5KTBA

Structure of a complex between s. cerevisiae csm1 and mam1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
151
Chain Sequence
LLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSDYSIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monopolin complex subunit CSM1
publication title Molecular architecture of the yeast monopolin complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 51
structure length 151
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5ktbA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ktbA02
3BASA 5KTBA 3U1CA 1X79B 1WT6A 4GIFA 3C9IA 4ZKPA 2FXMA 3N4SA 1IC2A 3N7NA 5BU5A 3BATA 3VP9A 4I1LA 3P8CD 4N78D 2JEEA 2POHA 3HRNA 3N4XA 4ZKUA 3U59A 5BVZA 4O9BA 3VP8A 1NKNA 3U1AA 5BU8B 4N3YB 3OJAB 3N4RA
chains in the Genus database with same CATH superfamily
2KP8A 3FTBA 2YHKA 4GEBA 4ASVA 1OHYA 2PO3A 2CB1A 4M3LA 4EIJA 4E1OA 1CQ7A 1LP1B 4BRYB 2HUUA 3N7NA 1P3WA 5AVVB 3CCQP 3VTPC 3II6A 3CCMP 2Q5UA 1IFIA 1QX8A 1Q81Q 4OGQB 3M0AA 1SQVD 1B9IA 2N1TA 2QRXA 3AE4C 3BCAA 2VI8A 1SQVG 4IL6X 1FG7A 5CMZA 4K2IA 2YIUB 4K3AA 2Z20A 1C0NA 1LS3A 4F5MA 1NO4A 1VEFA 3NYUA 1OVUA 1ELQA 1D2FA 3V2PA 1FJKA 2AY6A 4MQPA 4L73A 1T2KD 1VF5B 3TSIA 2Z5IA 4R8DA 4H44B 2W7EA 3VAXA 1AV1A 3MKJA 3CL3D 1X29A 2ZVNB 1YQ3C 2GB3A 3GZCA 2FXPA 1YNUA 2W6BA 4LC3A 3KZIH 1LTJB 4GE7A 1DGEA 2HZPA 2AEVA 3F0HA 1GEXA 3HE5A 3ZRQA 4RKUJ 3G71P 3F89A 4I8AA 2XNXA 2E7IA 2YKQA 4YXWH 2DW3A 5EUNA 2AY8A 1VQ5P 2BYLA 4GE9A 3E77A 2WVRA 3HUSB 2OKKA 1AQTA 3V2RA 3VP8A 4EMYA 1JS6A 4WYDA 1AMSA 3EQ2A 1H0TA 3GG2A 1BJNA 2A06E 5FT4A 2JP3A 1BGYD 2O01J 3L75E 4HH2A 3MGNA 1JCCA 1BGYG 3CQ5A 1NTKD 4DQ6A 1YI2P 1NTKG 1WRGA 1EDLA 2QMAA 4N0WA 1BJ4A 3NTNA 3BC8A 4W7ZA 4OVNF 1AJSB 5D5SA 4WP0A 2Q3EA 1EC5A 1Z7DA 3R9AA 2JWAA 2YNYA 1VQNP 3AEPA 1O4SA 4WB0B 2Z1ZA 1G2CB 1PV3A 3L72J 4OH8B 4ZMDA 1T3UA 3FZ6A 4A6UA 3E2ZA 1AHEA 2FYUE 2KS1B 4WLHA 4BA4A 3IN6A 2BKWA 2W7MA 3RGUA 1ZOBA 1D7UA 4WYEA 1EDIA 2HODA 1KB9I 3LIDA 2W8VA 3MZWB 2WTYA 2W8ZA 3K28A 1NWQA 3LVKA 3L70J 1NTZE 3CC4P 3RK2C 3KDPB 4PIWA 5AVWB 3FFHA 1YJSA 4EDFA 1D7MA 3A7OA 1X9VA 4AYCA 1NAFA 3BATA 3B5NB 4WD2A 4K35A 2POHA 3H1HE 2VLHA 3E7KA 4R4MA 1SZUA 3PTZA 4N3YB 2O3JA 4KAMA 2NPSA 2BIAA 4R5FA 1OZHA 1AHXA 4RKCA 3CX5I 5AVTB 2C44A 3B8XA 3MAFA 1X79B 1EXJA 1GL2D 1SP4A 1SQXK 1KZUB 1GL2B 2E74C 1QEXA 1AKCA 2ZY2A 1U7MA 2M3BA 3P7KA 5APXA 3RCHA 2AEFA 4CXQA 3MC6C 1KYOI 1ECXA 2CJDA 2O1BA 3RBFA 2Y0CA 1M8OB 4AO4A 3PDBA 1WYUB 3L35A 3UIAA 1W7MA 4MKJA 3G3ZA 2VMZA 4XJLA 3M9BA 1M90Q 3A9XA 5CBOA 1GEWA 3WKRA 4HKZH 4AOAA 2B87A 3O6QA 1NTKK 3AOVA 1DEEG 1EZVI 1ARIA 3QHXA 5CJ4A 2QB2A 2DR1A 2N1TD 5KLVE 1GK6A 2N1TB 1AKBA 1KILA 4L0OA 3A9YA 1NVOA 2E75C 1QLED 2WSFJ 4Y99B 3L72E 3C9IA 2E7JA 5APSA 2WSCJ 3TNUA 3TK1A 1AHGA 2VGWA 3GBXA 4ASWA 1R5SA 5I92A 4TLFA 3EI5A 2VGZA 2HYNA 4ADEA 3M0DA 5KJ7C 3M0DC 1QGNA 3V4QA 1N86A 1Y9BA 5BJ3A 3E1RA 4PD4E 2FYUD 4GT1A 3PGYA 3RK3E 5B66E 2CH2A 3L70E 3FX0A 2FYUG 1R5LA 3H32A 4D6TD 2H7HA 3FDDA 1AVOA 2IZ1A 1V72A 3HE5B 4UHNA 4D6TG 2WK7A 3QI6A 4XJMA 1OVRA 2JJLA 5APQA 1NTZD 3H6PA 5C39A 4W1VA 2MJZA 1NTZG 1SZSA 3R4TA 1YIZA 2JDIH 3N4RA 2VIBA 1TOIA 3WUVA 1GK4A 1KB9E 1ZP0C 1H0TB 4PV1B 1GU5A 1OWAA 4GSAA 1AIBA 4MSOA 1FBMA 1YTZI 2ZP7A 1IZNB 3AEJC 1NGMB 2JJEA 3H1HD 4RIZA 1I29A 1CQ6A 3H1HG 2AEMA 3NFQA 4U7JA 1IO4A 2GMUA 4A6RA 1D7VA 3P8CE 3HD7A 3HD7C 3CPWO 4W7YA 2BIEA 2EYQA 3B46A 1GTWA 4E77A 1X22A 2WWWA 1CL1A 1LTBC 1HF9A 3TATA 1QL2A 1IC2A 3E2ZB 1FOSF 2J5UA 2NRGA 3CCLP 4ADBA 3CX5E 2FY8A 3F5HA 2ZY3A 4RITA 4F5FA 1JY2N 4A00A 1VQOP 4ZDLA 4Q76A 1W3UA 2HODB 2HFED 3QGUA 3L74D 1ASGA 2Y0EA 5AW8B 2W7GA 3EUCA 1KYOE 3L74G 3RBXA 2E76B 3V2QA 5FT6A 3FDBA 3G7QA 1IFNA 3K5BA 1PIXA 1TU3F 4H13D 4OBVA 1SFCA 5KLVD 1WYTA 1VQ8P 1UU0A 3VMZA 5KLVG 1HJ0A 3B71A 3CWBE 3VMAA 3T97A 1SQVJ 3ASBA 4BA5A 1PG8A 2FYUK 3GF3A 3H7FA 2NPSD 3CI9A 2NPSB 2QVAA 3TF5A 2WT7A 2X8UA 3MAFB 2OTLP 3OP7A 3QH9A 3AEMA 3CXHE 3AEMC 1X2AA 2R44A 3FGAD 2KB7P 2JR8A 1S3JA 3CQ4A 1S09A 1ZRTD 3HBXA 1IJDB 3RCHB 1NTZK 4ZSYA 1MAQA 2FYFA 3RK3D 4ZM3A 1KORA 3EWKA 2HLOA 3MD0A 1GD9A 3OJAB 2QB3A 1FOSE 2O1KA 3PDBB 3BWNC 2ITAA 1AMAA 2WKAA 1LP1A 2ZYAA 4FFCA 1G4VA 3KE3A 3I4JA 3AEGC 3VP9A 2B87B 3O6QB 4F5KA 3G6EP 3I5TA 1ZMEC 3FVSA 5E5IA 2YRIA 2WPVB 1JY3N 2BI3A 3G0TA 2J58A 4O9BA 1M0OA 3AE2C 1KB9D 3U1AA 2VMOA 1LTTC 1N7SC 1KILD 2VMVA 2TPLA 5AW1B 2YCPA 1KILB 2O0RA 1YJWP 1JNMA 1A02J 2WMMA 5EUEA 1H8AA 4WY4C 2OGEA 4Y0HA 1W5CE 2CY8A 4TT3H 1BSHA 4UQVA 3A3YB 2O01H 1BGYJ 5DJ9A 2FQ6A 1HH0A 3TNUB 1P84I 2OYOA 3VOPA 4CVQA 4MN4C 3D70A 1NTKJ 4GOFA 2AATA 2VGTA 5KAFE 2IZ0A 2OTKE 1H88A 3WGBA 1B5OA 3PP5A 3N0LA 3Q5SA 2XBNA 1FDOA 2ZSLA 1FZBA 2R0TA 1V2DA 1VQPP 3BCCD 5B5EE 3ASAA 3CCVP 1LTJA 2ZT9D 3SWKA 3CX5D 4ATPA 3BCCG 3FRKA 3DRDA 2CANA 5KLVK 1FZCA 2KI7B 3H32B 4O6ZA 1AJRA 4RJ0A 1FE6A 2KNCA 1K73Q 2QSIA 3FD0A 1A02F 4WXFA 3KGXA 2YCNA 3L73E 2NMPA 1KYOD 5CCGA 2WQYC 2W8WA 3EI8A 3C8VA 2H89C 4PD4H 2CPSA 4ATQA 3G9RA 5B66H 1L4AA 1SQVE 3W1HA 2VMQA 2WPQA 2VGSA 3B4SA 1HGVA 1LTIC 3VK3A 1J1DB 1S5LX 5APYA 1KMKA 4JPZB 2VMXA 3H1IJ 2YKOA 3I55P 4F5GA 3O8ZA 3CWBD 3GMAA 1EZVD 1D7SA 3CC2P 1BS0A 1MDXA 1RF0C 3CWBG 2QEXP 1EZVG 1O62A 3HD7B 3ABVC 3EZ1A 4CXRA 1VQ7P 3NUIA 4H0LD 2D63A 1NTMD 4H0LB 4WYFA 2DKBA 2O01N 2DGLA 1TPLA 1NTMG 2W6JH 2P1JA 2CH1A 3GHGA 3GHGC 3OW2O 3KGWA 3FWLA 5C6UA 3U59A 2XU6A 4EFFA 5AW5B 4IFMA 2H88C 3BN1A 2LXCB 1LKCA 3DR7A 4JF1A 5AW9B 2AXTE 3H1KE 2VMWA 1RF1A 4F5LA 1AIAA 1RF1C 1WYVA 3AEAC 5KKZC 4LNLA 1FC4A 1PZQA 2EZ2A 2ZSMA 4UHOA 1LC8A 1SFCD 1NOHA 3CCJP 1DIPA 1SFCB 3CCUP 1WYTB 2VMPA 1AMQA 4YTPC 4ZASA 2IBZI 2D2CB 2ZJSE 4WYCA 8AATA 4JBZA 3T97B 3MADA 3MAUA 1JY3O 4U3FE 1VP4A 4DOJA 2XDJA 4EOTA 2WSFH 2WT7B 4WLJA 4ITXA 3SWYA 1WKHA 2WSCH 1AHFA 4AH3A 2I1KA 3G4SP 3AEDC 2W7JA 1X28A 2W7IA 1BT4A 2PGDA 3P6KA 2L5GB 3M91A 1ARGA 5E3KA 3VK2A 3B1CA 4B9BA 2VMTA 1UIIA 3ECDA 4GODA 4PFFA 1ZC9A 3CXHH 3HE4A 2YOBA 2FYUJ 3MUDC 1ASCA 3DZZA 3E9KA 1FDIA 1ASEA 1MFZA 3TDKA 1MZ9A 1IVRA 4AUWA 1LT9C 2JO1A 4D6TJ 3L73D 4OGQD 3PHLA 1S2EA 1IJIA 3H1IE 3S1KA 3E2YA 3L73G 1QJ5A 3W1IA 4C46A 2R3CA 1NTZJ 1S9KE 3WKSA 1OATA 1W2BO 1CI6A 3HTKA 4UB6H 4WVZA 1HVVA 3GF7A 2QJPC 1FU1A 2V0YA 2RKLA 3JWBA 3USFA 3H1HJ 1VF5D 4IL6E 2E54A 4RAEA 2HPCA 4H44D 2K1AA 1OHVA 4OCAA 2YXRB 3S9OA 3LG0A 5DX5A 1NKNA 1H0CA 2BEZF 4LW2A 2FFDC 4K2MA 2YRRA 1FZAA 2Z5HA 1G4XA 2WK8A 5JAYA 3IF4A 4PJ0H 3UWCA 1SPAA 1KL1A 5BU5A 3HT4A 2K9YA 2XKMA 1EJIA 4RO0A 1CW5A 5KAFH 2G8YA 1FZCB 3D6ZA 1YJ9P 3CCEP 1FJPA 2KNCB 1YIYA 4RLGA 3WCNA 4F5JA 5CCGD 4ISYA 1FZEA 3H1KD 4KJMA 2QIWA 1B4XA 3L74J 1DFOA 3USSA 3H1KG 5KLIC 1L4AB 4JYBA 4F4EA 4W1XA 2Z9VA 4W91A 2AY1A 1ZR4A 4OC9A 1ARSA 1H1CA 4YXDC 2JGTA 1O61A 1DGDA 3UE8A 2QA3A 1GC2A 3SFEC 4XEWA 3IR9A 1BQAA 4W5KA 1C4KA 3VMYA 5KLVJ 1HTLC 1CSBA 1XEYA 4U3FD 5CCHC 4AO9A 1YHQP 3WY7A 5EIGA 2VGVA 1BSNA 4U3FG 4UB8E 1FAVA 3SFDC 3G8MA 2IX7C 4Y0DA 1NHLA 3ZRRA 3GR9A 3RL0B 3QBOA 3RL0g 1V2FA 3WGCA 4GKGA 5G4JA 3RBZA 4R2NA 3W68A 4CBSA 4N78D 4GE4A 4E3RA 2JEEA 3GHGB 4LC1A 1P84D 1GC4A 4P7YA 1YIJP 2VMUA 3FZ7A 4D6TE 1SQVK 3AE9C 1FDMA 5F9SA 2ZXXA 5M46A 4BMKA 1GDEA 2M5AA 2EO5A 1OX3A 4JEWA 1T3JA 1G7XA 1GW3A 1EQBA 2KZIA 4HVKA 4W80A 2JG2A 1U08A 1B8GA 2QE7H 1RF1B 1AAMA 4IYOA 1WYVB 3ATHA 3JC22 3H1ID 4ADDA 3B5ND 3WCOA 1B5PA 2P67A 1R8EA 4Q75A 3CMAP 1Q2NA 3H1IG 1S9KD 1DKAA 1IAYA 2B9BA 2YO3A 3OA7A 1VJOA 2D61A 3LY1A 2A45I 1DJ9A 2M0BA 1X0MA 3Q1MA 1CS1A 3TGUE 2G6WA 1U7JA 2VRSA 4H13C 3R4YA 2QJKB 1V2EA 2QJYC 3HVYA 1J04A 3MC6A 2VYCA 1G7WA 4B86A 1KTMA 1M1JC 3NU7A 5APUA 5EFSA 1CZQA 1ASMA 3NMDA 4XJPA 5KAIE 1T6AA 2BWNA 3E2FA 3GZDC 3L74E 2F8JA 1Q86Q 3BCCJ 3HE4B 4GOEA 5APVA 1S07A 4GDOA 3N4SA 1KAFA 1Y47A 1LC5A 2KXPB 2B89A 2IFMA 1GCKA 3DC1A 3MEBA 2BCCD 3RK3C 3S4RA 1S72P 4J8LA 3AECC 3P1TA 2BI1A 2BCCG 2XNDH 1QJ3A 1AJYA 