5KTBA

Structure of a complex between s. cerevisiae csm1 and mam1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
151
Chain Sequence
b'LLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSDYSIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monopolin complex subunit CSM1
publication title Molecular architecture of the yeast monopolin complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 51
structure length 151
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5ktbA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ktbA02
3HRNA 3OJAB 4I1LA 5BVZA 3U1CA 4O9BA 3N7NA 3U1AA 5KTBA 3BATA 5BU5A 4N3YB 4N78D 3C9IA 1WT6A 2POHA 4ZKUA 2JEEA 1IC2A 3VP8A 3N4XA 1NKNA 3N4SA 1X79B 3P8CD 3BASA 3N4RA 4ZKPA 5BU8B 3VP9A 2FXMA 3U59A 4GIFA
chains in the Genus database with same CATH superfamily
3FQ7A 1M6SA 5BVZA 2QRXA 3B5NA 4WB4A 3N7NA 3U1AA 3L73G 4U3FG 5EQCA 3AEGC 1AMAA 1BJWA 1SQVG 2HORA 3R2PA 3FVSA 2PGDA 2JEEA 3KDPB 3GZDA 3PPLA 1LW4A 3BVHA 2VMYA 2JWAA 2YRRA 1DEBA 2VMSA 1SQXJ 4A0GA 1WYUA 3ZRQA 3MIWA 4IW7A 1FZCA 3CCVP 1L0LE 2FXPA 3CCSP 2BI2A 1SF2A 1RVYA 3L35A 3UE8A 1AKCA 5KKZC 1ZOYC 3C9IA 4PV1C 1SQBD 2OQQA 2QJPC 2HOZA 3KYQA 4WP0A 3LIDA 4A0HA 1KKPA 1WRGA 3TNUA 2RFVA 1I41A 3PDBA 1AJRA 1EQBA 3MEBA 3DRDA 5G09A 1MAQA 3M9HA 2YKOA 1RE3C 1A02F 2IPPA 1U7MA 3ZRRA 4E77A 2A1VA 3GF7A 2N1TC 5D95A 2WT7A 3GR9A 1D7UA 5B66E 2LKMA 1JG8A 5AVWB 3N5MA 1CL1A 4MN4C 4MKKA 4A0FA 3VP9A 1KILE 4I2LC 5KLVD 3L71E 2XZRA 2VI9A 3NX3A 2P7JA 1H1CA 3FQAA 3SWYA 2L5GB 2HPCA 3HUSB 5B66H 3WCNA 2XH1A 5APUA 1C7OA 3KHUA 4PD4E 1IC2A 2R0TA 4WWIA 1G4VA 1NTKE 5KJ7D 3TGUJ 3RBZA 1Q86Q 5C6UA 1X79B 3A5TA 1URQA 4RO0A 3AE3C 3H1JJ 2C0RA 1LC5A 4K05A 1S0AA 3RBFA 2D66A 1GBNA 1ZN5A 3E2ZA 1IFMA 4GEBA 3RUYA 1M1JC 1SQXG 1K05A 1SQBK 3HQTA 2D63A 2ZXXA 1FZEA 2E75B 1M7LA 3M91A 3NYUA 2E43A 2A06D 4H44D 2D61A 2BYJA 4RIZA 2QB2A 3L75E 2M0BA 2BHXA 2NPSD 1AY8A 3BCCE 1LP1B 3CXHD 2R5DA 3DODA 1WT6A 2R5CB 1AVYA 4WYFA 2QJYB 3LY1A 4WYGA 1UIIA 1PMOA 4LC1A 1KMKA 1CQ8A 1ZODA 3AEJC 2K37A 1T2KD 3MP7B 5M49A 2NRGA 5B5EE 1DFOA 2GUVA 1ORDA 1JCDA 2G7JA 3BWOA 2ZC0A 5KLVK 1ASFA 3RK3B 1WYTB 3V2RA 1MGVA 1FZAA 3VMXA 2QJKB 2W6BA 1B4XA 1NTZK 3TYYA 1DX7A 3P1TA 5E5IA 3S9OA 1C7GA 2FYUJ 4UHMA 2IBZD 3GF3A 5E79E 3A0BH 2Z5HA 4DT0A 3B8EB 3GMAA 4IL6E 1TOJA 1AHYA 2JJGA 2ZSMA 3M0DA 1YQ4C 1BJ4A 1GW4A 3WUUA 2BIEA 3NYSA 3PJ0A 3WY7A 4ZKPA 5KJ7C 1PPJD 1SPAA 1X0MA 3QBOA 1N7SA 2XNXA 1AAWA 2ZYDA 4GIFA 3AOWA 1JTHB 3O6QB 3FSLA 2R2NA 5AW4B 2OYHA 1CZEA 4ASVA 4XJLA 4U3FE 4GDOA 2ZT9D 3TGUG 4JEZA 3ISLA 5M4DA 3JWBA 2VYCA 4BQ0A 2WSEJ 2P2UA 4JF7A 1ARSA 1GDEA 1ZP0C 3ASAA 3VYIA 4IL6H 2POHA 1YYCA 2YKUA 1W3UA 2KI7B 2PAJA 4GDYA 1SQQG 1CS1A 1GCKA 3KZIE 4PD4I 3GWPA 4H44C 2VMXA 3AE9C 1RQVA 4EB5A 2WB6A 2E54A 3B5NB 1QVGO 2Q3IA 2E74C 2NPSC 1HBWA 4H13B 1HF9A 1DJ9A 1EZVG 1BGYG 4OBUA 2HUUA 2FYNB 4IX8A 4ZDPA 2OQXA 4Y99B 1KB9D 2W7EA 1E79H 3KZIH 3EUCA 3N4SA 5CCHD 4LGDE 3HD7D 1T2KC 1WYUB 1B8GA 5IWQA 4ATPA 2FNIA 1YI2P 2CANA 1HUCA 4RKUJ 1NTMJ 8AATA 2ZY3A 2J59M 3QWOC 1MLYA 1FDMA 3CAIA 1S9KE 1TASA 3TDKA 2ZXEB 3A2BA 1R5SA 3NTNA 1LTJC 1YAAA 2VMRA 5BJ3A 3M9BA 1CI6B 3CBFA 1KMJA 2IX7C 2KOGA 2FYUG 3Q3DA 1VQ9P 1VP4A 1W7LA 4PJ0H 1OHVA 1MDZA 2E5YA 3HE4A 3WMM0 4EMYA 2QA4P 1AMSA 2ZT9C 2WT7B 3AE6C 1CZQA 3FZ7A 1OW7A 2O7CA 3WCOA 3A9XA 1ELUA 3D70A 3HTKB 2A45H 4W91A 4JBZA 2BIGA 3NUIA 4JEYA 3W68A 2YMKA 2WSCH 3ZZJA 1ZXGA 1SQXE 4BA4A 3F9TA 3BC8A 1BCCD 2HPCB 3EIBA 3CWBJ 1EXIA 4OBVA 1U57A 3CPWO 4RKCA 1M8OB 1VQPP 2ZJGA 2V7QJ 2JR8A 5TJHA 4R8DA 1JY2O 1GMJA 2HZPA 4R2NA 1L0LJ 3E1RA 5CCHC 1EDKA 1LWUA 2GM4A 2YCNA 4WLHA 1XTGB 3HD7C 3FXDA 1I48A 2CTZA 2H8PD 3H32A 1BQAA 3E2ZB 2KZIA 1BDDA 1O69A 4PIWA 2CINA 1LT9B 2FY8A 4MQRA 3L70D 1NGMB 1Y47A 5APVA 5TISE 1QITA 1Q90D 3B8XA 3RQ1A 1MFZA 1KV4A 3L8AA 3G0TA 1VEFA 4K2IA 2D2CB 2BI3A 2OATA 1AKAA 1SQPK 1YTZT 2M5AB 3II0A 4JF0A 5DJ9A 2VMOA 2O1KA 5K8BA 5TISH 2YCTA 4YTPC 2P67A 4W1XA 2VGSA 2Y0EA 4IFMA 2ZAEB 3BASA 2QSRA 2FKIA 3ACZA 4GOFA 4NOGA 1ARHA 4H51A 5APQA 1KILA 3TGUE 1JM0A 3AE8C 3E1IA 3UIAA 1M90Q 2YNYA 1JMMA 1O62A 2W7HA 1NWQA 3H1JE 2QM8A 5C39A 2OGEA 2TPLA 1N73C 4BXLA 2JJHA 4GT1A 2VMPA 3L73D 3GHGB 1WKGA 2E76B 1LTAC 4EYYQ 3ECDA 2FQ6A 3VMAA 1B5OA 1VL2A 1IAYA 2FN6A 5HHYA 1NU1K 1ZR4A 1FBMA 4XA4A 1GC0A 2Z4EA 3CWBG 1GC3A 4Q31A 2N9BA 3PTZA 1J1DC 2OYHB 5HXXA 3USSA 2QBTA 1JUNA 4XK1A 1SVVA 4F5GA 3MC6A 1P84E 4DOJA 3H1LJ 1EZVE 2CPSA 1L0LG 3RK3D 1IJIA 1KYOE 1QVFO 3NDNA 3L72J 4F5LA 2ZY2A 3BWNC 3HL2A 4RLGA 3V5BA 2IYPA 1S07A 1J1EC 1OVVA 2BEZF 3N4RA 1IJDB 1AHGA 4ZWVA 2C7TA 4U2HA 1PP9D 4I7ZB 3B71A 5AVZB 2G6WA 1SLQA 2W8WA 4M2MA 3EFGA 3G7QA 3CCRP 3FQ8A 4JEVA 2BASA 2QG4A 2FBWC 2LR2A 4M2JA 3NU7A 4AOAA 2Q5UA 2O0RA 4UHOA 4C7NA 2HYNA 3G9RA 1E5WA 2HP1A 1TU3F 2VGZA 1G1IA 3CCUP 2FYUE 1OHWA 3L37A 1BDCA 2WVRA 5EFWB 3IHJA 4XQ2A 2E75C 4R4LA 1MDOA 4KT0J 2VMVA 1QZ9A 4ITGA 3B5ND 4W1WA 2JKVA 3AELA 4R5ZA 1YNUA 3I4JA 1V72A 4H13D 1EQ7A 4O6ZA 1SQVK 2VMNA 3H1IJ 5KLIB 2QJYC 4U7JA 3KGXA 3A0HE 3RBLA 3BATA 3HE4B 3RL0B 4AZJA 1CSBA 3FFRA 2L91A 3AEDC 1R5LA 2FFDA 4F5JA 1AJSB 3CQ5A 3LV2A 5AW0B 1LW5A 3L74J 4Z1MH 1M1KQ 2FM1A 2N9YB 1OX3A 3VTPC 3D6KA 2QJKC 2XBNA 3H1LG 3A0HH 3CCLP 4E1OA 3V4QA 5APSA 3LG0A 3SSUA 2YXQB 4AZKA 4UB6H 1GU5A 5CBOA 3L72G 3H1KD 3PRJA 1S09A 2WPSA 7AATA 2I1JA 4ZDLA 3D6YA 2KP8A 4R5FA 2ZP7A 5EFSA 3L75G 2WK9A 5EUNA 4ZLVA 1ZW0A 4J8LA 3RCHA 2A06E 3BCCG 1S72P 2HODA 1NTME 4WXBA 1TOGA 1P84I 4IFFA 4ZWMA 1ASEA 1EZVI 4XAUA 2Z1ZA 4WVZA 2R5BA 1KYOI 3CXHE 3L36A 4AQRD 3ATHA 1LWUB 1IAXA 3RGUA 4JYCA 3EIAA 2Z9WA 4W80A 3H32B 4DCKA 2QVAA 4WY4A 1XTCC 4N78D 2WTYA 3V6IA 2C44A 4LW2A 2I1KA 2Q1KA 1ASNA 1Y8AA 1ZRTD 2KS1B 2O01N 1DEEG 3CXHH 3FD0A 4H13C 3FVUA 4HVKA 1L0NJ 2WQYC 4GRXA 4UB8E 2Z5IA 2FYNC 2WSCJ 2IBZE 4Y99C 2ZY4A 5AX8A 3A2AA 1KL1A 1OMIA 2I8DA 2BWOA 2YKQA 2YIUC 3K5BA 3H1IG 3P8CE 1JO5A 3MHVA 1LJ2A 1MLZA 2GUSA 4RM1A 2KNCA 4E3QA 1S5LE 2JISA 4UOYA 4UB8H 3CWBE 1CL2A 2HOXA 3V4WA 1SQQD 3WGBA 3QHXA 3WX9A 2OGAA 3U59A 5AW7B 1KILB 2DGMA 3L74G 3AOVA 1EDLA 1OFCX 4WB0A 2JJLA 3HE5A 2BCCD 2D2CD 4H0LB 3NNKA 3GZCA 1S5LH 2W8TA 2WITA 2ZYGA 1ASMA 5TF5A 2V7QH 1WMKA 2R5EA 1VQOP 1X8YA 4IXZA 3C8VA 3GBXA 2WWWA 1T3UA 1KB9E 3H1KJ 3BCAA 5APXA 4L75A 4BWNA 2ZVNB 4JPZB 3E2FA 1SS1A 2WPQA 5F9SA 2AEUA 4EFFA 1JY3P 4XEWA 2OTKE 4IYOB 2CH2A 1AFOA 2E76D 3VP6A 2YKPA 3JWAA 3Q5PA 1MUUA 1M0NA 1KB9H 4QMAA 2X5DA 1AY4A 2BI5A 3WUTA 3O8ZA 2A45G 1JF9A 5EIGB 1NTZD 1L0NG 2Y0CA 3CXHI 4IY7A 4W5KA 3ITKA 1AA0A 2DOUA 1RE3A 1KN7A 4C7NB 1GL2A 1BKGA 2N1TA 1LT9C 4A72A 1QLED 1SFCA 1SQQK 1QEXA 3K28A 3AEAC 4XJPA 5M4BA 5AVUB 1LKCA 4R4MA 1OW8A 4L74A 4HB1A 2M8RA 1XI9A 3HBXA 3TK1A 4N6JA 1RV3A 2OTJP 4N3YB 2C9NY 3V2NA 1PFIA 3CMAP 3SWKA 3H1LE 2IBZI 3W1JA 2R32A 1JOCA 1FOSE 1TPLA 1YJZA 2JJFA 3BRTB 3L72E 5AW1B 4Y28J 2Y0DA 3K40A 1BCCE 1YTZI 3CLQA 1C0NA 5G4JA 4CPGA 3AEEC 3P6KA 1YJSA 4M2KA 3CC4P 4ZAHA 1YIZA 2AY3A 2W7IA 1X28A 2R44A 3VMYA 2OKJA 2B9BA 2JWDA 3AENA 2BCCJ 2AY1A 2K3RA 3FKDA 1MFTA 1M1JA 2H89C 4TN4A 1SQBJ 1Z3ZA 3GHGC 3A0BE 4A6UA 2E76C 1IFJA 1M57D 3M06A 1TOKA 1JMBA 2Q7CA 3U1CA 4F5HA 3JW9A 3E77A 3M0DC 1M56D 1MAPA 1OXZA 3M5UA 3MUDA 5AVXB 4A0RA 1SZKA 1N2DC 1E5EA 4EOTA 3RCHB 3C1LA 2OYHC 5KAFE 3RL0D 5H2FH 2YO3A 3JSVC 2O1BA 2O3JA 2P58A 2Q3EA 4OC9A 3B4SA 3G6EP 4EDFA 5APYA 5DX5A 3UWCA 4WYAA 2J58A 3H1HD 3AEJA 3H1IE 4RITA 5KAFH 5KLVJ 2W7KA 1ASGA 1M7YA 1DD3A 1Q82Q 2H43A 4I7ZC 2ORDA 3H1JG 3M9QA 5AW3B 1VQ4P 2OARA 2VGTA 1MV8A 3N4XA 4EI2A 1NTZJ 3AEPA 5AVQB 2DR1A 1DH3A 3FGAD 2EPJA 1IZNB 3L74E 1S1CX 3MAUA 1EJIA 1FE6A 4Y0HA 3H25A 2VGVA 4OYTA 3PP5A 4HJGH 3HLMA 1MDXA 4F5IA 2GMSA 3AE2C 5KJ7A 3H7FA 3BB8A 1BE3D 1UU2A 4OWFA 2W8ZA 3WGCA 4CBRA 1WYVA 