 4EIJA 1YJNP 1LT9C 3RL0B 3C1LA 3LW5J 1AJYA 3CCLP 4KT0J 3CCVP 1NAFA 2E75C 2FNIA 2KLUA 3H7FA 1L4AB 5CJ0A 1G4VA 3CD6P 3G71P 3HUSB 4HH2A 1ASLA 2W83C 1AIAA 1SQVK 2BEQD 2O01J 1K73Q 3Q8NA 2D2CB 2YKQA 1GU4A 3L36A 3I16A 2AEMA 2OTKE 4ZLVA 3WLXA 4WY4D 1S06A 3OJAB 3FQ7A 3EI9A 3CQ6A 4PV1C 3TK1A 2FNUA 2O7CA 4PVFA 3ZDMA 1FZCB 2H88C 3TNUB 1SVVA 5KLVG 3C9IA 2D5YA 2HUIA 3BCBA 2IDBA 3CQ4A 4K3AA 4J8LA 2MKVA 2J5UA 2W7JA 5APYA 3II6A 1WRGA 2QVAA 3CXHH 3K28A 5H2FH 2LKMA 1RH5B 1ZRTE 4LGDE 1MV8A 3ASAA 2QJKC 1Z3ZA 5C39A 1X9VA 2Z9WA 1GL2C 1PGJA 4W5KA 3FCRA 1XI9A 3CCMP 1SQPE 2WPQA 3TGUJ 5KAIH 1NWQA 1YHQP 3H32B 3P6KA 3AE7C 3GW6A 3GF3A 2YHKA 2OYIB 5E79H 1FDOA 4GE4A 1NTKJ 2XKMA 4I7ZB 2CINA 3L74J 4KJMA 4OWFA 2W8JA 2GA1A 2C81A 2OYIA 3H1HG 1HGZA 3AEDC 1IZNB 3GHGA 3AATA 3NDNA 1BS0A 2YKOA 2YKPA 4F5JA 2WITA 4ZM3A 3MIWA 3EI6A 1B5PA 4R5FA 1DJUA 1AAMA 2BI9A 5FT6A 1YJYA 3E6GA 5F9SA 4EMYA 1OFCX 5AW6B 1AQ5A 4RKDA 1KILE 4W8IA 2R5DA 2IZ0A 1KKJA 4W7ZA 1IFDA 3D70A 3L73G 3K5BA 1HTLC 3B5ND 4ADEA 1BW0A 2E43A 1LC5A 3BVHA 1QITA 1NTKK 5GTHH 2QJPC 1LTTC 1IAXA 1I43A 4NPDA 1V2EA 2E54A 1DH3A 1NAYA 3A9XA 1D7VA 3NXSA 3NFQA 4TLFA 1GCKA 4CVQA 2EZ1A 3PJSK 1IBJA 3AEJA 4WY4B 4GODA 4WXBA 3CQ5A 3BV0A 3HUSC 1D7MA 5CJ4A 5JAYA 1RVYA 2HOYA 3ATHA 5K8BA 1QJ5A 2W8VA 5AVQB 1C7GA 4IY7A 1URQC 2YKUA 4IFFA 3M5UA 1EZVD 3AE5C 1ZRTD 5AVWB 4HKZH 2CJGA 1RQUA 1USDA 3ELPA 5G0AA 2ZJSE 3H1LD 3RBLA 3P8CD 1FZGA 2M5AA 1OXOA 2Q7CA
chains in the Genus database with same CATH topology
1YNUA 3HD7C 3BWOA 1LTJB 1T2KC 2EO5A 4ZDOA 4QGRA 1T8ZA 2M3BA 4IW7A 1WKHA 1WYUA 5HDMA 1T3UA 1M7YA 2GUSA 3HMUA 2HZPA 4DQ6A 1YIZA 3UAKA 4ISYA 2I1JA 1WYTB 1SLQA 2BWPA 1N73A 3WKSA 3N7NA 3TSIA 1FU1A 3OP7A 1DKAA 1M0OA 3COGA 3N5MA 5HXXA 2C9LY 5G4JA 2FYUK 5APUA 3VK3A 3HQTA 1ZR2A 3FVSA 4BQ0A 1T3JA 3A9YA 3KGWA 3R9AA 3TCMA 3B5NA 1IJDB 3G3ZA 1BQDA 3MC6A 1JUNA 5BU5A 4JYCA 3HT4A 2HUUA 4AO9A 4CBSA 1QL2A 2DGLA 4AZJA 4WB4A 4XJPA 4PFFA 3V5BA 3BWNA 2HUFA 2O1BA 1SQBK 2JJHA 3LV2A 3LVMA 2NPSA 4P7YA 1G2CA 2C0RA 2GMSA 1DJ9A 3IFMA 5AW1B 1LWUC 5EFSA 1P3WA 1HJBA 4GSAA 2BHXA 4Q76A 2KB7P 3AELA 3E2FA 1J04A 3N4XA 1LT9B 2BIAA 1G7WA 3HD7D 4CXRA 4L0OA 4UHOA 2CTZA 2I1KA 4WBTA 3QI6A 1YJSA 1L4AC 2VMNA 2OYHC 4MKJA 2WSEH 3PAAA 3PD6B 5EQCA 1J1DC 3DODA 3RBFA 1SPAA 2OYHB 2VMRA 1XEYA 3AENB 2NPSC 1Y4IA 5DJ1A 4MSOA 4ZAHA 2E7UA 3A2AA 1B9IA 2Z61A 5M4BA 1KL2A 4RJ0A 2X8UA 1BJNA 1GL2A 3DXWA 1WYVB 4TMRA 2QBTA 2D64A 4M2MA 3ASBA 2F8JA 4M3LA 3RK3C 1RVUA 3DC1A 1VEFA 3PGYA 2BYJA 1AY5A 3MBBA 4K2MA 3M91A 5AW5B 2W7HA 3M0DA 4PIWA 1BKGA 2EH6A 3FVUA 3B8XA 1ZV8A 2W7DA 4OBVA 2ZUKA 1JY3P 5F8VA 3ZZKA 2Z20A 4LC1A 1Z7DA 2CFBA 5G4IA 4E3QA 2Z1YA 2KP8A 1EJIA 4A00A 5C6UA 2WB6A 3LWSA 1ARGA 1BT4A 4XJOA 2Z9VA 2XBNA 3JTXA 1FZEA 1NKZB 1N7LA 1LW4A 2PO3A 3A5TA 2Z5IA 1AKCA 1V2FA 1O69A 4K05A 3LIDA 1WYTA 1JTHA 2Z5HA 5TF5A 1LK9A 1SZSA 1JY3N 1GD2E 1ZOBA 4IXOA 2BWNA 4IFDK 1SZKA 1HGVA 1W3UA 1G1IA 2HPCB 1FZFA 1S9KE 1OXPA 3KQGA 3HE4B 3P32A 1E5WA 1ASMA 1FBMA 3NU8A 1CW5A 1QL1A 2C9NY 4WXGA 3HE4A 2E7JA 1D7UA 2WTYA 1SQXK 3U1CA 3FVXA 1J32A 1GTWA 2VIBA 3VP6A 2FN6A 2XNXA 3FQ8A 1N86A 5I92A 1GDEA 1ECXA 3WMM0 1SF2A 1G7XA 1UKJA 1RE4C 3LVKA 3G0TA 2QSRA 4WY4A 3RL0C 2PAJA 1B5OA 1LS3A 1YJZA 4LW4A 2WWWA 2N1TC 3NYSA 4F5LA 1XTGB 1T3IA 2QM7A 2O0RA 5AVVB 4I1LA 4CXQA 8AATA 1MFZA 4IXZA 3OA7A 2VMXA 2QM8A 2YCTA 3P8CE 1JCDA 2XDJA 1PMOA 5AVUB 1EG5A 4N0WA 2AY9A 1GD9A 4ADBA 2VMWA 4MQQA 3ZRQA 3EI7A 4N6JA 5D5SA 3KE3A 1LTIC 2R32A 3V2PA 3VMYA 2YRRA 4MQRA 3FRKA 2AY2A 2R2NA 1URQD 2W8WA 4CBRA 4AO4A 1AICA 3OAKA 2IFMA 1X8YA 1OWAA 4ZWVA 3W1IA 5CCHA 1H1CA 2DOUA 1JY2O 2DKBA 3G8MA 2BI5A 1SFCB 3FFRA 1N2TA 1Z56A 4GE9A 2HPCA 2GSAA 2D65A 4HYTB 5AVTB 2HLOA 4AQRD 3BC8A 1B8GA 2WT7A 5DB5A 1IFNA 2OATA 5HHYA 3NRAA 2PP6A 3CI9A 3B1DA 2WK8A 2H8PD 4A6TA 5E5IA 1JG8A 1OATA 1N8PA 1NTZK 3L4FA 3JWBA 1GU5A 1SFFA 5AW3B 2W7KA 5AW9B 2YOBA 1AHGA 2E7IA 1DX7A 1FZCC 3PA9A 2BWOA 2KSJA 3I4JA 2AEUA 1FC4A 3ELEA 3EQ2A 1M0QA 2C7TA 3V4QA 2POHA 2Q9IA 2E42A 2CH1A 1S9KD 1G1JA 3PPLA 3NYUA 3P1TA 2NPSD 1JOCA 2KOGA 2HP1A 4ATQA 1MGVA 5G09A 2XU6A 2ZYJA 1X29A 3N75A 5AVZB 1ASEA 1AJRA 2QA3A 5G2QA 4ADDA 2C44A 1XTCC 3WGCA 3B8EB 4I2LC 4JF7A 4KYOA 5KJ7C 1JO5A 3HD7A 2ZJGA 1I48A 3CLQA 1EQ7A 4WY4C 4WLJA 1QZ9A 1IX7A 2OKJA 3FZ8A 1LWUB 4ZSWA 2W6BA 3K40A 1MUUA 4JEYA 4WLHA 2KFPA 3VYIA 1EQBA 1O62A 4RKCA 3V2RA 2X5DA 4NOGA 2YO3A 1FOSF 2WZ7A 4MKKA 4N3YB 3R2PA 1AHEA 2EZ2A 1N2DC 3HTKB 4GT1A 2YKVA 2R3CA 4E3RA 2R0TA 4E1OA 2PB0A 2AY7A 3GJUA 1N7SD 1VJOA 4KXKA 4JF0A 1YTZI 2WT7B 1AIBA 3B5NB 3EI8A 4UQVA 1LTJA 4OBUA 3IHJA 3NTNA 1W7NA 1VDFA 2M8RA 3JZLA 1CI6B 3VK2A 3E2ZA 2HOXA 2VMQA 3P8MC 3T32A 2CH2A 4U2HA 1CZQA 2OKKA 2AY5A 1M1JA 2N1TB 1HBWA 3HE5A 2HODA 4C7RA 4XAUA 7AATA 1JMMA 1M0PA 3D6KA 3SWYA 2FKIA 1X79B 2BI2A 2IPPA 4AYCA 1JTHB 4OT8A 4LNLA 1RF0A 5CMZA 1CS1A 2VMPA 4FFCA 4JEVA 3HBXA 3TFTA 1MLYA 4FL0A 1OHWA 5AW4B 4UHNA 3TYYA 4M2KA 1NOHA 2WPRA 3GHGC 1YTZT 1HWTC 4LLHA 2VLHA 3EZSA 2R5EA 1OHYA 1GC4A 2W7LA 5KTBA 2TPLA 4TN4A 3AENA 4ZDLA 1DFOA 2H7HA 4AH3A 1JNMA 1AHXA 1AJSB 2BI1A 3ACZA 3G7QA 1IO4A 4XE5B 1FJPA 5EUDA 1AMSA 2FKWB 2ZP7A 1H8AA 4IYOA 1N7SA 3AOWA 3HLMA 2DR1A 3M9QA 4EB7A 4EOTA 5AX8A 4JEWA 2VRSA 1M0NA 2GUVA 1TOKA 5AVYB 4WB0B 2EYQA 4ITXA 1OXZA 3ECDA 1TARA 2FFDA 2DGMA 3WCOA 4LNMA 2D7ZA 1X0MA 3EI5A 1AAWA 2Q3IA 2AY1A 1LTBC 1MAPA 2VGVA 4BHDA 1JY2P 5BU8B 1ZR4A 4JYBA 4RESB 2VI8A 1RY3A 4KAMA 3USFA 1ASBA 3QN6A 1ARTA 1HUCA 3QHXA 1IVRA 3DR7A 2NPSB 2KLVA 4GDYA 3VK4A 1IFMA 5E4ZA 3VN0A 4R5ZA 2HFED 1J1EC 1N73C 2OARA 2CANA 3U59A 3L8AA 3VMXA 3ZZJA 3GBXA 1ASGA 3QPGA 1W7LA 1DEBA 4J5UA 4W1WA 2BIEA 4B86A 2CJHA 1A02J 1MAQA 5EAAA 4B98A 3GZDA 2WKAA 4BMKA 1SQPK 1WYUB 1IAYA 4Y0IA 2A45H 2PB2A 1ARHA 3MUDA 4C7NA 4U1TA 1VP4A 2Z1ZA 3RK3B 5G2PA 1M1JB 2ZC0A 3A2BA 2YRIA 1GW4A 3CAIA 1L0NK 2G7JA 2JEEA 3V4WA 3EFGA 1YAAA 3EIAA 2D66A 2YCPA 2ZY4A 4AUWA 1OHVA 1GK6A 3MC6C 1JF9A 2WSCH 1FAVA 1PG8A 1KMJA 1U08A 5DX5A 4OYTA 1AY8A 3RQ1A 1S08A 1ZN5A 1M32A 1PFFA 1KQLA 1FG7A 1WSTA 1E5EA 3AEOA 5AW7B 4WYGA 1L4AA 1C0NA 