4I2LC 3EI9A 4I7ZC 2AY3A 2AY5A 2CK3H 1CI6B 2FN6A 2UWJE 3HTKB 1UIXA 5GTIE 1KD1Q 1MLYA 1DD3A 2AXCA 1MKMA 1XTGB 2GUSA 1NKZB 3N4XA 3CWBJ 1Y4IA 2HPCB 1JMBA 3ELPA 1M4NA 1DJUA 2PB0A 1ZRTE 3NNKA 5KJ7A 1PGPA 1XTCC 4OYTA 2ORDA 2IBZD 1U57A 2WSEH 3AE8C 1OVVA 2IBZG 2P7JA 3LVLB 2YKXA 2C0XA 1NTMJ 3PH0A 2Z9WA 4IL6H 2VMYA 1Z3ZA 3AE3C 1IUGA 3I5CA 1RE4C 5APTA 1NH4A 3A0BE 4A0FA 5M4BA 3PIUA 3JWAA 3NDNA 5DJ1A 4M2JA 2QG4A 3VP6A 1GZLA 2YKYA 1KN7A 1VDFA 4PV1D 2WZ7A 4RESB 1N73C 4C7RA 4EB5A 3I16A 1KILE 1JO5A 1UU1A 1SQBE 3P8MC 1C7GA 4Y28J 3AEJA 4UHMA 3CCSP 2YXQB 4L75A 1J1EC 1E5FA 2K37A 2RMZA 3OKSA 2BWPA 2W7FA 1PGQA 4QMAA 2AEJA 1IFMA 3VOMA 1OFCX 4A0HA 3WU2E 3RBLA 1N8PA 4FL0A 2BWOA 3FCRA 1X0TA 5EIGB 5HXXA 3TGUD 1IX8A 5KTBA 3L71J 3TGUG 1M7LA 3K7YA 4NOGA 2MKVA 4WXGA 3BCCE 5AVZB 2EGYA 4LNMA 3P32A 1I41A 3PPLA 2VLFA 1URQC 2BI9A 1PGOA 1NYHA 3Q8NA 4A0RA 1BDCA 4JEYA 4UB8H 1C7NA 2P58A 2M5AB 3CCRP 4HJGH 2KFPA 3BASA 2FYNC 2FM1A 5M49A 2ZFCA 3BCBA 2E76D 3RK2B 1KFMA 1N8RQ 3MP7B 5AX8A 5HHYA 1K9MQ 2C0RA 4CBRA 3JCUE 4IYOB 4WYAA 3RQ1A 3Q3DA 3L73J 3MHVA 4A7PA 1W7LA 1EZVE 1KMJA 2OYIC 3L36A 1RV4A 2FBWC 1GEYA 3V6IA 1ARTA 2O7CA 1BDDA 3DODA 2E74D 3AENA 2EH6A 2HOXA 2E74B 1NTME 1YJYA 1PGJA 3DYDA 3N75A 1OW8A 3M5UA 1EG5A 3FQ8A 3FQ7A 1JOCA 1TOKA 2K3RA 3AELA 1H89A 2AY2A 3BRVB 1L0LE 4C7NA 1HWTC 3FVUA 3FKDA 3BWNA 1S08A 1OXPA 1KL2A 2OYHA 2OYHC 4AQRD 4A0GA 1M32A 3ZZKA 1KQFB 3AE6C 3BVHA 2Q9IA 1SQPE 2KUBA 1PL5A 2HUIA 1KKJA 1PFFA 2R5EA 2ZY4A 3E1IA 4DBCA 2HUFA 4TMRA 1N7SA 2Q1KA 5KAIH 2PRRA 1MGVA 3H1KJ 4JYCA 5AVSB 3SSUA 1SQBD 1SLQA 2E75D 1BCCE 1N7LA 4WY4A 4I7ZB 2E75B 1QVFO 1SQBG 1X8YA 4XFJA 3L71E 1OHWA 2OGAA 1GU4A 2HR3A 3H1JE 2PB2A 4XJOA 3PA9A 1GD2E 5H2FE 1JS3A 2FYZA 3F6TA 3JTXA 1RE3C 1AVYA 4OWFA 2ZXEB 4U3FJ 2YIUC 2OQXA 1K8AQ 3DXVA 2IPPA 2VIAA 2AY4A 4BWNA 2GSAA 3GJUA 5AVXB 3BRTB 3AEOA 1RQUA 2SPZA 4XK1A 2A45G 5TF5A 3A0HE 4KT0J 1VF5C 1YQ4C 1LK9A 1T2KC 4H44C 4YPCA 4HYTB 2GA1A 3HRNA 4OT8A 2KYVA 3JZLA 9AATA 1YBKA 2IDBA 1RVUA 1BE3D 3AV7A 3CMEP 1YAAA 3DU4A 3W67A 4IX8A 1JY2O 2JWDA 4WBAA 1BE3G 2KZJA 1KQLA 5EAVA 4NPFX 1KQGB 2FXMA 4OBUA 2QM8A 3AEEC 1QVGO 3HDOA 5AVQB 3B8EB 5TJHA 3TFTA 1SF2A 4WXBA 1SZKA 1J1EB 3GETA 3A0BH 3ZRPA 1ZV8A 5G2PA 2V7QJ 1RF0A 3HD7D 2WITA 4IW7A 3MIWA 1S5LE 3LIEA 1LTGC 3B1DA 1KB9H 2WSEJ 4KYOA 1ZW0A 5FT5A 1GC3A 4JF0A 1Q90D 2QBTA 3D6KA 2CINA 1NU1E 3VMXA 2D64A 1RH5B 2L91A 3LVMA 1L0LD 1ASAA 5BJ4A 3WU2H 2FKWB 3FFRA 3ELEA 1WMKA 1L0LG 5AW6B 2X5DA 1PP9D 4BHDA 3VK4A 3C1LA 1HUCA 1FG3A 1SQBK 4R5ZA 3U1CA 1LWUA 4AZJA 1PP9G 1LWUC 1EQ7A 3V2NA 1M0NA 4I6MC 1SQPD 2A45H 2ZUKA 3CX5H 3BWOA 1SQPG 2C0WA 2GUVA 1YITP 5G2QA 1OMIA 2D5YA 2C9LY 1HJBA 1I48A 2KIKA 1JUNA 1JG8A 2QSRA 2BCCJ 2D2CD 1EDKA 1BCCD 2ZYJA 1KYOH 4A72A 1DH3A 4UOYA 4OMAA 4ZWVA 3CQ6A 1BCCG 4P3MA 2IYOA 1XI9A 1YJNP 2KK7A 3L71D 2QA4P 3JCUH 3H1JD 3L71G 3B5NC 5TISE 3AENB 3H1JG 2A1VA 3II0A 5AW2B 4N78E 1CZCA 1L0NE 4LNJA 3K40A 1UKJA 2DGKA 2OATA 1P84E 3WMM0 1ARHA 4ZNCA 1ZOYC 3LW5J 3UAKA 4C7NB 1TATA 1AICA 1GL2C 3MUDA 2OYHB 3TYYA 5EFWB 2HORA 4ZKPA 3FWNA 4XAUA 3ZDMA 1VQMP 1LT9A 1FS0E 3EFFK 3QM2A 1KMIZ 5M4DA 1AQ5A 3NUBA 1GBNA 3GLMA 2BEQD 2VGUA 5AW7B 1AAWA 1N7SD 3L4FA 3EFGA 1BW0A 4LW4A 5M1BA 1N7SB 1N2TA 1NTMK 1MDOA 4WY4D 4Z1MH 4WY4B 2R2NA 3QN6A 2G7JA 3GW6A 1I43A 1LW4A 3PD6A 1L0LK 4ZKUA 4EI2A 2N1TC 3KHUA 2Z4EA 1PPJD 1JY3P 3HQTA 3VYIA 2FFDA 1PPJG 4WYGA 1G1JA 4Y99C 1W7NA 5HDMA 3TGUJ 1SVVA 5AW0B 1NU1D 3AATA 1SQPK 1VL2A 2HOZA 1NU1G 4LLHA 2YKVA 3AOWA 2KLVA 3PLNA 3Q5PA 4IXZA 4PVFA 2KLUA 5H2FH 2E5TA 1K05A 3SWFA 4F5IA 4RKDA 4K05A 4CPGA 1LTAC 1YTZT 4NPEA 1BQDA 1E5WA 2BCCE 2ZVOB 5B5EH 3WLXA 1L4AD 3NYSA 1SQQE 3ITKA 5G0AA 1SQXD 3A0HH 3WZFA 3RUYA 1ZODA 4HF8A 1SQXG 2OQQA 1USDA 1WSTA 4JEXA 4Y0IA 1ASBA 4Q31A 1IFDA 2WB6A 1AY8A 3NU8A 1OIPA 3KPEA 2YKPA 5CCHA 1C9CA 4IY7A 1Q82Q 2Z9UA 1WKGA 3FXDA 2Q6QA 5EUDA 4PV1C 3WUTA 4IFFA 2BI5A 2JJFA 4ADCA 2R5DA 3RL0D 5AVRB 2CSTA 2JJGA 2IBZE 1FZFA 4R4LA 1GC0A 3A9ZA 1ZXGA 1L0ND 1ASFA 4PD4I 4XQ2A 1L0NG 4A6TA 4IXSA 4ZAHA 1ORDA 1ASLA 2YCTA 4ZLVA 1S5LH 2PP6A 1JTHA 3L44A 1RY3A 3H1LD 1IFJA 3PJSK 3IFMA 2OARA 2Y9ZA 2YKUA 1LWUB 3H1LG 4M2MA 1FC2C 2W7HA 1RHZB 2R3SA 1UU2A 1AKAA 4H63Q 2E43A 2QM7A 2R32A 5KKZB 2OKJA 1QL1A 1QISA 3N5MA 2Z9XA 1VQLP 1M56D 3IHJA 2Y0DA 2M8RA 5GTHE 1IFPA 1MV8A 2AY9A 2W6AA 5DJTB 1AY4A 2AXTH 2E76C 2H43A 1Z56A 1NU1K 3M9HA 5J8QA 3COGA 5G4IA 1SQBJ 2RN0A 1BJOA 2BYJA 4JEZA 2BI2A 1K04A 3D71A 3NXSA 5K5GB 1ZN5A 2QLRA 2V1PA 3HLMA 3NX3A 3NYTA 2CTZA 1M1JA 4U2HA 1Y8AA 2NPSC 1N31A 2Y9YA 4XE5B 2P2UA 1TOEA 3GZDA 2YO2A 5TISH 4I1LA 1AA0A 2YMKA 1M7YA 1LT9B 2W7LA 2CPBA 2E42A 1T3IA 1E79H 1GW4A 1JMMA 3B1EA 3EIAA 2GMSA 2EPJA 1P84H 2JISA 1D7RA 1CQ8A 1DTYA 1YYCA 2J59M 1PMMA 1HGZA 1SQQD 1BE3J 2ZYGA 4ZDPA 1SS1A 3TQXA 1SQQG 3EI6A 2WSSH 1MDZA 2VMNA 3PJ0A 1AFOA 2W7KA 2K88A 2VMRA 2DKJA 1L0NK 2D7YA 2QJPB 3BB8A 1CZEA 3KKIA 1QZ9A 1QGKB 5K8BA 3PD6B 2XH1A 2V7QH 3CXHI 1LGHB 2EZ1A 4WBTA 2A06D 4DCKA 2ZAEB 1KILC 1EXIA 1E5EA 1QIRA 3A2BA 3RI6A 3L75D 2A06G 1VQ6P 3KXDA 1LC7A 2FFDB 5EAAA 2K9JA 4ZWMA 3FSLA 1CJ0A 3L75G 1OW6A 1BKGA 2AY7A 1DEBA 4KHXA 5CHXA 2BIGA 2G3AA 1AX4A 1HBWA 2RFVA 4W8IA 2HP2A 1RE4A 1OXZA 1L0LJ 2W8TA 3PRJA 4WWIA 3TFUA 1PP9J 1JF9A 3FZ8A 1YOOA 3L8AA 4EB7A 2HG5D 1N73A 2ZT9C 2HP1A 5KLIB 4DGTA 3JSVC 5AVUB 2ZC0A 1SQPJ 3WX9A 1LT1A 2C81A 4EYYQ 2WK9A 1S4XA 1KKPA 3Q5RA 4BQ0A 3FQAA 1PFIA 1M57D 3AEBC 5CCHD 2W90A 3ISLA 3I56P 4W1WA 3V4WA 2LKMA 1RV3A 1BCCJ 3EZSA 4JF7A 1Q7YQ 1C7OA 2W8UA 1WT6A 1J1DC 2CJHA 1QITA 3AE5C 5D95A 3H1JJ 2LR2A 3L37A 1FZGA 1VQ4P 4KXKA 1URQA 1PMOA 5E79E 3FVXA 2Z61A 4IXOA 1N2DC 1SQQK 5BU8B 1TOJA 5APWA 3AE1C 3A5TA 2N9BA 3Q2YA 1JTHB 2KSEA 4H0LC 3RK2D 3LW5H 1BE3E 1ASNA 5AW4B 4DJGA 2C7TA 2C9NY 4DZOA 4TN4A 3WUUA 1VQ9P 3F9TA 5CBNA 1W23A 5G09A 3M06A 1O69A 1DX7A 4PFNA 4JEVA 2Q7CA 3QPGA 5DB5A 2OYIA 3GWPA 2R5CA 1USEA 1TARA 1BJOB 5IWQA 3LVJA 4H13B 4BXLA 1SFCC 5AW3B 2QJYB 4H51A 2FNUA 2PAJA 2D2CC 2OTJP 5GTHH 1IX7A 3BS8A 4HB1A 2ZYDA 2I8DA 3NTJA 1DD4A 1M1JB 2X3LA 3L72D 1AHYA 1BJWA 2P10A 3L72G 4M2KA 1KV4A 2BASA 3BV0A 1PP9E 4GIFA 1NU1J 2WPSA 2R5BA 4L74A 1RVYA 3EI7A 3A8UX 2D66A 3T32A 1LNQA 5DJUB 3CAIA 1MUUA 4MY5A 4PD4D 4XA4A 1YJZA 2H8PD 3L70D 3RK3B 1AMRA 2E7UA 4E3QA 3FXEA 3L70G 2W27A 1IK9A 2CJGA 4JQ0D 4BRYA 3BCXA 4UB6E 2YMYA 3NRAA 2ZJGA 3LV2A 3IAOA 4QGRA 1SQXJ 2M3EA 2HOYA 4OGQC 2RH0A 2D65A 2KSJA 1RE3A 2ZY5A 2KOGA 1IK7A 5KJ7D 3TCMA 1M6SA 2JJHA 3LWSA 1SFFA 4IOIH 2VMSA 1RQVA 2K9JB 3KQGA 5GTIH 1ELUA 4PJ0E 4U1TA 3MBBA 3KZIE 4IFDK 3P8CD 1JEKA 4ZSWA 1S1CX 2WPRA 1L0NJ 1JB0J 3MTUE 1MFTA 2DGMA 3JW9A 2O1JA 4ZM4A 3AE7C 1NJIQ 4MQRA 4RJYA 2XV5A 2IYPA 1IX6A 1L2PA 3M9QA 5CJ0A 3CD6P 1SVFA 3H1LJ 3V5BA 3H25A 1LTJC 1KQSO 3ACZA 2ZT9B 1N73B 2FXOA 2GM4A 2PFXA 1M1KQ 1FZCC 1J2JB 3ZZJA 4GDYA 4MQQA 3HUSA 1OW7A 1W2EA 3HUSC 4Q6RA 2D7ZA 2N9YB 5CCGC 1EDJA 1VQKP 1M0QA 1DJEA 1L4AC 4DT0A 3R2PA 5F8VA 1PPJE 2FNIA 2IFNA 1B9HA 1NAYA 1S0AA 4RM1A 1LW5A 4GRXA 5AVYB 1TOGA 5EQCA 2W83C 1LJ2A 2W7DA 1URQD 1AJSA 2BHXA 3PAAA 5BVZA 1IAXA 1URQB 2VI9A 4AZKA 4WB0A 1G2CA 3CXHD 2Q3IA 4RJTA 3E6GA 3RL0C 3HMUA 1AY5A 1ASDA 1T8ZA 1ZR2A 3DXWA 2FYNB 2FKIA 4B98A 2KS1A 1G1IA 1CL2A 5FT8A 5E4ZA 4J5UA 2V4HA 1GMJA 2DOUA 2JKVA 3GSBA 1SQXE 5E79H 2CFBA 3D6YA 2LXBA 2XZRA 3DR4A 1MLZA 1GDTA 3QWOC 4WB4A 7AATA 2B88A 1KFNA 1JY2P 3CBFA 4LGDE 1SQQJ 2OYIB 4NPDA 1MAPA 4ITGA 2W8JA 5L8RJ 2R5CB 3EIBA 3AEFC 3A2AA 3B5NA 1M0PA 3VN0A 4ZDOA 1BGYE 2AEUA 4K2BA 1JM0A 1NTKE 2I1JA 3H9XA 3W1JA 1JCDA 2Z1YA 3L75J 1OXOA 1GL2A 2NZ2A 2GQNA 3KYQA 1J32A 2QJKC 3H1LE 2E5YA 2X5FA 1IBJA 2OGUA 1ZLLA 3CLQA 1TASA 2Q7WA 3PDXA 1KC8Q 3HL2A 4MKKA 4N6JA 4L76A 3CC7P 4EU1A 3OAKA 4F5HA 1WYUA 1S06A 4OTLA 1VPCA 1LTSC
chains in the Genus database with same CATH topology