1QGKB 4LNLA 1T6AA 4RAEA 5AVSB 1S08A 4DBCA 2CPBA 4WD2A 1ZR2A 4TT3H 1H89A 1RE4C 1RH5B 1EDJA 3IF4A 1C9CA 3DZZA 3H9XA 3TATA 1FZCB 3Q5SA 1PL5A 2VGUA 3QM2A 4D6TD 4WB0B 3HE5B 3Q1MA 1FZFA 4ZM3A 1KORA 2B89A 5FT4A 4PJ0E 5KLIC 2DW3A 1GK6A 1ZOBA 4BHDA 2K9JA 2PB0A 4ASWA 3KPEA 3CQ4A 1GZLA 1AHEA 3BV0A 3RL0C 1AV1A 1W5CE 4A00A 1WKHA 3TNUB 2X3LA 3F6TA 3PDBB 4I8AA 2HUFA 1MZ9A 1EXJA 1D7RA 1SP4A 1VQ7P 4RESB 5AVRB 1H0CA 1YOOA 1QJ3A 1L0NE 1RF0C 1SQPD 1JS3A 4NPFX 1NKZB 1AJYA 1N31A 1KILD 3L71D 2HLOA 2KIKA 2CK3H 2YXRB 3HMUA 3OP7A 3EI9A 3LVMA 2XKMA 1DGDA 3AE5C 4GE9A 5AW5B 4H0LD 2W8VA 2E42A 2HP2A 4WXGA 2AEMA 5KLVG 1OIPA 4PD4D 2C0XA 1IFIA 1NTKD 3GJUA 3USFA 1LTJA 2HR3A 3FWNA 2HUIA 1PIXA 4ADDA 1OWAA 2M3EA 2Y9ZA 3HVYA 1M0OA 2PRRA 1LWUC 3A3YB 1H0TA 3BN1A 3H1HJ 1L4AA 1L0LK 2BWPA 1GL2B 2AY2A 1FJPA 1IX7A 2GMUA 4IXSA 2AATA 1NU1D 2N1TB 3FFHA 2HG5D 1HGZA 1NJIQ 5APTA 1SFCB 1URQB 3F89A 3CCJP 2V0YA 3V2PA 1KAFA 4C7RA 1NHLA 3MBBA 3PAAA 3PGYA 2CY8A 3R9AA 2OGUA 5AVYB 1DTYA 2AY7A 3H1KE 2A06G 4TMRA 2AY5A 2WZ7A 1NTMG 3H6PA 3MD0A 1JNMA 3BCBA 2UWJE 2W7LA 2NMPA 5HDMA 2Z9VA 1SFFA 3L44A 3LVLB 3CL3D 1LNQA 2QE7H 1J2JB 3S1KA 4ZKUA 1KILC 2P1JA 4D6TJ 3HD7A 3EWKA 4E3RA 4IXOA 3PHLA 4Y0IA 2YKYA 4H0LC 1GW3A 1BS0A 4RKDA 4N78E 2EH6A 2WSSH 1NTKK 2YOBA 3COGA 1KZUB 1PGPA 1DKAA 2IBZG 2AXTH 1ZC9A 3F0HA 5CJ0A 2QMAA 4K2MA 4U3FD 2A45I 1S06A 4AO9A 1SQVD 1IVRA 3MC6C 1S3JA 3P8MC 3JZLA 3AECC 3QH9A 1PPJG 2R3CA 4PFFA 3HRNA 1IUGA 4XFJA 1N7SB 2QSIA 1EG5A 1YIYA 4LLHA 2GB3A 3ELPA 3QGUA 4HKZH 5APWA 1DIPA 2AY9A 3DR7A 1Y9BA 2VMWA 1T3IA 1P3WA 1G7XA 1NYHA 3AEFC 4DZOA 3CC7P 3EI8A 3TFUA 4CVQA 1W2EA 4W7YA 2EYQA 1BCCJ 2RMZA 2WK8A 1N73A 2D64A 3HUSC 2AY4A 2BCCE 3RL0g 2AY8A 2CJDA 2P10A 3DU4A 2Q6QA 1K73Q 1KMIZ 3T97A 1NU1J 1FZGA 1SQBE 3JTXA 5BU5A 2QIWA 3RK2B 2M3BA 1ARGA 2E7IA 3D71A 1RVUA 2W8JA 4HH2A 4WY4D 3B1CA 4ITXA 3I5TA 3IFMA 5CCGA 3L70J 3VMZA 1YJYA 4ZSYA 1NAYA 3BWNA 2XNDH 1W2BO 3JCUH 2Z20A 3FX0A 1RQUA 1QIRA 3GETA 1YQ3C 1N86A 3RBXA 1W23A 2SPZA 1PGOA 1YJNP 4B86A 1PG8A 1GK4A 1IX6A 2QB3A 1EC5A 3E7KA 2K9JB 1IX8A 3NFQA 4OGQB 1O61A 5KLVE 1UU1A 3I5CA 1FJKA 3PD6A 1LC7A 3Q2YA 1HJBA 3OAKA 1NTZE 2WK7A 2VLFA 2KZJA 4UB6E 2K9YA 2H88C 2IDBA 3VOMA 2Z1YA 1SQXD 4CBSA 4MKJA 2W27A 1N2TA 4MY5A 2EZ1A 3RK3C 4GKGA 3MAFA 3E2YA 3L73J 1VQ5P 4GODA 4W7ZA 1FOSF 1ARTA 1JY2N 1SQVJ 2CJGA 2CB1A 4GE7A 1CQ6A 3M0AA 3DXWA 4AH3A 1BCCG 1LP1A 2ZJSE 4J5UA 4EU1A 4FFCA 1Q81Q 3NMDA 2B88A 1W7NA 1K8AQ 4HF8A 4KXKA 1H0TB 1X0TA 1L4AB 3WLXA 1R8EA 1UU0A 2VMUA 3N0LA 1Q2NA 5DJ1A 3VN0A 2J5UA 2E7UA 2AXCA 3CMEP 1CW5A 1GEXA 4FL0A 1LT1A 4A7PA 5I92A 1ECXA 3LWSA 1M0QA 2OYIA 1PP9J 3L70G 2IFMA 1KL2A 1QL1A 2ITAA 3CCQP 4PFNA 4YXDC 2KUBA 3GLMA 3LIEA 3KE3A 3B5NC 4WLJA 1A02J 1VQMP 2VGWA 4UHNA 3AEMA 1V2DA 3VK3A 2C81A 4F4EA 2CJHA 1OW6A 1GL2D 2VRSA 4PVFA 5K5GB 2WSFH 3GZDC 2N1TD 2Z9XA 3CQ6A 1SFCD 1URQD 4O9BA 2VLHA 3TGUD 3IR9A 1B5PA 1DJUA 1G1JA 1PPJE 1FZCC 1SQXK 3FCRA 2K1AA 1QL2A 4XJMA 5JAYA 3LVJA 1UIXA 1RF1A 3H1HE 2FYZA 4ZM4A 1SVFA 1GD2E 1DGEA 4WXFA 3EQ2A 2CH1A 1VPCA 1GC2A 2W7GA 2JGTA 2QEXP 5FT6A 2W83C 3LVKA 2LXBA 2BWNA 3ZDMA 2HOYA 1AMRA 1P84D 5F8VA 1EZVD 1BGYD 1KTMA 3S4RA 5EAAA 3OA7A 1JS6A 2GA1A 1V2FA 4WYEA 1KYOD 3ABVC 3SWFA 4H63Q 4F5MA 3DXVA 2AEFA 2W90A 2W7DA 4TLFA 2FYFA 1FG3A 3TCMA 1BE3E 3SFDC 2B87A 1QJ5A 1BJNA 3PDXA 1T3JA 5GTIE 1TARA 1K9MQ 3NXSA 4LNJA 1WSTA 2BI1A 1KC8Q 2RKLA 1ASAA 2FKWB 3MKJA 2RH0A 4BMKA 2VMTA 1VQ8P 3CX5D 3Q5RA 4B98A 3AE7C 3CCMP 2G8YA 2O01J 2WPRA 1CI6A 1H88A 5AVTB 4D6TE 1N73B 3HT4A 1PP9G 2C9LY 3NRAA 5GTIH 4AO4A 2EO5A 4ZMDA 1VQKP 1ASDA 1ZV8A 3T97B 3VK4A 4BRYA 2FYUD 1GL2C 3W67A 1I43A 1HVVA 1AMQA 4L0OA 5G0AA 2ZSLA 1N7SD 4WYDA 3FXEA 1SFCC 1URQC 2QLRA 1KQFB 3ASBA 1V2EA 1J1DB 2R3SA 2D7ZA 1S4XA 3BRVB 5GTHE 3HTKA 3AE1C 4JF1A 3CC2P 1SQPE 1ELQA 3BS8A 1BW0A 1AIBA 1U08A 2WKAA 3IAOA 1XEYA 2ZYAA 3L4FA 1ZMEC 1B9HA 1J1EB 2JG2A 1X29A 2KLVA 5GTHH 5M1BA 2D2CC 3FDDA 3B1DA 1ASBA 5AW6B 3RK2D 4N0WA 2NZ2A 1G4XA 2ZYJA 3PD6B 2XV5A 2FXMA 4C46A 1OVRA 2OTLP 4QGRA 3GG2A 3NYTA 1SQQJ 3I55P 1BSHA 4XJOA 1LT9A 2KXPB 4PD4H 3NUBA 2DKJA 3WKSA 1NU1E 1VF5B 3QN6A 1YHQP 4F5FA 2FFDB 3HDOA 2W7JA 3R4YA 1BJOA 2G3AA 1VQ6P 3MAFB 1NH4A 3MUDC 5BU8B 5H2FE 1NTMD 4OGQD 5CHXA 3H1KG 1BGYJ 3A9ZA 1KQLA 3PLNA 2E74D 3DYDA 5AW8B 4ZNCA 1BT4A 1AQTA 2M5AA 3L70E 1JY2P 1OZHA 2FYUK 1GU4A 3CD6P 3EI7A 4ADCA 1JCCA 1YIJP 4LNMA 1NO4A 1N7SC 4IL6X 1G2CA 2KSJA 1RHZB 2Z61A 3A9YA 2HODB 1TOEA 5AW9B 1M0PA 3ZZKA 3A7OA 3E9KA 3AV7A 3N75A 4B9BA 1KB9I 2DGLA 1AHXA 5DB5A 1IFPA 3LW5J 3PH0A 3MTUE 1SZSA 3FZ6A 3R4TA 3FRKA 1AIAA 3WU2E 1YJWP 2OYIB 3VOPA 3GHGA 1KQGB 4WY4B 5J8QA 3WZFA 3RI6A 2QM7A 2YO2A 1AAMA 3TFTA 1KKJA 5B5EH 5CMZA 2O1JA 2KK7A 3P8CD 1GDTA 1L4AD 1FDOA 4KYOA 3RK2C 1LTTC 1ASCA 1GEYA 3WU2H 1USDA 5D5SA 3CWBD 3MADA 3L73E 1KD1Q 2PB2A 4DQ6A 2Y9YA 1SQVE 1M32A 5E79H 4MQQA 3II6A 2FXOA 2OYOA 1L0LD 1SZUA 1ARIA 3FDBA 2KNCB 4JYBA 2W7FA 3GSBA 4HYTB 1KQSO 1TOIA 1RF1B 3QPGA 1NTMK 4I1LA 4OGQC 3RK3E 1AX4A 2JJEA 1JY3O 5AVVB 2BCCG 2CFBA 3CCEP 1X22A 1AICA 4LW4A 3UAKA 1SQBG 2F8JA 4Q6RA 3B46A 1J32A 3W1HA 1YBKA 2BEQD 1PP9E 1S2EA 3AE4C 2E7JA 2NPSA 3QI6A 4YXWH 2YIUB 1OXOA 4GSAA 1HWTC 3EZSA 2WSFJ 3G71P 2B87B 1LS3A 5EUDA 5DJTB 4GE4A 2YHKA 3KKIA 4K2BA 3DC1A 4ZDOA 5E3KA 1RE4A 1VQNP 4ZASA 2W8UA 2Z9UA 1IK7A 2W6JH 3PJSK 1NAFA 2YRIA 4P7YA 2ZY5A 1H8AA 2VIBA 2MJZA 4ADBA 5KKZB 1L4AC 1D7VA 4PV1B 3TQXA 2QJPB 3BCXA 4BRYB 1E5FA 2BKWA 1VJOA 1NTZG 4RJ0A 3TSIA 2X5FA 1YJ9P 4MQPA 4Q76A 1IK9A 1FZBA 1AJSA 1PZQA 4WYCA 3CI9A 2X8UA 2PFXA 3MZWB 2LXCB 3EFFK 1RF0A 3TF5A 1HH0A 1D2FA 2DGKA 3ELEA 4OT8A 1PMMA 1IO4A 5G2PA 3H1LD 2BYLA 4CXQA 1C4KA 3FWLA 1T8ZA 5G2QA 3ZRPA 3L72D 2BI9A 2Q9IA 1CZCA 1RV4A 1LC8A 1IFDA 3L75D 4AUWA 3WUVA 2AEJA 1KFNA 3VP8A 3BCCD 4JEXA 1HJ0A 3G4SP 1NKNA 2QA3A 4KAMA 1BE3J 4Y0DA 2KFPA 3SFEC 1O4SA 4WBAA 1Z56A 1M4NA 2EZ2A 1QGNA 3A8UX 5CCGD 5FT5A 1FDIA 4U1TA 1OXPA 3KGWA 1CJ0A 1UKJA 4DGTA 4M3LA 3I16A 2CSTA 2VIAA 2DKBA 2JDIH 5CCHA 5EUEA 4EB7A 1GEWA 3NTJA 3KQGA 1LTBC 2KS1A 3AENB 4UQVA 2AXTE 1USEA 1BJOB 1LGHB 2O01H 1IBJA 2WPVB 3G3ZA 1M1JB 4RJYA 4LC3A 1FAVA 2YKXA 4W8IA 4I6MC 1I29A 4OH8B 1OHYA 5E4ZA 3AATA 4A6RA 1ZRTE 2IFNA 1X2AA 5DJUB 1VQLP 2ZVOB 1Y4IA 4L73A 1G2CB 1N7LA 1SQPJ 3H1ID 2V1PA 5BJ4A 3V2QA 2IZ0A 3L71J 3GW6A 1VF5D 2MKVA 3I56P 1LK9A 1PGQA 2E75D 4KJMA 1JB0J 5AW2B 3H1HG 2JO1A 3OW2O 2W6AA 3L74D 2Q7WA 2D7YA 4W1VA 1X9VA 1AQ5A 5G4IA 1NTKJ 1EDIA 5CBNA 2AY6A 1SQQE 1GC4A 1PFFA 1N8RQ 2PO3A 1PV3A 1CQ7A 4YPCA 4NPEA 4AYCA 3JC22 1D7SA 4CXRA 4ISYA 4ADEA 2E5TA 2IYOA 2K88A 3G8MA 3IN6A 1PGJA 1JY3N 2VMQA 1BGYE 5CCGC 2VMZA 4OCAA 1BE3G 1AVOA 1OVUA 3JCUE 1Z7DA 2KYVA 4IYOA 1KFMA 2ZUKA 2C0WA 2D5YA 1FC4A 1B9IA 3L75J 1WYVB 1LTSC 1S9KD 5EAVA 1NVOA 4XE5B 2GSAA 3EI5A 3BCCJ 1P84H 5CJ4A 4RJTA 3E6GA 3OJAB 4D6TG 3CX5E 1KYOH 5EIGA 3HUSA 2XDJA 2KLUA 3WKRA 1L0ND 1G7WA 4P3MA 1FU1A 4H44B 1GTWA 1FG7A 5KAIE 3FTBA 2JP3A 5FT8A 1LTGC 2E74B 1FC2C 2AEVA 3KXDA 2RN0A 2NPSB 1BQDA 1VF5C 1Q7YQ 2FFDC 3CX5H 4BA5A 3T32A 4IFDK 4GOEA 1SQPG 3LW5H 4K35A 3L71G 3FVXA 1W7MA 3NU8A 5KAIH 1AKBA 2EGYA 1FS0E 1TATA 1IFNA 4L76A 2KB7P 2IZ1A 1RY3A 4U3FJ 1NTKG 2KSEA 2FNUA 1VDFA 1U7JA 1LTJB 3AEOA 2OKKA 3MGNA 1DD4A 4NPDA 1J04A 4DJGA 2WSEH 2R5CA 4K3AA 4Q75A 1C7NA 1DJEA 4OVNF 3W1IA 3PA9A 2YCPA 1NU1G 1ASLA 9AATA 2ZFCA 2OYIC 1AHFA 1QX8A 4WY4C 5L8RJ 3VAXA 2ZT9B 1ZLLA 1K04A 2XU6A 4KHXA 1WYTA 5KTBA 1JEKA 4PV1D 3AEMC 1D7MA 1LTIC 2WMMA 4ZSWA 4JQ0D 4IOIH 4EIJA 1MKMA 4A6TA 2GQNA 1OATA 1L2PA 4ATQA 1L0NK 3AEBC 1YITP 3F5HA 1NOHA 1HGVA 1GD9A 3EI6A 1HTLC 2V4HA 2BIAA 1QISA 3K7YA 1JTHA 3O6QA 3OKSA 3VK2A 3DR4A 3P32A 3P7KA 3D6ZA 2H7HA 1BSNA 4OTLA 1AY5A 1RF1C 4WBTA 3B1EA 3PIUA 2HFED 2D65A 2VI8A 1S5LX 3FZ8A 2W7MA 5M46A 4MSOA 2YMYA 3CX5I 3HD7B 3H1JD 2PP6A 2YKVA 1N8PA 3EZ1A 3Q8NA 4JEWA 4OMAA 4F5KA