1LGHB 5FT8A 2HOZA 3ISLA 2CB1A 4W80A 3E2YA 3FZ6A 2N1TA 5BJ3A 3F9TA 1ASCA 3HVYA 4WP0A 3P7KA 3DR4A 5CCGA 1W7MA 4DBCA 3VMZA 1ZODA 2VMOA 3MADA 3I5CA 2ZY2A 2BASA 3VP8A 4F5MA 5IWQA 3E77A 1CQ6A 3RCHA 5EUEA 1PFIA 1D7RA 4BA5A 3HTKA 1QISA 4Y0HA 3BWNC 2W7FA 1MZ9A 4DGTA 1LT9A 2O1KA 2GM4A 2FFDB 3HDOA 4XJMA 3CBFA 4OH8B 2VGWA 2IX7C 2P1JA 2OYHA 1H0CA 1ASDA 1I29A 1GL2B 3FZ7A 1T2KD 3FFHA 3JWAA 1CI6A 1GDTA 1MDXA 1IX6A 1CSBA 3L44A 4MY5A 1CL1A 3GSBA 5CCHD 1DGDA 2NMPA 2GMUA 4ZDPA 1RE3A 3JW9A 1ORDA 3E1IA 4BA4A 2ZFCA 4RM1A 1W23A 3GHGB 1V2DA 1WT6A 3BB8A 4LW2A 3WCNA 1ASFA 1KMKA 4K2IA 1TASA 2GQNA 1JCCA 3EZ1A 3WX9A 3PDBA 3M06A 3DRDA 1LW5A 5EIGA 1NHLA 4ZKPA 1RF1C 3RL0D 4LNJA 1CZEA 4WD2A 2MJZA 5FT4A 4PFNA 1FJKA 4N78E 5M4DA 1YYCA 2AY3A 3FDBA 3BRTB 2P67A 5CCGC 2HP2A 2AEVA 1SFCD 1GC0A 5KJ7A 2YKYA 3FKDA 2CPBA 3PP5A 3AV7A 4A0RA 1URQB 1AKAA 1BJOB 1D7SA 4GEBA 4M2JA 3K7YA 4JEZA 3F0HA 1QIRA 5AW8B 3TQXA 4W1VA 3N4RA 2VMSA 3BASA 1GK4A 3UIAA 1IJIA 2J59M 2W7GA 2Z9XA 1WKGA 1GL2D 1HVVA 4IX8A 3I5TA 2VMTA 3RUYA 1MDZA 4XK1A 3E2ZB 3RI6A 4WYDA 2W7MA 4UOYA 1KFNA 1BJ4A 1FOSE 4F5GA 5APSA 2ORDA 1TOIA 3NNKA 3RK2C 4RIZA 4ADCA 4RAEA 1HH0A 3NUIA 2FQ6A 4HF8A 4EB5A 3KDPB 3H6PA 3AOVA 4P3MA 1YOOA 3NX3A 3BS8A 1KILD 3WY7A 2OYIC 1RF0C 3E9KA 4IFMA 4XJLA 2OGAA 2A45G 1JS3A 3RK3D 3EUCA 5AW0B 3PDBB 1FZBA 3HL2A 4XQ2A 4A72A 2OGEA 2QB3A 3FSLA 2ZY5A 2D63A 1ELUA 3TNUA 2VGZA 1G4XA 1VPCA 2VI9A 1ELQA 3DZZA 2D7YA 1AKBA 2X5FA 3R4TA 4ZKUA 5KJ7D 2YCNA 2V0YA 5BVZA 5AVXB 5CCHC 1H88A 2W27A 2ZY3A 3IR9A 1BJOA 5EUNA 1ZLLA 4AZKA 2DGKA 9AATA 1DGEA 1RF1B 2XV5A 1GEXA 1W2EA 1JY2N 1CZCA 5APXA 2OQXA 4C7NB 1PMMA 1C7NA 2XH1A 4DOJA 1J1EB 1UU1A 2P7JA 1NKNA 1AHFA 4ZSYA 2O1JA 1FZCA 1A02F 1TOJA 3FTBA 3NTJA 3FQAA 3II0A 2R5CA 3DYDA 2EPJA 2L5GB 1X2AA 2FFDC 3DU4A 4WYCA 1UU2A 4Q31A 3NU7A 1ASAA 3PDXA 3A7OA 4JF1A 1JY3O 2Z4EA 2X3LA 4E77A 3BCXA 3VAXA 3LIEA 2FYFA 1KILB 1NU1K 1SFCC 4Y99C 5APTA 5CHXA 3LVJA 3T97A 4K2BA 1J2JB 2A45I 1N7SC 3HRNA 2BKWA 1FG3A 5FT5A 2N9BA 1H89A 1LWUA 1IFJA 1LKCA 4GKGA 2N1TD 3H9XA 3QM2A 1B4XA 1JS6A 3N0LA 5D95A 1N31A 1C4KA 4GRXA 3TFUA 3W1JA 4Q75A 1X28A 5M49A 1KILC 4EU1A 4GE7A 1ARSA 3V2NA 3M0DC 2QLRA 1IK9A 3KKIA 1E5FA 4WB0A 3O8ZA 4Y99B 3MAFA 5APVA 4EFFA 3GR9A 2YNYA 3DXVA 4AOAA 2W6AA 1GBNA 3RK2D 4WYAA 3FD0A 2V1PA 1RF1A 3HUSA 2JGTA 1WYVA 1KILA 3LW5H 3LVLB 3U1AA 3TATA 1NH4A 4OTLA 2J58A 1CQ8A 5AVSB 2YKXA 2IFNA 4A0FA 3PJ0A 3BN1A 3MKJA 3H32A 2C0WA 2C0XA 3NMDA 1LTAC 3AEPA 4Q6RA 3MD0A 1SVFA 1AJSA 1IFIA 1SZUA 2FM1A 3CL3D 1D2FA 2CJDA 3ZRRA 1M6SA 1M1JC 3B1CA 5KLVK 2VGSA 1V72A 1QGNA 1NTMK 4LC3A 3KYQA 2H43A 2QB2A 2KYVA 2FXMA 4IXSA 2GB3A 4GIFA 3MAFB 3HD7B 4ZASA 3B46A 4A6UA 1C7OA 3NUBA 3OKSA 3AEMA 1GW3A 1N73B 4XEWA 1AMRA 1AY4A 2AATA 3QGUA 2AY4A 3GWPA 4H63Q 1ZC9A 4F5KA 3N4SA 3V2QA 3MAUA 1RV3A 1URQA 3HE5B 3B1EA 3AEMC 1M4NA 2Q5UA 2WK7A 4F5FA 1C9CA 4JEXA 4HVKA 1MDOA 4XA4A 3VTPC 5APWA 4A6RA 3AEJC 5E3KA 1AX4A 3GETA 2ZXEB 1LTGC 3RK2B 1RE4A 2A1VA 3A8UX 1CJ0A 4H51A 2R5BA 5CCGD 5EAVA 2BIGA 1UU0A 4RITA 2Q7WA 4F4EA 1KZUB 5AW2B 4WYFA 2FYZA 3W1HA 2W8TA 1AMQA 2WSFH 1QJ3A 1S07A 1O4SA 5EIGB 2BYLA 1LTJC 3NYTA 4RJYA 4DZOA 2AY6A 3M0AA 3VOPA 2VGTA 3BATA 1RE3C 4A0HA 2JJFA 3QBOA 1AHYA 5M46A 3M9BA 4W1XA 3PIUA 4R2NA 5AVRB 4F5HA 2CPSA 1CQ7A 1B9HA 4RLGA 2YMYA 4N78D 2ZSLA 4OCAA 5APQA 4WBAA 1M7LA 2JG2A 1G2CB 1TOEA 3SWFA 4O9BA 1J1DB 4ZWMA 4WXFA 2W8UA 2HORA 2WK9A 4IYOB 3GZDC 5DJ9A 2Z9UA 3ZRPA 3WGBA 3UE8A 4ITGA 4I6MC 3KGXA 1S09A 3BCAA 4KHXA 2VGUA 2XZRA 2VMYA 1FZAA 1SQQK 1BJWA 1S0AA 1DJEA 2W7EA 2HODB 3L37A 1TOGA 4F5IA 1ASNA 1O61A 1RV4A 2W7IA 2DKJA 1CL2A 3WZFA 1L0LK 1SP4A 4I8AA 2VIAA 1L4AD 3A9ZA 3M9HA 1TPLA 5BJ4A 1LC8A 1I41A 1GEWA 2JJLA 2BI3A 2WPSA 3VP9A 3PD6A 2JJEA 1GC3A 2JISA 1YIYA 2CY8A 2VYCA 2VMZA 2VMVA 1NO4A 3FDDA 4W91A 4Y0DA 1DTYA 3L35A 1ARIA 2CSTA 2ZSMA 4WYEA 1GC2A 4ATPA 3EIBA 3A3YB 4W7YA 3MGNA 3KPEA 2JJGA 3B5NC 1FDMA 1GEYA 1KFMA 2RFVA 3F6TA 1AMAA 1KKPA 1SFCA 1LTSC 2D61A 2EGYA 4OC9A 1MLZA 2P2UA 2QMAA 4MQPA 1IUGA 4A0GA 1N7SB 2O01H 4C46A 4R8DA 3LY1A 3UWCA 2AY8A 2VLFA 3WKRA 3MEBA 1GZLA 3MTUE 1BQAA 3RCHB 3GZCA 2G6WA 2YO2A 4UHMA 2VMUA 1KL1A 1IC2A 3VOMA 3BRVB 2R5CB 1LC7A 1TATA 1IX8A 3LG0A 4ZM4A 5J8QA 1AFOA 4O6ZA 2HG5D 2HYNA 4OMAA 4B9BA 4EIJA 1LT9C 3RL0B 1NAFA 2FNIA 3H7FA 1L4AB 5CJ0A 1G4VA 3HUSB 4HH2A 1ASLA 1AIAA 1SQVK 3Q8NA 2YKQA 1GU4A 3L36A 3I16A 4ZLVA 3WLXA 4WY4D 1S06A 3OJAB 3FQ7A 3EI9A 3CQ6A 3TK1A 2FNUA 2O7CA 4PVFA 1FZCB 3TNUB 1SVVA 2D5YA 3C9IA 2HUIA 3BCBA 3CQ4A 4J8LA 2W7JA 5APYA 3II6A 1WRGA 3K28A 2LKMA 4LGDE 3ASAA 1MV8A 1Z3ZA 1X9VA 2Z9WA 1GL2C 4W5KA 3FCRA 1XI9A 2WPQA 1NWQA 3H32B 3P6KA 2YHKA 2OYIB 4GE4A 2XKMA 2CINA 2W8JA 2C81A 2OYIA 1HGZA 3GHGA 3NDNA 3AATA 1BS0A 2YKOA 2YKPA 4F5JA 2WITA 4ZM3A 3MIWA 3EI6A 1B5PA 4R5FA 1DJUA 1AAMA 2BI9A 5FT6A 1YJYA 3E6GA 5F9SA 4EMYA 5AW6B 1AQ5A 4RKDA 4W8IA 2R5DA 1KKJA 4W7ZA 1IFDA 1HTLC 3B5ND 4ADEA 1BW0A 2E43A 1LC5A 3BVHA 1QITA 1NTKK 1LTTC 1IAXA 1I43A 1V2EA 2E54A 1DH3A 3A9XA 1D7VA 3NXSA 3NFQA 1GCKA 4CVQA 2EZ1A 1IBJA 3AEJA 4WY4B 4WXBA 3CQ5A 3BV0A 3HUSC 5CJ4A 5JAYA 1RVYA 2HOYA 3ATHA 5K8BA 1QJ5A 2W8VA 5AVQB 1C7GA 4IY7A 1URQC 2YKUA 4IFFA 3M5UA 2CJGA 5AVWB 3ELPA 5G0AA 3RBLA 3P8CD 1FZGA 1OXOA 2Q7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U59 A;  3N4S A;  5BVZ A;  3BAT A;  3VP8 A;  3HRN A;  3N7N A;  3U1A A;  3N4R A;  3BAS A;  3U1C A;  1NKN A;  1X79 B;  4O9B A;  5BU8 B;  2POH A;  3OJA B;  4ZKP A;  5BU5 A;  3N4X A;  3C9I A;  4I1L A;  1WT6 A;  2JEE A;  4N3Y B;  4ZKU A;  3P8C D;  1IC2 A;  2FXM A;  3VP9 A;  5KTB A;  4N78 D;  4GIF A; 
#chains in the Genus database with same CATH topology