2KP8A 3FTBA 2YHKA 4GEBA 1OHYA 2PO3A 2CB1A 4M3LA 4EIJA 4E1OA 1CQ7A 2HUUA 3N7NA 1P3WA 5AVVB 3VTPC 3II6A 2Q5UA 1IFIA 3M0AA 1B9IA 2N1TA 3BCAA 2VI8A 1FG7A 5CMZA 4K2IA 2Z20A 1C0NA 1LS3A 4F5MA 1NO4A 1VEFA 3NYUA 1ELQA 1D2FA 3V2PA 1FJKA 2AY6A 4MQPA 1T2KD 3TSIA 2Z5IA 4R8DA 2W7EA 3VAXA 3MKJA 3CL3D 1X29A 2GB3A 3GZCA 1YNUA 2W6BA 4LC3A 1LTJB 4GE7A 1DGEA 2HZPA 2AEVA 3F0HA 1GEXA 3HE5A 3ZRQA 4I8AA 2XNXA 2E7IA 2YKQA 5EUNA 2AY8A 2BYLA 4GE9A 3E77A 3HUSB 2OKKA 3V2RA 4EMYA 3VP8A 1JS6A 4WYDA 1AMSA 3EQ2A 1BJNA 5FT4A 4HH2A 3MGNA 1JCCA 3CQ5A 4DQ6A 1WRGA 2QMAA 4N0WA 1BJ4A 3NTNA 3BC8A 4W7ZA 4WP0A 1AJSB 5D5SA 1Z7DA 3R9AA 2YNYA 3AEPA 1O4SA 4WB0B 2Z1ZA 1G2CB 4OH8B 1T3UA 3FZ6A 4A6UA 3E2ZA 1AHEA 4WLHA 4BA4A 2BKWA 2W7MA 1ZOBA 1D7UA 4WYEA 2HODA 2W8VA 3LIDA 2WTYA 3K28A 1NWQA 3LVKA 3RK2C 3KDPB 4PIWA 5AVWB 3FFHA 1YJSA 3A7OA 1X9VA 4AYCA 1NAFA 3BATA 3B5NB 4WD2A 2POHA 2VLHA 1SZUA 4N3YB 4KAMA 2NPSA 2BIAA 4R5FA 1AHXA 4RKCA 5AVTB 3B8XA 2C44A 3MAFA 1X79B 1GL2D 1SP4A 1SQXK 1KZUB 1GL2B 1AKCA 2ZY2A 2M3BA 3P7KA 5APXA 3RCHA 4CXQA 3MC6C 1ECXA 2CJDA 2O1BA 3RBFA 4AO4A 3PDBA 1WYUB 3L35A 3UIAA 1W7MA 4MKJA 3G3ZA 2VMZA 4XJLA 3M9BA 3A9XA 1GEWA 3WKRA 4AOAA 1NTKK 3AOVA 1ARIA 3QHXA 5CJ4A 2QB2A 2DR1A 2N1TD 1GK6A 2N1TB 1AKBA 1KILA 4L0OA 3A9YA 4Y99B 3C9IA 2E7JA 5APSA 3TNUA 3TK1A 1AHGA 2VGWA 3GBXA 5I92A 3EI5A 2VGZA 2HYNA 4ADEA 3M0DA 5KJ7C 3M0DC 1QGNA 3V4QA 1N86A 5BJ3A 3PGYA 4GT1A 2CH2A 3H32A 2H7HA 3FDDA 1V72A 3HE5B 4UHNA 2WK7A 3QI6A 4XJMA 2JJLA 5APQA 3H6PA 4W1VA 2MJZA 3R4TA 1SZSA 1YIZA 3N4RA 2VIBA 1TOIA 1GK4A 1GU5A 1OWAA 4GSAA 1AIBA 4MSOA 1FBMA 1YTZI 2ZP7A 3AEJC 2JJEA 4RIZA 1I29A 1CQ6A 3NFQA 4A6RA 1IO4A 2GMUA 1D7VA 3P8CE 3HD7A 3HD7C 4W7YA 2BIEA 2EYQA 3B46A 1GTWA 4E77A 2WWWA 1CL1A 1LTBC 3TATA 1QL2A 1IC2A 3E2ZB 1FOSF 4ADBA 2ZY3A 4RITA 4F5FA 1JY2N 4A00A 4ZDLA 4Q76A 1W3UA 2HODB 2HFED 3QGUA 1ASGA 5AW8B 2W7GA 3EUCA 3V2QA 5FT6A 3FDBA 3G7QA 1IFNA 4OBVA 1SFCA 1WYTA 1UU0A 3VMZA 3ASBA 4BA5A 3T97A 1PG8A 2FYUK 3H7FA 2NPSD 3CI9A 2NPSB 2WT7A 2X8UA 3MAFB 3OP7A 3AEMA 3AEMC 1X2AA 2KB7P 3CQ4A 1S09A 3HBXA 1IJDB 3RCHB 1NTZK 4ZSYA 1MAQA 2FYFA 3RK3D 4ZM3A 2HLOA 3MD0A 1GD9A 3OJAB 2QB3A 1FOSE 2O1KA 3PDBB 3BWNC 1AMAA 2WKAA 4FFCA 1G4VA 3KE3A 3I4JA 3VP9A 4F5KA 3I5TA 3FVSA 5E5IA 2YRIA 1JY3N 2BI3A 3G0TA 2J58A 4O9BA 1M0OA 3U1AA 2VMOA 1LTTC 1N7SC 1KILD 2VMVA 2TPLA 5AW1B 2YCPA 1KILB 2O0RA 1JNMA 1A02J 5EUEA 1H8AA 4WY4C 2OGEA 4Y0HA 2CY8A 4UQVA 3A3YB 2O01H 5DJ9A 2FQ6A 1HH0A 3TNUB 3VOPA 4CVQA 2AATA 2VGTA 1H88A 3WGBA 1B5OA 3PP5A 3N0LA 2XBNA 2ZSLA 1FZBA 2R0TA 1V2DA 3ASAA 1LTJA 4ATPA 3FRKA 3DRDA 2CANA 5KLVK 1FZCA 3H32B 4O6ZA 1AJRA 4RJ0A 3FD0A 1A02F 4WXFA 3KGXA 2YCNA 2NMPA 5CCGA 2W8WA 3EI8A 2CPSA 4ATQA 1L4AA 3W1HA 2VMQA 2WPQA 2VGSA 1HGVA 1LTIC 3VK3A 1J1DB 5APYA 1KMKA 2VMXA 2YKOA 4F5GA 3O8ZA 1D7SA 1BS0A 1MDXA 1RF0C 1O62A 3HD7B 3EZ1A 4CXRA 3NUIA 2D63A 4WYFA 2DKBA 2DGLA 1TPLA 2P1JA 2CH1A 3GHGA 3GHGC 3KGWA 5C6UA 3U59A 2XU6A 4EFFA 5AW5B 4IFMA 3BN1A 1LKCA 3DR7A 4JF1A 5AW9B 2VMWA 1RF1A 4F5LA 1AIAA 1RF1C 1WYVA 4LNLA 1FC4A 2EZ2A 2ZSMA 4UHOA 1LC8A 1SFCD 1NOHA 1SFCB 1WYTB 2VMPA 1AMQA 4ZASA 8AATA 4WYCA 3MADA 3MAUA 1JY3O 1VP4A 4DOJA 2XDJA 4EOTA 2WSFH 2WT7B 4WLJA 4ITXA 3SWYA 1WKHA 2WSCH 1AHFA 4AH3A 2I1KA 2W7JA 1X28A 2W7IA 1BT4A 3P6KA 2L5GB 3M91A 1ARGA 5E3KA 3VK2A 3B1CA 4B9BA 2VMTA 3ECDA 4PFFA 1ZC9A 2YOBA 3HE4A 3DZZA 3E9KA 1ASCA 1ASEA 1MFZA 1MZ9A 1IVRA 4AUWA 1LT9C 1IJIA 3E2YA 1QJ5A 3W1IA 4C46A 2R3CA 1S9KE 3WKSA 1OATA 1CI6A 3HTKA 1HVVA 1FU1A 2V0YA 3JWBA 3USFA 2E54A 4RAEA 2HPCA 1OHVA 4OCAA 3LG0A 5DX5A 1NKNA 1H0CA 4LW2A 2FFDC 4K2MA 2YRRA 1FZAA 2Z5HA 1G4XA 2WK8A 5JAYA 3UWCA 1SPAA 1KL1A 5BU5A 3HT4A 2XKMA 1EJIA 1CW5A 1FZCB 1FJPA 1YIYA 4RLGA 3WCNA 4F5JA 5CCGD 4ISYA 1FZEA 1B4XA 1DFOA 1L4AB 4JYBA 4F4EA 4W1XA 2Z9VA 4W91A 2AY1A 1ZR4A 4OC9A 1ARSA 1H1CA 2JGTA 1O61A 1DGDA 3UE8A 2QA3A 1GC2A 4XEWA 3IR9A 1BQAA 4W5KA 1C4KA 3VMYA 1HTLC 1CSBA 1XEYA 5CCHC 4AO9A 3WY7A 5EIGA 2VGVA 1FAVA 3G8MA 2IX7C 4Y0DA 1NHLA 3ZRRA 3GR9A 3RL0B 3QBOA 1V2FA 3WGCA 4GKGA 5G4JA 4R2NA 4CBSA 4N78D 4GE4A 4E3RA 2JEEA 3GHGB 4LC1A 1GC4A 4P7YA 2VMUA 3FZ7A 1SQVK 5F9SA 1FDMA 5M46A 4BMKA 1GDEA 2EO5A 4JEWA 1T3JA 1G7XA 1GW3A 1EQBA 4HVKA 4W80A 2JG2A 1U08A 1B8GA 1RF1B 1AAMA 4IYOA 1WYVB 3ATHA 4ADDA 3B5ND 3WCOA 1B5PA 2P67A 4Q75A 1S9KD 1DKAA 1IAYA 2YO3A 3OA7A 1VJOA 2D61A 3LY1A 2A45I 1DJ9A 1X0MA 1CS1A 2G6WA 2VRSA 1V2EA 3HVYA 1J04A 3MC6A 2VYCA 1G7WA 4B86A 3NU7A 1M1JC 5APUA 5EFSA 1CZQA 1ASMA 3NMDA 4XJPA 2BWNA 3E2FA 3GZDC 2F8JA 3HE4B 5APVA 1S07A 3N4SA 1LC5A 2IFMA 1GCKA 3DC1A 3MEBA 3RK3C 4J8LA 3P1TA 2BI1A 1QJ3A 4I2LC 3EI9A 2AY3A 2AY5A 1CI6B 2FN6A 3HTKB 1MLYA 1XTGB 2GUSA 1NKZB 3N4XA 1Y4IA 2HPCB 3ELPA 1M4NA 1DJUA 2PB0A 3NNKA 5KJ7A 1XTCC 4OYTA 2ORDA 2WSEH 3LVLB 2P7JA 2YKXA 2C0XA 2Z9WA 2VMYA 1Z3ZA 1IUGA 3I5CA 1RE4C 5APTA 1NH4A 4A0FA 5M4BA 3PIUA 3JWAA 3NDNA 5DJ1A 4M2JA 3VP6A 1GZLA 2YKYA 1VDFA 2WZ7A 4RESB 1N73C 4C7RA 4EB5A 3I16A 1JO5A 1UU1A 3P8MC 1C7GA 3AEJA 4UHMA 1J1EC 1E5FA 3OKSA 2BWPA 2W7FA 1IFMA 3VOMA 4A0HA 3RBLA 1N8PA 4FL0A 2BWOA 3FCRA 5HXXA 5EIGB 1IX8A 5KTBA 1M7LA 3K7YA 4NOGA 4WXGA 5AVZB 2EGYA 4LNMA 3P32A 1I41A 3PPLA 2VLFA 1URQC 2BI9A 3Q8NA 4A0RA 4JEYA 1C7NA 2KFPA 3BASA 2FM1A 5M49A 2ZFCA 3BCBA 3RK2B 1KFMA 5AX8A 5HHYA 2C0RA 4CBRA 4IYOB 4WYAA 3RQ1A 1W7LA 1KMJA 2OYIC 3L36A 1RV4A 1GEYA 1ARTA 2O7CA 3DODA 3AENA 2EH6A 2HOXA 1YJYA 3DYDA 3N75A 3M5UA 1EG5A 3FQ8A 3FQ7A 1JOCA 1TOKA 3AELA 1H89A 2AY2A 3BRVB 4C7NA 1HWTC 3FVUA 3FKDA 3BWNA 1S08A 1OXPA 1KL2A 2OYHA 2OYHC 4AQRD 4A0GA 1M32A 3ZZKA 3BVHA 2Q9IA 2HUIA 1KKJA 1PFFA 2R5EA 2ZY4A 3E1IA 4DBCA 2HUFA 4TMRA 1N7SA 1MGVA 4JYCA 5AVSB 1SLQA 1N7LA 4WY4A 1X8YA 1OHWA 2OGAA 1GU4A 2PB2A 4XJOA 3PA9A 1GD2E 1JS3A 2FYZA 3F6TA 3JTXA 1RE3C 2ZXEB 2OQXA 3DXVA 2IPPA 2VIAA 2AY4A 2GSAA 3GJUA 5AVXB 3BRTB 3AEOA 4XK1A 2A45G 5TF5A 1LK9A 1T2KC 4HYTB 3HRNA 4OT8A 2KYVA 3JZLA 9AATA 1RVUA 3AV7A 3DU4A 1YAAA 4IX8A 1JY2O 4WBAA 1KQLA 5EAVA 2FXMA 4OBUA 2QM8A 3HDOA 5AVQB 3B8EB 3TFTA 1SF2A 4WXBA 1SZKA 1J1EB 3GETA 3ZRPA 1ZV8A 5G2PA 1RF0A 3HD7D 2WITA 4IW7A 3MIWA 3LIEA 1LTGC 3B1DA 4KYOA 5FT5A 1GC3A 4JF0A 2QBTA 3D6KA 2CINA 3VMXA 2D64A 3LVMA 1ASAA 5BJ4A 2FKWB 3FFRA 3ELEA 5AW6B 2X5DA 4BHDA 3VK4A 1HUCA 1FG3A 1SQBK 4R5ZA 3U1CA 1LWUA 4AZJA 1LWUC 1EQ7A 3V2NA 1M0NA 4I6MC 2A45H 2ZUKA 3BWOA 2C0WA 2GUVA 5G2QA 2D5YA 2C9LY 1HJBA 1I48A 1JUNA 1JG8A 2QSRA 2ZYJA 4A72A 1DH3A 4UOYA 4OMAA 4ZWVA 3CQ6A 4P3MA 1XI9A 3B5NC 3AENB 2A1VA 3II0A 5AW2B 4N78E 1CZCA 4LNJA 3K40A 1UKJA 2DGKA 2OATA 3WMM0 1ARHA 3UAKA 4C7NB 1TATA 1AICA 1GL2C 3MUDA 2OYHB 3TYYA 2HORA 4ZKPA 4XAUA 1LT9A 3QM2A 5M4DA 1AQ5A 3NUBA 1GBNA 2VGUA 5AW7B 1AAWA 1N7SD 3L4FA 3EFGA 1BW0A 4LW4A 1N7SB 1N2TA 1NTMK 1MDOA 4WY4D 4WY4B 2R2NA 3QN6A 2G7JA 1I43A 1LW4A 3PD6A 1L0LK 4ZKUA 2N1TC 2Z4EA 1JY3P 3HQTA 3VYIA 2FFDA 4WYGA 1G1JA 4Y99C 1W7NA 5HDMA 1SVVA 5AW0B 3AATA 1SQPK 2HOZA 4LLHA 2YKVA 3AOWA 2KLVA 4IXZA 4PVFA 3SWFA 4F5IA 4RKDA 4K05A 1LTAC 1YTZT 1BQDA 1E5WA 3WLXA 1L4AD 3NYSA 5G0AA 3WZFA 3RUYA 1ZODA 4HF8A 1WSTA 4JEXA 4Y0IA 1ASBA 4Q31A 1IFDA 2WB6A 1AY8A 3NU8A 3KPEA 2YKPA 5CCHA 1C9CA 4IY7A 2Z9UA 1WKGA 5EUDA 4IFFA 2BI5A 2JJFA 4ADCA 2R5DA 3RL0D 5AVRB 2CSTA 2JJGA 1FZFA 1GC0A 3A9ZA 1ASFA 4XQ2A 4A6TA 4IXSA 4ZAHA 1ORDA 1ASLA 2YCTA 4ZLVA 2PP6A 1JTHA 3L44A 1RY3A 1IFJA 3IFMA 2OARA 2YKUA 1LWUB 4M2MA 2W7HA 1UU2A 1AKAA 4H63Q 2E43A 2QM7A 2R32A 2OKJA 1QL1A 1QISA 3N5MA 2Z9XA 3IHJA 2M8RA 2AY9A 1MV8A 2W6AA 1AY4A 2H43A 1Z56A 1NU1K 3M9HA 5J8QA 3COGA 5G4IA 1BJOA 2BYJA 4JEZA 2BI2A 3NXSA 1ZN5A 2QLRA 2V1PA 3HLMA 3NX3A 3NYTA 2CTZA 1M1JA 4U2HA 2NPSC 1N31A 4XE5B 2P2UA 1TOEA 3GZDA 2YO2A 4I1LA 1M7YA 1LT9B 2W7LA 2CPBA 2E42A 1T3IA 1GW4A 1JMMA 3B1EA 3EIAA 2GMSA 2EPJA 2JISA 1D7RA 1CQ8A 1DTYA 1YYCA 2J59M 1PMMA 1HGZA 4ZDPA 3TQXA 3EI6A 1MDZA 2VMNA 3PJ0A 1AFOA 2W7KA 2VMRA 2DKJA 1L0NK 2D7YA 3BB8A 1CZEA 3KKIA 1QZ9A 