chains in the Genus database with same CATH topology
3FQ7A 1M6SA 5BVZA 3B5NA 4WB4A 3N7NA 3U1AA 5EQCA 1AMAA 1BJWA 2HORA 3R2PA 3FVSA 2JEEA 3KDPB 3GZDA 3PPLA 1LW4A 3BVHA 2VMYA 2YRRA 1DEBA 2VMSA 4A0GA 1WYUA 3ZRQA 3MIWA 4IW7A 1FZCA 2BI2A 1SF2A 1RVYA 3L35A 3UE8A 1AKCA 3C9IA 2HOZA 3KYQA 4WP0A 3LIDA 4A0HA 1KKPA 1WRGA 3TNUA 2RFVA 1I41A 3PDBA 1AJRA 1EQBA 3MEBA 3DRDA 5G09A 1MAQA 3M9HA 2YKOA 1RE3C 1A02F 2IPPA 3ZRRA 4E77A 2A1VA 2N1TC 5D95A 2WT7A 3GR9A 1D7UA 2LKMA 1JG8A 5AVWB 3N5MA 1CL1A 4MKKA 4A0FA 3VP9A 4I2LC 2XZRA 2VI9A 3NX3A 2P7JA 1H1CA 3FQAA 3SWYA 2L5GB 2HPCA 3HUSB 3WCNA 2XH1A 5APUA 1C7OA 1IC2A 2R0TA 1G4VA 5KJ7D 5C6UA 1X79B 3A5TA 1URQA 2C0RA 1LC5A 4K05A 1S0AA 3RBFA 2D66A 1GBNA 1ZN5A 3E2ZA 1IFMA 4GEBA 3RUYA 1M1JC 1SQBK 3HQTA 2D63A 1FZEA 1M7LA 3M91A 3NYUA 2E43A 2D61A 2BYJA 4RIZA 2QB2A 2BHXA 2NPSD 1AY8A 2R5DA 3DODA 1WT6A 2R5CB 4WYFA 3LY1A 4WYGA 1PMOA 4LC1A 1KMKA 1CQ8A 1ZODA 3AEJC 1T2KD 5M49A 1DFOA 1ORDA 2G7JA 2GUVA 1JCDA 3BWOA 2ZC0A 5KLVK 1ASFA 3RK3B 1WYTB 3V2RA 1MGVA 1FZAA 3VMXA 2W6BA 1B4XA 1NTZK 3TYYA 1DX7A 3P1TA 5E5IA 1C7GA 4UHMA 2Z5HA 3B8EB 1TOJA 1AHYA 2JJGA 2ZSMA 3M0DA 1BJ4A 1GW4A 2BIEA 3NYSA 3PJ0A 3WY7A 4ZKPA 5KJ7C 1SPAA 1X0MA 3QBOA 1N7SA 2XNXA 1AAWA 4GIFA 3AOWA 1JTHB 3FSLA 2R2NA 5AW4B 2OYHA 1CZEA 4XJLA 4JEZA 3ISLA 5M4DA 3JWBA 2VYCA 4BQ0A 2P2UA 4JF7A 1ARSA 1GDEA 3ASAA 3VYIA 2YKUA 2POHA 1YYCA 1W3UA 2PAJA 4GDYA 1CS1A 1GCKA 3GWPA 2VMXA 4EB5A 2WB6A 2E54A 3B5NB 2Q3IA 2NPSC 1HBWA 1DJ9A 4OBUA 2HUUA 4IX8A 4ZDPA 2OQXA 4Y99B 2W7EA 3EUCA 3N4SA 5CCHD 4LGDE 3HD7D 1T2KC 1WYUB 1B8GA 5IWQA 4ATPA 2FNIA 2CANA 1HUCA 8AATA 2ZY3A 2J59M 1MLYA 1FDMA 3CAIA 1S9KE 1TASA 2ZXEB 3A2BA 3NTNA 1LTJC 1YAAA 2VMRA 5BJ3A 3M9BA 1CI6B 3CBFA 1KMJA 2IX7C 2KOGA 1VP4A 1W7LA 1OHVA 1MDZA 3HE4A 3WMM0 4EMYA 1AMSA 2WT7B 1CZQA 3FZ7A 2O7CA 3WCOA 3A9XA 1ELUA 3HTKB 2A45H 4W91A 2BIGA 3NUIA 4JEYA 2WSCH 3ZZJA 4BA4A 3F9TA 3BC8A 2HPCB 3EIBA 4OBVA 4RKCA 2ZJGA 4R8DA 1JY2O 2HZPA 4R2NA 5CCHC 1LWUA 2GM4A 2YCNA 4WLHA 1XTGB 3HD7C 1I48A 2CTZA 2H8PD 3H32A 1BQAA 3E2ZB 1O69A 4PIWA 2CINA 1LT9B 4MQRA 5APVA 1QITA 3B8XA 3RQ1A 1MFZA 3L8AA 3G0TA 1VEFA 4K2IA 2BI3A 2OATA 1AKAA 1SQPK 1YTZT 3II0A 4JF0A 5DJ9A 2VMOA 2O1KA 5K8BA 2YCTA 2P67A 4W1XA 2VGSA 4IFMA 3BASA 2QSRA 2FKIA 3ACZA 4NOGA 1ARHA 4H51A 5APQA 1KILA 3UIAA 3E1IA 2YNYA 1JMMA 1O62A 2W7HA 1NWQA 2QM8A 2OGEA 2TPLA 1N73C 2JJHA 4GT1A 2VMPA 3GHGB 1WKGA 1LTAC 3ECDA 2FQ6A 1B5OA 1IAYA 2FN6A 5HHYA 1NU1K 1ZR4A 1FBMA 4XA4A 1GC0A 2Z4EA 1GC3A 4Q31A 2N9BA 1J1DC 2OYHB 5HXXA 2QBTA 1JUNA 4XK1A 1SVVA 4F5GA 3MC6A 4DOJA 2CPSA 3RK3D 1IJIA 3NDNA 4F5LA 2ZY2A 3BWNC 3HL2A 4RLGA 3V5BA 1S07A 1J1EC 3N4RA 1IJDB 1AHGA 4ZWVA 2C7TA 4U2HA 5AVZB 2G6WA 2W8WA 1SLQA 4M2MA 3EFGA 3G7QA 3FQ8A 4JEVA 2BASA 4M2JA 3NU7A 4AOAA 2Q5UA 2O0RA 4UHOA 4C7NA 2HYNA 1E5WA 2HP1A 2VGZA 1G1IA 1OHWA 3L37A 3IHJA 4XQ2A 1MDOA 2VMVA 1QZ9A 4ITGA 3B5ND 4W1WA 4R5ZA 3AELA 1YNUA 3I4JA 1V72A 1EQ7A 4O6ZA 1SQVK 2VMNA 3KGXA 3RBLA 3HE4B 3BATA 3RL0B 4AZJA 1CSBA 3FFRA 4F5JA 2FFDA 1AJSB 3CQ5A 3LV2A 5AW0B 1LW5A 2FM1A 3VTPC 3D6KA 2XBNA 4E1OA 3V4QA 5APSA 3LG0A 4AZKA 1GU5A 1S09A 2WPSA 7AATA 2I1JA 4ZDLA 4R5FA 2KP8A 2ZP7A 5EFSA 2WK9A 5EUNA 4ZLVA 4J8LA 3RCHA 2HODA 4WXBA 1TOGA 4IFFA 4ZWMA 1ASEA 4XAUA 2Z1ZA 2R5BA 3L36A 4AQRD 3ATHA 1LWUB 1IAXA 4JYCA 3EIAA 2Z9WA 4W80A 3H32B 4WY4A 1XTCC 4N78D 2WTYA 2C44A 4LW2A 2I1KA 1ASNA 3FD0A 3FVUA 4HVKA 4GRXA 2Z5IA 4Y99C 5AX8A 2ZY4A 3A2AA 1KL1A 2BWOA 2YKQA 3P8CE 1JO5A 1MLZA 2GUSA 4RM1A 4E3QA 2JISA 4UOYA 1CL2A 2HOXA 3V4WA 3WGBA 3QHXA 3WX9A 2OGAA 3U59A 5AW7B 1KILB 2DGMA 3AOVA 4WB0A 3HE5A 2JJLA 3NNKA 3GZCA 2W8TA 2WITA 1ASMA 5TF5A 2R5EA 1X8YA 4IXZA 3GBXA 2WWWA 1T3UA 3BCAA 5APXA 3E2FA 2WPQA 5F9SA 2AEUA 4EFFA 1JY3P 4XEWA 4IYOB 2CH2A 1AFOA 3VP6A 2YKPA 3JWAA 1MUUA 1M0NA 2X5DA 1AY4A 2BI5A 3O8ZA 2A45G 1JF9A 5EIGB 4IY7A 4W5KA 2DOUA 1RE3A 4C7NB 1GL2A 1BKGA 2N1TA 1LT9C 4A72A 1SFCA 1SQQK 3K28A 4XJPA 5M4BA 5AVUB 1LKCA 2M8RA 1XI9A 3HBXA 3TK1A 4N6JA 1RV3A 4N3YB 2C9NY 3V2NA 1PFIA 3W1JA 2R32A 1JOCA 1FOSE 1TPLA 1YJZA 2JJFA 3BRTB 5AW1B 3K40A 1YTZI 3CLQA 1C0NA 5G4JA 3P6KA 4M2KA 1YJSA 4ZAHA 1YIZA 2AY3A 2W7IA 1X28A 3VMYA 2OKJA 3AENA 2AY1A 3FKDA 1M1JA 4TN4A 1Z3ZA 3GHGC 4A6UA 1IFJA 3M06A 1TOKA 2Q7CA 3U1CA 4F5HA 3JW9A 3E77A 3M0DC 1MAPA 1OXZA 3M5UA 3MUDA 5AVXB 4A0RA 1SZKA 1N2DC 1E5EA 4EOTA 3RCHB 2OYHC 3RL0D 2YO3A 2O1BA 4OC9A 5APYA 5DX5A 3UWCA 4WYAA 2J58A 3AEJA 4RITA 2W7KA 1ASGA 1M7YA 2H43A 2ORDA 3M9QA 5AW3B 2OARA 2VGTA 1MV8A 3N4XA 3AEPA 5AVQB 2DR1A 1DH3A 2EPJA 3MAUA 1EJIA 4Y0HA 2VGVA 4OYTA 3PP5A 3HLMA 1MDXA 4F5IA 2GMSA 5KJ7A 3H7FA 3BB8A 1UU2A 3WGCA 4CBRA 1WYVA 4LNLA 4RAEA 5AVSB 1S08A 4DBCA 2CPBA 4WD2A 1ZR2A 1H89A 1RE4C 1C9CA 3H9XA 3DZZA 3TATA 1FZCB 2VGUA 3QM2A 4WB0B 3HE5B 1FZFA 4ZM3A 5FT4A 1GK6A 1ZOBA 4BHDA 2PB0A 3KPEA 3CQ4A 1GZLA 1AHEA 3BV0A 3RL0C 4A00A 1WKHA 3TNUB 2X3LA 3F6TA 3PDBB 4I8AA 2HUFA 1MZ9A 1D7RA 1SP4A 4RESB 5AVRB 1H0CA 1YOOA 1QJ3A 1RF0C 1JS3A 1NKZB 1N31A 1KILD 2HLOA 3HMUA 3OP7A 3EI9A 3LVMA 2XKMA 1DGDA 4GE9A 5AW5B 2W8VA 2E42A 2HP2A 4WXGA 2C0XA 1IFIA 3GJUA 3USFA 1LTJA 2HUIA 4ADDA 1OWAA 3HVYA 1M0OA 3BN1A 1LWUC 3A3YB 1L4AA 1L0LK 2BWPA 1GL2B 2AY2A 1FJPA 1IX7A 2GMUA 4IXSA 2AATA 2N1TB 3FFHA 2HG5D 1HGZA 5APTA 1SFCB 1URQB 2V0YA 3V2PA 4C7RA 1NHLA 3MBBA 3PAAA 3PGYA 2CY8A 3R9AA 5AVYB 1DTYA 2AY7A 4TMRA 2AY5A 2WZ7A 3MD0A 3H6PA 1JNMA 3BCBA 2W7LA 2NMPA 5HDMA 2Z9VA 1SFFA 3L44A 3LVLB 3CL3D 1J2JB 4ZKUA 1KILC 2P1JA 3HD7A 4E3RA 4IXOA 4Y0IA 2YKYA 1GW3A 1BS0A 4RKDA 4N78E 2EH6A 1NTKK 2YOBA 3COGA 1KZUB 1DKAA 1ZC9A 3F0HA 5CJ0A 2QMAA 4K2MA 2A45I 1S06A 4AO9A 1IVRA 3MC6C 3P8MC 3JZLA 2R3CA 4PFFA 3HRNA 1IUGA 1N7SB 1YIYA 1EG5A 2GB3A 4LLHA 3ELPA 3QGUA 5APWA 2AY9A 3DR7A 2VMWA 1T3IA 1P3WA 1G7XA 4DZOA 3EI8A 3TFUA 4CVQA 1W2EA 4W7YA 2EYQA 2WK8A 1N73A 2D64A 3HUSC 2AY4A 2AY8A 2CJDA 3DU4A 3T97A 1FZGA 3JTXA 5BU5A 3RK2B 2M3BA 1ARGA 2E7IA 1RVUA 2W8JA 4HH2A 4WY4D 3B1CA 4ITXA 3I5TA 3IFMA 5CCGA 3VMZA 1YJYA 4ZSYA 3BWNA 2Z20A 1QIRA 3GETA 1N86A 1W23A 4B86A 1PG8A 1GK4A 1IX6A 2QB3A 1IX8A 3NFQA 1O61A 1UU1A 3I5CA 1FJKA 3PD6A 1LC7A 1HJBA 3OAKA 2WK7A 2VLFA 3VOMA 2Z1YA 4CBSA 4MKJA 2W27A 1N2TA 4MY5A 2EZ1A 3RK3C 4GKGA 3MAFA 3E2YA 4W7ZA 1FOSF 1ARTA 1JY2N 2CJGA 2CB1A 4GE7A 1CQ6A 3M0AA 3DXWA 4AH3A 4J5UA 4EU1A 4FFCA 3NMDA 1W7NA 4HF8A 4KXKA 1L4AB 3WLXA 1UU0A 2VMUA 3N0LA 5DJ1A 3VN0A 2E7UA 1CW5A 1GEXA 4FL0A 5I92A 1ECXA 3LWSA 1M0QA 2OYIA 2IFMA 1KL2A 1QL1A 4PFNA 3LIEA 3KE3A 3B5NC 4WLJA 1A02J 2VGWA 4UHNA 3AEMA 1V2DA 3VK3A 2C81A 4F4EA 2CJHA 1GL2D 2VRSA 4PVFA 2WSFH 3GZDC 2N1TD 2Z9XA 3CQ6A 1SFCD 1URQD 4O9BA 2VLHA 3IR9A 1B5PA 1DJUA 1G1JA 1FZCC 1SQXK 3FCRA 1QL2A 4XJMA 5JAYA 3LVJA 1RF1A 2FYZA 4ZM4A 1SVFA 1GD2E 1DGEA 4WXFA 3EQ2A 2CH1A 1VPCA 1GC2A 2W7GA 2JGTA 5FT6A 3LVKA 2BWNA 2HOYA 1AMRA 5F8VA 5EAAA 3OA7A 1JS6A 1V2FA 4WYEA 3SWFA 4H63Q 4F5MA 3DXVA 2W7DA 2FYFA 1FG3A 3TCMA 1QJ5A 1BJNA 3PDXA 1T3JA 1TARA 3NXSA 4LNJA 1WSTA 2BI1A 1ASAA 2FKWB 3MKJA 4BMKA 2VMTA 4B98A 2WPRA 1CI6A 1H88A 5AVTB 1N73B 3HT4A 2C9LY 3NRAA 4AO4A 2EO5A 1ASDA 1ZV8A 3VK4A 1I43A 1GL2C 1HVVA 1AMQA 4L0OA 5G0AA 2ZSLA 1N7SD 4WYDA 1SFCC 1URQC 2QLRA 3ASBA 1V2EA 1J1DB 2D7ZA 3BRVB 3HTKA 4JF1A 1ELQA 3BS8A 1BW0A 1AIBA 1U08A 2WKAA 1XEYA 3L4FA 1B9HA 1J1EB 2JG2A 1X29A 2KLVA 3FDDA 3B1DA 1ASBA 5AW6B 3RK2D 4N0WA 1G4XA 2ZYJA 3PD6B 2XV5A 2FXMA 4C46A 4QGRA 3NYTA 4XJOA 1LT9A 3NUBA 2DKJA 3WKSA 3QN6A 4F5FA 2FFDB 3HDOA 2W7JA 1BJOA 3MAFB 1NH4A 5BU8B 5CHXA 3A9ZA 1KQLA 3DYDA 5AW8B 1BT4A 1JY2P 2FYUK 1GU4A 3EI7A 4ADCA 1JCCA 4LNMA 1NO4A 1N7SC 1G2CA 2KSJA 2Z61A 3A9YA 2HODB 1TOEA 5AW9B 1M0PA 3ZZKA 3A7OA 3E9KA 3AV7A 