 1H0T B;  2QJY C;  1YNU A;  3HD7 C;  1Q7Y Q;  3BWO A;  3CPW O;  2E76 B;  1LTJ B;  1T2K C;  2EO5 A;  4ZDO A;  4QGR A;  1T8Z A;  2M3B A;  4IW7 A;  2I8D A;  1WKH A;  3BCC D;  1W2B O;  3H1H J;  1WYU A;  5HDM A;  1T3U A;  1M7Y A;  2GUS A;  3HMU A;  3BCC G;  4GOE A;  2HZP A;  4DQ6 A;  1EXI A;  1YIZ A;  3UAK A;  4ISY A;  4WWI A;  1HF9 A;  2I1J A;  5M1B A;  1WYT B;  1SLQ A;  4H13 D;  1N73 A;  2BWP A;  4Z1M H;  3WKS A;  3N7N A;  1SQX J;  1SQP D;  3TSI A;  1FU1 A;  3OP7 A;  1DKA A;  1M0O A;  3COG A;  1M1K Q;  3N5M A;  5HXX A;  2C9L Y;  5G4J A;  5DJU B;  2FYU K;  2Y0D A;  5APU A;  3VK3 A;  1ZP0 C;  3WUU A;  1ZR2 A;  3HQT A;  1L0L G;  1L0L E;  3FVS A;  3O6Q A;  1T3J A;  4BQ0 A;  3A9Y A;  3Q5S A;  3KGW A;  3B71 A;  1EDI A;  2D2C D;  3R9A A;  2K88 A;  5K5G B;  3TCM A;  3B5N A;  1IJD B;  3G3Z A;  1BQD A;  2AXC A;  3MC6 A;  4RJT A;  1JUN A;  5BU5 A;  4U3F E;  2H89 C;  4JYC A;  3HT4 A;  1DD3 A;  2HUU A;  1N8R Q;  2G8Y A;  3L70 E;  2IYO A;  4AO9 A;  2FY8 A;  3A0B H;  4CBS A;  3MZW B;  1PPJ E;  1QL2 A;  1NTM G;  5CBN A;  2DGL A;  2QRX A;  1OVV A;  3TF5 A;  4AZJ A;  1LJ2 A;  4WB4 A;  4XJP A;  4PFF A;  3V5B A;  3BWN A;  2HUF A;  2O1B A;  1SQB K;  2KZI A;  2JJH A;  3LV2 A;  3LVM A;  2NPS A;  3FWL A;  1YQ4 C;  4P7Y A;  1G2C A;  2C0R A;  3L75 G;  2Y9Y A;  1NTZ G;  2GMS A;  1M8O B;  1DJ9 A;  1OVR A;  3IFM A;  5AW1 B;  1LWU C;  5EFS A;  1P3W A;  2LXB A;  3S4R A;  1HJB A;  4GSA A;  5EFW B;  2BHX A;  4Q76 A;  2KB7 P;  3AEL A;  3E2F A;  1J04 A;  3N4X A;  1LT9 B;  2BIA A;  1G7W A;  4QMA A;  5KLI C;  3HD7 D;  1NTK G;  4CXR A;  4L0O A;  4UHO A;  2CTZ A;  1EDL A;  3AE8 C;  2I1K A;  4WBT A;  3G6E P;  3QI6 A;  4ZMD A;  1YJS A;  1L4A C;  2VMN A;  2OYH C;  4MKJ A;  2WSE H;  3H1I J;  3PAA A;  3PD6 B;  5EQC A;  3FGA D;  1J1D C;  3DOD A;  3RBF A;  1FC2 C;  1SPA A;  2OYH B;  2VMR A;  1XEY A;  3AEN B;  2NPS C;  1Y4I A;  5DJ1 A;  1L0L D;  4MSO A;  4ZAH A;  2Y0C A;  1K9M Q;  2E7U A;  2WSS H;  3A2A A;  1B9I A;  2Z61 A;  5M4B A;  1KL2 A;  1PP9 D;  4RJ0 A;  3PHL A;  2X8U A;  1BJN A;  1GL2 A;  3DXW A;  1WYV B;  4TMR A;  2QBT A;  2IBZ D;  2QJP B;  2D64 A;  2JDI H;  4M2M A;  3ASB A;  2F8J A;  2V7Q J;  4M3L A;  3RK3 C;  1RVU A;  3DC1 A;  1W5C E;  1VEF A;  3PGY A;  1AVY A;  2BYJ A;  1AY5 A;  3MBB A;  4K2M A;  3M91 A;  5AW5 B;  2W7H A;  3M0D A;  4PIW A;  1BKG A;  2EH6 A;  3FVU A;  1K04 A;  3B8X A;  1ZV8 A;  1EDK A;  2W7D A;  3USS A;  4OBV A;  2ZUK A;  1JY3 P;  5F8V A;  3ZZK A;  4PD4 D;  2Z20 A;  4LC1 A;  4H0L D;  1Z7D A;  2CFB A;  5G4I A;  4E3Q A;  2Z1Y A;  2KP8 A;  1EJI A;  1FDI A;  4A00 A;  5C6U A;  2AEF A;  2WB6 A;  3LWS A;  1ARG A;  1BT4 A;  1QX8 A;  1SQQ G;  2KNC B;  2Z9V A;  4XJO A;  2XBN A;  3JTX A;  1FZE A;  1KQF B;  1NKZ B;  1N7L A;  1LW4 A;  2PO3 A;  3Q5P A;  3L72 D;  4MN4 C;  3A5T A;  2Z5I A;  1AKC A;  1V2F A;  4L75 A;  1O69 A;  4IL6 E;  4K05 A;  3LID A;  1WYT A;  4EI2 A;  1JTH A;  2Z5H A;  5TF5 A;  1LK9 A;  1SZS A;  2BEZ F;  1KQS O;  1QVF O;  1JY3 N;  1GD2 E;  1EZV G;  5H2F E;  4L74 A;  1ZOB A;  4IXO A;  3PTZ A;  4IFD K;  1SZK A;  2BWN A;  2KI7 B;  1HGV A;  1W3U A;  2K9J A;  1G1I A;  3BCC E;  2HPC B;  1KOR A;  1FZF A;  4UB6 H;  1S9K E;  1OXP A;  3KQG A;  3HE4 B;  3P32 A;  1E5W A;  1ASM A;  1FBM A;  3NU8 A;  1CW5 A;  1QL1 A;  2C9N Y;  4WXG A;  3HE4 A;  2E7J A;  2WSF J;  1D7U A;  2WTY A;  1SQX K;  3U1C A;  3FVX A;  1PPJ D;  1J32 A;  1GTW A;  2VIB A;  3VP6 A;  2FN6 A;  2XNX A;  2QEX P;  1N86 A;  3FQ8 A;  5I92 A;  1GDE A;  1ECX A;  3WMM 0;  1TU3 F;  1SF2 A;  1G7X A;  1UKJ A;  3A0H E;  3CX5 I;  1RE4 C;  3LVK A;  3G0T A;  2QSR A;  4WY4 A;  3RL0 C;  2PAJ A;  1B5O A;  1LS3 A;  1YJZ A;  4LW4 A;  2WWW A;  2N1T C;  2A06 G;  3NYS A;  1KYO I;  2R3S A;  4YPC A;  4F5L A;  1NTM J;  1XTG B;  1S5L E;  1T3I A;  1VQO P;  2QM7 A;  2O0R A;  5AVV B;  1SQQ J;  5CBO A;  4I1L A;  3GMA A;  4CXQ A;  2B9B A;  1SQX D;  8AAT A;  3SFD C;  1MFZ A;  3H1L G;  3OA7 A;  2KS1 B;  2VMX A;  4IXZ A;  2QM8 A;  2YCT A;  3P8C E;  1JCD A;  2XDJ A;  1PMO A;  2RMZ A;  1K05 A;  3QH9 A;  5AVU B;  1EG5 A;  4N0W A;  2AY9 A;  1GD9 A;  4ADB A;  2VMW A;  3W67 A;  4MQQ A;  3ZRQ A;  3EI7 A;  1PGQ A;  1YJ9 P;  2ITA A;  4N6J A;  4H0L C;  5D5S A;  3KE3 A;  1LTI C;  2R32 A;  3V2P A;  3VMY A;  1VQP P;  2YRR A;  4MQR A;  3CCQ P;  3FRK A;  2AY2 A;  2R2N A;  3S9O A;  3KXD A;  1URQ D;  2W8W A;  4CBR A;  4AO4 A;  1AIC A;  2OQQ A;  3KZI H;  3OAK A;  2IFM A;  1SQP G;  3GLM A;  1X8Y A;  1NTK E;  1OWA A;  4ZWV A;  3W1I A;  5CCH A;  1H1C A;  2A06 D;  2DOU A;  2K37 A;  1JY2 O;  2DKB A;  1NTZ D;  3G8M A;  1KC8 Q;  2BI5 A;  1SFC B;  3FFR A;  3RK3 E;  2NZ2 A;  1N2T A;  1KYO D;  1Z56 A;  1EDJ A;  4GE9 A;  2HPC A;  2GSA A;  4I7Z C;  2D65 A;  4HYT B;  5AVT B;  2HLO A;  4AQR D;  1FS0 E;  3BC8 A;  1EXJ A;  1B8G A;  1LT1 A;  1BDC A;  1NYH A;  2WT7 A;  2IYP A;  5DB5 A;  5KLV E;  1IFN A;  1K8A Q;  2OAT A;  3GF7 A;  2OGU A;  5HHY A;  2RH0 A;  3NRA A;  2PP6 A;  3CI9 A;  3B1D A;  2WK8 A;  2H8P D;  4BRY A;  5E5I A;  4A6T A;  2WSE J;  1JG8 A;  1DEE G;  4PV1 B;  4OGQ C;  1OAT A;  1N8P A;  1NTZ K;  2E75 D;  3L4F A;  4H44 D;  3JWB A;  3H1L J;  1GU5 A;  1EC5 A;  3AEG C;  1SFF A;  5AW3 B;  2W7K A;  5AW9 B;  2YOB A;  1AHG A;  2E7I A;  2WVR A;  1DX7 A;  1FZC C;  3PA9 A;  3H1K G;  1LP1 A;  2BWO A;  2D2C C;  3FXE A;  2KSJ A;  3D6Z A;  3I4J A;  2OYO A;  2AEU A;  1EZV E;  1FC4 A;  3ELE A;  3EQ2 A;  3BCC J;  1M0Q A;  2C7T A;  3V4Q A;  2POH A;  2Q9I A;  2E42 A;  3SWK A;  1QVG O;  2KZJ A;  2CH1 A;  1S9K D;  1G1J A;  1R5L A;  3PPL A;  1QLE D;  3NYU A;  3P1T A;  2NPS D;  2HR3 A;  3AEC C;  1JOC A;  2KOG A;  1L0N D;  2Q6Q A;  3CXH D;  2HP1 A;  4ATQ A;  1MGV A;  2WSC J;  5G09 A;  2XU6 A;  2ZYJ A;  2YXQ B;  1KTM A;  4OVN F;  1X29 A;  3N75 A;  5AVZ B;  1ASE A;  1AJR A;  2QA3 A;  5G2Q A;  4ADD A;  1KB9 D;  1AV1 A;  1PGO A;  2C44 A;  1M56 D;  1XTC C;  3WGC A;  3CX5 H;  3B8E B;  1ZW0 A;  3A0B E;  4I2L C;  4JF7 A;  4KYO A;  5KJ7 C;  1JO5 A;  3HD7 A;  2ZJG A;  1I48 A;  3CLQ A;  1EQ7 A;  4WY4 C;  4WLJ A;  1QZ9 A;  1IX7 A;  2OKJ A;  3FZ8 A;  1LWU B;  4ZSW A;  2W6B A;  3K40 A;  1MUU A;  4JEY A;  4WLH A;  2KFP A;  3VYI A;  1EQB A;  1O62 A;  4RKC A;  3V2R A;  2X5D A;  5E79 E;  1BGY E;  4NOG A;  2K3R A;  2YO3 A;  1FOS F;  2WZ7 A;  4MKK A;  4N3Y B;  3R2P A;  1AHE A;  2EZ2 A;  