5K8BA 3PD6B 2XH1A 1LGHB 2EZ1A 4WBTA 1QIRA 1KILC 3RI6A 1E5EA 3A2BA 4ZWMA 1LC7A 5EAAA 2FFDB 3FSLA 1CJ0A 1BKGA 2AY7A 1DEBA 4KHXA 5CHXA 2BIGA 1AX4A 1HBWA 2RFVA 4W8IA 2HP2A 1RE4A 1OXZA 2W8TA 3TFUA 1JF9A 3FZ8A 1YOOA 3L8AA 4EB7A 2HG5D 1N73A 2HP1A 4DGTA 5AVUB 2ZC0A 3WX9A 2C81A 2WK9A 1KKPA 4BQ0A 3FQAA 1PFIA 5CCHD 3ISLA 4W1WA 3V4WA 2LKMA 1RV3A 3EZSA 4JF7A 1C7OA 2W8UA 1WT6A 1J1DC 2CJHA 1QITA 5D95A 3L37A 1FZGA 4KXKA 1URQA 1PMOA 3FVXA 2Z61A 4IXOA 1N2DC 1SQQK 5BU8B 1TOJA 5APWA 3A5TA 2N9BA 1JTHB 3RK2D 3LW5H 1ASNA 5AW4B 2C7TA 2C9NY 4DZOA 4TN4A 3F9TA 1W23A 5G09A 3M06A 1O69A 1DX7A 4PFNA 4JEVA 2Q7CA 3QPGA 5DB5A 2OYIA 3GWPA 2R5CA 1TARA 1BJOB 5IWQA 3LVJA 1SFCC 5AW3B 4H51A 2FNUA 2PAJA 1IX7A 3BS8A 3NTJA 1M1JB 2X3LA 1AHYA 1BJWA 4M2KA 2BASA 3BV0A 4GIFA 2WPSA 2R5BA 1RVYA 3EI7A 3A8UX 2D66A 3T32A 3CAIA 1MUUA 4MY5A 4XA4A 1YJZA 2H8PD 3RK3B 1AMRA 2E7UA 4E3QA 2W27A 1IK9A 2CJGA 3BCXA 2YMYA 3NRAA 2ZJGA 3LV2A 4QGRA 2HOYA 2D65A 2KSJA 1RE3A 2ZY5A 2KOGA 5KJ7D 3TCMA 1M6SA 2JJHA 3LWSA 1SFFA 2VMSA 3KQGA 1ELUA 4U1TA 3MBBA 4IFDK 3P8CD 4ZSWA 2WPRA 3MTUE 2DGMA 3JW9A 2O1JA 4ZM4A 4MQRA 4RJYA 2XV5A 1IX6A 3M9QA 5CJ0A 1SVFA 3V5BA 1LTJC 3ACZA 1N73B 2GM4A 1FZCC 1J2JB 3ZZJA 4GDYA 4MQQA 3HUSA 1W2EA 3HUSC 4Q6RA 2D7ZA 5CCGC 1M0QA 1DJEA 1L4AC 3R2PA 5F8VA 2FNIA 2IFNA 1B9HA 1S0AA 4RM1A 1LW5A 4GRXA 5AVYB 1TOGA 5EQCA 2W7DA 1URQD 1AJSA 2BHXA 3PAAA 5BVZA 1IAXA 1URQB 2VI9A 4AZKA 4WB0A 1G2CA 2Q3IA 3E6GA 3RL0C 3HMUA 1AY5A 1ASDA 1T8ZA 1ZR2A 3DXWA 2FKIA 4B98A 1G1IA 1CL2A 5FT8A 5E4ZA 4J5UA 2DOUA 3GSBA 2CFBA 2XZRA 3DR4A 1MLZA 1GDTA 4WB4A 7AATA 1KFNA 1JY2P 3CBFA 4LGDE 2OYIB 1MAPA 4ITGA 2W8JA 2R5CB 3EIBA 3A2AA 3B5NA 1M0PA 3VN0A 4ZDOA 2AEUA 4K2BA 2I1JA 3H9XA 3W1JA 1JCDA 2Z1YA 1OXOA 1GL2A 2GQNA 3KYQA 1J32A 2X5FA 1IBJA 3CLQA 1ZLLA 1TASA 2Q7WA 3PDXA 3HL2A 4MKKA 4N6JA 4EU1A 3OAKA 4F5HA 1WYUA 1S06A 4OTLA 1VPCA 1LTSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAS A;  5KTB A;  3U1C A;  1X79 B;  1WT6 A;  4GIF A;  3C9I A;  4ZKP A;  2FXM A;  3N4S A;  1IC2 A;  3N7N A;  5BU5 A;  3BAT A;  3VP9 A;  4I1L A;  3P8C D;  4N78 D;  2JEE A;  2POH A;  3HRN A;  3N4X A;  4ZKU A;  3U59 A;  5BVZ A;  4O9B A;  3VP8 A;  1NKN A;  3U1A A;  5BU8 B;  4N3Y B;  3OJA B;  3N4R A; 
#chains in the Genus database with same CATH topology
 2KP8 A;  3FTB A;  2YHK A;  4GEB A;  4ASV A;  1OHY A;  2PO3 A;  2CB1 A;  4M3L A;  4EIJ A;  4E1O A;  1CQ7 A;  1LP1 B;  4BRY B;  2HUU A;  3N7N A;  1P3W A;  5AVV B;  3CCQ P;  3VTP C;  3II6 A;  3CCM P;  2Q5U A;  1IFI A;  1QX8 A;  1Q81 Q;  4OGQ B;  3M0A A;  1SQV D;  1B9I A;  2N1T A;  2QRX A;  3AE4 C;  3BCA A;  2VI8 A;  1SQV G;  4IL6 X;  1FG7 A;  5CMZ A;  4K2I A;  2YIU B;  4K3A A;  2Z20 A;  1C0N A;  1LS3 A;  4F5M A;  1NO4 A;  1VEF A;  3NYU A;  1OVU A;  1ELQ A;  1D2F A;  3V2P A;  1FJK A;  2AY6 A;  4MQP A;  4L73 A;  1T2K D;  1VF5 B;  3TSI A;  2Z5I A;  4R8D A;  4H44 B;  2W7E A;  3VAX A;  1AV1 A;  3MKJ A;  3CL3 D;  1X29 A;  2ZVN B;  1YQ3 C;  2GB3 A;  3GZC A;  2FXP A;  1YNU A;  2W6B A;  4LC3 A;  3KZI H;  1LTJ B;  4GE7 A;  1DGE A;  2HZP A;  2AEV A;  3F0H A;  1GEX A;  3HE5 A;  3ZRQ A;  4RKU J;  3G71 P;  3F89 A;  4I8A A;  2XNX A;  2E7I A;  2YKQ A;  4YXW H;  2DW3 A;  5EUN A;  2AY8 A;  1VQ5 P;  2BYL A;  4GE9 A;  3E77 A;  2WVR A;  3HUS B;  2OKK A;  1AQT A;  3V2R A;  3VP8 A;  4EMY A;  1JS6 A;  4WYD A;  1AMS A;  3EQ2 A;  1H0T A;  3GG2 A;  1BJN A;  2A06 E;  5FT4 A;  2JP3 A;  1BGY D;  2O01 J;  3L75 E;  4HH2 A;  3MGN A;  1JCC A;  1BGY G;  3CQ5 A;  1NTK D;  4DQ6 A;  1YI2 P;  1NTK G;  1WRG A;  1EDL A;  2QMA A;  4N0W A;  1BJ4 A;  3NTN A;  3BC8 A;  4W7Z A;  4OVN F;  1AJS B;  5D5S A;  4WP0 A;  2Q3E A;  1EC5 A;  1Z7D A;  3R9A A;  2JWA A;  2YNY A;  1VQN P;  3AEP A;  1O4S A;  4WB0 B;  2Z1Z A;  1G2C B;  1PV3 A;  3L72 J;  4OH8 B;  4ZMD A;  1T3U A;  3FZ6 A;  4A6U A;  3E2Z A;  1AHE A;  2FYU E;  2KS1 B;  4WLH A;  4BA4 A;  3IN6 A;  2BKW A;  2W7M A;  3RGU A;  1ZOB A;  1D7U A;  4WYE A;  1EDI A;  2HOD A;  1KB9 I;  3LID A;  2W8V A;  3MZW B;  2WTY A;  2W8Z A;  3K28 A;  1NWQ A;  3LVK A;  3L70 J;  1NTZ E;  3CC4 P;  3RK2 C;  3KDP B;  4PIW A;  5AVW B;  3FFH A;  1YJS A;  4EDF A;  1D7M A;  3A7O A;  1X9V A;  4AYC A;  1NAF A;  3BAT A;  3B5N B;  4WD2 A;  4K35 A;  2POH A;  3H1H E;  2VLH A;  3E7K A;  4R4M A;  1SZU A;  3PTZ A;  4N3Y B;  2O3J A;  4KAM A;  2NPS A;  2BIA A;  4R5F A;  1OZH A;  1AHX A;  4RKC A;  3CX5 I;  5AVT B;  2C44 A;  3B8X A;  3MAF A;  1X79 B;  1EXJ A;  1GL2 D;  1SP4 A;  1SQX K;  1KZU B;  1GL2 B;  2E74 C;  1QEX A;  1AKC A;  2ZY2 A;  1U7M A;  2M3B A;  3P7K A;  5APX A;  3RCH A;  2AEF A;  4CXQ A;  3MC6 C;  1KYO I;  1ECX A;  2CJD A;  2O1B A;  3RBF A;  2Y0C A;  1M8O B;  4AO4 A;  3PDB A;  1WYU B;  3L35 A;  3UIA A;  1W7M A;  4MKJ A;  3G3Z A;  2VMZ A;  4XJL A;  3M9B A;  1M90 Q;  3A9X A;  5CBO A;  1GEW A;  3WKR A;  4HKZ H;  4AOA A;  2B87 A;  3O6Q A;  1NTK K;  3AOV A;  1DEE G;  1EZV I;  1ARI A;  3QHX A;  5CJ4 A;  2QB2 A;  2DR1 A;  2N1T D;  5KLV E;  1GK6 A;  2N1T B;  1AKB A;  1KIL A;  4L0O A;  3A9Y A;  1NVO A;  2E75 C;  1QLE D;  2WSF J;  4Y99 B;  3L72 E;  3C9I A;  2E7J A;  5APS A;  2WSC J;  3TNU A;  3TK1 A;  1AHG A;  2VGW A;  3GBX A;  4ASW A;  1R5S A;  5I92 A;  4TLF A;  3EI5 A;  2VGZ A;  2HYN A;  4ADE A;  3M0D A;  5KJ7 C;  3M0D C;  1QGN A;  3V4Q A;  1N86 A;  1Y9B A;  5BJ3 A;  3E1R A;  4PD4 E;  2FYU D;  4GT1 A;  3PGY A;  3RK3 E;  5B66 E;  2CH2 A;  3L70 E;  3FX0 A;  2FYU G;  1R5L A;  3H32 A;  4D6T D;  2H7H A;  3FDD A;  1AVO A;  2IZ1 A;  1V72 A;  3HE5 B;  4UHN A;  4D6T G;  2WK7 A;  3QI6 A;  4XJM A;  1OVR A;  2JJL A;  5APQ A;  1NTZ D;  3H6P A;  5C39 A;  4W1V A;  2MJZ A;  1NTZ G;  1SZS A;  3R4T A;  1YIZ A;  2JDI H;  3N4R A;  2VIB A;  1TOI A;  3WUV A;  1GK4 A;  1KB9 E;  1ZP0 C;  1H0T B;  4PV1 B;  1GU5 A;  1OWA A;  4GSA A;  1AIB A;  4MSO A;  1FBM A;  1YTZ I;  2ZP7 A;  1IZN B;  3AEJ C;  1NGM B;  2JJE A;  3H1H D;  4RIZ A;  1I29 A;  1CQ6 A;  3H1H G;  2AEM A;  3NFQ A;  4U7J A;  1IO4 A;  2GMU A;  4A6R A;  1D7V A;  3P8C E;  3HD7 A;  3HD7 C;  3CPW O;  4W7Y A;  2BIE A;  2EYQ A;  3B46 A;  1GTW A;  4E77 A;  1X22 A;  2WWW A;  1CL1 A;  1LTB C;  1HF9 A;  3TAT A;  1QL2 A;  1IC2 A;  3E2Z B;  1FOS F;  2J5U A;  2NRG A;  3CCL P;  4ADB A;  3CX5 E;  2FY8 A;  3F5H A;  2ZY3 A;  4RIT A;  4F5F A;  1JY2 N;  4A00 A;  1VQO P;  4ZDL A;  4Q76 A;  1W3U A;  2HOD B;  2HFE D;  3QGU A;  3L74 D;  1ASG A;  2Y0E A;  5AW8 B;  2W7G A;  3EUC A;  1KYO E;  3L74 G;  3RBX A;  2E76 B;  3V2Q A;  5FT6 A;  3FDB A;  3G7Q A;  1IFN A;  3K5B A;  1PIX A;  1TU3 F;  4H13 D;  4OBV A;  1SFC A;  5KLV D;  1WYT A;  1VQ8 P;  1UU0 A;  3VMZ A;  5KLV G;  1HJ0 A;  3B71 A;  3CWB E;  3VMA A;  3T97 A;  1SQV J;  3ASB A;  4BA5 A;  1PG8 A;  2FYU K;  3GF3 A;  3H7F A;  2NPS D;  3CI9 A;  2NPS B;  2QVA A;  3TF5 A;  2WT7 A;  2X8U A;  3MAF B;  2OTL P;  3OP7 A;  3QH9 A;  3AEM A;  3CXH E;  3AEM C;  1X2A A;  2R44 A;  3FGA D;  2KB7 P;  2JR8 A;  1S3J A;  3CQ4 A;  1S09 A;  1ZRT D;  3HBX A;  1IJD B;  3RCH B;  1NTZ K;  4ZSY A;  1MAQ A;  2FYF A;  3RK3 D;  4ZM3 A;  1KOR A;  3EWK A;  2HLO A;  3MD0 A;  1GD9 A;  3OJA B;  2QB3 A;  1FOS E;  2O1K A;  3PDB B;  3BWN C;  2ITA A;  1AMA A;  2WKA A;  1LP1 A;  2ZYA A;  4FFC A;  1G4V A;  3KE3 A;  3I4J A;  3AEG C;  3VP9 A;  2B87 B;  3O6Q B;  4F5K A;  3G6E P;  3I5T A;  1ZME C;  3FVS A;  5E5I A;  2YRI A;  2WPV B;  1JY3 N;  2BI3 A;  3G0T A;  2J58 A;  4O9B A;  1M0O A;  3AE2 C;  1KB9 D;  3U1A A;  2VMO A;  1LTT C;  1N7S C;  1KIL D;  2VMV A;  2TPL A;  5AW1 B;  2YCP A;  1KIL B;  2O0R A;  1YJW P;  1JNM A;  1A02 J;  2WMM A;  5EUE A;  1H8A A;  4WY4 C;  2OGE A;  4Y0H A;  1W5C E;  2CY8 A;  4TT3 H;  1BSH A;  4UQV A;  3A3Y B;  2O01 H;  1BGY J;  5DJ9 