3N75A 4B9BA 2DGLA 1AHXA 5DB5A 3MTUE 1SZSA 3FZ6A 3R4TA 3FRKA 1AIAA 2OYIB 3VOPA 3GHGA 4WY4B 5J8QA 3WZFA 3RI6A 2QM7A 2YO2A 1AAMA 3TFTA 1KKJA 5CMZA 2O1JA 3P8CD 1GDTA 1L4AD 4KYOA 3RK2C 1LTTC 1ASCA 1GEYA 5D5SA 3MADA 2PB2A 4DQ6A 1M32A 4MQQA 3II6A 1SZUA 1ARIA 3FDBA 4JYBA 2W7FA 3GSBA 4HYTB 1TOIA 1RF1B 3QPGA 1NTMK 4I1LA 1AX4A 2JJEA 1JY3O 5AVVB 2CFBA 1AICA 4LW4A 3UAKA 2F8JA 4Q6RA 3B46A 1J32A 3W1HA 2E7JA 2NPSA 3QI6A 1OXOA 4GSAA 1HWTC 3EZSA 1LS3A 5EUDA 4GE4A 2YHKA 3KKIA 4K2BA 3DC1A 4ZDOA 5E3KA 1RE4A 4ZASA 2W8UA 2Z9UA 1NAFA 2YRIA 4P7YA 2ZY5A 1H8AA 2VIBA 2MJZA 4ADBA 1L4AC 1D7VA 3TQXA 3BCXA 1E5FA 2BKWA 1VJOA 4RJ0A 3TSIA 2X5FA 4MQPA 4Q76A 1IK9A 1FZBA 1AJSA 4WYCA 3CI9A 2X8UA 1RF0A 1HH0A 1D2FA 2DGKA 3ELEA 4OT8A 1PMMA 1IO4A 5G2PA 2BYLA 4CXQA 1C4KA 1T8ZA 5G2QA 3ZRPA 2BI9A 2Q9IA 1CZCA 1RV4A 1LC8A 1IFDA 4AUWA 1KFNA 3VP8A 4JEXA 1NKNA 2QA3A 4KAMA 4Y0DA 2KFPA 1O4SA 4WBAA 1Z56A 1M4NA 2EZ2A 1QGNA 3A8UX 5CCGD 5FT5A 4U1TA 1OXPA 3KGWA 1CJ0A 1UKJA 4DGTA 4M3LA 3I16A 2CSTA 2VIAA 2DKBA 5CCHA 5EUEA 4EB7A 1GEWA 3NTJA 3KQGA 1LTBC 3AENB 4UQVA 1BJOB 1LGHB 2O01H 1IBJA 3G3ZA 1M1JB 4RJYA 4LC3A 1FAVA 2YKXA 4W8IA 4I6MC 1I29A 4OH8B 1OHYA 5E4ZA 3AATA 4A6RA 2IFNA 1X2AA 1Y4IA 1G2CB 1N7LA 2V1PA 5BJ4A 3V2QA 1LK9A 5AW2B 2W6AA 2Q7WA 2D7YA 4W1VA 1X9VA 1AQ5A 5G4IA 2AY6A 1GC4A 1PFFA 2PO3A 1CQ7A 1D7SA 4AYCA 4CXRA 4ISYA 4ADEA 3G8MA 1JY3N 2VMQA 5CCGC 2VMZA 4OCAA 1Z7DA 2KYVA 4IYOA 1KFMA 2ZUKA 2C0WA 2D5YA 1FC4A 1B9IA 1WYVB 1LTSC 1S9KD 5EAVA 4XE5B 2GSAA 3EI5A 5CJ4A 3E6GA 3OJAB 5EIGA 3HUSA 2XDJA 3WKRA 1G7WA 4P3MA 1FU1A 1GTWA 1FG7A 3FTBA 5FT8A 1LTGC 2AEVA 1BQDA 2NPSB 2FFDC 4BA5A 3T32A 4IFDK 3LW5H 3FVXA 1W7MA 3NU8A 1AKBA 2EGYA 1TATA 1IFNA 2KB7P 1RY3A 2FNUA 1VDFA 1LTJB 3AEOA 2OKKA 3MGNA 1J04A 2WSEH 2R5CA 4Q75A 1C7NA 1DJEA 3W1IA 3PA9A 2YCPA 1ASLA 9AATA 2ZFCA 2OYIC 1AHFA 4WY4C 3VAXA 1ZLLA 2XU6A 4KHXA 1WYTA 5KTBA 3AEMC 1LTIC 4ZSWA 4EIJA 4A6TA 2GQNA 1OATA 4ATQA 1L0NK 1NOHA 1HGVA 1GD9A 3EI6A 1HTLC 2BIAA 1QISA 3K7YA 1JTHA 3OKSA 3VK2A 3DR4A 3P32A 3P7KA 2H7HA 4OTLA 1AY5A 1RF1C 4WBTA 3B1EA 3PIUA 2HFED 2D65A 2VI8A 3FZ8A 2W7MA 5M46A 4MSOA 2YMYA 3HD7B 2PP6A 2YKVA 1N8PA 3EZ1A 3Q8NA 4JEWA 4OMAA 4F5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRN A;  3OJA B;  4I1L A;  5BVZ A;  3U1C A;  4O9B A;  3N7N A;  3U1A A;  5KTB A;  3BAT A;  5BU5 A;  4N3Y B;  4N78 D;  3C9I A;  1WT6 A;  2POH A;  4ZKU A;  2JEE A;  1IC2 A;  3VP8 A;  3N4X A;  1NKN A;  3N4S A;  1X79 B;  3P8C D;  3BAS A;  3N4R A;  4ZKP A;  5BU8 B;  3VP9 A;  2FXM A;  3U59 A;  4GIF A; 
#chains in the Genus database with same CATH topology
 3FQ7 A;  1M6S A;  5BVZ A;  2QRX A;  3B5N A;  4WB4 A;  3N7N A;  3U1A A;  3L73 G;  4U3F G;  5EQC A;  3AEG C;  1AMA A;  1BJW A;  1SQV G;  2HOR A;  3R2P A;  3FVS A;  2PGD A;  2JEE A;  3KDP B;  3GZD A;  3PPL A;  1LW4 A;  3BVH A;  2VMY A;  2JWA A;  2YRR A;  1DEB A;  2VMS A;  1SQX J;  4A0G A;  1WYU A;  3ZRQ A;  3MIW A;  4IW7 A;  1FZC A;  3CCV P;  1L0L E;  2FXP A;  3CCS P;  2BI2 A;  1SF2 A;  1RVY A;  3L35 A;  3UE8 A;  1AKC A;  5KKZ C;  1ZOY C;  3C9I A;  4PV1 C;  1SQB D;  2OQQ A;  2QJP C;  2HOZ A;  3KYQ A;  4WP0 A;  3LID A;  4A0H A;  1KKP A;  1WRG A;  3TNU A;  2RFV A;  1I41 A;  3PDB A;  1AJR A;  1EQB A;  3MEB A;  3DRD A;  5G09 A;  1MAQ A;  3M9H A;  2YKO A;  1RE3 C;  1A02 F;  2IPP A;  1U7M A;  3ZRR A;  4E77 A;  2A1V A;  3GF7 A;  2N1T C;  5D95 A;  2WT7 A;  3GR9 A;  1D7U A;  5B66 E;  2LKM A;  1JG8 A;  5AVW B;  3N5M A;  1CL1 A;  4MN4 C;  4MKK A;  4A0F A;  3VP9 A;  1KIL E;  4I2L C;  5KLV D;  3L71 E;  2XZR A;  2VI9 A;  3NX3 A;  2P7J A;  1H1C A;  3FQA A;  3SWY A;  2L5G B;  2HPC A;  3HUS B;  5B66 H;  3WCN A;  2XH1 A;  5APU A;  1C7O A;  3KHU A;  4PD4 E;  1IC2 A;  2R0T A;  4WWI A;  1G4V A;  1NTK E;  5KJ7 D;  3TGU J;  3RBZ A;  1Q86 Q;  5C6U A;  1X79 B;  3A5T A;  1URQ A;  4RO0 A;  3AE3 C;  3H1J J;  2C0R A;  1LC5 A;  4K05 A;  1S0A A;  3RBF A;  2D66 A;  1GBN A;  1ZN5 A;  3E2Z A;  1IFM A;  4GEB A;  3RUY A;  1M1J C;  1SQX G;  1K05 A;  1SQB K;  3HQT A;  2D63 A;  2ZXX A;  1FZE A;  2E75 B;  1M7L A;  3M91 A;  3NYU A;  2E43 A;  2A06 D;  4H44 D;  2D61 A;  2BYJ A;  4RIZ A;  2QB2 A;  3L75 E;  2M0B A;  2BHX A;  2NPS D;  1AY8 A;  3BCC E;  1LP1 B;  3CXH D;  2R5D A;  3DOD A;  1WT6 A;  2R5C B;  1AVY A;  4WYF A;  2QJY B;  3LY1 A;  4WYG A;  1UII A;  1PMO A;  4LC1 A;  1KMK A;  1CQ8 A;  1ZOD A;  3AEJ C;  2K37 A;  1T2K D;  3MP7 B;  5M49 A;  2NRG A;  5B5E E;  1DFO A;  2GUV A;  1ORD A;  1JCD A;  2G7J A;  3BWO A;  2ZC0 A;  5KLV K;  1ASF A;  3RK3 B;  1WYT B;  3V2R A;  1MGV A;  1FZA A;  3VMX A;  2QJK B;  2W6B A;  1B4X A;  1NTZ K;  3TYY A;  1DX7 A;  3P1T A;  5E5I A;  3S9O A;  1C7G A;  2FYU J;  4UHM A;  2IBZ D;  3GF3 A;  5E79 E;  3A0B H;  2Z5H A;  4DT0 A;  3B8E B;  3GMA A;  4IL6 E;  1TOJ A;  1AHY A;  2JJG A;  2ZSM A;  3M0D A;  1YQ4 C;  1BJ4 A;  1GW4 A;  3WUU A;  2BIE A;  3NYS A;  3PJ0 A;  3WY7 A;  4ZKP A;  5KJ7 C;  1PPJ D;  1SPA A;  1X0M A;  3QBO A;  1N7S A;  2XNX A;  1AAW A;  2ZYD A;  4GIF A;  3AOW A;  1JTH B;  3O6Q B;  3FSL A;  2R2N A;  5AW4 B;  2OYH A;  1CZE A;  4ASV A;  4XJL A;  4U3F E;  4GDO A;  2ZT9 D;  3TGU G;  4JEZ A;  3ISL A;  5M4D A;  3JWB A;  2VYC A;  4BQ0 A;  2WSE J;  2P2U A;  4JF7 A;  1ARS A;  1GDE A;  1ZP0 C;  3ASA A;  3VYI A;  4IL6 H;  2POH A;  1YYC A;  2YKU A;  1W3U A;  2KI7 B;  2PAJ A;  4GDY A;  1SQQ G;  1CS1 A;  1GCK A;  3KZI E;  4PD4 I;  3GWP A;  4H44 C;  2VMX A;  3AE9 C;  1RQV A;  4EB5 A;  2WB6 A;  2E54 A;  3B5N B;  1QVG O;  2Q3I A;  2E74 C;  2NPS C;  1HBW A;  4H13 B;  1HF9 A;  1DJ9 A;  1EZV G;  1BGY G;  4OBU A;  2HUU A;  2FYN B;  4IX8 A;  4ZDP A;  2OQX A;  4Y99 B;  1KB9 D;  2W7E A;  1E79 H;  3KZI H;  3EUC A;  3N4S A;  5CCH D;  4LGD E;  3HD7 D;  1T2K C;  1WYU B;  1B8G A;  5IWQ A;  4ATP A;  2FNI A;  1YI2 P;  2CAN A;  1HUC A;  4RKU J;  1NTM J;  8AAT A;  2ZY3 A;  2J59 M;  3QWO C;  1MLY A;  1FDM A;  3CAI A;  1S9K E;  1TAS A;  3TDK A;  2ZXE B;  3A2B A;  1R5S A;  3NTN A;  1LTJ C;  1YAA A;  2VMR A;  5BJ3 A;  3M9B A;  1CI6 B;  3CBF A;  1KMJ A;  2IX7 C;  2KOG A;  2FYU G;  3Q3D A;  1VQ9 P;  1VP4 A;  1W7L A;  4PJ0 H;  1OHV A;  1MDZ A;  2E5Y A;  3HE4 A;  3WMM 0;  4EMY A;  2QA4 P;  1AMS A;  2ZT9 C;  2WT7 B;  3AE6 C;  1CZQ A;  3FZ7 A;  1OW7 A;  2O7C A;  3WCO A;  3A9X A;  1ELU A;  3D70 A;  3HTK B;  2A45 H;  4W91 A;  4JBZ A;  2BIG A;  3NUI A;  4JEY A;  3W68 A;  2YMK A;  2WSC H;  3ZZJ A;  1ZXG A;  1SQX E;  4BA4 A;  3F9T A;  3BC8 A;  1BCC D;  2HPC B;  3EIB A;  3CWB J;  1EXI A;  4OBV A;  1U57 A;  3CPW O;  4RKC A;  1M8O B;  1VQP P;  2ZJG A;  2V7Q J;  2JR8 A;  5TJH A;  4R8D A;  1JY2 O;  1GMJ A;  2HZP A;  4R2N A;  1L0L J;  3E1R A;  5CCH C;  1EDK A;  1LWU A;  2GM4 A;  2YCN A;  4WLH A;  1XTG B;  3HD7 C;  3FXD A;  1I48 A;  2CTZ A;  2H8P D;  3H32 A;  1BQA A;  3E2Z B;  2KZI A;  1BDD A;  1O69 A;  4PIW A;  2CIN A;  1LT9 B;  2FY8 A;  4MQR A;  3L70 D;  1NGM B;  1Y47 A;  5APV A;  5TIS E;  1QIT A;  1Q90 D;  3B8X A;  3RQ1 A;  1MFZ A;  1KV4 A;  3L8A A;  3G0T A;  1VEF A;  4K2I A;  2D2C B;  2BI3 A;  2OAT A;  1AKA A;  1SQP K;  1YTZ T;  2M5A B;  3II0 A;  4JF0 A;  5DJ9 A;  2VMO A;  2O1K A;  5K8B A;  5TIS H;  2YCT A;  4YTP C;  2P67 A;  4W1X A;  2VGS A;  2Y0E A;  4IFM A;  2ZAE B;  3BAS A;  2QSR A;  2FKI A;  3ACZ A;  4GOF A;  4NOG A;  1ARH A;  4H51 A;  5APQ A;  1KIL A;  3TGU E;  1JM0 A;  3AE8 C;  3E1I A;  3UIA A;  1M90 Q;  2YNY A;  1JMM A;  1O62 A;  2W7H A;  1NWQ A;  3H1J E;  2QM8 A;  5C39 A;  2OGE A;  2TPL A;  1N73 C;  4BXL A;  2JJH A;  4GT1 A;  2VMP A;  3L73 D;  3GHG B;  1WKG A;  2E76 B;  1LTA C;  4EYY Q;  3ECD A;  2FQ6 A;  