4YTP C;  1MKM A;  1N2D C;  3HTK B;  2JKV A;  4GT1 A;  3TDK A;  2YKV A;  2R3C A;  4E3R A;  2R0T A;  1SQV G;  4E1O A;  4BWN A;  2PB0 A;  2AY7 A;  3GJU A;  1N7S D;  1VJO A;  4KXK A;  4JF0 A;  1YTZ I;  2WT7 B;  1AIB A;  1KB9 E;  3B5N B;  3EI8 A;  4UQV A;  1JB0 J;  1LTJ A;  2K9Y A;  4OBU A;  3IHJ A;  3L75 D;  3NTN A;  1W7N A;  3A0H H;  1OMI A;  1QEX A;  1VDF A;  3PRJ A;  2M8R A;  3JZL A;  1CI6 B;  3VK2 A;  3E2Z A;  2HOX A;  4ZNC A;  3L74 E;  2VMQ A;  3P8M C;  1P84 E;  3SFE C;  3T32 A;  1NTK D;  2CH2 A;  4U2H A;  1CZQ A;  2OKK A;  2E74 D;  1M1J A;  2AY5 A;  2N1T B;  1JMB A;  1HBW A;  3HE5 A;  3L73 E;  2OTJ P;  2HOD A;  4C7R A;  4XAU A;  4U7J A;  7AAT A;  1PIX A;  2QJK B;  3CME P;  1JMM A;  1M0P A;  2FYU G;  3L71 E;  2XND H;  3D6K A;  3SWY A;  2B88 A;  1X79 B;  2BI2 A;  2FKI A;  2IPP A;  4AYC A;  1JTH B;  4OT8 A;  4LNL A;  1RF0 A;  5CMZ A;  1KMI Z;  1SQX G;  1CS1 A;  2VMP A;  4FFC A;  4JEV A;  3HBX A;  4NPF X;  2P58 A;  3TFT A;  1MLY A;  4FL0 A;  1OHW A;  1YI2 P;  5AW4 B;  4UHN A;  3TYY A;  4M2K A;  1NOH A;  2WPR A;  1RQV A;  3GHG C;  1YTZ T;  4EYY Q;  1M90 Q;  1HWT C;  1BDD A;  1SQB D;  2KNC A;  4LLH A;  2VLH A;  3EZS A;  2WPV B;  2R5E A;  1OHY A;  1GC4 A;  2W7L A;  5KTB A;  2TPL A;  4TN4 A;  5KAF H;  3AEN A;  4ZDL A;  1DFO A;  2H7H A;  1KD1 Q;  4AH3 A;  3CMA P;  1JNM A;  2L91 A;  1AHX A;  1AJS B;  2BI1 A;  1OW7 A;  1VQ8 P;  1ZME C;  3ACZ A;  1U7M A;  3G7Q A;  2E75 B;  1IO4 A;  4XE5 B;  1FJP A;  5EUD A;  1AMS A;  1BCC E;  2FKW B;  2ZP7 A;  1NU1 J;  1H8A A;  4IYO A;  1N7S A;  3AOW A;  1BCC D;  3TGU G;  2B87 A;  3HLM A;  3W68 A;  3E1R A;  2DR1 A;  3M9Q A;  4EB7 A;  2ZT9 C;  4EOT A;  1KB9 H;  5AX8 A;  4JEW A;  3ABV C;  2VRS A;  3L72 J;  1M0N A;  2GUV A;  1TOK A;  5AVY B;  3L71 J;  3RBX A;  1X22 A;  2EYQ A;  4WB0 B;  2FYU J;  4PD4 H;  1S5L X;  1ZOY C;  4ITX A;  1OZH A;  1OXZ A;  3ECD A;  1TAR A;  1BSN A;  1VF5 B;  2ZAE B;  2FFD A;  2DGM A;  3WCO A;  4LNM A;  3RL0 g;  1BSH A;  2D7Z A;  1X0M A;  3EI5 A;  1AAW A;  2Q3I A;  2AY1 A;  5L8R J;  1LTB C;  1MAP A;  2VGV A;  3EFF K;  4BHD A;  1JY2 P;  5BU8 B;  1ZR4 A;  4JYB A;  1VQ7 P;  3H1K D;  4JPZ B;  4RES B;  4DCK A;  1HJ0 A;  1T6A A;  2VI8 A;  1VQ6 P;  4ASV A;  1RY3 A;  4KAM A;  2N9Y B;  3USF A;  1ASB A;  3QN6 A;  1DIP A;  1ART A;  1BE3 J;  2E5Y A;  1HUC A;  1IVR A;  3QHX A;  3DR7 A;  2NPS B;  2KLV A;  4GDY A;  3VK4 A;  1IFM A;  3H1H D;  5E4Z A;  1YBK A;  4IL6 X;  3VN0 A;  4R5Z A;  2HFE D;  2E74 C;  3KHU A;  2JWD A;  1VQL P;  1J1E C;  1N73 C;  2OAR A;  1MFT A;  1EZV I;  2CAN A;  3U59 A;  3VMA A;  2Y0E A;  3L8A A;  3VMX A;  3ZZJ A;  3GBX A;  1UII A;  1ASG A;  3QPG A;  1W7L A;  1DEB A;  4J5U A;  4W1W A;  2IBZ I;  2BIE A;  2FYU D;  4B86 A;  2CJH A;  2ZYG A;  1A02 J;  1MAQ A;  5EAA A;  4B98 A;  1Q82 Q;  3GZD A;  2WKA A;  3EWK A;  4BMK A;  1SQB J;  1BCC G;  1SQP K;  2IBZ E;  2O01 N;  1WYU B;  5B5E E;  2E76 D;  1IAY A;  4Y0I A;  2A45 H;  1OW6 A;  2PB2 A;  1ARH A;  3MUD A;  4C7N A;  3L72 G;  4U1T A;  1VP4 A;  2FYU E;  2Z1Z A;  3RK3 B;  5G2P A;  1M1J B;  4IOI H;  2ZC0 A;  1KAF A;  2B87 B;  1P84 I;  2E5T A;  1OIP A;  3A2B A;  2AXT E;  1OW8 A;  2YRI A;  1GW4 A;  3CAI A;  1L0N K;  1SQX E;  2G7J A;  2JEE A;  3V4W A;  3EFG A;  1YAA A;  3EIA A;  2D66 A;  1YIT P;  2YCP A;  2ZY4 A;  4AUW A;  1OHV A;  1GK6 A;  2ZYA A;  3MC6 C;  1JF9 A;  1ZXG A;  2WSC H;  1FAV A;  1PG8 A;  1KMJ A;  1U08 A;  3QWO C;  1NTZ J;  5DX5 A;  4OYT A;  1DD4 A;  1AY8 A;  3RQ1 A;  1S08 A;  1ZN5 A;  1M32 A;  1PFF A;  3CCE P;  1KQL A;  1FG7 A;  1WST A;  1E5E A;  3AEO A;  5AW7 B;  1L4A A;  1C0N A;  4WYG A;  4D6T E;  1LGH B;  5FT8 A;  4XFJ A;  2E74 B;  2HOZ A;  3ISL A;  2CB1 A;  4W80 A;  2Q1K A;  3E2Y A;  1SQV E;  3FZ6 A;  3H1H E;  2N1T A;  3L75 E;  3Q2Y A;  1SQQ D;  5BJ3 A;  3F9T A;  3L74 G;  2G3A A;  1ASC A;  3HVY A;  4WP0 A;  3P7K A;  3DR4 A;  5CCG A;  3L71 G;  2RKL A;  1W7M A;  3KZI E;  4DBC A;  1AQT A;  3VMZ A;  1ZOD A;  2VMO A;  3MAD A;  3AE4 C;  4RKU J;  3I5C A;  2ZY2 A;  2BAS A;  3VP8 A;  1IK7 A;  4F5M A;  5IWQ A;  3E77 A;  2LR2 A;  2KS1 A;  1CQ6 A;  2IZ1 A;  3RCH A;  5EUE A;  2WMM A;  1PFI A;  1D7R A;  4BA5 A;  3HTK A;  1QIS A;  1RHZ B;  3S1K A;  4Y0H A;  3BWN C;  2JP3 A;  2UWJ E;  2W7F A;  1VF5 C;  2W8Z A;  5B66 E;  2PGD A;  1MZ9 A;  4DGT A;  2O1K A;  1LT9 A;  2GM4 A;  5TJH A;  2FFD B;  3HDO A;  4JBZ A;  4XJM A;  4BRY B;  1M57 D;  3L70 G;  1L0N E;  3ITK A;  3CBF A;  4OH8 B;  1LNQ A;  4U3F G;  2VGW A;  2IX7 C;  2P1J A;  2JR8 A;  2OYH A;  1H0C A;  1UIX A;  1VQN P;  1ASD A;  1I29 A;  1GL2 B;  1KV4 A;  1T2K D;  3FZ7 A;  3FFH A;  2FXP A;  3JWA A;  1SQV J;  3L74 D;  1CI6 A;  1GDT A;  1MDX A;  1IX6 A;  1CSB A;  3L44 A;  4MY5 A;  1CL1 A;  3H25 A;  1NGM B;  3GSB A;  5CCH D;  1DGD A;  2NMP A;  2GMU A;  4ZDP A;  1RE3 A;  3JW9 A;  1ORD A;  4TT3 H;  3E1I A;  3MHV A;  4BA4 A;  3CCS P;  2ZFC A;  2Y9Z A;  4RM1 A;  1W23 A;  3I56 P;  3GHG B;  1V2D A;  2QG4 A;  1PZQ A;  1WT6 A;  3BB8 A;  1KYO H;  2O3J A;  4LW2 A;  3WCN A;  1ASF A;  3CXH E;  4UB8 H;  1KMK A;  1PP9 J;  4K2I A;  1TAS A;  2GQN A;  1JCC A;  3EZ1 A;  3WX9 A;  3PDB A;  3M06 A;  3DRD A;  3H1J J;  4UB6 E;  1LW5 A;  3CC7 P;  5EIG A;  1NHL A;  4ZKP A;  1RF1 C;  1E79 H;  1S2E A;  3RL0 D;  4LNJ A;  3AE9 C;  1CZE A;  1R8E A;  3C8V A;  3IAO A;  4WD2 A;  2MJZ A;  5FT4 A;  2QE7 H;  1NJI Q;  4PFN A;  1FJK A;  4N78 E;  3RGU A;  5M4D A;  1YYC A;  2AY3 A;  1BE3 E;  3FDB A;  3AE2 C;  3BRT B;  2P67 A;  1SQV D;  3CWB D;  4L73 A;  5CCG C;  2HP2 A;  3I55 P;  1SFC D;  2AEV A;  5KKZ B;  1GC0 A;  5KJ7 A;  2YKY A;  3FKD A;  2CPB A;  3PP5 A;  3AV7 A;  4A0R A;  1URQ B;  1AKA A;  1BJO B;  1PL5 A;  1D7S A;  4GEB A;  4M2J A;  3K7Y A;  4JEZ A;  1L2P A;  3F0H A;  3G4S P;  1QIR A;  5AW8 B;  3TQX A;  4W1V A;  3N4R A;  3B4S A;  2VMS A;  3BAS A;  1GK4 A;  3CWB E;  3H1K J;  5TIS H;  2P10 A;  2W90 A;  1X0T A;  2YIU B;  3FX0 A;  3UIA A;  2QIW A;  