A;  2FQ6 A;  1HH0 A;  3TNU B;  1P84 I;  2OYO A;  3VOP A;  4CVQ A;  4MN4 C;  3D70 A;  1NTK J;  4GOF A;  2AAT A;  2VGT A;  5KAF E;  2IZ0 A;  2OTK E;  1H88 A;  3WGB A;  1B5O A;  3PP5 A;  3N0L A;  3Q5S A;  2XBN A;  1FDO A;  2ZSL A;  1FZB A;  2R0T A;  1V2D A;  1VQP P;  3BCC D;  5B5E E;  3ASA A;  3CCV P;  1LTJ A;  2ZT9 D;  3SWK A;  3CX5 D;  4ATP A;  3BCC G;  3FRK A;  3DRD A;  2CAN A;  5KLV K;  1FZC A;  2KI7 B;  3H32 B;  4O6Z A;  1AJR A;  4RJ0 A;  1FE6 A;  2KNC A;  1K73 Q;  2QSI A;  3FD0 A;  1A02 F;  4WXF A;  3KGX A;  2YCN A;  3L73 E;  2NMP A;  1KYO D;  5CCG A;  2WQY C;  2W8W A;  3EI8 A;  3C8V A;  2H89 C;  4PD4 H;  2CPS A;  4ATQ A;  3G9R A;  5B66 H;  1L4A A;  1SQV E;  3W1H A;  2VMQ A;  2WPQ A;  2VGS A;  3B4S A;  1HGV A;  1LTI C;  3VK3 A;  1J1D B;  1S5L X;  5APY A;  1KMK A;  4JPZ B;  2VMX A;  3H1I J;  2YKO A;  3I55 P;  4F5G A;  3O8Z A;  3CWB D;  3GMA A;  1EZV D;  1D7S A;  3CC2 P;  1BS0 A;  1MDX A;  1RF0 C;  3CWB G;  2QEX P;  1EZV G;  1O62 A;  3HD7 B;  3ABV C;  3EZ1 A;  4CXR A;  1VQ7 P;  3NUI A;  4H0L D;  2D63 A;  1NTM D;  4H0L B;  4WYF A;  2DKB A;  2O01 N;  2DGL A;  1TPL A;  1NTM G;  2W6J H;  2P1J A;  2CH1 A;  3GHG A;  3GHG C;  3OW2 O;  3KGW A;  3FWL A;  5C6U A;  3U59 A;  2XU6 A;  4EFF A;  5AW5 B;  4IFM A;  2H88 C;  3BN1 A;  2LXC B;  1LKC A;  3DR7 A;  4JF1 A;  5AW9 B;  2AXT E;  3H1K E;  2VMW A;  1RF1 A;  4F5L A;  1AIA A;  1RF1 C;  1WYV A;  3AEA C;  5KKZ C;  4LNL A;  1FC4 A;  1PZQ A;  2EZ2 A;  2ZSM A;  4UHO A;  1LC8 A;  1SFC D;  1NOH A;  3CCJ P;  1DIP A;  1SFC B;  3CCU P;  1WYT B;  2VMP A;  1AMQ A;  4YTP C;  4ZAS A;  2IBZ I;  2D2C B;  2ZJS E;  4WYC A;  8AAT A;  4JBZ A;  3T97 B;  3MAD A;  3MAU A;  1JY3 O;  4U3F E;  1VP4 A;  4DOJ A;  2XDJ A;  4EOT A;  2WSF H;  2WT7 B;  4WLJ A;  4ITX A;  3SWY A;  1WKH A;  2WSC H;  1AHF A;  4AH3 A;  2I1K A;  3G4S P;  3AED C;  2W7J A;  1X28 A;  2W7I A;  1BT4 A;  2PGD A;  3P6K A;  2L5G B;  3M91 A;  1ARG A;  5E3K A;  3VK2 A;  3B1C A;  4B9B A;  2VMT A;  1UII A;  3ECD A;  4GOD A;  4PFF A;  1ZC9 A;  3CXH H;  3HE4 A;  2YOB A;  2FYU J;  3MUD C;  1ASC A;  3DZZ A;  3E9K A;  1FDI A;  1ASE A;  1MFZ A;  3TDK A;  1MZ9 A;  1IVR A;  4AUW A;  1LT9 C;  2JO1 A;  4D6T J;  3L73 D;  4OGQ D;  3PHL A;  1S2E A;  1IJI A;  3H1I E;  3S1K A;  3E2Y A;  3L73 G;  1QJ5 A;  3W1I A;  4C46 A;  2R3C A;  1NTZ J;  1S9K E;  3WKS A;  1OAT A;  1W2B O;  1CI6 A;  3HTK A;  4UB6 H;  4WVZ A;  1HVV A;  3GF7 A;  2QJP C;  1FU1 A;  2V0Y A;  2RKL A;  3JWB A;  3USF A;  3H1H J;  1VF5 D;  4IL6 E;  2E54 A;  4RAE A;  2HPC A;  4H44 D;  2K1A A;  1OHV A;  4OCA A;  2YXR B;  3S9O A;  3LG0 A;  5DX5 A;  1NKN A;  1H0C A;  2BEZ F;  4LW2 A;  2FFD C;  4K2M A;  2YRR A;  1FZA A;  2Z5H A;  1G4X A;  2WK8 A;  5JAY A;  3IF4 A;  4PJ0 H;  3UWC A;  1SPA A;  1KL1 A;  5BU5 A;  3HT4 A;  2K9Y A;  2XKM A;  1EJI A;  4RO0 A;  1CW5 A;  5KAF H;  2G8Y A;  1FZC B;  3D6Z A;  1YJ9 P;  3CCE P;  1FJP A;  2KNC B;  1YIY A;  4RLG A;  3WCN A;  4F5J A;  5CCG D;  4ISY A;  1FZE A;  3H1K D;  4KJM A;  2QIW A;  1B4X A;  3L74 J;  1DFO A;  3USS A;  3H1K G;  5KLI C;  1L4A B;  4JYB A;  4F4E A;  4W1X A;  2Z9V A;  4W91 A;  2AY1 A;  1ZR4 A;  4OC9 A;  1ARS A;  1H1C A;  4YXD C;  2JGT A;  1O61 A;  1DGD A;  3UE8 A;  2QA3 A;  1GC2 A;  3SFE C;  4XEW A;  3IR9 A;  1BQA A;  4W5K A;  1C4K A;  3VMY A;  5KLV J;  1HTL C;  1CSB A;  1XEY A;  4U3F D;  5CCH C;  4AO9 A;  1YHQ P;  3WY7 A;  5EIG A;  2VGV A;  1BSN A;  4U3F G;  4UB8 E;  1FAV A;  3SFD C;  3G8M A;  2IX7 C;  4Y0D A;  1NHL A;  3ZRR A;  3GR9 A;  3RL0 B;  3QBO A;  3RL0 g;  1V2F A;  3WGC A;  4GKG A;  5G4J A;  3RBZ A;  4R2N A;  3W68 A;  4CBS A;  4N78 D;  4GE4 A;  4E3R A;  2JEE A;  3GHG B;  4LC1 A;  1P84 D;  1GC4 A;  4P7Y A;  1YIJ P;  2VMU A;  3FZ7 A;  4D6T E;  1SQV K;  3AE9 C;  1FDM A;  5F9S A;  2ZXX A;  5M46 A;  4BMK A;  1GDE A;  2M5A A;  2EO5 A;  1OX3 A;  4JEW A;  1T3J A;  1G7X A;  1GW3 A;  1EQB A;  2KZI A;  4HVK A;  4W80 A;  2JG2 A;  1U08 A;  1B8G A;  2QE7 H;  1RF1 B;  1AAM A;  4IYO A;  1WYV B;  3ATH A;  3JC2 2;  3H1I D;  4ADD A;  3B5N D;  3WCO A;  1B5P A;  2P67 A;  1R8E A;  4Q75 A;  3CMA P;  1Q2N A;  3H1I G;  1S9K D;  1DKA A;  1IAY A;  2B9B A;  2YO3 A;  3OA7 A;  1VJO A;  2D61 A;  3LY1 A;  2A45 I;  1DJ9 A;  2M0B A;  1X0M A;  3Q1M A;  1CS1 A;  3TGU E;  2G6W A;  1U7J A;  2VRS A;  4H13 C;  3R4Y A;  2QJK B;  1V2E A;  2QJY C;  3HVY A;  1J04 A;  3MC6 A;  2VYC A;  1G7W A;  4B86 A;  1KTM A;  1M1J C;  3NU7 A;  5APU A;  5EFS A;  1CZQ A;  1ASM A;  3NMD A;  4XJP A;  5KAI E;  1T6A A;  2BWN A;  3E2F A;  3GZD C;  3L74 E;  2F8J A;  1Q86 Q;  3BCC J;  3HE4 B;  4GOE A;  5APV A;  1S07 A;  4GDO A;  3N4S A;  1KAF A;  1Y47 A;  1LC5 A;  2KXP B;  2B89 A;  2IFM A;  1GCK A;  3DC1 A;  3MEB A;  2BCC D;  3RK3 C;  3S4R A;  1S72 P;  4J8L A;  3AEC C;  3P1T A;  2BI1 A;  2BCC G;  2XND H;  1QJ3 A;  1AJY A;  4I2L C;  3EI9 A;  4I7Z C;  2AY3 A;  2AY5 A;  2CK3 H;  1CI6 B;  2FN6 A;  2UWJ E;  3HTK B;  1UIX A;  5GTI E;  1KD1 Q;  1MLY A;  1DD3 A;  2AXC A;  1MKM A;  1XTG B;  2GUS A;  1NKZ B;  3N4X A;  3CWB J;  1Y4I A;  2HPC B;  1JMB A;  3ELP A;  1M4N A;  1DJU A;  2PB0 A;  1ZRT E;  3NNK A;  5KJ7 A;  1PGP A;  1XTC C;  4OYT A;  2ORD A;  2IBZ D;  1U57 A;  2WSE H;  3AE8 C;  1OVV A;  2IBZ G;  2P7J A;  3LVL B;  2YKX A;  2C0X A;  1NTM J;  3PH0 A;  2Z9W A;  4IL6 H;  2VMY A;  1Z3Z A;  3AE3 C;  1IUG A;  3I5C A;  1RE4 C;  5APT A;  1NH4 A;  3A0B E;  4A0F A;  5M4B A;  3PIU A;  3JWA A;  3NDN A;  5DJ1 A;  4M2J A;  2QG4 A;  3VP6 A;  1GZL A;  2YKY A;  1KN7 A;  1VDF A;  4PV1 D;  2WZ7 A;  4RES B;  1N73 C;  4C7R A;  4EB5 A;  3I16 A;  1KIL E;  1JO5 A;  1UU1 A;  1SQB E;  3P8M C;  1C7G A;  4Y28 J;  3AEJ A;  4UHM A;  3CCS P;  2YXQ B;  4L75 A;  1J1E C;  1E5F A;  2K37 A;  2RMZ A;  3OKS A;  2BWP A;  2W7F A;  1PGQ A;  4QMA A;  2AEJ A;  1IFM A;  3VOM A;  1OFC X;  4A0H A;  3WU2 E;  3RBL A;  1N8P A;  4FL0 A;  2BWO A;  3FCR A;  1X0T A;  5EIG B;  5HXX A;  3TGU D;  1IX8 A;  5KTB A;  3L71 J;  3TGU G;  1M7L A;  3K7Y A;  4NOG A;  2MKV A;  4WXG A;  3BCC E;  5AVZ B;  2EGY A;  4LNM A;  3P32 A;  1I41 A;  3PPL A;  2VLF A;  1URQ C;  2BI9 A;  1PGO A;  1NYH A;  3Q8N A;  4A0R A;  1BDC A;  4JEY A;  4UB8 H;  1C7N A;  2P58 A;  2M5A B;  3CCR P;  4HJG H;  2KFP A;  3BAS A;  2FYN C;  2FM1 A;  5M49 A;  2ZFC A;  3BCB A;  2E76 D;  3RK2 B;  1KFM A;  1N8R Q;  3MP7 B;  5AX8 A;  5HHY A;  1K9M Q;  2C0R A;  4CBR A;  3JCU E;  4IYO B;  4WYA A;  3RQ1 A;  3Q3D A;  3L73 J;  3MHV A;  4A7P A;  1W7L A;  1EZV E;  1KMJ A;  2OYI C;  3L36 A;  1RV4 A;  2FBW C;  1GEY A;  3V6I A;  1ART A;  2O7C A;  1BDD A;  3DOD A;  2E74 D;  3AEN A;  2EH6 A;  2HOX A;  2E74 B;  1NTM E;  1YJY A;  1PGJ A;  3DYD A;  3N75 A;  1OW8 A;  3M5U A;  1EG5 A;  3FQ8 A;  3FQ7 A;  1JOC A;  1TOK A;  2K3R A;  3AEL A;  1H89 A;  2AY2 A;  3BRV B;  1L0L E;  4C7N A;  1HWT C;  3FVU A;  3FKD A;  3BWN A;  1S08 A;  1OXP A;  1KL2 A;  2OYH A;  2OYH C;  4AQR D;  4A0G A;  1M32 A;  3ZZK A;  1KQF B;  3AE6 C;  3BVH A;  2Q9I A;  1SQP E;  2KUB A;  1PL5 A;  2HUI A;  1KKJ A;  1PFF A;  2R5E A;  2ZY4 A;  3E1I A;  4DBC A;  2HUF A;  4TMR A;  1N7S A;  2Q1K A;  5KAI H;  2PRR A;  1MGV A;  3H1K J;  4JYC A;  5AVS B;  3SSU A;  1SQB D;  1SLQ A;  2E75 D;  1BCC E;  1N7L A;  4WY4 A;  4I7Z B;  2E75 B;  1QVF O;  1SQB G;  1X8Y A;  4XFJ A;  3L71 E;  1OHW A;  2OGA A;  1GU4 A;  2HR3 A;  3H1J E;  2PB2 A;  4XJO A;  3PA9 A;  1GD2 E;  5H2F E;  1JS3 A;  2FYZ A;  3F6T A;  3JTX A;  1RE3 C;  1AVY A;  4OWF A;  2ZXE B;  4U3F J;  2YIU C;  2OQX A;  1K8A Q;  3DXV A;  2IPP A;  2VIA A;  2AY4 A;  4BWN A;  2GSA A;  3GJU A;  5AVX B;  3BRT B;  3AEO A;  1RQU A;  2SPZ A;  4XK1 A;  2A45 G;  5TF5 A;  3A0H E;  4KT0 J;  