3VMA A;  1B5O A;  1VL2 A;  1IAY A;  2FN6 A;  5HHY A;  1NU1 K;  1ZR4 A;  1FBM A;  4XA4 A;  1GC0 A;  2Z4E A;  3CWB G;  1GC3 A;  4Q31 A;  2N9B A;  3PTZ A;  1J1D C;  2OYH B;  5HXX A;  3USS A;  2QBT A;  1JUN A;  4XK1 A;  1SVV A;  4F5G A;  3MC6 A;  1P84 E;  4DOJ A;  3H1L J;  1EZV E;  2CPS A;  1L0L G;  3RK3 D;  1IJI A;  1KYO E;  1QVF O;  3NDN A;  3L72 J;  4F5L A;  2ZY2 A;  3BWN C;  3HL2 A;  4RLG A;  3V5B A;  2IYP A;  1S07 A;  1J1E C;  1OVV A;  2BEZ F;  3N4R A;  1IJD B;  1AHG A;  4ZWV A;  2C7T A;  4U2H A;  1PP9 D;  4I7Z B;  3B71 A;  5AVZ B;  2G6W A;  1SLQ A;  2W8W A;  4M2M A;  3EFG A;  3G7Q A;  3CCR P;  3FQ8 A;  4JEV A;  2BAS A;  2QG4 A;  2FBW C;  2LR2 A;  4M2J A;  3NU7 A;  4AOA A;  2Q5U A;  2O0R A;  4UHO A;  4C7N A;  2HYN A;  3G9R A;  1E5W A;  2HP1 A;  1TU3 F;  2VGZ A;  1G1I A;  3CCU P;  2FYU E;  1OHW A;  3L37 A;  1BDC A;  2WVR A;  5EFW B;  3IHJ A;  4XQ2 A;  2E75 C;  4R4L A;  1MDO A;  4KT0 J;  2VMV A;  1QZ9 A;  4ITG A;  3B5N D;  4W1W A;  2JKV A;  3AEL A;  4R5Z A;  1YNU A;  3I4J A;  1V72 A;  4H13 D;  1EQ7 A;  4O6Z A;  1SQV K;  2VMN A;  3H1I J;  5KLI B;  2QJY C;  4U7J A;  3KGX A;  3A0H E;  3RBL A;  3BAT A;  3HE4 B;  3RL0 B;  4AZJ A;  1CSB A;  3FFR A;  2L91 A;  3AED C;  1R5L A;  2FFD A;  4F5J A;  1AJS B;  3CQ5 A;  3LV2 A;  5AW0 B;  1LW5 A;  3L74 J;  4Z1M H;  1M1K Q;  2FM1 A;  2N9Y B;  1OX3 A;  3VTP C;  3D6K A;  2QJK C;  2XBN A;  3H1L G;  3A0H H;  3CCL P;  4E1O A;  3V4Q A;  5APS A;  3LG0 A;  3SSU A;  2YXQ B;  4AZK A;  4UB6 H;  1GU5 A;  5CBO A;  3L72 G;  3H1K D;  3PRJ A;  1S09 A;  2WPS A;  7AAT A;  2I1J A;  4ZDL A;  3D6Y A;  2KP8 A;  4R5F A;  2ZP7 A;  5EFS A;  3L75 G;  2WK9 A;  5EUN A;  4ZLV A;  1ZW0 A;  4J8L A;  3RCH A;  2A06 E;  3BCC G;  1S72 P;  2HOD A;  1NTM E;  4WXB A;  1TOG A;  1P84 I;  4IFF A;  4ZWM A;  1ASE A;  1EZV I;  4XAU A;  2Z1Z A;  4WVZ A;  2R5B A;  1KYO I;  3CXH E;  3L36 A;  4AQR D;  3ATH A;  1LWU B;  1IAX A;  3RGU A;  4JYC A;  3EIA A;  2Z9W A;  4W80 A;  3H32 B;  4DCK A;  2QVA A;  4WY4 A;  1XTC C;  4N78 D;  2WTY A;  3V6I A;  2C44 A;  4LW2 A;  2I1K A;  2Q1K A;  1ASN A;  1Y8A A;  1ZRT D;  2KS1 B;  2O01 N;  1DEE G;  3CXH H;  3FD0 A;  4H13 C;  3FVU A;  4HVK A;  1L0N J;  2WQY C;  4GRX A;  4UB8 E;  2Z5I A;  2FYN C;  2WSC J;  2IBZ E;  4Y99 C;  2ZY4 A;  5AX8 A;  3A2A A;  1KL1 A;  1OMI A;  2I8D A;  2BWO A;  2YKQ A;  2YIU C;  3K5B A;  3H1I G;  3P8C E;  1JO5 A;  3MHV A;  1LJ2 A;  1MLZ A;  2GUS A;  4RM1 A;  2KNC A;  4E3Q A;  1S5L E;  2JIS A;  4UOY A;  4UB8 H;  3CWB E;  1CL2 A;  2HOX A;  3V4W A;  1SQQ D;  3WGB A;  3QHX A;  3WX9 A;  2OGA A;  3U59 A;  5AW7 B;  1KIL B;  2DGM A;  3L74 G;  3AOV A;  1EDL A;  1OFC X;  4WB0 A;  2JJL A;  3HE5 A;  2BCC D;  2D2C D;  4H0L B;  3NNK A;  3GZC A;  1S5L H;  2W8T A;  2WIT A;  2ZYG A;  1ASM A;  5TF5 A;  2V7Q H;  1WMK A;  2R5E A;  1VQO P;  1X8Y A;  4IXZ A;  3C8V A;  3GBX A;  2WWW A;  1T3U A;  1KB9 E;  3H1K J;  3BCA A;  5APX A;  4L75 A;  4BWN A;  2ZVN B;  4JPZ B;  3E2F A;  1SS1 A;  2WPQ A;  5F9S A;  2AEU A;  4EFF A;  1JY3 P;  4XEW A;  2OTK E;  4IYO B;  2CH2 A;  1AFO A;  2E76 D;  3VP6 A;  2YKP A;  3JWA A;  3Q5P A;  1MUU A;  1M0N A;  1KB9 H;  4QMA A;  2X5D A;  1AY4 A;  2BI5 A;  3WUT A;  3O8Z A;  2A45 G;  1JF9 A;  5EIG B;  1NTZ D;  1L0N G;  2Y0C A;  3CXH I;  4IY7 A;  4W5K A;  3ITK A;  1AA0 A;  2DOU A;  1RE3 A;  1KN7 A;  4C7N B;  1GL2 A;  1BKG A;  2N1T A;  1LT9 C;  4A72 A;  1QLE D;  1SFC A;  1SQQ K;  1QEX A;  3K28 A;  3AEA C;  4XJP A;  5M4B A;  5AVU B;  1LKC A;  4R4M A;  1OW8 A;  4L74 A;  4HB1 A;  2M8R A;  1XI9 A;  3HBX A;  3TK1 A;  4N6J A;  1RV3 A;  2OTJ P;  4N3Y B;  2C9N Y;  3V2N A;  1PFI A;  3CMA P;  3SWK A;  3H1L E;  2IBZ I;  3W1J A;  2R32 A;  1JOC A;  1FOS E;  1TPL A;  1YJZ A;  2JJF A;  3BRT B;  3L72 E;  5AW1 B;  4Y28 J;  2Y0D A;  3K40 A;  1BCC E;  1YTZ I;  3CLQ A;  1C0N A;  5G4J A;  4CPG A;  3AEE C;  3P6K A;  1YJS A;  4M2K A;  3CC4 P;  4ZAH A;  1YIZ A;  2AY3 A;  2W7I A;  1X28 A;  2R44 A;  3VMY A;  2OKJ A;  2B9B A;  2JWD A;  3AEN A;  2BCC J;  2AY1 A;  2K3R A;  3FKD A;  1MFT A;  1M1J A;  2H89 C;  4TN4 A;  1SQB J;  1Z3Z A;  3GHG C;  3A0B E;  4A6U A;  2E76 C;  1IFJ A;  1M57 D;  3M06 A;  1TOK A;  1JMB A;  2Q7C A;  3U1C A;  4F5H A;  3JW9 A;  3E77 A;  3M0D C;  1M56 D;  1MAP A;  1OXZ A;  3M5U A;  3MUD A;  5AVX B;  4A0R A;  1SZK A;  1N2D C;  1E5E A;  4EOT A;  3RCH B;  3C1L A;  2OYH C;  5KAF E;  3RL0 D;  5H2F H;  2YO3 A;  3JSV C;  2O1B A;  2O3J A;  2P58 A;  2Q3E A;  4OC9 A;  3B4S A;  3G6E P;  4EDF A;  5APY A;  5DX5 A;  3UWC A;  4WYA A;  2J58 A;  3H1H D;  3AEJ A;  3H1I E;  4RIT A;  5KAF H;  5KLV J;  2W7K A;  1ASG A;  1M7Y A;  1DD3 A;  1Q82 Q;  2H43 A;  4I7Z C;  2ORD A;  3H1J G;  3M9Q A;  5AW3 B;  1VQ4 P;  2OAR A;  2VGT A;  1MV8 A;  3N4X A;  4EI2 A;  1NTZ J;  3AEP A;  5AVQ B;  2DR1 A;  1DH3 A;  3FGA D;  2EPJ A;  1IZN B;  3L74 E;  1S1C X;  3MAU A;  1EJI A;  1FE6 A;  4Y0H A;  3H25 A;  2VGV A;  4OYT A;  3PP5 A;  4HJG H;  3HLM A;  1MDX A;  4F5I A;  2GMS A;  3AE2 C;  5KJ7 A;  3H7F A;  3BB8 A;  1BE3 D;  1UU2 A;  4OWF A;  2W8Z A;  3WGC A;  4CBR A;  1WYV A;  1QGK B;  4LNL A;  1T6A A;  4RAE A;  5AVS B;  1S08 A;  4DBC A;  2CPB A;  4WD2 A;  1ZR2 A;  4TT3 H;  1H89 A;  1RE4 C;  1RH5 B;  1EDJ A;  3IF4 A;  1C9C A;  3DZZ A;  3H9X A;  3TAT A;  1FZC B;  3Q5S A;  1PL5 A;  2VGU A;  3QM2 A;  4D6T D;  4WB0 B;  3HE5 B;  3Q1M A;  1FZF A;  4ZM3 A;  1KOR A;  2B89 A;  5FT4 A;  4PJ0 E;  5KLI C;  2DW3 A;  1GK6 A;  1ZOB A;  4BHD A;  2K9J A;  2PB0 A;  4ASW A;  3KPE A;  3CQ4 A;  1GZL A;  1AHE A;  3BV0 A;  3RL0 C;  1AV1 A;  1W5C E;  4A00 A;  1WKH A;  3TNU B;  2X3L A;  3F6T A;  3PDB B;  4I8A A;  2HUF A;  1MZ9 A;  1EXJ A;  1D7R A;  1SP4 A;  1VQ7 P;  4RES B;  5AVR B;  1H0C A;  1YOO A;  1QJ3 A;  1L0N E;  1RF0 C;  1SQP D;  1JS3 A;  4NPF X;  1NKZ B;  1AJY A;  1N31 A;  1KIL D;  3L71 D;  2HLO A;  2KIK A;  2CK3 H;  2YXR B;  3HMU A;  3OP7 A;  3EI9 A;  3LVM A;  2XKM A;  1DGD A;  3AE5 C;  4GE9 A;  5AW5 B;  4H0L D;  2W8V A;  2E42 A;  2HP2 A;  4WXG A;  2AEM A;  5KLV G;  1OIP A;  4PD4 D;  2C0X A;  1IFI A;  1NTK D;  3GJU A;  3USF A;  1LTJ A;  2HR3 A;  3FWN A;  2HUI A;  1PIX A;  4ADD A;  1OWA A;  2M3E A;  2Y9Z A;  3HVY A;  1M0O A;  2PRR A;  1LWU C;  3A3Y B;  1H0T A;  3BN1 A;  3H1H J;  1L4A A;  1L0L K;  2BWP A;  1GL2 B;  2AY2 A;  1FJP A;  1IX7 A;  2GMU A;  4IXS A;  2AAT A;  1NU1 D;  2N1T B;  3FFH A;  2HG5 D;  1HGZ A;  1NJI Q;  5APT A;  1SFC B;  1URQ B;  3F89 A;  3CCJ P;  2V0Y A;  3V2P A;  1KAF A;  4C7R A;  1NHL A;  3MBB A;  3PAA A;  3PGY A;  2CY8 A;  3R9A A;  2OGU A;  5AVY B;  1DTY A;  2AY7 A;  3H1K E;  2A06 G;  4TMR A;  2AY5 A;  2WZ7 A;  1NTM G;  3H6P A;  3MD0 A;  1JNM A;  3BCB A;  2UWJ E;  2W7L A;  2NMP A;  5HDM A;  2Z9V A;  1SFF A;  3L44 A;  3LVL B;  3CL3 D;  1LNQ A;  2QE7 H;  1J2J B;  3S1K A;  4ZKU A;  1KIL C;  2P1J A;  4D6T J;  3HD7 A;  3EWK A;  4E3R A;  4IXO A;  3PHL A;  4Y0I A;  2YKY A;  4H0L C;  1GW3 A;  1BS0 A;  4RKD A;  4N78 E;  2EH6 A;  2WSS H;  1NTK K;  2YOB A;  3COG A;  1KZU B;  1PGP A;  1DKA A;  2IBZ G;  2AXT H;  1ZC9 A;  3F0H A;  5CJ0 A;  2QMA A;  4K2M A;  4U3F D;  2A45 I;  1S06 A;  4AO9 A;  1SQV D;  1IVR A;  3MC6 C;  1S3J A;  3P8M C;  3JZL A;  3AEC C;  3QH9 A;  1PPJ G;  2R3C A;  4PFF A;  3HRN A;  1IUG A;  4XFJ A;  1N7S B;  2QSI A;  1EG5 A;  1YIY A;  4LLH A;  2GB3 A;  3ELP A;  3QGU A;  4HKZ H;  5APW A;  1DIP A;  2AY9 A;  3DR7 A;  1Y9B A;  2VMW A;  1T3I A;  1P3W A;  1G7X A;  1NYH A;  3AEF C;  4DZO A;  3CC7 P;  3EI8 A;  3TFU A;  4CVQ A;  1W2E A;  4W7Y A;  2EYQ A;  1BCC J;  2RMZ A;  2WK8 