2J59 M;  4HJG H;  1IJI A;  2W7G A;  2PRR A;  2Z9X A;  1WKG A;  1GL2 D;  1HVV A;  1VQM P;  4IL6 H;  4IX8 A;  1QGK B;  3I5T A;  2VMT A;  3RUY A;  1MDZ A;  1PV3 A;  4XK1 A;  3E2Z B;  3RI6 A;  4WYD A;  2KK7 A;  2W7M A;  4UOY A;  1KFN A;  1BJ4 A;  1FOS E;  4F5G A;  3H1L E;  2ZXX A;  5GTI H;  5APS A;  2ORD A;  3CC4 P;  1TOI A;  3NNK A;  3RK2 C;  4RIZ A;  3MUD C;  4ADC A;  3L75 J;  1GMJ A;  4RAE A;  1HH0 A;  3L73 J;  3NUI A;  1BE3 D;  2FQ6 A;  4HF8 A;  4EB5 A;  3KDP B;  3H6P A;  2BCC E;  1AA0 A;  3AOV A;  1NU1 D;  2YIU C;  4P3M A;  1YOO A;  3NX3 A;  2KUB A;  3BS8 A;  1KIL D;  3WY7 A;  1JM0 A;  3OW2 O;  2OYI C;  1RF0 C;  3E9K A;  3D6Y A;  4IFM A;  4XJL A;  2OGA A;  5KLV J;  2A45 G;  1JS3 A;  3RK3 D;  2ZVO B;  3EUC A;  5AW0 B;  3PDB B;  2AEJ A;  2W6J H;  1FZB A;  3HL2 A;  4XQ2 A;  4A72 A;  3Q1M A;  2OGE A;  2R44 A;  3WUT A;  3RBZ A;  2QB3 A;  4OGQ D;  3FSL A;  2ZY5 A;  4CPG A;  2D63 A;  1ELU A;  4H44 C;  3TNU A;  2VGZ A;  3FWN A;  1G4X A;  1PGP A;  1VPC A;  3L72 E;  2VI9 A;  2DW3 A;  1ELQ A;  1BGY J;  3DZZ A;  2D7Y A;  4PJ0 H;  1AKB A;  2A06 E;  2X5F A;  3R4T A;  4ZKU A;  5KJ7 D;  1OVU A;  1PPJ G;  2ZT9 D;  2YCN A;  2V0Y A;  5BVZ A;  5AVX B;  3R4Y A;  5CCH C;  1H88 A;  2W27 A;  2ZY3 A;  3IR9 A;  1BJO A;  2OTL P;  5EUN A;  1L0L J;  1ZLL A;  4AZK A;  2DGK A;  9AAT A;  1DGE A;  2QSI A;  4Y28 J;  1RF1 B;  2XV5 A;  1GEX A;  4U3F J;  1W2E A;  3E7K A;  1JY2 N;  4PJ0 E;  1CZC A;  5APX A;  2OQX A;  4C7N B;  1PMM A;  1C7N A;  2RN0 A;  3JCU H;  2XH1 A;  4DOJ A;  1J1E B;  1UU1 A;  2P7J A;  1NKN A;  3H1I G;  1AHF A;  4ZSY A;  2O1J A;  1FZC A;  1A02 F;  1TOJ A;  3FTB A;  3NTJ A;  5KAF E;  3FQA A;  3CWB J;  3II0 A;  2B89 A;  2K1A A;  3H1I E;  2R5C A;  3DYD A;  1S4X A;  3GG2 A;  2EPJ A;  2L5G B;  1X2A A;  2FFD C;  3DU4 A;  4WYC A;  1UU2 A;  4RO0 A;  3TGU E;  3L73 D;  4Q31 A;  3NU7 A;  1ASA A;  3PDX A;  3A7O A;  4JF1 A;  2LXC B;  3CX5 E;  1JY3 O;  2Z4E A;  2X3L A;  4E77 A;  3BCX A;  3VAX A;  1IFP A;  3LIE A;  4JQ0 D;  2FYF A;  3G9R A;  1KIL B;  1NU1 K;  1U57 A;  3H1J D;  1SFC C;  2KSE A;  1VQ4 P;  3MP7 B;  3L70 J;  4Y99 C;  5APT A;  5CHX A;  3T97 A;  3LVJ A;  4K2B A;  1J2J B;  4YXW H;  2A45 I;  4PV1 D;  1N7S C;  3HRN A;  4H13 C;  2BKW A;  1FG3 A;  5FT5 A;  2N9B A;  1H89 A;  2BCC D;  4H13 B;  1LWU A;  1IFJ A;  1LKC A;  1BGY D;  4GKG A;  2N1T D;  3H1J E;  3H9X A;  5KAI E;  3QM2 A;  1B4X A;  1JS6 A;  3N0L A;  3F5H A;  5D95 A;  1N31 A;  2FYN C;  1Q81 Q;  2E76 C;  3H1K E;  1C4K A;  4GRX A;  1BCC J;  1KB9 I;  3TFU A;  3W1J A;  4Q75 A;  1X28 A;  5M49 A;  1VQK P;  1Y8A A;  1KIL C;  4EU1 A;  4GE7 A;  1ARS A;  2JWA A;  3V2N A;  3M0D C;  2QLR A;  1IK9 A;  3KKI A;  1E5F A;  4WB0 A;  2FBW C;  3O8Z A;  4Y99 B;  3MAF A;  2Q3E A;  5APV A;  4EFF A;  3CXH I;  3GR9 A;  2YNY A;  1H0T A;  3DXV A;  4AOA A;  2W6A A;  1GBN A;  3RK2 D;  4WYA A;  3FD0 A;  3D71 A;  2V1P A;  1RF1 A;  3HUS A;  2JGT A;  1WYV A;  1KIL A;  3LW5 H;  4K35 A;  3LVL B;  1KYO E;  3U1A A;  5KKZ C;  3TAT A;  3PH0 A;  1L0N J;  1NH4 A;  4OTL A;  2J58 A;  1P84 D;  1CQ8 A;  1NTZ E;  5AVS B;  2YKX A;  2IFN A;  4A0F A;  2BCC G;  3PJ0 A;  3BN1 A;  3MKJ A;  3H32 A;  2C0W A;  2C0X A;  3NMD A;  1LTA C;  3AEP A;  4Q6R A;  3MD0 A;  1SVF A;  1AJS A;  1IFI A;  1YJW P;  1SZU A;  1Q2N A;  2FM1 A;  3CL3 D;  1D2F A;  2CJD A;  3ZRR A;  2QA4 P;  1R5S A;  1M6S A;  1M1J C;  3B1C A;  3SSU A;  5KLV K;  2VGS A;  1V72 A;  1QGN A;  1NTM K;  3IN6 A;  4LC3 A;  3KYQ A;  5KLV D;  2H43 A;  2QB2 A;  2KYV A;  2FXM A;  2GB3 A;  4IXS A;  4GIF A;  3WU2 E;  3MAF B;  3HD7 B;  4OGQ B;  4ZAS A;  3B46 A;  5GTH E;  4A6U A;  1YQ3 C;  3Q5R A;  1C7O A;  2SPZ A;  3WUV A;  3NUB A;  3OKS A;  3AEM A;  3CX5 D;  1GW3 A;  3CWB G;  1N73 B;  4XEW A;  1AMR A;  1AY4 A;  2AAT A;  3QGU A;  2AY4 A;  4DJG A;  3GWP A;  1NTM E;  1USE A;  4H63 Q;  1ZC9 A;  4F5K A;  3N4S A;  4GDO A;  3V2Q A;  3MAU A;  1RV3 A;  3JCU E;  1URQ A;  1SQB G;  3HE5 B;  3B1E A;  3AEM C;  1M4N A;  3V6I A;  2Q5U A;  2WK7 A;  4F5F A;  4U3F D;  1C9C A;  4JEX A;  1U7J A;  4HVK A;  1MDO A;  4XA4 A;  3VTP C;  5APW A;  1NTM D;  3O6Q B;  4A6R A;  3AEJ C;  3AE1 C;  5E3K A;  1AX4 A;  3GET A;  1AVO A;  2ZXE B;  1LTG C;  3RK2 B;  1RE4 A;  2KXP B;  2A1V A;  3A8U X;  1CJ0 A;  2KIK A;  4H51 A;  1L0N G;  2R5B A;  5CCG D;  5EAV A;  3CC2 P;  1FE6 A;  2BIG A;  1UU0 A;  4RIT A;  2Q7W A;  4F4E A;  1KZU B;  5AW2 B;  4WYF A;  2FYZ A;  4DT0 A;  2JO1 A;  2BCC J;  3W1H A;  1P84 H;  3AE3 C;  2W8T A;  1AMQ A;  2WSF H;  1QJ3 A;  1S07 A;  1O4S A;  5EIG B;  2BYL A;  1LTJ C;  3NYT A;  4RJY A;  2NRG A;  4H0L B;  4DZO A;  2AY6 A;  3M0A A;  3VOP A;  2VGT A;  2QJY B;  3BAT A;  1S72 P;  4EDF A;  1RE3 C;  1PP9 G;  4A0H A;  3JSV C;  1SQQ E;  2JJF A;  3QBO A;  2ZT9 B;  1AHY A;  3M9B A;  5M46 A;  4W1X A;  4PD4 I;  4BXL A;  1VQ9 P;  3PIU A;  4R2N A;  5AVR B;  3IF4 A;  3L71 D;  4F5H A;  3F89 A;  2CPS A;  1CQ7 A;  3L70 D;  3AEB C;  4NPE A;  4GOF A;  4UB8 E;  1VL2 A;  1B9H A;  4R4M A;  4RLG A;  2YMY A;  4N78 D;  2ZSL A;  4OCA A;  5APQ A;  4WBA A;  1M7L A;  2JG2 A;  1G2C B;  2M5A B;  1TOE A;  3SWF A;  5KLI B;  4O9B A;  1NVO A;  1Y9B A;  1J1D B;  1NU1 E;  4ZWM A;  4WXF A;  4D6T J;  2W8U A;  1JEK A;  2HOR A;  1WMK A;  3CCJ P;  2WK9 A;  4IYO B;  4YXD C;  5GTI E;  1Q86 Q;  3GZD C;  5DJ9 A;  2PFX A;  2Z9U A;  3ZRP A;  3Q3D A;  3WGB A;  3UE8 A;  1Y47 A;  4ITG A;  1VQ5 P;  4I6M C;  3JC2 2;  3KGX A;  1S09 A;  3BCA A;  4KHX A;  2VGU A;  2XZR A;  2VMY A;  1FZA A;  2M0B A;  2ZVN B;  1SQQ K;  1BJW A;  1S0A A;  1DJE A;  2W7E A;  2HOD B;  3L37 A;  4R4L A;  1TOG A;  4F5I A;  1ASN A;  1VF5 D;  3AE6 C;  1O61 A;  5TIS E;  5B66 H;  1S5L H;  1RV4 A;  4D6T G;  1Q90 D;  2W7I A;  2DKJ A;  4ASW A;  1CL2 A;  3WZF A;  1L0L K;  2V7Q H;  5DJT B;  1SP4 A;  4I8A A;  3FXD A;  2VIA A;  1L4A D;  3A9Z A;  3M9H A;  2M3E A;  1TPL A;  5BJ4 A;  1LC8 A;  1I41 A;  1GEW A;  2JJL A;  2K9J B;  2BI3 A;  2WPS