1VF5 C;  1YQ4 C;  1LK9 A;  1T2K C;  4H44 C;  4YPC A;  4HYT B;  2GA1 A;  3HRN A;  4OT8 A;  2KYV A;  3JZL A;  9AAT A;  1YBK A;  2IDB A;  1RVU A;  1BE3 D;  3AV7 A;  3CME P;  1YAA A;  3DU4 A;  3W67 A;  4IX8 A;  1JY2 O;  2JWD A;  4WBA A;  1BE3 G;  2KZJ A;  1KQL A;  5EAV A;  4NPF X;  1KQG B;  2FXM A;  4OBU A;  2QM8 A;  3AEE C;  1QVG O;  3HDO A;  5AVQ B;  3B8E B;  5TJH A;  3TFT A;  1SF2 A;  4WXB A;  1SZK A;  1J1E B;  3GET A;  3A0B H;  3ZRP A;  1ZV8 A;  5G2P A;  2V7Q J;  1RF0 A;  3HD7 D;  2WIT A;  4IW7 A;  3MIW A;  1S5L E;  3LIE A;  1LTG C;  3B1D A;  1KB9 H;  2WSE J;  4KYO A;  1ZW0 A;  5FT5 A;  1GC3 A;  4JF0 A;  1Q90 D;  2QBT A;  3D6K A;  2CIN A;  1NU1 E;  3VMX A;  2D64 A;  1RH5 B;  2L91 A;  3LVM A;  1L0L D;  1ASA A;  5BJ4 A;  3WU2 H;  2FKW B;  3FFR A;  3ELE A;  1WMK A;  1L0L G;  5AW6 B;  2X5D A;  1PP9 D;  4BHD A;  3VK4 A;  3C1L A;  1HUC A;  1FG3 A;  1SQB K;  4R5Z A;  3U1C A;  1LWU A;  4AZJ A;  1PP9 G;  1LWU C;  1EQ7 A;  3V2N A;  1M0N A;  4I6M C;  1SQP D;  2A45 H;  2ZUK A;  3CX5 H;  3BWO A;  1SQP G;  2C0W A;  2GUV A;  1YIT P;  5G2Q A;  1OMI A;  2D5Y A;  2C9L Y;  1HJB A;  1I48 A;  2KIK A;  1JUN A;  1JG8 A;  2QSR A;  2BCC J;  2D2C D;  1EDK A;  1BCC D;  2ZYJ A;  1KYO H;  4A72 A;  1DH3 A;  4UOY A;  4OMA A;  4ZWV A;  3CQ6 A;  1BCC G;  4P3M A;  2IYO A;  1XI9 A;  1YJN P;  2KK7 A;  3L71 D;  2QA4 P;  3JCU H;  3H1J D;  3L71 G;  3B5N C;  5TIS E;  3AEN B;  3H1J G;  2A1V A;  3II0 A;  5AW2 B;  4N78 E;  1CZC A;  1L0N E;  4LNJ A;  3K40 A;  1UKJ A;  2DGK A;  2OAT A;  1P84 E;  3WMM 0;  1ARH A;  4ZNC A;  1ZOY C;  3LW5 J;  3UAK A;  4C7N B;  1TAT A;  1AIC A;  1GL2 C;  3MUD A;  2OYH B;  3TYY A;  5EFW B;  2HOR A;  4ZKP A;  3FWN A;  4XAU A;  3ZDM A;  1VQM P;  1LT9 A;  1FS0 E;  3EFF K;  3QM2 A;  1KMI Z;  5M4D A;  1AQ5 A;  3NUB A;  1GBN A;  3GLM A;  2BEQ D;  2VGU A;  5AW7 B;  1AAW A;  1N7S D;  3L4F A;  3EFG A;  1BW0 A;  4LW4 A;  5M1B A;  1N7S B;  1N2T A;  1NTM K;  1MDO A;  4WY4 D;  4Z1M H;  4WY4 B;  2R2N A;  3QN6 A;  2G7J A;  3GW6 A;  1I43 A;  1LW4 A;  3PD6 A;  1L0L K;  4ZKU A;  4EI2 A;  2N1T C;  3KHU A;  2Z4E A;  1PPJ D;  1JY3 P;  3HQT A;  3VYI A;  2FFD A;  1PPJ G;  4WYG A;  1G1J A;  4Y99 C;  1W7N A;  5HDM A;  3TGU J;  1SVV A;  5AW0 B;  1NU1 D;  3AAT A;  1SQP K;  1VL2 A;  2HOZ A;  1NU1 G;  4LLH A;  2YKV A;  3AOW A;  2KLV A;  3PLN A;  3Q5P A;  4IXZ A;  4PVF A;  2KLU A;  5H2F H;  2E5T A;  1K05 A;  3SWF A;  4F5I A;  4RKD A;  4K05 A;  4CPG A;  1LTA C;  1YTZ T;  4NPE A;  1BQD A;  1E5W A;  2BCC E;  2ZVO B;  5B5E H;  3WLX A;  1L4A D;  3NYS A;  1SQQ E;  3ITK A;  5G0A A;  1SQX D;  3A0H H;  3WZF A;  3RUY A;  1ZOD A;  4HF8 A;  1SQX G;  2OQQ A;  1USD A;  1WST A;  4JEX A;  4Y0I A;  1ASB A;  4Q31 A;  1IFD A;  2WB6 A;  1AY8 A;  3NU8 A;  1OIP A;  3KPE A;  2YKP A;  5CCH A;  1C9C A;  4IY7 A;  1Q82 Q;  2Z9U A;  1WKG A;  3FXD A;  2Q6Q A;  5EUD A;  4PV1 C;  3WUT A;  4IFF A;  2BI5 A;  2JJF A;  4ADC A;  2R5D A;  3RL0 D;  5AVR B;  2CST A;  2JJG A;  2IBZ E;  1FZF A;  4R4L A;  1GC0 A;  3A9Z A;  1ZXG A;  1L0N D;  1ASF A;  4PD4 I;  4XQ2 A;  1L0N G;  4A6T A;  4IXS A;  4ZAH A;  1ORD A;  1ASL A;  2YCT A;  4ZLV A;  1S5L H;  2PP6 A;  1JTH A;  3L44 A;  1RY3 A;  3H1L D;  1IFJ A;  3PJS K;  3IFM A;  2OAR A;  2Y9Z A;  2YKU A;  1LWU B;  3H1L G;  4M2M A;  1FC2 C;  2W7H A;  1RHZ B;  2R3S A;  1UU2 A;  1AKA A;  4H63 Q;  2E43 A;  2QM7 A;  2R32 A;  5KKZ B;  2OKJ A;  1QL1 A;  1QIS A;  3N5M A;  2Z9X A;  1VQL P;  1M56 D;  3IHJ A;  2Y0D A;  2M8R A;  5GTH E;  1IFP A;  1MV8 A;  2AY9 A;  2W6A A;  5DJT B;  1AY4 A;  2AXT H;  2E76 C;  2H43 A;  1Z56 A;  1NU1 K;  3M9H A;  5J8Q A;  3COG A;  5G4I A;  1SQB J;  2RN0 A;  1BJO A;  2BYJ A;  4JEZ A;  2BI2 A;  1K04 A;  3D71 A;  3NXS A;  5K5G B;  1ZN5 A;  2QLR A;  2V1P A;  3HLM A;  3NX3 A;  3NYT A;  2CTZ A;  1M1J A;  4U2H A;  1Y8A A;  2NPS C;  1N31 A;  2Y9Y A;  4XE5 B;  2P2U A;  1TOE A;  3GZD A;  2YO2 A;  5TIS H;  4I1L A;  1AA0 A;  2YMK A;  1M7Y A;  1LT9 B;  2W7L A;  2CPB A;  2E42 A;  1T3I A;  1E79 H;  1GW4 A;  1JMM A;  3B1E A;  3EIA A;  2GMS A;  2EPJ A;  1P84 H;  2JIS A;  1D7R A;  1CQ8 A;  1DTY A;  1YYC A;  2J59 M;  1PMM A;  1HGZ A;  1SQQ D;  1BE3 J;  2ZYG A;  4ZDP A;  1SS1 A;  3TQX A;  1SQQ G;  3EI6 A;  2WSS H;  1MDZ A;  2VMN A;  3PJ0 A;  1AFO A;  2W7K A;  2K88 A;  2VMR A;  2DKJ A;  1L0N K;  2D7Y A;  2QJP B;  3BB8 A;  1CZE A;  3KKI A;  1QZ9 A;  1QGK B;  5K8B A;  3PD6 B;  2XH1 A;  2V7Q H;  3CXH I;  1LGH B;  2EZ1 A;  4WBT A;  2A06 D;  4DCK A;  2ZAE B;  1KIL C;  1EXI A;  1E5E A;  1QIR A;  3A2B A;  3RI6 A;  3L75 D;  2A06 G;  1VQ6 P;  3KXD A;  1LC7 A;  2FFD B;  5EAA A;  2K9J A;  4ZWM A;  3FSL A;  1CJ0 A;  3L75 G;  1OW6 A;  1BKG A;  2AY7 A;  1DEB A;  4KHX A;  5CHX A;  2BIG A;  2G3A A;  1AX4 A;  1HBW A;  2RFV A;  4W8I A;  2HP2 A;  1RE4 A;  1OXZ A;  1L0L J;  2W8T A;  3PRJ A;  4WWI A;  3TFU A;  1PP9 J;  1JF9 A;  3FZ8 A;  1YOO A;  3L8A A;  4EB7 A;  2HG5 D;  1N73 A;  2ZT9 C;  2HP1 A;  5KLI B;  4DGT A;  3JSV C;  5AVU B;  2ZC0 A;  1SQP J;  3WX9 A;  1LT1 A;  2C81 A;  4EYY Q;  2WK9 A;  1S4X A;  1KKP A;  3Q5R A;  4BQ0 A;  3FQA A;  1PFI A;  1M57 D;  3AEB C;  5CCH D;  2W90 A;  3ISL A;  3I56 P;  4W1W A;  3V4W A;  2LKM A;  1RV3 A;  1BCC J;  3EZS A;  4JF7 A;  1Q7Y Q;  1C7O A;  2W8U A;  1WT6 A;  1J1D C;  2CJH A;  1QIT A;  3AE5 C;  5D95 A;  3H1J J;  2LR2 A;  3L37 A;  1FZG A;  1VQ4 P;  4KXK A;  1URQ A;  1PMO A;  5E79 E;  3FVX A;  2Z61 A;  4IXO A;  1N2D C;  1SQQ K;  5BU8 B;  1TOJ A;  5APW A;  3AE1 C;  3A5T A;  2N9B A;  3Q2Y A;  1JTH B;  2KSE A;  4H0L C;  3RK2 D;  3LW5 H;  1BE3 E;  1ASN A;  5AW4 B;  4DJG A;  2C7T A;  2C9N Y;  4DZO A;  4TN4 A;  3WUU A;  1VQ9 P;  3F9T A;  5CBN A;  1W23 A;  5G09 A;  3M06 A;  1O69 A;  1DX7 A;  4PFN A;  4JEV A;  2Q7C A;  3QPG A;  5DB5 A;  2OYI A;  3GWP A;  2R5C A;  1USE A;  1TAR A;  1BJO B;  5IWQ A;  3LVJ A;  4H13 B;  4BXL A;  1SFC C;  5AW3 B;  2QJY B;  4H51 A;  2FNU A;  2PAJ A;  2D2C C;  2OTJ P;  5GTH H;  1IX7 A;  3BS8 A;  4HB1 A;  2ZYD A;  2I8D A;  3NTJ A;  1DD4 A;  1M1J B;  2X3L A;  3L72 D;  1AHY A;  1BJW A;  2P10 A;  3L72 G;  4M2K A;  1KV4 A;  2BAS A;  3BV0 A;  1PP9 E;  4GIF A;  1NU1 J;  2WPS A;  2R5B A;  4L74 A;  1RVY A;  3EI7 A;  3A8U X;  2D66 A;  3T32 A;  1LNQ A;  5DJU B;  3CAI A;  1MUU A;  4MY5 A;  4PD4 D;  4XA4 A;  1YJZ A;  2H8P D;  3L70 D;  3RK3 B;  1AMR A;  2E7U A;  4E3Q A;  3FXE A;  3L70 G;  2W27 A;  1IK9 A;  2CJG A;  4JQ0 D;  4BRY A;  3BCX A;  4UB6 E;  2YMY A;  3NRA A;  2ZJG A;  3LV2 A;  3IAO A;  4QGR A;  1SQX J;  2M3E A;  2HOY A;  4OGQ C;  2RH0 A;  2D65 A;  2KSJ A;  1RE3 A;  2ZY5 A;  2KOG A;  1IK7 A;  5KJ7 D;  3TCM A;  1M6S A;  2JJH A;  3LWS A;  1SFF A;  4IOI H;  2VMS A;  1RQV A;  2K9J B;  3KQG A;  5GTI H;  1ELU A;  4PJ0 E;  4U1T A;  3MBB A;  3KZI E;  4IFD K;  3P8C D;  1JEK A;  4ZSW A;  1S1C X;  2WPR A;  1L0N J;  1JB0 J;  3MTU E;  1MFT A;  2DGM A;  3JW9 A;  2O1J A;  4ZM4 A;  3AE7 C;  1NJI Q;  4MQR A;  4RJY A;  2XV5 A;  2IYP A;  1IX6 A;  1L2P A;  3M9Q A;  5CJ0 A;  3CD6 P;  1SVF A;  3H1L J;  3V5B A;  3H25 A;  1LTJ C;  1KQS O;  3ACZ A;  2ZT9 B;  1N73 B;  2FXO A;  2GM4 A;  2PFX A;  1M1K Q;  1FZC C;  1J2J B;  3ZZJ A;  4GDY A;  4MQQ A;  3HUS A;  1OW7 A;  1W2E A;  3HUS C;  4Q6R A;  2D7Z A;  2N9Y B;  5CCG C;  1EDJ A;  1VQK P;  1M0Q A;  1DJE A;  1L4A C;  4DT0 A;  3R2P A;  5F8V A;  1PPJ E;  2FNI A;  2IFN A;  1B9H A;  1NAY A;  1S0A A;  4RM1 A;  1LW5 A;  4GRX A;  5AVY B;  1TOG A;  5EQC A;  2W83 C;  1LJ2 A;  2W7D A;  1URQ D;  1AJS A;  2BHX A;  3PAA A;  5BVZ A;  1IAX A;  1URQ B;  2VI9 A;  4AZK A;  4WB0 A;  1G2C A;  3CXH D;  2Q3I A;  4RJT A;  3E6G A;  3RL0 C;  3HMU A;  1AY5 A;  1ASD A;  1T8Z A;  1ZR2 A;  3DXW A;  2FYN B;  2FKI A;  4B98 A;  2KS1 A;  1G1I A;  1CL2 A;  5FT8 A;  5E4Z A;  4J5U A;  2V4H A;  1GMJ A;  2DOU A;  2JKV A;  3GSB A;  1SQX E;  5E79 H;  2CFB A;  3D6Y A;  2LXB A;  2XZR A;  3DR4 A;  1MLZ A;  1GDT A;  3QWO C;  4WB4 A;  7AAT A;  2B88 A;  1KFN A;  1JY2 P;  3CBF A;  4LGD E;  1SQQ J;  2OYI B;  4NPD A;  1MAP A;  4ITG A;  2W8J A;  5L8R J;  2R5C B;  3EIB A;  3AEF C;  3A2A A;  3B5N A;  1M0P A;  3VN0 A;  4ZDO A;  1BGY E;  2AEU A;  4K2B A;  1JM0 A;  1NTK E;  2I1J A;  3H9X A;  3W1J A;  1JCD A;  2Z1Y A;  3L75 J;  1OXO A;  1GL2 A;  2NZ2 A;  2GQN A;  3KYQ A;  1J32 A;  2QJK C;  3H1L E;  2E5Y A;  2X5F A;  1IBJ A;  2OGU A;  1ZLL A;  3CLQ A;  1TAS A;  2Q7W A;  3PDX A;  1KC8 Q;  3HL2 A;  4MKK A;  4N6J A;  4L76 A;  3CC7 P;  4EU1 A;  3OAK A;  4F5H A;  1WYU A;  1S06 A;  4OTL A;  1VPC A;  1LTS C; 