A;  1N73 A;  2D64 A;  3HUS C;  2AY4 A;  2BCC E;  3RL0 g;  2AY8 A;  2CJD A;  2P10 A;  3DU4 A;  2Q6Q A;  1K73 Q;  1KMI Z;  3T97 A;  1NU1 J;  1FZG A;  1SQB E;  3JTX A;  5BU5 A;  2QIW A;  3RK2 B;  2M3B A;  1ARG A;  2E7I A;  3D71 A;  1RVU A;  2W8J A;  4HH2 A;  4WY4 D;  3B1C A;  4ITX A;  3I5T A;  3IFM A;  5CCG A;  3L70 J;  3VMZ A;  1YJY A;  4ZSY A;  1NAY A;  3BWN A;  2XND H;  1W2B O;  3JCU H;  2Z20 A;  3FX0 A;  1RQU A;  1QIR A;  3GET A;  1YQ3 C;  1N86 A;  3RBX A;  1W23 A;  2SPZ A;  1PGO A;  1YJN P;  4B86 A;  1PG8 A;  1GK4 A;  1IX6 A;  2QB3 A;  1EC5 A;  3E7K A;  2K9J B;  1IX8 A;  3NFQ A;  4OGQ B;  1O61 A;  5KLV E;  1UU1 A;  3I5C A;  1FJK A;  3PD6 A;  1LC7 A;  3Q2Y A;  1HJB A;  3OAK A;  1NTZ E;  2WK7 A;  2VLF A;  2KZJ A;  4UB6 E;  2K9Y A;  2H88 C;  2IDB A;  3VOM A;  2Z1Y A;  1SQX D;  4CBS A;  4MKJ A;  2W27 A;  1N2T A;  4MY5 A;  2EZ1 A;  3RK3 C;  4GKG A;  3MAF A;  3E2Y A;  3L73 J;  1VQ5 P;  4GOD A;  4W7Z A;  1FOS F;  1ART A;  1JY2 N;  1SQV J;  2CJG A;  2CB1 A;  4GE7 A;  1CQ6 A;  3M0A A;  3DXW A;  4AH3 A;  1BCC G;  1LP1 A;  2ZJS E;  4J5U A;  4EU1 A;  4FFC A;  1Q81 Q;  3NMD A;  2B88 A;  1W7N A;  1K8A Q;  4HF8 A;  4KXK A;  1H0T B;  1X0T A;  1L4A B;  3WLX A;  1R8E A;  1UU0 A;  2VMU A;  3N0L A;  1Q2N A;  5DJ1 A;  3VN0 A;  2J5U A;  2E7U A;  2AXC A;  3CME P;  1CW5 A;  1GEX A;  4FL0 A;  1LT1 A;  4A7P A;  5I92 A;  1ECX A;  3LWS A;  1M0Q A;  2OYI A;  1PP9 J;  3L70 G;  2IFM A;  1KL2 A;  1QL1 A;  2ITA A;  3CCQ P;  4PFN A;  4YXD C;  2KUB A;  3GLM A;  3LIE A;  3KE3 A;  3B5N C;  4WLJ A;  1A02 J;  1VQM P;  2VGW A;  4UHN A;  3AEM A;  1V2D A;  3VK3 A;  2C81 A;  4F4E A;  2CJH A;  1OW6 A;  1GL2 D;  2VRS A;  4PVF A;  5K5G B;  2WSF H;  3GZD C;  2N1T D;  2Z9X A;  3CQ6 A;  1SFC D;  1URQ D;  4O9B A;  2VLH A;  3TGU D;  3IR9 A;  1B5P A;  1DJU A;  1G1J A;  1PPJ E;  1FZC C;  1SQX K;  3FCR A;  2K1A A;  1QL2 A;  4XJM A;  5JAY A;  3LVJ A;  1UIX A;  1RF1 A;  3H1H E;  2FYZ A;  4ZM4 A;  1SVF A;  1GD2 E;  1DGE A;  4WXF A;  3EQ2 A;  2CH1 A;  1VPC A;  1GC2 A;  2W7G A;  2JGT A;  2QEX P;  5FT6 A;  2W83 C;  3LVK A;  2LXB A;  2BWN A;  3ZDM A;  2HOY A;  1AMR A;  1P84 D;  5F8V A;  1EZV D;  1BGY D;  1KTM A;  3S4R A;  5EAA A;  3OA7 A;  1JS6 A;  2GA1 A;  1V2F A;  4WYE A;  1KYO D;  3ABV C;  3SWF A;  4H63 Q;  4F5M A;  3DXV A;  2AEF A;  2W90 A;  2W7D A;  4TLF A;  2FYF A;  1FG3 A;  3TCM A;  1BE3 E;  3SFD C;  2B87 A;  1QJ5 A;  1BJN A;  3PDX A;  1T3J A;  5GTI E;  1TAR A;  1K9M Q;  3NXS A;  4LNJ A;  1WST A;  2BI1 A;  1KC8 Q;  2RKL A;  1ASA A;  2FKW B;  3MKJ A;  2RH0 A;  4BMK A;  2VMT A;  1VQ8 P;  3CX5 D;  3Q5R A;  4B98 A;  3AE7 C;  3CCM P;  2G8Y A;  2O01 J;  2WPR A;  1CI6 A;  1H88 A;  5AVT B;  4D6T E;  1N73 B;  3HT4 A;  1PP9 G;  2C9L Y;  3NRA A;  5GTI H;  4AO4 A;  2EO5 A;  4ZMD A;  1VQK P;  1ASD A;  1ZV8 A;  3T97 B;  3VK4 A;  4BRY A;  2FYU D;  1GL2 C;  3W67 A;  1I43 A;  1HVV A;  1AMQ A;  4L0O A;  5G0A A;  2ZSL A;  1N7S D;  4WYD A;  3FXE A;  1SFC C;  1URQ C;  2QLR A;  1KQF B;  3ASB A;  1V2E A;  1J1D B;  2R3S A;  2D7Z A;  1S4X A;  3BRV B;  5GTH E;  3HTK A;  3AE1 C;  4JF1 A;  3CC2 P;  1SQP E;  1ELQ A;  3BS8 A;  1BW0 A;  1AIB A;  1U08 A;  2WKA A;  3IAO A;  1XEY A;  2ZYA A;  3L4F A;  1ZME C;  1B9H A;  1J1E B;  2JG2 A;  1X29 A;  2KLV A;  5GTH H;  5M1B A;  2D2C C;  3FDD A;  3B1D A;  1ASB A;  5AW6 B;  3RK2 D;  4N0W A;  2NZ2 A;  1G4X A;  2ZYJ A;  3PD6 B;  2XV5 A;  2FXM A;  4C46 A;  1OVR A;  2OTL P;  4QGR A;  3GG2 A;  3NYT A;  1SQQ J;  3I55 P;  1BSH A;  4XJO A;  1LT9 A;  2KXP B;  4PD4 H;  3NUB A;  2DKJ A;  3WKS A;  1NU1 E;  1VF5 B;  3QN6 A;  1YHQ P;  4F5F A;  2FFD B;  3HDO A;  2W7J A;  3R4Y A;  1BJO A;  2G3A A;  1VQ6 P;  3MAF B;  1NH4 A;  3MUD C;  5BU8 B;  5H2F E;  1NTM D;  4OGQ D;  5CHX A;  3H1K G;  1BGY J;  3A9Z A;  1KQL A;  3PLN A;  2E74 D;  3DYD A;  5AW8 B;  4ZNC A;  1BT4 A;  1AQT A;  2M5A A;  3L70 E;  1JY2 P;  1OZH A;  2FYU K;  1GU4 A;  3CD6 P;  3EI7 A;  4ADC A;  1JCC A;  1YIJ P;  4LNM A;  1NO4 A;  1N7S C;  4IL6 X;  1G2C A;  2KSJ A;  1RHZ B;  2Z61 A;  3A9Y A;  2HOD B;  1TOE A;  5AW9 B;  1M0P A;  3ZZK A;  3A7O A;  3E9K A;  3AV7 A;  3N75 A;  4B9B A;  1KB9 I;  2DGL A;  1AHX A;  5DB5 A;  1IFP A;  3LW5 J;  3PH0 A;  3MTU E;  1SZS A;  3FZ6 A;  3R4T A;  3FRK A;  1AIA A;  3WU2 E;  1YJW P;  2OYI B;  3VOP A;  3GHG A;  1KQG B;  4WY4 B;  5J8Q A;  3WZF A;  3RI6 A;  2QM7 A;  2YO2 A;  1AAM A;  3TFT A;  1KKJ A;  5B5E H;  5CMZ A;  2O1J A;  2KK7 A;  3P8C D;  1GDT A;  1L4A D;  1FDO A;  4KYO A;  3RK2 C;  1LTT C;  1ASC A;  1GEY A;  3WU2 H;  1USD A;  5D5S A;  3CWB D;  3MAD A;  3L73 E;  1KD1 Q;  2PB2 A;  4DQ6 A;  2Y9Y A;  1SQV E;  1M32 A;  5E79 H;  4MQQ A;  3II6 A;  2FXO A;  2OYO A;  1L0L D;  1SZU A;  1ARI A;  3FDB A;  2KNC B;  4JYB A;  2W7F A;  3GSB A;  4HYT B;  1KQS O;  1TOI A;  1RF1 B;  3QPG A;  1NTM K;  4I1L A;  4OGQ C;  3RK3 E;  1AX4 A;  2JJE A;  1JY3 O;  5AVV B;  2BCC G;  2CFB A;  3CCE P;  1X22 A;  1AIC A;  4LW4 A;  3UAK A;  1SQB G;  2F8J A;  4Q6R A;  3B46 A;  1J32 A;  3W1H A;  1YBK A;  2BEQ D;  1PP9 E;  1S2E A;  3AE4 C;  2E7J A;  2NPS A;  3QI6 A;  4YXW H;  2YIU B;  1OXO A;  4GSA A;  1HWT C;  3EZS A;  2WSF J;  3G71 P;  2B87 B;  1LS3 A;  5EUD A;  5DJT B;  4GE4 A;  2YHK A;  3KKI A;  4K2B A;  3DC1 A;  4ZDO A;  5E3K A;  1RE4 A;  1VQN P;  4ZAS A;  2W8U A;  2Z9U A;  1IK7 A;  2W6J H;  3PJS K;  1NAF A;  2YRI A;  4P7Y A;  2ZY5 A;  1H8A A;  2VIB A;  2MJZ A;  4ADB A;  5KKZ B;  1L4A C;  1D7V A;  4PV1 B;  3TQX A;  2QJP B;  3BCX A;  4BRY B;  1E5F A;  2BKW A;  1VJO A;  1NTZ G;  4RJ0 A;  3TSI A;  2X5F A;  1YJ9 P;  4MQP A;  4Q76 A;  1IK9 A;  1FZB A;  1AJS A;  1PZQ A;  4WYC A;  3CI9 A;  2X8U A;  2PFX A;  3MZW B;  2LXC B;  3EFF K;  1RF0 A;  3TF5 A;  1HH0 A;  1D2F A;  2DGK A;  3ELE A;  4OT8 A;  1PMM A;  1IO4 A;  5G2P A;  3H1L D;  2BYL A;  4CXQ A;  1C4K A;  3FWL A;  1T8Z A;  5G2Q A;  3ZRP A;  3L72 D;  2BI9 A;  2Q9I A;  1CZC A;  1RV4 A;  1LC8 A;  1IFD A;  3L75 D;  4AUW A;  3WUV A;  2AEJ A;  1KFN A;  3VP8 A;  3BCC D;  4JEX A;  1HJ0 A;  3G4S P;  1NKN A;  2QA3 A;  4KAM A;  1BE3 J;  4Y0D A;  2KFP A;  3SFE C;  1O4S A;  4WBA A;  1Z56 A;  1M4N A;  2EZ2 A;  1QGN A;  3A8U X;  5CCG D;  5FT5 A;  1FDI A;  4U1T A;  1OXP A;  3KGW A;  1CJ0 A;  1UKJ A;  4DGT A;  4M3L A;  3I16 A;  2CST A;  2VIA A;  2DKB A;  2JDI H;  5CCH A;  5EUE A;  4EB7 A;  1GEW A;  3NTJ A;  3KQG A;  1LTB C;  2KS1 A;  3AEN B;  4UQV A;  2AXT E;  1USE A;  1BJO B;  1LGH B;  2O01 H;  1IBJ A;  2WPV B;  3G3Z A;  1M1J B;  4RJY A;  4LC3 A;  1FAV A;  2YKX A;  4W8I A;  4I6M C;  1I29 A;  4OH8 B;  1OHY A;  5E4Z A;  3AAT A;  4A6R A;  1ZRT E;  2IFN A;  1X2A A;  5DJU B;  1VQL P;  2ZVO B;  1Y4I A;  4L73 A;  1G2C B;  1N7L A;  1SQP J;  3H1I D;  2V1P A;  5BJ4 A;  3V2Q A;  2IZ0 A;  3L71 J;  3GW6 A;  1VF5 D;  2MKV A;  3I56 P;  1LK9 A;  1PGQ A;  2E75 D;  4KJM A;  1JB0 J;  5AW2 B;  3H1H G;  2JO1 A;  3OW2 O;  2W6A A;  3L74 D;  2Q7W A;  2D7Y A;  4W1V A;  1X9V A;  1AQ5 A;  5G4I A;  1NTK J;  1EDI A;  5CBN A;  2AY6 A;  1SQQ E;  1GC4 A;  1PFF A;  1N8R Q;  2PO3 A;  1PV3 A;  1CQ7 A;  4YPC A;  4NPE A;  4AYC A;  3JC2 2;  1D7S A;  4CXR A;  4ISY A;  4ADE A;  2E5T A;  2IYO A;  2K88 A;  3G8M A;  3IN6 A;  1PGJ A;  1JY3 N;  2VMQ A;  1BGY E;  5CCG C;  2VMZ A;  4OCA A;  1BE3 G;  1AVO A;  1OVU A;  3JCU E;  1Z7D A;  2KYV A;  4IYO A;  1KFM A;  2ZUK A;  2C0W A;  2D5Y A;  1FC4 A;  1B9I A;  3L75 J;  1WYV B;  1LTS C;  1S9K D;  5EAV A;  1NVO A;  4XE5 B;  2GSA A;  3EI5 A;  3BCC J;  1P84 H;  5CJ4 A;  4RJT A;  3E6G A;  3OJA B;  4D6T G;  3CX5 E;  1KYO H;  5EIG A;  3HUS