A;  3VP9 A;  1SS1 A;  3PD6 A;  2JJE A;  1OX3 A;  1NU1 G;  1GC3 A;  3AEE C;  2JIS A;  1BE3 G;  1YIY A;  2CY8 A;  2CK3 H;  2VYC A;  3AEF C;  2WQY C;  2IBZ G;  2VMZ A;  2VMV A;  1KN7 A;  2FXO A;  1NO4 A;  3FDD A;  1S1C X;  4W91 A;  1DTY A;  4Y0D A;  3L35 A;  1ARI A;  2CST A;  3H1J G;  2ZSM A;  4WYE A;  1GC2 A;  2YMK A;  4ATP A;  3EIB A;  3A3Y B;  4W7Y A;  1S3J A;  3MGN A;  3H1I D;  3KPE A;  2JJG A;  3B5N C;  1FDM A;  2FYN B;  1GEY A;  1KFM A;  2RFV A;  3F6T A;  4A7P A;  1AMA A;  3T97 B;  1YIJ P;  1KKP A;  1SFC A;  1LTS C;  2D61 A;  2EGY A;  4OC9 A;  1MLZ A;  2P2U A;  1BGY G;  2QMA A;  4MQP A;  1KQG B;  1IUG A;  1LP1 B;  4A0G A;  1N7S B;  4PD4 E;  3CCU P;  2O01 H;  4C46 A;  2YXR B;  4WVZ A;  2ZYD A;  4R8D A;  3TGU D;  2V4H A;  3PLN A;  3LY1 A;  3UWC A;  1PP9 E;  2AXT H;  2AY8 A;  2VLF A;  3WKR A;  3MEB A;  1GZL A;  3MTU E;  1BQA A;  3RCH B;  3GZC A;  2G6W A;  2YO2 A;  3CCR P;  3AEA C;  4UHM A;  2VMU A;  5B5E H;  1KL1 A;  3WU2 H;  4HB1 A;  4H44 B;  4D6T D;  1IC2 A;  3VOM A;  3BRV B;  2R5C B;  1LC7 A;  1TAT A;  1IX8 A;  1SQP J;  3LG0 A;  4ZM4 A;  4L76 A;  1AFO A;  5J8Q A;  4O6Z A;  1SQB E;  2HG5 D;  2HYN A;  4OMA A;  4B9B A;  4EIJ A;  1YJN P;  1LT9 C;  3RL0 B;  3C1L A;  3LW5 J;  1AJY A;  3CCL P;  4KT0 J;  3CCV P;  1NAF A;  2E75 C;  2FNI A;  2KLU A;  3H7F A;  1L4A B;  5CJ0 A;  1G4V A;  3CD6 P;  3G71 P;  3HUS B;  4HH2 A;  1ASL A;  2W83 C;  1AIA A;  1SQV K;  2BEQ D;  2O01 J;  1K73 Q;  3Q8N A;  2D2C B;  2YKQ A;  1GU4 A;  3L36 A;  3I16 A;  2AEM A;  2OTK E;  4ZLV A;  3WLX A;  4WY4 D;  1S06 A;  3OJA B;  3FQ7 A;  3EI9 A;  3CQ6 A;  4PV1 C;  3TK1 A;  2FNU A;  2O7C A;  4PVF A;  3ZDM A;  1FZC B;  2H88 C;  3TNU B;  1SVV A;  5KLV G;  3C9I A;  2D5Y A;  2HUI A;  3BCB A;  2IDB A;  3CQ4 A;  4K3A A;  4J8L A;  2MKV A;  2J5U A;  2W7J A;  5APY A;  3II6 A;  1WRG A;  2QVA A;  3CXH H;  3K28 A;  5H2F H;  2LKM A;  1RH5 B;  1ZRT E;  4LGD E;  1MV8 A;  3ASA A;  2QJK C;  1Z3Z A;  5C39 A;  1X9V A;  2Z9W A;  1GL2 C;  1PGJ A;  4W5K A;  3FCR A;  1XI9 A;  3CCM P;  1SQP E;  2WPQ A;  3TGU J;  5KAI H;  1NWQ A;  1YHQ P;  3H32 B;  3P6K A;  3AE7 C;  3GW6 A;  3GF3 A;  2YHK A;  2OYI B;  5E79 H;  1FDO A;  4GE4 A;  1NTK J;  2XKM A;  4I7Z B;  2CIN A;  3L74 J;  4KJM A;  4OWF A;  2W8J A;  2GA1 A;  2C81 A;  2OYI A;  3H1H G;  1HGZ A;  3AED C;  1IZN B;  3GHG A;  3AAT A;  3NDN A;  1BS0 A;  2YKO A;  2YKP A;  4F5J A;  2WIT A;  4ZM3 A;  3MIW A;  3EI6 A;  1B5P A;  4R5F A;  1DJU A;  1AAM A;  2BI9 A;  5FT6 A;  1YJY A;  3E6G A;  5F9S A;  4EMY A;  1OFC X;  5AW6 B;  1AQ5 A;  4RKD A;  1KIL E;  4W8I A;  2R5D A;  2IZ0 A;  1KKJ A;  4W7Z A;  1IFD A;  3D70 A;  3L73 G;  3K5B A;  1HTL C;  3B5N D;  4ADE A;  1BW0 A;  2E43 A;  1LC5 A;  3BVH A;  1QIT A;  1NTK K;  5GTH H;  2QJP C;  1LTT C;  1IAX A;  1I43 A;  4NPD A;  1V2E A;  2E54 A;  1DH3 A;  1NAY A;  3A9X A;  1D7V A;  3NXS A;  3NFQ A;  4TLF A;  1GCK A;  4CVQ A;  2EZ1 A;  3PJS K;  1IBJ A;  3AEJ A;  4WY4 B;  4GOD A;  4WXB A;  3CQ5 A;  3BV0 A;  3HUS C;  1D7M A;  5CJ4 A;  5JAY A;  1RVY A;  2HOY A;  3ATH A;  5K8B A;  1QJ5 A;  2W8V A;  5AVQ B;  1C7G A;  4IY7 A;  1URQ C;  2YKU A;  4IFF A;  3M5U A;  1EZV D;  3AE5 C;  1ZRT D;  5AVW B;  4HKZ H;  2CJG A;  1RQU A;  1USD A;  3ELP A;  5G0A A;  2ZJS E;  3H1L D;  3RBL A;  3P8C D;  1FZG A;  2M5A A;  1OXO A;  2Q7C A; 
#chains in the Genus database with same CATH homology
 1YNU A;  3HD7 C;  3BWO A;  1LTJ B;  1T2K C;  2EO5 A;  4ZDO A;  4QGR A;  1T8Z A;  2M3B A;  4IW7 A;  1WKH A;  1WYU A;  5HDM A;  1T3U A;  1M7Y A;  2GUS A;  3HMU A;  2HZP A;  4DQ6 A;  1YIZ A;  3UAK A;  4ISY A;  2I1J A;  1WYT B;  1SLQ A;  2BWP A;  1N73 A;  3WKS A;  3N7N A;  3TSI A;  1FU1 A;  3OP7 A;  1DKA A;  1M0O A;  3COG A;  3N5M A;  5HXX A;  2C9L Y;  5G4J A;  2FYU K;  5APU A;  3VK3 A;  3HQT A;  1ZR2 A;  3FVS A;  4BQ0 A;  1T3J A;  3A9Y A;  3KGW A;  3R9A A;  3TCM A;  3B5N A;  1IJD B;  3G3Z A;  1BQD A;  3MC6 A;  1JUN A;  5BU5 A;  4JYC A;  3HT4 A;  2HUU A;  4AO9 A;  4CBS A;  1QL2 A;  2DGL A;  4AZJ A;  4WB4 A;  4XJP A;  4PFF A;  3V5B A;  3BWN A;  2HUF A;  2O1B A;  1SQB K;  2JJH A;  3LV2 A;  3LVM A;  2NPS A;  4P7Y A;  1G2C A;  2C0R A;  2GMS A;  1DJ9 A;  3IFM A;  5AW1 B;  1LWU C;  5EFS A;  1P3W A;  1HJB A;  4GSA A;  2BHX A;  4Q76 A;  2KB7 P;  3AEL A;  3E2F A;  1J04 A;  3N4X A;  1LT9 B;  2BIA A;  1G7W A;  3HD7 D;  4CXR A;  4L0O A;  4UHO A;  2CTZ A;  2I1K A;  4WBT A;  3QI6 A;  1YJS A;  1L4A C;  2VMN A;  2OYH C;  4MKJ A;  2WSE H;  3PAA A;  3PD6 B;  5EQC A;  1J1D C;  3DOD A;  3RBF A;  1SPA A;  2OYH B;  2VMR A;  1XEY A;  3AEN B;  2NPS C;  1Y4I A;  5DJ1 A;  4MSO A;  4ZAH A;  2E7U A;  3A2A A;  1B9I A;  2Z61 A;  5M4B A;  1KL2 A;  4RJ0 A;  2X8U A;  1BJN A;  1GL2 A;  3DXW A;  1WYV B;  4TMR A;  2QBT A;  2D64 A;  4M2M A;  3ASB A;  2F8J A;  4M3L A;  3RK3 C;  1RVU A;  3DC1 A;  1VEF A;  3PGY A;  2BYJ A;  1AY5 A;  3MBB A;  4K2M A;  3M91 A;  5AW5 B;  2W7H A;  3M0D A;  4PIW A;  1BKG A;  2EH6 A;  3FVU A;  3B8X A;  1ZV8 A;  2W7D A;  4OBV A;  2ZUK A;  1JY3 P;  5F8V A;  3ZZK A;  2Z20 A;  4LC1 A;  1Z7D A;  2CFB A;  5G4I A;  4E3Q A;  2Z1Y A;  2KP8 A;  1EJI A;  4A00 A;  5C6U A;  2WB6 A;  3LWS A;  1ARG A;  1BT4 A;  4XJO A;  2Z9V A;  2XBN A;  3JTX A;  1FZE A;  1NKZ B;  1N7L A;  1LW4 A;  2PO3 A;  3A5T A;  2Z5I A;  1AKC A;  1V2F A;  1O69 A;  4K05 A;  3LID A;  1WYT A;  1JTH A;  2Z5H A;  5TF5 A;  1LK9 A;  1SZS A;  1JY3 N;  1GD2 E;  1ZOB A;  4IXO A;  2BWN A;  4IFD K;  1SZK A;  1HGV A;  1W3U A;  1G1I A;  2HPC B;  1FZF A;  1S9K E;  1OXP A;  3KQG A;  3HE4 B;  3P32 A;  1E5W A;  1ASM A;  1FBM A;  3NU8 A;  1CW5 A;  1QL1 A;  2C9N Y;  4WXG A;  3HE4 A;  2E7J A;  1D7U A;  2WTY A;  1SQX K;  3U1C A;  3FVX A;  1J32 A;  1GTW A;  2VIB A;  3VP6 A;  2FN6 A;  2XNX A;  3FQ8 A;  1N86 A;  5I92 A;  1GDE A;  1ECX A;  3WMM 0;  1SF2 A;  1G7X A;  1UKJ A;  1RE4 C;  3LVK A;  3G0T A;  2QSR A;  4WY4 A;  3RL0 C;  2PAJ A;  1B5O A;  1LS3 A;  1YJZ A;  4LW4 A;  2WWW A;  2N1T C;  3NYS A;  4F5L A;  1XTG B;  1T3I A;  2QM7 A;  2O0R A;  5AVV B;  4I1L A;  4CXQ A;  8AAT A;  1MFZ A;  4IXZ A;  3OA7 A;  2VMX A;  2QM8 A;  2YCT A;  3P8C E;  1JCD A;  2XDJ A;  1PMO A;  5AVU B;  1EG5 A;  4N0W A;  2AY9 A;  1GD9 A;  4ADB A;  2VMW A;  4MQQ A;  3ZRQ A;  3EI7 A;  4N6J A;  5D5S A;  3KE3 A;  1LTI C;  2R32 A;  3V2P A;  3VMY A;  2YRR A;  4MQR A;  3FRK A;  2AY2 A;  2R2N A;  1URQ D;  2W8W A;  4CBR A;  4AO4 A;  1AIC A;  3OAK A;  2IFM A;  1X8Y A;  1OWA A;  4ZWV A;  3W1I A;  5CCH A;  1H1C A;  2DOU A;  1JY2 O;  2DKB A;  3G8M A;  2BI5 A;  1SFC B;  3FFR A;  1N2T A;  1Z56 A;  4GE9 A;  2HPC A;  2GSA A;  2D65 A;  4HYT B;  5AVT B;  2HLO A;  4AQR D;  3BC8 A;  1B8G A;  2WT7 A;  5DB5 A;  1IFN A;  2OAT A;  5HHY A;  3NRA A;  2PP6 A;  3CI9 A;  3B1D A;  2WK8 A;  2H8P D;  4A6T A;  5E5I A;  1JG8 A;  1OAT A;  1N8P A;  1NTZ K;  3L4F A;  3JWB A;  1GU5 A;  1SFF A;  5AW3 B;  2W7K A;  5AW9 B;  2YOB A;  1AHG A;  2E7I A;  1DX7 A;  1FZC C;  3PA9 A;  2BWO A;  2KSJ A;  3I4J A;  2AEU A;  1FC4 A;  3ELE A;  3EQ2 A;  1M0Q A;  2C7T A;  3V4Q A;  2POH A;  2Q9I A;  2E42 A;  2CH1 A;  1S9K D;  1G1J A;  3PPL A;  3NYU A;  3P1T A;  2NPS D;  1JOC A;  2KOG A;  2HP1 A;  4ATQ A;  1MGV A;  5G09 A;  2XU6 A;  2ZYJ A;  1X29 A;  3N75 A;  5AVZ B;  1ASE A;  1AJR A;  2QA3 A;  5G2Q A;  4ADD A;  2C44 A;  1XTC C;  3WGC A;  3B8E B;  4I2L C;  4JF7 A;  4KYO A;  5KJ7 C;  1JO5 A;  3HD7 A;  2ZJG A;  1I48 A;  3CLQ A;  1EQ7 A;  4WY4 C;  4WLJ A;  1QZ9 A;  1IX7 A;  2OKJ A;  3FZ8 A;  1LWU B;  4ZSW A;  2W6B A;  3K40 A;  1MUU A;  4JEY A;  4WLH A;  2KFP A;  3VYI A;  1EQB A;  1O62 A;  4RKC A;  3V2R A;  2X5D A;  4NOG A;  2YO3 A;  1FOS F;  2WZ7 A;  4MKK A;  4N3Y B;  3R2P A;  1AHE A;  2EZ2 A;  1N2D C;  3HTK B;  4GT1 A;  2YKV A;  2R3C A;  4E3R A;  2R0T A;  4E1O A;  2PB0 A;  2AY7 A;  3GJU A;  1N7S D;  1VJO A;  4KXK A;  4JF0 A;  1YTZ I;  2WT7 B;  1AIB A;  3B5N B;  3EI8 A;  4UQV A;  1LTJ A;  4OBU A;  3IHJ A;  3NTN A;  1W7N A;  1VDF A;  2M8R A;  3JZL A;  1CI6 B;  3VK2 A;  3E2Z A;  2HOX A;  2VMQ A;  3P8M C;  3T32 A;  2CH2 A;  4U2H A;  1CZQ A;  2OKK A;  2AY5 A;  1M1J A;  2N1T B;  1HBW A;  3HE5 A;  2HOD A;  4C7R A;  4XAU A;  7AAT A;  1JMM A;  1M0P A;  3D6K A;  3SWY A;  2FKI A;  1X79 B;  2BI2 A;  2IPP A;  4AYC A;  1JTH B;  4OT8 A;  4LNL A;  1RF0 A;  5CMZ A;  1CS1 A;  2VMP A;  4FFC A;  4JEV A;  3HBX A;  3TFT A;  1MLY A;  4FL0 A;  1OHW A;  5AW4 B;  4UHN A;  3TYY A;  4M2K A;  1NOH A;  2WPR A;  3GHG C;  1YTZ T;  1HWT C;  4LLH A;  2VLH A;  3EZS A;  2R5E A;  1OHY A;  1GC4 A;  2W7L A;  5KTB A;  2TPL A;  4TN4 A;  3AEN A;  4ZDL A;  1DFO A;  2H7H A;  4AH3 A;  1JNM A;  1AHX A;  1AJS B;  2BI1 A;  3ACZ A;  3G7Q A;  1IO4 A;  4XE5 B;  1FJP A;  5EUD A;  1AMS A;  2FKW B;  2ZP7 A;  1H8A A;  4IYO A;  1N7S A;  3AOW A;  3HLM A;  2DR1 A;  3M9Q A;  4EB7 A;  4EOT A;  5AX8 A;  4JEW A;  2VRS A;  1M0N A;  2GUV A;  1TOK A;  5AVY B;  4WB0 B;  2EYQ A;  4ITX A;  1OXZ A;  3ECD A;  1TAR A;  2FFD A;  2DGM A;  3WCO A;  4LNM A;  2D7Z A;  1X0M A;  3EI5 A;  1AAW A;  2Q3I A;  2AY1 A;  1LTB C;  1MAP A;  2VGV A;  4BHD A;  1JY2 P;  5BU8 B;  1ZR4 A;  4JYB A;  4RES B;  2VI8 A;  1RY3 A;  4KAM A;  3USF A;  1ASB A;  3QN6 A;  1ART A;  1HUC A;  3QHX A;  1IVR A;  3DR7 A;  2NPS B;  2KLV A;  4GDY A;  3VK4 A;  1IFM A;  5E4Z A;  3VN0 A;  4R5Z A;  2HFE D;  1J1E C;  1N73 C;  2OAR A;  2CAN A;  3U59 A;  3L8A A;  3VMX A;  3ZZJ A;  3GBX A;  1ASG A;  3QPG A;  1W7L A;  1DEB A;  4J5U A;  4W1W A;  2BIE A;  4B86 A;  2CJH A;  1A02 J;  1MAQ A;  5EAA A;  4B98 A;  3GZD A;  2WKA A;  4BMK A;  1SQP K;  1WYU B;  1IAY A;  4Y0I A;  2A45 H;  2PB2 A;  1ARH A;  3MUD A;  4C7N A;  4U1T A;  1VP4 A;  2Z1Z A;  3RK3 B;  5G2P A;  1M1J B;  2ZC0 A;  3A2B A;  2YRI A;  1GW4 A;  3CAI A;  1L0N K;  2G7J A;  2JEE A;  3V4W A;  3EFG A;  1YAA A;  3EIA A;  2D66 A;  2YCP A;  2ZY4 A;  4AUW A;  1OHV A;  1GK6 A;  3MC6 C;  1JF9 A;  2WSC H;  1FAV A;  1PG8 A;  1KMJ A;  1U08 A;  5DX5 A;  4OYT A;  1AY8 A;  3RQ1 A;  1S08 A;  1ZN5 A;  1M32 A;  1PFF A;  1KQL A;  1FG7 A;  1WST A;  1E5E A;  3AEO A;  5AW7 B;  4WYG A;  1L4A A;  1C0N A;  1LGH B;  5FT8 A;  2HOZ A;  3ISL A;  2CB1 A;  4W80 A;  3E2Y A;  3FZ6 A;  2N1T A;  5BJ3 A;  3F9T A;  1ASC A;  3HVY A;  4WP0 A;  3P7K A;  3DR4 A;  5CCG A;  1W7M A;  4DBC A;  3VMZ A;  1ZOD A;  2VMO A;  3MAD A;  3I5C A;  2ZY2 A;  2BAS A;  3VP8 A;  4F5M A;  5IWQ A;  3E77 A;  1CQ6 A;  3RCH A;  5EUE A;  1PFI A;  1D7R A;  4BA5 A;  3HTK A;  1QIS A;  4Y0H A;  3BWN C;  2W7F A;  1MZ9 A;  4DGT A;  1LT9 A;  2O1K A;  2GM4 A;  2FFD B;  3HDO A;  4XJM A;  3CBF A;  4OH8 B;  2VGW A;  2IX7 C;  2P1J A;  2OYH A;  1H0C A;  1ASD A;  1I29 A;  1GL2 B;  3FZ7 A;  1T2K D;  3FFH A;  3JWA A;  1CI6 A;  1GDT A;  1MDX A;  1IX6 A;  1CSB A;  3L44 A;  4MY5 A;  1CL1 A;  3GSB A;  5CCH D;  1DGD A;  2NMP A;  2GMU A;  4ZDP A;  1RE3 A;  3JW9 A;  1ORD A;  3E1I A;  4BA4 A;  2ZFC A;  4RM1 A;  1W23 A;  3GHG B;  1V2D A;  1WT6 A;  3BB8 A;  4LW2 A;  3WCN A;  1ASF A;  1KMK A;  4K2I A;  1TAS A;  2GQN A;  1JCC A;  3EZ1 A;  3WX9 A;  3PDB A;  3M06 A;  3DRD A;  1LW5 A;  5EIG A;  1NHL A;  4ZKP A;  1RF1 C;  3RL0 D;  4LNJ A;  1CZE A;  4WD2 A;  2MJZ A;  5FT4 A;  4PFN A;  1FJK A;  4N78 E;  5M4D A;  1YYC A;  2AY3 A;  3FDB A;  3BRT B;  2P67 A;  5CCG C;  2HP2 A;  2AEV A;  1SFC D;  1GC0 A;  5KJ7 A;  2YKY A;  3FKD A;  2CPB A;  3PP5 A;  3AV7 A;  4A0R A;  1URQ B;  1AKA A;  1BJO B;  1D7S A;  4GEB A;  4M2J A;  3K7Y A;  4JEZ A;  3F0H A;  1QIR A;  5AW8 B;  3TQX A;  4W1V A;  3N4R A;  2VMS A;  3BAS A;  1GK4 A;  3UIA A;  1IJI A;  2J59 M;  2W7G A;  2Z9X A;  1WKG A;  1GL2 D;  1HVV A;  4IX8 A;  3I5T A;  2VMT A;  3RUY A;  1MDZ A;  4XK1 A;  3E2Z B;  3RI6 A;  4WYD A;  2W7M A;  4UOY A;  1KFN A;  1BJ4 A;  1FOS E;  4F5G A;  5APS A;  2ORD A;  1TOI A;  3NNK A;  3RK2 C;  4RIZ A;  4ADC A;  4RAE A;  1HH0 A;  3NUI A;  2FQ6 A;  4HF8 A;  4EB5 A;  3KDP B;  3H6P A;  3AOV A;  