#chains in the Genus database with same CATH homology
 2KP8 A;  3FTB A;  2YHK A;  4GEB A;  1OHY A;  2PO3 A;  2CB1 A;  4M3L A;  4EIJ A;  4E1O A;  1CQ7 A;  2HUU A;  3N7N A;  1P3W A;  5AVV B;  3VTP C;  3II6 A;  2Q5U A;  1IFI A;  3M0A A;  1B9I A;  2N1T A;  3BCA A;  2VI8 A;  1FG7 A;  5CMZ A;  4K2I A;  2Z20 A;  1C0N A;  1LS3 A;  4F5M A;  1NO4 A;  1VEF A;  3NYU A;  1ELQ A;  1D2F A;  3V2P A;  1FJK A;  2AY6 A;  4MQP A;  1T2K D;  3TSI A;  2Z5I A;  4R8D A;  2W7E A;  3VAX A;  3MKJ A;  3CL3 D;  1X29 A;  2GB3 A;  3GZC A;  1YNU A;  2W6B A;  4LC3 A;  1LTJ B;  4GE7 A;  1DGE A;  2HZP A;  2AEV A;  3F0H A;  1GEX A;  3HE5 A;  3ZRQ A;  4I8A A;  2XNX A;  2E7I A;  2YKQ A;  5EUN A;  2AY8 A;  2BYL A;  4GE9 A;  3E77 A;  3HUS B;  2OKK A;  3V2R A;  4EMY A;  3VP8 A;  1JS6 A;  4WYD A;  1AMS A;  3EQ2 A;  1BJN A;  5FT4 A;  4HH2 A;  3MGN A;  1JCC A;  3CQ5 A;  4DQ6 A;  1WRG A;  2QMA A;  4N0W A;  1BJ4 A;  3NTN A;  3BC8 A;  4W7Z A;  4WP0 A;  1AJS B;  5D5S A;  1Z7D A;  3R9A A;  2YNY A;  3AEP A;  1O4S A;  4WB0 B;  2Z1Z A;  1G2C B;  4OH8 B;  1T3U A;  3FZ6 A;  4A6U A;  3E2Z A;  1AHE A;  4WLH A;  4BA4 A;  2BKW A;  2W7M A;  1ZOB A;  1D7U A;  4WYE A;  2HOD A;  2W8V A;  3LID A;  2WTY A;  3K28 A;  1NWQ A;  3LVK A;  3RK2 C;  3KDP B;  4PIW A;  5AVW B;  3FFH A;  1YJS A;  3A7O A;  1X9V A;  4AYC A;  1NAF A;  3BAT A;  3B5N B;  4WD2 A;  2POH A;  2VLH A;  1SZU A;  4N3Y B;  4KAM A;  2NPS A;  2BIA A;  4R5F A;  1AHX A;  4RKC A;  5AVT B;  3B8X A;  2C44 A;  3MAF A;  1X79 B;  1GL2 D;  1SP4 A;  1SQX K;  1KZU B;  1GL2 B;  1AKC A;  2ZY2 A;  2M3B A;  3P7K A;  5APX A;  3RCH A;  4CXQ A;  3MC6 C;  1ECX A;  2CJD A;  2O1B A;  3RBF A;  4AO4 A;  3PDB A;  1WYU B;  3L35 A;  3UIA A;  1W7M A;  4MKJ A;  3G3Z A;  2VMZ A;  4XJL A;  3M9B A;  3A9X A;  1GEW A;  3WKR A;  4AOA A;  1NTK K;  3AOV A;  1ARI A;  3QHX A;  5CJ4 A;  2QB2 A;  2DR1 A;  2N1T D;  1GK6 A;  2N1T B;  1AKB A;  1KIL A;  4L0O A;  3A9Y A;  4Y99 B;  3C9I A;  2E7J A;  5APS A;  3TNU A;  3TK1 A;  1AHG A;  2VGW A;  3GBX A;  5I92 A;  3EI5 A;  2VGZ A;  2HYN A;  4ADE A;  3M0D A;  5KJ7 C;  3M0D C;  1QGN A;  3V4Q A;  1N86 A;  5BJ3 A;  3PGY A;  4GT1 A;  2CH2 A;  3H32 A;  2H7H A;  3FDD A;  1V72 A;  3HE5 B;  4UHN A;  2WK7 A;  3QI6 A;  4XJM A;  2JJL A;  5APQ A;  3H6P A;  4W1V A;  2MJZ A;  3R4T A;  1SZS A;  1YIZ A;  3N4R A;  2VIB A;  1TOI A;  1GK4 A;  1GU5 A;  1OWA A;  4GSA A;  1AIB A;  4MSO A;  1FBM A;  1YTZ I;  2ZP7 A;  3AEJ C;  2JJE A;  4RIZ A;  1I29 A;  1CQ6 A;  3NFQ A;  4A6R A;  1IO4 A;  2GMU A;  1D7V A;  3P8C E;  3HD7 A;  3HD7 C;  4W7Y A;  2BIE A;  2EYQ A;  3B46 A;  1GTW A;  4E77 A;  2WWW A;  1CL1 A;  1LTB C;  3TAT A;  1QL2 A;  1IC2 A;  3E2Z B;  1FOS F;  4ADB A;  2ZY3 A;  4RIT A;  4F5F A;  1JY2 N;  4A00 A;  4ZDL A;  4Q76 A;  1W3U A;  2HOD B;  2HFE D;  3QGU A;  1ASG A;  5AW8 B;  2W7G A;  3EUC A;  3V2Q A;  5FT6 A;  3FDB A;  3G7Q A;  1IFN A;  4OBV A;  1SFC A;  1WYT A;  1UU0 A;  3VMZ A;  3ASB A;  4BA5 A;  3T97 A;  1PG8 A;  2FYU K;  3H7F A;  2NPS D;  3CI9 A;  2NPS B;  2WT7 A;  2X8U A;  3MAF B;  3OP7 A;  3AEM A;  3AEM C;  1X2A A;  2KB7 P;  3CQ4 A;  1S09 A;  3HBX A;  1IJD B;  3RCH B;  1NTZ K;  4ZSY A;  1MAQ A;  2FYF A;  3RK3 D;  4ZM3 A;  2HLO A;  3MD0 A;  1GD9 A;  3OJA B;  2QB3 A;  1FOS E;  2O1K A;  3PDB B;  3BWN C;  1AMA A;  2WKA A;  4FFC A;  1G4V A;  3KE3 A;  3I4J A;  3VP9 A;  4F5K A;  3I5T A;  3FVS A;  5E5I A;  2YRI A;  1JY3 N;  2BI3 A;  3G0T A;  2J58 A;  4O9B A;  1M0O A;  3U1A A;  2VMO A;  1LTT C;  1N7S C;  1KIL D;  2VMV A;  2TPL A;  5AW1 B;  2YCP A;  1KIL B;  2O0R A;  1JNM A;  1A02 J;  5EUE A;  1H8A A;  4WY4 C;  2OGE A;  4Y0H A;  2CY8 A;  4UQV A;  3A3Y B;  2O01 H;  5DJ9 A;  2FQ6 A;  1HH0 A;  3TNU B;  3VOP A;  4CVQ A;  2AAT A;  2VGT A;  1H88 A;  3WGB A;  1B5O A;  3PP5 A;  3N0L A;  2XBN A;  2ZSL A;  1FZB A;  2R0T A;  1V2D A;  3ASA A;  1LTJ A;  4ATP A;  3FRK A;  3DRD A;  2CAN A;  5KLV K;  1FZC A;  3H32 B;  4O6Z A;  1AJR A;  4RJ0 A;  3FD0 A;  1A02 F;  4WXF A;  3KGX A;  2YCN A;  2NMP A;  5CCG A;  2W8W A;  3EI8 A;  2CPS A;  4ATQ A;  1L4A A;  3W1H A;  2VMQ A;  2WPQ A;  2VGS A;  1HGV A;  1LTI C;  3VK3 A;  1J1D B;  5APY A;  1KMK A;  2VMX A;  2YKO A;  4F5G A;  3O8Z A;  1D7S A;  1BS0 A;  1MDX A;  1RF0 C;  1O62 A;  3HD7 B;  3EZ1 A;  4CXR A;  3NUI A;  2D63 A;  4WYF A;  2DKB A;  2DGL A;  1TPL A;  2P1J A;  2CH1 A;  3GHG A;  3GHG C;  3KGW A;  5C6U A;  3U59 A;  2XU6 A;  4EFF A;  5AW5 B;  4IFM A;  3BN1 A;  1LKC A;  3DR7 A;  4JF1 A;  5AW9 B;  2VMW A;  1RF1 A;  4F5L A;  1AIA A;  1RF1 C;  1WYV A;  4LNL A;  1FC4 A;  2EZ2 A;  2ZSM A;  4UHO A;  1LC8 A;  1SFC D;  1NOH A;  1SFC B;  1WYT B;  2VMP A;  1AMQ A;  4ZAS A;  8AAT A;  4WYC A;  3MAD A;  3MAU A;  1JY3 O;  1VP4 A;  4DOJ A;  2XDJ A;  4EOT A;  2WSF H;  2WT7 B;  4WLJ A;  4ITX A;  3SWY A;  1WKH A;  2WSC H;  1AHF A;  4AH3 A;  2I1K A;  2W7J A;  1X28 A;  2W7I A;  1BT4 A;  3P6K A;  2L5G B;  3M91 A;  1ARG A;  5E3K A;  3VK2 A;  3B1C A;  4B9B A;  2VMT A;  3ECD A;  4PFF A;  1ZC9 A;  2YOB A;  3HE4 A;  3DZZ A;  3E9K A;  1ASC A;  1ASE A;  1MFZ A;  1MZ9 A;  1IVR A;  4AUW A;  1LT9 C;  1IJI A;  3E2Y A;  1QJ5 A;  3W1I A;  4C46 A;  2R3C A;  1S9K E;  3WKS A;  1OAT A;  1CI6 A;  3HTK A;  1HVV A;  1FU1 A;  2V0Y A;  3JWB A;  3USF A;  2E54 A;  4RAE A;  2HPC A;  1OHV A;  4OCA A;  3LG0 A;  5DX5 A;  1NKN A;  1H0C A;  4LW2 A;  2FFD C;  4K2M A;  2YRR A;  1FZA A;  2Z5H A;  1G4X A;  2WK8 A;  5JAY A;  3UWC A;  1SPA A;  1KL1 A;  5BU5 A;  3HT4 A;  2XKM A;  1EJI A;  1CW5 A;  1FZC B;  1FJP A;  1YIY A;  4RLG A;  3WCN A;  4F5J A;  5CCG D;  4ISY A;  1FZE A;  1B4X A;  1DFO A;  1L4A B;  4JYB A;  4F4E A;  4W1X A;  2Z9V A;  4W91 A;  2AY1 A;  1ZR4 A;  4OC9 A;  1ARS A;  1H1C A;  2JGT A;  1O61 A;  1DGD A;  3UE8 A;  2QA3 A;  1GC2 A;  4XEW A;  3IR9 A;  1BQA A;  4W5K A;  1C4K A;  3VMY A;  1HTL C;  1CSB A;  1XEY A;  5CCH C;  4AO9 A;  3WY7 A;  5EIG A;  2VGV A;  1FAV A;  3G8M A;  2IX7 C;  4Y0D A;  1NHL A;  3ZRR A;  3GR9 A;  3RL0 B;  3QBO A;  1V2F A;  3WGC A;  4GKG A;  5G4J A;  4R2N A;  4CBS A;  4N78 D;  4GE4 A;  4E3R A;  2JEE A;  3GHG B;  4LC1 A;  1GC4 A;  4P7Y A;  2VMU A;  3FZ7 A;  1SQV K;  5F9S A;  1FDM A;  5M46 A;  4BMK A;  1GDE A;  2EO5 A;  4JEW A;  1T3J A;  1G7X A;  1GW3 A;  1EQB A;  4HVK A;  4W80 A;  2JG2 A;  1U08 A;  1B8G A;  1RF1 B;  1AAM A;  4IYO A;  1WYV B;  3ATH A;  4ADD A;  3B5N D;  3WCO A;  1B5P A;  2P67 A;  4Q75 A;  1S9K D;  1DKA A;  1IAY A;  2YO3 A;  3OA7 A;  1VJO A;  2D61 A;  3LY1 A;  2A45 I;  1DJ9 A;  1X0M A;  1CS1 A;  2G6W A;  2VRS A;  1V2E A;  3HVY A;  1J04 A;  3MC6 A;  2VYC A;  1G7W A;  4B86 A;  3NU7 A;  1M1J C;  5APU A;  5EFS A;  1CZQ A;  1ASM A;  3NMD A;  4XJP A;  2BWN A;  3E2F A;  3GZD C;  2F8J A;  3HE4 B;  5APV A;  1S07 A;  3N4S A;  1LC5 A;  2IFM A;  1GCK A;  3DC1 A;  3MEB A;  3RK3 C;  4J8L A;  