4P3M A;  1YOO A;  3NX3 A;  3BS8 A;  1KIL D;  3WY7 A;  2OYI C;  1RF0 C;  3E9K A;  4IFM A;  4XJL A;  2OGA A;  2A45 G;  1JS3 A;  3RK3 D;  3EUC A;  5AW0 B;  3PDB B;  1FZB A;  3HL2 A;  4XQ2 A;  4A72 A;  2OGE A;  2QB3 A;  3FSL A;  2ZY5 A;  2D63 A;  1ELU A;  3TNU A;  2VGZ A;  1G4X A;  1VPC A;  2VI9 A;  1ELQ A;  3DZZ A;  2D7Y A;  1AKB A;  2X5F A;  3R4T A;  4ZKU A;  5KJ7 D;  2YCN A;  2V0Y A;  5BVZ A;  5AVX B;  5CCH C;  1H88 A;  2W27 A;  2ZY3 A;  3IR9 A;  1BJO A;  5EUN A;  1ZLL A;  4AZK A;  2DGK A;  9AAT A;  1DGE A;  1RF1 B;  2XV5 A;  1GEX A;  1W2E A;  1JY2 N;  1CZC A;  5APX A;  2OQX A;  4C7N B;  1PMM A;  1C7N A;  2XH1 A;  4DOJ A;  1J1E B;  1UU1 A;  2P7J A;  1NKN A;  1AHF A;  4ZSY A;  2O1J A;  1FZC A;  1A02 F;  1TOJ A;  3FTB A;  3NTJ A;  3FQA A;  3II0 A;  2R5C A;  3DYD A;  2EPJ A;  2L5G B;  1X2A A;  2FFD C;  3DU4 A;  4WYC A;  1UU2 A;  4Q31 A;  3NU7 A;  1ASA A;  3PDX A;  3A7O A;  4JF1 A;  1JY3 O;  2Z4E A;  2X3L A;  4E77 A;  3BCX A;  3VAX A;  3LIE A;  2FYF A;  1KIL B;  1NU1 K;  1SFC C;  4Y99 C;  5APT A;  5CHX A;  3LVJ A;  3T97 A;  4K2B A;  1J2J B;  2A45 I;  1N7S C;  3HRN A;  2BKW A;  1FG3 A;  5FT5 A;  2N9B A;  1H89 A;  1LWU A;  1IFJ A;  1LKC A;  4GKG A;  2N1T D;  3H9X A;  3QM2 A;  1B4X A;  1JS6 A;  3N0L A;  5D95 A;  1N31 A;  1C4K A;  4GRX A;  3TFU A;  3W1J A;  4Q75 A;  1X28 A;  5M49 A;  1KIL C;  4EU1 A;  4GE7 A;  1ARS A;  3V2N A;  3M0D C;  2QLR A;  1IK9 A;  3KKI A;  1E5F A;  4WB0 A;  3O8Z A;  4Y99 B;  3MAF A;  5APV A;  4EFF A;  3GR9 A;  2YNY A;  3DXV A;  4AOA A;  2W6A A;  1GBN A;  3RK2 D;  4WYA A;  3FD0 A;  2V1P A;  1RF1 A;  3HUS A;  2JGT A;  1WYV A;  1KIL A;  3LW5 H;  3LVL B;  3U1A A;  3TAT A;  1NH4 A;  4OTL A;  2J58 A;  1CQ8 A;  5AVS B;  2YKX A;  2IFN A;  4A0F A;  3PJ0 A;  3BN1 A;  3MKJ A;  3H32 A;  2C0W A;  2C0X A;  3NMD A;  1LTA C;  3AEP A;  4Q6R A;  3MD0 A;  1SVF A;  1AJS A;  1IFI A;  1SZU A;  2FM1 A;  3CL3 D;  1D2F A;  2CJD A;  3ZRR A;  1M6S A;  1M1J C;  3B1C A;  5KLV K;  2VGS A;  1V72 A;  1QGN A;  1NTM K;  4LC3 A;  3KYQ A;  2H43 A;  2QB2 A;  2KYV A;  2FXM A;  4IXS A;  2GB3 A;  4GIF A;  3MAF B;  3HD7 B;  4ZAS A;  3B46 A;  4A6U A;  1C7O A;  3NUB A;  3OKS A;  3AEM A;  1GW3 A;  1N73 B;  4XEW A;  1AMR A;  1AY4 A;  2AAT A;  3QGU A;  2AY4 A;  3GWP A;  4H63 Q;  1ZC9 A;  4F5K A;  3N4S A;  3V2Q A;  3MAU A;  1RV3 A;  1URQ A;  3HE5 B;  3B1E A;  3AEM C;  1M4N A;  2Q5U A;  2WK7 A;  4F5F A;  1C9C A;  4JEX A;  4HVK A;  1MDO A;  4XA4 A;  3VTP C;  5APW A;  4A6R A;  3AEJ C;  5E3K A;  1AX4 A;  3GET A;  2ZXE B;  1LTG C;  3RK2 B;  1RE4 A;  2A1V A;  3A8U X;  1CJ0 A;  4H51 A;  2R5B A;  5CCG D;  5EAV A;  2BIG A;  1UU0 A;  4RIT A;  2Q7W A;  4F4E A;  1KZU B;  5AW2 B;  4WYF A;  2FYZ A;  3W1H A;  2W8T A;  1AMQ A;  2WSF H;  1QJ3 A;  1S07 A;  1O4S A;  5EIG B;  2BYL A;  1LTJ C;  3NYT A;  4RJY A;  4DZO A;  2AY6 A;  3M0A A;  3VOP A;  2VGT A;  3BAT A;  1RE3 C;  4A0H A;  2JJF A;  3QBO A;  1AHY A;  5M46 A;  3M9B A;  4W1X A;  3PIU A;  4R2N A;  5AVR B;  4F5H A;  2CPS A;  1CQ7 A;  1B9H A;  4RLG A;  2YMY A;  4N78 D;  2ZSL A;  4OCA A;  5APQ A;  4WBA A;  1M7L A;  2JG2 A;  1G2C B;  1TOE A;  3SWF A;  4O9B A;  1J1D B;  4ZWM A;  4WXF A;  2W8U A;  2HOR A;  2WK9 A;  4IYO B;  3GZD C;  5DJ9 A;  2Z9U A;  3ZRP A;  3WGB A;  3UE8 A;  4ITG A;  4I6M C;  3KGX A;  1S09 A;  3BCA A;  4KHX A;  2VGU A;  2XZR A;  2VMY A;  1FZA A;  1SQQ K;  1BJW A;  1S0A A;  1DJE A;  2W7E A;  2HOD B;  3L37 A;  1TOG A;  4F5I A;  1ASN A;  1O61 A;  1RV4 A;  2W7I A;  2DKJ A;  1CL2 A;  3WZF A;  1L0L K;  1SP4 A;  4I8A A;  2VIA A;  1L4A D;  3A9Z A;  3M9H A;  1TPL A;  5BJ4 A;  1LC8 A;  1I41 A;  1GEW A;  2JJL A;  2BI3 A;  2WPS A;  3VP9 A;  3PD6 A;  2JJE A;  1GC3 A;  2JIS A;  1YIY A;  2CY8 A;  2VYC A;  2VMZ A;  2VMV A;  1NO4 A;  3FDD A;  4W91 A;  4Y0D A;  1DTY A;  3L35 A;  1ARI A;  2CST A;  2ZSM A;  4WYE A;  1GC2 A;  4ATP A;  3EIB A;  3A3Y B;  4W7Y A;  3MGN A;  3KPE A;  2JJG A;  3B5N C;  1FDM A;  1GEY A;  1KFM A;  2RFV A;  3F6T A;  1AMA A;  1KKP A;  1SFC A;  1LTS C;  2D61 A;  2EGY A;  4OC9 A;  1MLZ A;  2P2U A;  2QMA A;  4MQP A;  1IUG A;  4A0G A;  1N7S B;  2O01 H;  4C46 A;  4R8D A;  3LY1 A;  3UWC A;  2AY8 A;  2VLF A;  3WKR A;  3MEB A;  1GZL A;  3MTU E;  1BQA A;  3RCH B;  3GZC A;  2G6W A;  2YO2 A;  4UHM A;  2VMU A;  1KL1 A;  1IC2 A;  3VOM A;  3BRV B;  2R5C B;  1LC7 A;  1TAT A;  1IX8 A;  3LG0 A;  4ZM4 A;  5J8Q A;  1AFO A;  4O6Z A;  2HG5 D;  2HYN A;  4OMA A;  4B9B A;  4EIJ A;  1LT9 C;  3RL0 B;  1NAF A;  2FNI A;  3H7F A;  1L4A B;  5CJ0 A;  1G4V A;  3HUS B;  4HH2 A;  1ASL A;  1AIA A;  1SQV K;  3Q8N A;  2YKQ A;  1GU4 A;  3L36 A;  3I16 A;  4ZLV A;  3WLX A;  4WY4 D;  1S06 A;  3OJA B;  3FQ7 A;  3EI9 A;  3CQ6 A;  3TK1 A;  2FNU A;  2O7C A;  4PVF A;  1FZC B;  3TNU B;  1SVV A;  2D5Y A;  3C9I A;  2HUI A;  3BCB A;  3CQ4 A;  4J8L A;  2W7J A;  5APY A;  3II6 A;  1WRG A;  3K28 A;  2LKM A;  4LGD E;  3ASA A;  1MV8 A;  1Z3Z A;  1X9V A;  2Z9W A;  1GL2 C;  4W5K A;  3FCR A;  1XI9 A;  2WPQ A;  1NWQ A;  3H32 B;  3P6K A;  2YHK A;  2OYI B;  4GE4 A;  2XKM A;  2CIN A;  2W8J A;  2C81 A;  2OYI A;  1HGZ A;  3GHG A;  3NDN A;  3AAT A;  1BS0 A;  2YKO A;  2YKP A;  4F5J A;  2WIT A;  4ZM3 A;  3MIW A;  3EI6 A;  1B5P A;  4R5F A;  1DJU A;  1AAM A;  2BI9 A;  5FT6 A;  1YJY A;  3E6G A;  5F9S A;  4EMY A;  5AW6 B;  1AQ5 A;  4RKD A;  4W8I A;  2R5D A;  1KKJ A;  4W7Z A;  1IFD A;  1HTL C;  3B5N D;  4ADE A;  1BW0 A;  2E43 A;  1LC5 A;  3BVH A;  1QIT A;  1NTK K;  1LTT C;  1IAX A;  1I43 A;  1V2E A;  2E54 A;  1DH3 A;  3A9X A;  1D7V A;  3NXS A;  3NFQ A;  1GCK A;  4CVQ A;  2EZ1 A;  1IBJ A;  3AEJ A;  4WY4 B;  4WXB A;  3CQ5 A;  3BV0 A;  3HUS C;  5CJ4 A;  5JAY A;  1RVY A;  2HOY A;  3ATH A;  5K8B A;  1QJ5 A;  2W8V A;  5AVQ B;  1C7G A;  4IY7 A;  1URQ C;  2YKU A;  4IFF A;  3M5U A;  2CJG A;  5AVW B;  3ELP A;  5G0A A;  3RBL A;  3P8C D;  1FZG A;  1OXO A;  2Q7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...