3P1T A;  2BI1 A;  1QJ3 A;  4I2L C;  3EI9 A;  2AY3 A;  2AY5 A;  1CI6 B;  2FN6 A;  3HTK B;  1MLY A;  1XTG B;  2GUS A;  1NKZ B;  3N4X A;  1Y4I A;  2HPC B;  3ELP A;  1M4N A;  1DJU A;  2PB0 A;  3NNK A;  5KJ7 A;  1XTC C;  4OYT A;  2ORD A;  2WSE H;  3LVL B;  2P7J A;  2YKX A;  2C0X A;  2Z9W A;  2VMY A;  1Z3Z A;  1IUG A;  3I5C A;  1RE4 C;  5APT A;  1NH4 A;  4A0F A;  5M4B A;  3PIU A;  3JWA A;  3NDN A;  5DJ1 A;  4M2J A;  3VP6 A;  1GZL A;  2YKY A;  1VDF A;  2WZ7 A;  4RES B;  1N73 C;  4C7R A;  4EB5 A;  3I16 A;  1JO5 A;  1UU1 A;  3P8M C;  1C7G A;  3AEJ A;  4UHM A;  1J1E C;  1E5F A;  3OKS A;  2BWP A;  2W7F A;  1IFM A;  3VOM A;  4A0H A;  3RBL A;  1N8P A;  4FL0 A;  2BWO A;  3FCR A;  5HXX A;  5EIG B;  1IX8 A;  5KTB A;  1M7L A;  3K7Y A;  4NOG A;  4WXG A;  5AVZ B;  2EGY A;  4LNM A;  3P32 A;  1I41 A;  3PPL A;  2VLF A;  1URQ C;  2BI9 A;  3Q8N A;  4A0R A;  4JEY A;  1C7N A;  2KFP A;  3BAS A;  2FM1 A;  5M49 A;  2ZFC A;  3BCB A;  3RK2 B;  1KFM A;  5AX8 A;  5HHY A;  2C0R A;  4CBR A;  4IYO B;  4WYA A;  3RQ1 A;  1W7L A;  1KMJ A;  2OYI C;  3L36 A;  1RV4 A;  1GEY A;  1ART A;  2O7C A;  3DOD A;  3AEN A;  2EH6 A;  2HOX A;  1YJY A;  3DYD A;  3N75 A;  3M5U A;  1EG5 A;  3FQ8 A;  3FQ7 A;  1JOC A;  1TOK A;  3AEL A;  1H89 A;  2AY2 A;  3BRV B;  4C7N A;  1HWT C;  3FVU A;  3FKD A;  3BWN A;  1S08 A;  1OXP A;  1KL2 A;  2OYH A;  2OYH C;  4AQR D;  4A0G A;  1M32 A;  3ZZK A;  3BVH A;  2Q9I A;  2HUI A;  1KKJ A;  1PFF A;  2R5E A;  2ZY4 A;  3E1I A;  4DBC A;  2HUF A;  4TMR A;  1N7S A;  1MGV A;  4JYC A;  5AVS B;  1SLQ A;  1N7L A;  4WY4 A;  1X8Y A;  1OHW A;  2OGA A;  1GU4 A;  2PB2 A;  4XJO A;  3PA9 A;  1GD2 E;  1JS3 A;  2FYZ A;  3F6T A;  3JTX A;  1RE3 C;  2ZXE B;  2OQX A;  3DXV A;  2IPP A;  2VIA A;  2AY4 A;  2GSA A;  3GJU A;  5AVX B;  3BRT B;  3AEO A;  4XK1 A;  2A45 G;  5TF5 A;  1LK9 A;  1T2K C;  4HYT B;  3HRN A;  4OT8 A;  2KYV A;  3JZL A;  9AAT A;  1RVU A;  3AV7 A;  3DU4 A;  1YAA A;  4IX8 A;  1JY2 O;  4WBA A;  1KQL A;  5EAV A;  2FXM A;  4OBU A;  2QM8 A;  3HDO A;  5AVQ B;  3B8E B;  3TFT A;  1SF2 A;  4WXB A;  1SZK A;  1J1E B;  3GET A;  3ZRP A;  1ZV8 A;  5G2P A;  1RF0 A;  3HD7 D;  2WIT A;  4IW7 A;  3MIW A;  3LIE A;  1LTG C;  3B1D A;  4KYO A;  5FT5 A;  1GC3 A;  4JF0 A;  2QBT A;  3D6K A;  2CIN A;  3VMX A;  2D64 A;  3LVM A;  1ASA A;  5BJ4 A;  2FKW B;  3FFR A;  3ELE A;  5AW6 B;  2X5D A;  4BHD A;  3VK4 A;  1HUC A;  1FG3 A;  1SQB K;  4R5Z A;  3U1C A;  1LWU A;  4AZJ A;  1LWU C;  1EQ7 A;  3V2N A;  1M0N A;  4I6M C;  2A45 H;  2ZUK A;  3BWO A;  2C0W A;  2GUV A;  5G2Q A;  2D5Y A;  2C9L Y;  1HJB A;  1I48 A;  1JUN A;  1JG8 A;  2QSR A;  2ZYJ A;  4A72 A;  1DH3 A;  4UOY A;  4OMA A;  4ZWV A;  3CQ6 A;  4P3M A;  1XI9 A;  3B5N C;  3AEN B;  2A1V A;  3II0 A;  5AW2 B;  4N78 E;  1CZC A;  4LNJ A;  3K40 A;  1UKJ A;  2DGK A;  2OAT A;  3WMM 0;  1ARH A;  3UAK A;  4C7N B;  1TAT A;  1AIC A;  1GL2 C;  3MUD A;  2OYH B;  3TYY A;  2HOR A;  4ZKP A;  4XAU A;  1LT9 A;  3QM2 A;  5M4D A;  1AQ5 A;  3NUB A;  1GBN A;  2VGU A;  5AW7 B;  1AAW A;  1N7S D;  3L4F A;  3EFG A;  1BW0 A;  4LW4 A;  1N7S B;  1N2T A;  1NTM K;  1MDO A;  4WY4 D;  4WY4 B;  2R2N A;  3QN6 A;  2G7J A;  1I43 A;  1LW4 A;  3PD6 A;  1L0L K;  4ZKU A;  2N1T C;  2Z4E A;  1JY3 P;  3HQT A;  3VYI A;  2FFD A;  4WYG A;  1G1J A;  4Y99 C;  1W7N A;  5HDM A;  1SVV A;  5AW0 B;  3AAT A;  1SQP K;  2HOZ A;  4LLH A;  2YKV A;  3AOW A;  2KLV A;  4IXZ A;  4PVF A;  3SWF A;  4F5I A;  4RKD A;  4K05 A;  1LTA C;  1YTZ T;  1BQD A;  1E5W A;  3WLX A;  1L4A D;  3NYS A;  5G0A A;  3WZF A;  3RUY A;  1ZOD A;  4HF8 A;  1WST A;  4JEX A;  4Y0I A;  1ASB A;  4Q31 A;  1IFD A;  2WB6 A;  1AY8 A;  3NU8 A;  3KPE A;  2YKP A;  5CCH A;  1C9C A;  4IY7 A;  2Z9U A;  1WKG A;  5EUD A;  4IFF A;  2BI5 A;  2JJF A;  4ADC A;  2R5D A;  3RL0 D;  5AVR B;  2CST A;  2JJG A;  1FZF A;  1GC0 A;  3A9Z A;  1ASF A;  4XQ2 A;  4A6T A;  4IXS A;  4ZAH A;  1ORD A;  1ASL A;  2YCT A;  4ZLV A;  2PP6 A;  1JTH A;  3L44 A;  1RY3 A;  1IFJ A;  3IFM A;  2OAR A;  2YKU A;  1LWU B;  4M2M A;  2W7H A;  1UU2 A;  1AKA A;  4H63 Q;  2E43 A;  2QM7 A;  2R32 A;  2OKJ A;  1QL1 A;  1QIS A;  3N5M A;  2Z9X A;  3IHJ A;  2M8R A;  2AY9 A;  1MV8 A;  2W6A A;  1AY4 A;  2H43 A;  1Z56 A;  1NU1 K;  3M9H A;  5J8Q A;  3COG A;  5G4I A;  1BJO A;  2BYJ A;  4JEZ A;  2BI2 A;  3NXS A;  1ZN5 A;  2QLR A;  2V1P A;  3HLM A;  3NX3 A;  3NYT A;  2CTZ A;  1M1J A;  4U2H A;  2NPS C;  1N31 A;  4XE5 B;  2P2U A;  1TOE A;  3GZD A;  2YO2 A;  4I1L A;  1M7Y A;  1LT9 B;  2W7L A;  2CPB A;  2E42 A;  1T3I A;  1GW4 A;  1JMM A;  3B1E A;  3EIA A;  2GMS A;  2EPJ A;  2JIS A;  1D7R A;  1CQ8 A;  1DTY A;  1YYC A;  2J59 M;  1PMM A;  1HGZ A;  4ZDP A;  3TQX A;  3EI6 A;  1MDZ A;  2VMN A;  3PJ0 A;  1AFO A;  2W7K A;  2VMR A;  2DKJ A;  1L0N K;  2D7Y A;  3BB8 A;  1CZE A;  3KKI A;  1QZ9 A;  5K8B A;  3PD6 B;  2XH1 A;  1LGH B;  2EZ1 A;  4WBT A;  1QIR A;  1KIL C;  3RI6 A;  1E5E A;  3A2B A;  4ZWM A;  1LC7 A;  5EAA A;  2FFD B;  3FSL A;  1CJ0 A;  1BKG A;  2AY7 A;  1DEB A;  4KHX A;  5CHX A;  2BIG A;  1AX4 A;  1HBW A;  2RFV A;  4W8I A;  2HP2 A;  1RE4 A;  1OXZ A;  2W8T A;  3TFU A;  1JF9 A;  3FZ8 A;  1YOO A;  3L8A A;  4EB7 A;  2HG5 D;  1N73 A;  2HP1 A;  4DGT A;  5AVU B;  2ZC0 A;  3WX9 A;  2C81 A;  2WK9 A;  1KKP A;  4BQ0 A;  3FQA A;  1PFI A;  5CCH D;  3ISL A;  4W1W A;  3V4W A;  2LKM A;  1RV3 A;  3EZS A;  4JF7 A;  1C7O A;  2W8U A;  1WT6 A;  1J1D C;  2CJH A;  1QIT A;  5D95 A;  3L37 A;  1FZG A;  4KXK A;  1URQ A;  1PMO A;  3FVX A;  2Z61 A;  4IXO A;  1N2D C;  1SQQ K;  5BU8 B;  1TOJ A;  5APW A;  3A5T A;  2N9B A;  1JTH B;  3RK2 D;  3LW5 H;  1ASN A;  5AW4 B;  2C7T A;  2C9N Y;  4DZO A;  4TN4 A;  3F9T A;  1W23 A;  5G09 A;  3M06 A;  1O69 A;  1DX7 A;  4PFN A;  4JEV A;  2Q7C A;  3QPG A;  5DB5 A;  2OYI A;  3GWP A;  2R5C A;  1TAR A;  1BJO B;  5IWQ A;  3LVJ A;  1SFC C;  5AW3 B;  4H51 A;  2FNU A;  2PAJ A;  1IX7 A;  3BS8 A;  3NTJ A;  1M1J B;  2X3L A;  1AHY A;  1BJW A;  4M2K A;  2BAS A;  3BV0 A;  4GIF A;  2WPS A;  2R5B A;  1RVY A;  3EI7 A;  3A8U X;  2D66 A;  3T32 A;  3CAI A;  1MUU A;  4MY5 A;  4XA4 A;  1YJZ A;  2H8P D;  3RK3 B;  1AMR A;  2E7U A;  4E3Q A;  2W27 A;  1IK9 A;  2CJG A;  3BCX A;  2YMY A;  3NRA A;  2ZJG A;  3LV2 A;  4QGR A;  2HOY A;  2D65 A;  2KSJ A;  1RE3 A;  2ZY5 A;  2KOG A;  5KJ7 D;  3TCM A;  1M6S A;  2JJH A;  3LWS A;  1SFF A;  2VMS A;  3KQG A;  1ELU A;  4U1T A;  3MBB A;  4IFD K;  3P8C D;  4ZSW A;  2WPR A;  3MTU E;  2DGM A;  3JW9 A;  2O1J A;  4ZM4 A;  4MQR A;  4RJY A;  2XV5 A;  1IX6 A;  3M9Q A;  5CJ0 A;  1SVF A;  3V5B A;  1LTJ C;  3ACZ A;  1N73 B;  2GM4 A;  1FZC C;  1J2J B;  3ZZJ A;  4GDY A;  4MQQ A;  3HUS A;  1W2E A;  3HUS C;  4Q6R A;  2D7Z A;  5CCG C;  1M0Q A;  1DJE A;  1L4A C;  3R2P A;  5F8V A;  2FNI A;  2IFN A;  1B9H A;  1S0A A;  4RM1 A;  1LW5 A;  4GRX A;  5AVY B;  1TOG A;  5EQC A;  2W7D A;  1URQ D;  1AJS A;  2BHX A;  3PAA A;  5BVZ A;  1IAX A;  1URQ B;  2VI9 A;  4AZK A;  4WB0 A;  1G2C A;  2Q3I A;  3E6G A;  3RL0 C;  3HMU A;  1AY5 A;  1ASD A;  1T8Z A;  1ZR2 A;  3DXW A;  2FKI A;  4B98 A;  1G1I A;  1CL2 A;  5FT8 A;  5E4Z A;  4J5U A;  2DOU A;  3GSB A;  2CFB A;  2XZR A;  3DR4 A;  1MLZ A;  1GDT A;  4WB4 A;  7AAT A;  1KFN A;  1JY2 P;  3CBF A;  4LGD E;  2OYI B;  1MAP A;  4ITG A;  2W8J A;  2R5C B;  3EIB A;  3A2A A;  3B5N A;  1M0P A;  3VN0 A;  4ZDO A;  2AEU A;  4K2B A;  2I1J A;  3H9X A;  3W1J A;  1JCD A;  2Z1Y A;  1OXO A;  1GL2 A;  2GQN A;  3KYQ A;  1J32 A;  2X5F A;  1IBJ A;  3CLQ A;  1ZLL A;  1TAS A;  2Q7W A;  3PDX A;  3HL2 A;  4MKK A;  4N6J A;  4EU1 A;  3OAK A;  4F5H A;  1WYU A;  1S06 A;  4OTL A;  1VPC A;  1LTS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...