A;  2XDJ A;  2KLU A;  3WKR A;  1L0N D;  1G7W A;  4P3M A;  1FU1 A;  4H44 B;  1GTW A;  1FG7 A;  5KAI E;  3FTB A;  2JP3 A;  5FT8 A;  1LTG C;  2E74 B;  1FC2 C;  2AEV A;  3KXD A;  2RN0 A;  2NPS B;  1BQD A;  1VF5 C;  1Q7Y Q;  2FFD C;  3CX5 H;  4BA5 A;  3T32 A;  4IFD K;  4GOE A;  1SQP G;  3LW5 H;  4K35 A;  3L71 G;  3FVX A;  1W7M A;  3NU8 A;  5KAI H;  1AKB A;  2EGY A;  1FS0 E;  1TAT A;  1IFN A;  4L76 A;  2KB7 P;  2IZ1 A;  1RY3 A;  4U3F J;  1NTK G;  2KSE A;  2FNU A;  1VDF A;  1U7J A;  1LTJ B;  3AEO A;  2OKK A;  3MGN A;  1DD4 A;  4NPD A;  1J04 A;  4DJG A;  2WSE H;  2R5C A;  4K3A A;  4Q75 A;  1C7N A;  1DJE A;  4OVN F;  3W1I A;  3PA9 A;  2YCP A;  1NU1 G;  1ASL A;  9AAT A;  2ZFC A;  2OYI C;  1AHF A;  1QX8 A;  4WY4 C;  5L8R J;  3VAX A;  2ZT9 B;  1ZLL A;  1K04 A;  2XU6 A;  4KHX A;  1WYT A;  5KTB A;  1JEK A;  4PV1 D;  3AEM C;  1D7M A;  1LTI C;  2WMM A;  4ZSW A;  4JQ0 D;  4IOI H;  4EIJ A;  1MKM A;  4A6T A;  2GQN A;  1OAT A;  1L2P A;  4ATQ A;  1L0N K;  3AEB C;  1YIT P;  3F5H A;  1NOH A;  1HGV A;  1GD9 A;  3EI6 A;  1HTL C;  2V4H A;  2BIA A;  1QIS A;  3K7Y A;  1JTH A;  3O6Q A;  3OKS A;  3VK2 A;  3DR4 A;  3P32 A;  3P7K A;  3D6Z A;  2H7H A;  1BSN A;  4OTL A;  1AY5 A;  1RF1 C;  4WBT A;  3B1E A;  3PIU A;  2HFE D;  2D65 A;  2VI8 A;  1S5L X;  3FZ8 A;  2W7M A;  5M46 A;  4MSO A;  2YMY A;  3CX5 I;  3HD7 B;  3H1J D;  2PP6 A;  2YKV A;  1N8P A;  3EZ1 A;  3Q8N A;  4JEW A;  4OMA A;  4F5K A; 
#chains in the Genus database with same CATH homology
 3FQ7 A;  1M6S A;  5BVZ A;  3B5N A;  4WB4 A;  3N7N A;  3U1A A;  5EQC A;  1AMA A;  1BJW A;  2HOR A;  3R2P A;  3FVS A;  2JEE A;  3KDP B;  3GZD A;  3PPL A;  1LW4 A;  3BVH A;  2VMY A;  2YRR A;  1DEB A;  2VMS A;  4A0G A;  1WYU A;  3ZRQ A;  3MIW A;  4IW7 A;  1FZC A;  2BI2 A;  1SF2 A;  1RVY A;  3L35 A;  3UE8 A;  1AKC A;  3C9I A;  2HOZ A;  3KYQ A;  4WP0 A;  3LID A;  4A0H A;  1KKP A;  1WRG A;  3TNU A;  2RFV A;  1I41 A;  3PDB A;  1AJR A;  1EQB A;  3MEB A;  3DRD A;  5G09 A;  1MAQ A;  3M9H A;  2YKO A;  1RE3 C;  1A02 F;  2IPP A;  3ZRR A;  4E77 A;  2A1V A;  2N1T C;  5D95 A;  2WT7 A;  3GR9 A;  1D7U A;  2LKM A;  1JG8 A;  5AVW B;  3N5M A;  1CL1 A;  4MKK A;  4A0F A;  3VP9 A;  4I2L C;  2XZR A;  2VI9 A;  3NX3 A;  2P7J A;  1H1C A;  3FQA A;  3SWY A;  2L5G B;  2HPC A;  3HUS B;  3WCN A;  2XH1 A;  5APU A;  1C7O A;  1IC2 A;  2R0T A;  1G4V A;  5KJ7 D;  5C6U A;  1X79 B;  3A5T A;  1URQ A;  2C0R A;  1LC5 A;  4K05 A;  1S0A A;  3RBF A;  2D66 A;  1GBN A;  1ZN5 A;  3E2Z A;  1IFM A;  4GEB A;  3RUY A;  1M1J C;  1SQB K;  3HQT A;  2D63 A;  1FZE A;  1M7L A;  3M91 A;  3NYU A;  2E43 A;  2D61 A;  2BYJ A;  4RIZ A;  2QB2 A;  2BHX A;  2NPS D;  1AY8 A;  2R5D A;  3DOD A;  1WT6 A;  2R5C B;  4WYF A;  3LY1 A;  4WYG A;  1PMO A;  4LC1 A;  1KMK A;  1CQ8 A;  1ZOD A;  3AEJ C;  1T2K D;  5M49 A;  1DFO A;  1ORD A;  2G7J A;  2GUV A;  1JCD A;  3BWO A;  2ZC0 A;  5KLV K;  1ASF A;  3RK3 B;  1WYT B;  3V2R A;  1MGV A;  1FZA A;  3VMX A;  2W6B A;  1B4X A;  1NTZ K;  3TYY A;  1DX7 A;  3P1T A;  5E5I A;  1C7G A;  4UHM A;  2Z5H A;  3B8E B;  1TOJ A;  1AHY A;  2JJG A;  2ZSM A;  3M0D A;  1BJ4 A;  1GW4 A;  2BIE A;  3NYS A;  3PJ0 A;  3WY7 A;  4ZKP A;  5KJ7 C;  1SPA A;  1X0M A;  3QBO A;  1N7S A;  2XNX A;  1AAW A;  4GIF A;  3AOW A;  1JTH B;  3FSL A;  2R2N A;  5AW4 B;  2OYH A;  1CZE A;  4XJL A;  4JEZ A;  3ISL A;  5M4D A;  3JWB A;  2VYC A;  4BQ0 A;  2P2U A;  4JF7 A;  1ARS A;  1GDE A;  3ASA A;  3VYI A;  2YKU A;  2POH A;  1YYC A;  1W3U A;  2PAJ A;  4GDY A;  1CS1 A;  1GCK A;  3GWP A;  2VMX A;  4EB5 A;  2WB6 A;  2E54 A;  3B5N B;  2Q3I A;  2NPS C;  1HBW A;  1DJ9 A;  4OBU A;  2HUU A;  4IX8 A;  4ZDP A;  2OQX A;  4Y99 B;  2W7E A;  3EUC A;  3N4S A;  5CCH D;  4LGD E;  3HD7 D;  1T2K C;  1WYU B;  1B8G A;  5IWQ A;  4ATP A;  2FNI A;  2CAN A;  1HUC A;  8AAT A;  2ZY3 A;  2J59 M;  1MLY A;  1FDM A;  3CAI A;  1S9K E;  1TAS A;  2ZXE B;  3A2B A;  3NTN A;  1LTJ C;  1YAA A;  2VMR A;  5BJ3 A;  3M9B A;  1CI6 B;  3CBF A;  1KMJ A;  2IX7 C;  2KOG A;  1VP4 A;  1W7L A;  1OHV A;  1MDZ A;  3HE4 A;  3WMM 0;  4EMY A;  1AMS A;  2WT7 B;  1CZQ A;  3FZ7 A;  2O7C A;  3WCO A;  3A9X A;  1ELU A;  3HTK B;  2A45 H;  4W91 A;  2BIG A;  3NUI A;  4JEY A;  2WSC H;  3ZZJ A;  4BA4 A;  3F9T A;  3BC8 A;  2HPC B;  3EIB A;  4OBV A;  4RKC A;  2ZJG A;  4R8D A;  1JY2 O;  2HZP A;  4R2N A;  5CCH C;  1LWU A;  2GM4 A;  2YCN A;  4WLH A;  1XTG B;  3HD7 C;  1I48 A;  2CTZ A;  2H8P D;  3H32 A;  1BQA A;  3E2Z B;  1O69 A;  4PIW A;  2CIN A;  1LT9 B;  4MQR A;  5APV A;  1QIT A;  3B8X A;  3RQ1 A;  1MFZ A;  3L8A A;  3G0T A;  1VEF A;  4K2I A;  2BI3 A;  2OAT A;  1AKA A;  1SQP K;  1YTZ T;  3II0 A;  4JF0 A;  5DJ9 A;  2VMO A;  2O1K A;  5K8B A;  2YCT A;  2P67 A;  4W1X A;  2VGS A;  4IFM A;  3BAS A;  2QSR A;  2FKI A;  3ACZ A;  4NOG A;  1ARH A;  4H51 A;  5APQ A;  1KIL A;  3UIA A;  3E1I A;  2YNY A;  1JMM A;  1O62 A;  2W7H A;  1NWQ A;  2QM8 A;  2OGE A;  2TPL A;  1N73 C;  2JJH A;  4GT1 A;  2VMP A;  3GHG B;  1WKG A;  1LTA C;  3ECD A;  2FQ6 A;  1B5O A;  1IAY A;  2FN6 A;  5HHY A;  1NU1 K;  1ZR4 A;  1FBM A;  4XA4 A;  1GC0 A;  2Z4E A;  1GC3 A;  4Q31 A;  2N9B A;  1J1D C;  2OYH B;  5HXX A;  2QBT A;  1JUN A;  4XK1 A;  1SVV A;  4F5G A;  3MC6 A;  4DOJ A;  2CPS A;  3RK3 D;  1IJI A;  3NDN A;  4F5L A;  2ZY2 A;  3BWN C;  3HL2 A;  4RLG A;  3V5B A;  1S07 A;  1J1E C;  3N4R A;  1IJD B;  1AHG A;  4ZWV A;  2C7T A;  4U2H A;  5AVZ B;  2G6W A;  2W8W A;  1SLQ A;  4M2M A;  3EFG A;  3G7Q A;  3FQ8 A;  4JEV A;  2BAS A;  4M2J A;  3NU7 A;  4AOA A;  2Q5U A;  2O0R A;  4UHO A;  4C7N A;  2HYN A;  1E5W A;  2HP1 A;  2VGZ A;  1G1I A;  1OHW A;  3L37 A;  3IHJ A;  4XQ2 A;  1MDO A;  2VMV A;  1QZ9 A;  4ITG A;  3B5N D;  4W1W A;  4R5Z A;  3AEL A;  1YNU A;  3I4J A;  1V72 A;  1EQ7 A;  4O6Z A;  1SQV K;  2VMN A;  3KGX A;  3RBL A;  3HE4 B;  3BAT A;  3RL0 B;  4AZJ A;  1CSB A;  3FFR A;  4F5J A;  2FFD A;  1AJS B;  3CQ5 A;  3LV2 A;  5AW0 B;  1LW5 A;  2FM1 A;  3VTP C;  3D6K A;  2XBN A;  4E1O A;  3V4Q A;  5APS A;  3LG0 A;  4AZK A;  1GU5 A;  1S09 A;  2WPS A;  7AAT A;  2I1J A;  4ZDL A;  4R5F A;  2KP8 A;  2ZP7 A;  5EFS A;  2WK9 A;  5EUN A;  4ZLV A;  4J8L A;  3RCH A;  2HOD A;  4WXB A;  1TOG A;  4IFF A;  4ZWM A;  1ASE A;  4XAU A;  2Z1Z A;  2R5B A;  3L36 A;  4AQR D;  3ATH A;  1LWU B;  1IAX A;  4JYC A;  3EIA A;  2Z9W A;  4W80 A;  3H32 B;  4WY4 A;  1XTC C;  4N78 D;  2WTY A;  2C44 A;  4LW2 A;  2I1K A;  1ASN A;  3FD0 A;  3FVU A;  4HVK A;  4GRX A;  2Z5I A;  4Y99 C;  5AX8 A;  2ZY4 A;  3A2A A;  1KL1 A;  2BWO A;  2YKQ A;  3P8C E;  1JO5 A;  1MLZ A;  2GUS A;  4RM1 A;  4E3Q A;  2JIS A;  4UOY A;  1CL2 A;  2HOX A;  3V4W A;  3WGB A;  3QHX A;  3WX9 A;  2OGA A;  3U59 A;  5AW7 B;  1KIL B;  2DGM A;  3AOV A;  4WB0 A;  3HE5 A;  2JJL A;  3NNK A;  3GZC A;  2W8T A;  2WIT A;  1ASM A;  5TF5 A;  2R5E A;  1X8Y A;  4IXZ A;  3GBX A;  2WWW A;  1T3U A;  3BCA A;  5APX A;  3E2F A;  2WPQ A;  5F9S A;  2AEU A;  4EFF A;  1JY3 P;  4XEW A;  4IYO B;  2CH2 A;  1AFO A;  3VP6 A;  2YKP A;  3JWA A;  1MUU A;  1M0N A;  2X5D A;  1AY4 A;  2BI5 A;  3O8Z A;  2A45 G;  1JF9 A;  5EIG B;  4IY7 A;  4W5K A;  2DOU A;  1RE3 A;  4C7N B;  1GL2 A;  1BKG A;  2N1T A;  1LT9 C;  4A72 A;  1SFC A;  1SQQ K;  3K28 A;  4XJP A;  5M4B A;  5AVU B;  1LKC A;  2M8R A;  1XI9 A;  3HBX A;  3TK1 A;  4N6J A;  1RV3 A;  4N3Y B;  2C9N Y;  3V2N A;  1PFI A;  3W1J A;  2R32 A;  1JOC A;  1FOS E;  1TPL A;  1YJZ A;  2JJF A;  3BRT B;  5AW1 B;  3K40 A;  1YTZ I;  3CLQ A;  1C0N A;  5G4J A;  3P6K A;  4M2K A;  1YJS A;  4ZAH A;  1YIZ A;  2AY3 A;  2W7I A;  1X28 A;  3VMY A;  2OKJ A;  3AEN A;  2AY1 A;  3FKD A;  1M1J A;  4TN4 A;  1Z3Z A;  3GHG C;  4A6U A;  1IFJ A;  3M06 A;  1TOK A;  2Q7C A;  3U1C A;  4F5H A;  3JW9 A;  3E77 A;  3M0D C;  1MAP A;  1OXZ A;  3M5U A;  3MUD A;  5AVX B;  4A0R A;  1SZK A;  1N2D C;  1E5E A;  4EOT A;  3RCH B;  2OYH C;  3RL0 D;  2YO3 A;  2O1B A;  4OC9 A;  5APY A;  5DX5 A;  3UWC A;  4WYA A;  2J58 A;  3AEJ A;  4RIT A;  2W7K A;  1ASG A;  1M7Y A;  2H43 A;  2ORD A;  3M9Q A;  5AW3 B;  2OAR A;  2VGT A;  1MV8 A;  3N4X A;  3AEP A;  5AVQ B;  2DR1 A;  1DH3 A;  2EPJ A;  3MAU A;  1EJI A;  4Y0H A;  2VGV A;  4OYT A;  3PP5 A;  3HLM A;  1MDX A;  4F5I A;  2GMS A;  5KJ7 A;  3H7F A;  3BB8 A;  1UU2 A;  3WGC A;  4CBR A;  1WYV A;  4LNL A;  4RAE A;  5AVS B;  1S08 A;  4DBC A;  2CPB A;  4WD2 A;  1ZR2 A;  1H89 A;  1RE4 C;  1C9C A;  3H9X A;  3DZZ A;  3TAT A;  1FZC B;  2VGU A;  3QM2 A;  4WB0 B;  3HE5 B;  1FZF A;  4ZM3 A;  5FT4 A;  1GK6 A;  1ZOB A;  4BHD A;  2PB0 A;  3KPE A;  3CQ4 A;  1GZL A;  1AHE A;  3BV0 A;  3RL0 C;  4A00 A;  1WKH A;  3TNU B;  2X3L A;  3F6T A;  3PDB B;  4I8A A;  2HUF A;  1MZ9 A;  1D7R A;  1SP4 A;  4RES B;  5AVR B;  1H0C A;  1YOO A;  1QJ3 A;  1RF0 C;  1JS3 A;  1NKZ B;  1N31 A;  1KIL D;  2HLO A;  3HMU A;  3OP7 A;  3EI9 A;  3LVM A;  2XKM A;  1DGD A;  4GE9 A;  5AW5 B;  2W8V A;  2E42 A;  2HP2 A;  4WXG A;  2C0X A;  1IFI A;  3GJU A;  3USF A;  1LTJ A;  2HUI A;  4ADD A;  1OWA A;  3HVY A;  1M0O A;  3BN1 A;  1LWU C;  3A3Y B;  1L4A A;  1L0L K;  2BWP A;  1GL2 B;  2AY2 A;  1FJP A;  1IX7 A;  2GMU A;  4IXS A;  2AAT A;  2N1T B;  3FFH A;  2HG5 D;  1HGZ A;  5APT A;  1SFC B;  1URQ B;  2V0Y A;  3V2P A;  4C7R A;  1NHL A;  3MBB A;  3PAA A;  3PGY A;  2CY8 A;  3R9A A;  5AVY B;  1DTY A;  2AY7 A;  4TMR A;  2AY5 A;  2WZ7 A;  3MD0 A;  3H6P A;  1JNM A;  3BCB A;  2W7L A;  2NMP A;  5HDM A;  2Z9V A;  1SFF A;  3L44 A;  3LVL B;  3CL3 D;  1J2J B;  4ZKU A;  1KIL C;  2P1J A;  3HD7 A;  4E3R A;  4IXO A;  4Y0I A;  2YKY A;  1GW3 A;  1BS0 A;  4RKD A;  4N78 E;  2EH6 A;  1NTK K;  2YOB A;  3COG A;  1KZU B;  1DKA A;  1ZC9 A;  3F0H A;  5CJ0 A;  2QMA A;  4K2M A;  2A45 I;  1S06 A;  4AO9 A;  1IVR A;  3MC6 C;  3P8M C;  3JZL A;  2R3C A;  4PFF A;  3HRN A;  1IUG A;  1N7S B;  1YIY A;  1EG5 A;  2GB3 A;  4LLH A;  3ELP A;  3QGU A;  5APW A;  2AY9 A;  3DR7 A;  2VMW A;  1T3I A;  1P3W A;  1G7X A;  4DZO A;  3EI8 A;  3TFU A;  4CVQ A;  1W2E A;  4W7Y A;  2EYQ A;  2WK8 A;  1N73 A;  2D64 A;  3HUS C;  2AY4 A;  2AY8 A;  2CJD A;  3DU4 A;  3T97 A;  1FZG A;  3JTX A;  5BU5 A;  3RK2 B;  2M3B A;  1ARG A;  2E7I A;  1RVU A;  2W8J A;  4HH2 A;  4WY4 D;  3B1C A;  4ITX A;  3I5T A;  3IFM A;  5CCG A;  3VMZ A;  1YJY A;  4ZSY A;  3BWN A;  2Z20 A;  1QIR A;  3GET A;  1N86 A;  1W23 A;  4B86 A;  1PG8 A;  1GK4 A;  1IX6 A;  2QB3 A;  1IX8 A;  3NFQ A;  1O61 A;  1UU1 A;  3I5C A;  1FJK A;  3PD6 A;  1LC7 A;  1HJB A;  3OAK A;  2WK7 A;  2VLF A;  3VOM A;  2Z1Y A;  4CBS A;  4MKJ A;  2W27 A;  1N2T A;  4MY5 A;  2EZ1 A;  3RK3 C;  4GKG A;  3MAF A;  3E2Y A;  4W7Z A;  1FOS F;  1ART A;  1JY2 N;  2CJG A;  2CB1 A;  4GE7 A;  1CQ6 A;  3M0A A;  3DXW A;  4AH3 A;  4J5U A;  4EU1 A;  4FFC A;  3NMD A;  1W7N A;  4HF8 A;  4KXK A;  1L4A B;  3WLX A;  1UU0 A;  2VMU A;  3N0L A;  5DJ1 A;  3VN0 A;  2E7U A;  1CW5 A;  1GEX A;  4FL0 A;  5I92 A;  1ECX A;  3LWS A;  1M0Q A;  2OYI A;  2IFM A;  1KL2 A;  1QL1 A;  4PFN A;  3LIE A;  3KE3 A;  3B5N C;  4WLJ A;  1A02 J;  2VGW A;  4UHN A;  3AEM A;  1V2D A;  3VK3 A;  2C81 A;  4F4E A;  2CJH A;  1GL2 D;  2VRS A;  4PVF A;  2WSF H;  3GZD C;  2N1T D;  2Z9X A;  3CQ6 A;  1SFC D;  1URQ D;  4O9B A;  2VLH A;  3IR9 A;  1B5P A;  1DJU A;  1G1J A;  1FZC C;  1SQX K;  3FCR A;  1QL2 A;  4XJM A;  5JAY A;  3LVJ A;  1RF1 A;  2FYZ A;  4ZM4 A;  1SVF A;  1GD2 E;  1DGE A;  4WXF A;  3EQ2 A;  2CH1 A;  1VPC A;  1GC2 A;  2W7G A;  2JGT A;  5FT6 A;  3LVK A;  2BWN A;  2HOY A;  1AMR A;  5F8V A;  5EAA A;  3OA7 A;  1JS6 A;  1V2F A;  4WYE A;  3SWF A;  4H63 Q;  4F5M A;  3DXV A;  2W7D A;  2FYF A;  1FG3 A;  3TCM A;  1QJ5 A;  1BJN A;  3PDX A;  1T3J A;  1TAR A;  3NXS A;  4LNJ A;  1WST A;  2BI1 A;  1ASA A;  2FKW B;  3MKJ A;  4BMK A;  2VMT A;  4B98 A;  2WPR A;  1CI6 A;  1H88 A;  5AVT B;  1N73 B;  3HT4 A;  2C9L Y;  3NRA A;  4AO4 A;  2EO5 A;  1ASD A;  1ZV8 A;  3VK4 A;  1I43 A;  1GL2 C;  1HVV A;  1AMQ A;  4L0O A;  5G0A A;  2ZSL A;  1N7S D;  4WYD A;  1SFC C;  1URQ C;  2QLR A;  3ASB A;  1V2E A;  1J1D B;  2D7Z A;  3BRV B;  3HTK A;  4JF1 A;  1ELQ A;  3BS8 A;  1BW0 A;  1AIB A;  1U08 A;  2WKA A;  1XEY A;  3L4F A;  1B9H A;  1J1E B;  2JG2 A;  1X29 A;  2KLV A;  3FDD A;  3B1D A;  1ASB A;  5AW6 B;  3RK2 D;  4N0W A;  1G4X A;  2ZYJ A;  3PD6 B;  2XV5 A;  2FXM A;  4C46 A;  4QGR A;  3NYT A;  4XJO A;  1LT9 A;  3NUB A;  2DKJ A;  3WKS A;  3QN6 A;  4F5F A;  2FFD B;  3HDO A;  2W7J A;  1BJO A;  3MAF B;  1NH4 A;  5BU8 B;  5CHX A;  3A9Z A;  1KQL A;  3DYD A;  5AW8 B;  1BT4 A;  1JY2 P;  2FYU K;  1GU4 A;  3EI7 A;  4ADC A;  1JCC A;  4LNM A;  1NO4 A;  1N7S C;  1G2C A;  2KSJ A;  2Z61 A;  3A9Y A;  2HOD B;  1TOE A;  5AW9 B;  1M0P A;  3ZZK A;  3A7O A;  3E9K A;  3AV7 A;  3N75 A;  4B9B A;  2DGL A;  1AHX A;  5DB5 A;  3MTU E;  1SZS A;  3FZ6 A;  3R4T A;  3FRK A;  1AIA A;  2OYI B;  3VOP A;  3GHG A;  4WY4 B;  5J8Q A;  3WZF A;  3RI6 A;  2QM7 A;  2YO2 A;  1AAM A;  3TFT A;  1KKJ A;  5CMZ A;  2O1J A;  3P8C D;  1GDT A;  1L4A D;  4KYO A;  3RK2 C;  1LTT C;  1ASC A;  1GEY A;  5D5S A;  3MAD A;  2PB2 A;  4DQ6 A;  1M32 A;  4MQQ A;  3II6 A;  1SZU A;  1ARI A;  3FDB A;  4JYB A;  2W7F A;  3GSB A;  4HYT B;  1TOI A;  1RF1 B;  3QPG A;  1NTM K;  4I1L A;  1AX4 A;  2JJE A;  1JY3 O;  5AVV B;  2CFB A;  1AIC A;  4LW4 A;  3UAK A;  2F8J A;  4Q6R A;  3B46 A;  1J32 A;  3W1H A;  2E7J A;  2NPS A;  3QI6 A;  1OXO A;  4GSA A;  1HWT C;  3EZS A;  1LS3 A;  5EUD A;  4GE4 A;  2YHK A;  3KKI A;  4K2B A;  3DC1 A;  4ZDO A;  5E3K A;  1RE4 A;  4ZAS A;  2W8U A;  2Z9U A;  1NAF A;  2YRI A;  4P7Y A;  2ZY5 A;  1H8A A;  2VIB A;  2MJZ A;  4ADB A;  1L4A C;  1D7V A;  3TQX A;  3BCX A;  1E5F A;  2BKW A;  1VJO A;  4RJ0 A;  3TSI A;  2X5F A;  4MQP A;  4Q76 A;  1IK9 A;  1FZB A;  1AJS A;  4WYC A;  3CI9 A;  2X8U A;  1RF0 A;  1HH0 A;  1D2F A;  2DGK A;  3ELE A;  4OT8 A;  1PMM A;  1IO4 A;  5G2P A;  2BYL A;  4CXQ A;  1C4K A;  1T8Z A;  5G2Q A;  3ZRP A;  2BI9 A;  2Q9I A;  1CZC A;  1RV4 A;  1LC8 A;  1IFD A;  4AUW A;  1KFN A;  3VP8 A;  4JEX A;  1NKN A;  2QA3 A;  4KAM A;  4Y0D A;  2KFP A;  1O4S A;  4WBA A;  1Z56 A;  1M4N A;  2EZ2 A;  1QGN A;  3A8U X;  5CCG D;  5FT5 A;  4U1T A;  1OXP A;  3KGW A;  1CJ0 A;  1UKJ A;  4DGT A;  4M3L A;  3I16 A;  2CST A;  2VIA A;  2DKB A;  5CCH A;  5EUE A;  4EB7 A;  1GEW A;  3NTJ A;  3KQG A;  1LTB C;  3AEN B;  4UQV A;  1BJO B;  1LGH B;  2O01 H;  1IBJ A;  3G3Z A;  1M1J B;  4RJY A;  4LC3 A;  1FAV A;  2YKX A;  4W8I A;  4I6M C;  1I29 A;  4OH8 B;  1OHY A;  5E4Z A;  3AAT A;  4A6R A;  2IFN A;  1X2A A;  1Y4I A;  1G2C B;  1N7L A;  2V1P A;  5BJ4 A;  3V2Q A;  1LK9 A;  5AW2 B;  2W6A A;  2Q7W A;  2D7Y A;  4W1V A;  1X9V A;  1AQ5 A;  5G4I A;  2AY6 A;  1GC4 A;  1PFF A;  2PO3 A;  1CQ7 A;  1D7S A;  4AYC A;  4CXR A;  4ISY A;  4ADE A;  3G8M A;  1JY3 N;  2VMQ A;  5CCG C;  2VMZ A;  4OCA A;  1Z7D A;  2KYV A;  4IYO A;  1KFM A;  2ZUK A;  2C0W A;  2D5Y A;  1FC4 A;  1B9I A;  1WYV B;  1LTS C;  1S9K D;  5EAV A;  4XE5 B;  2GSA A;  3EI5 A;  5CJ4 A;  3E6G A;  3OJA B;  5EIG A;  3HUS A;  2XDJ A;  3WKR A;  1G7W A;  4P3M A;  1FU1 A;  1GTW A;  1FG7 A;  3FTB A;  5FT8 A;  1LTG C;  2AEV A;  1BQD A;  2NPS B;  2FFD C;  4BA5 A;  3T32 A;  4IFD K;  3LW5 H;  3FVX A;  1W7M A;  3NU8 A;  1AKB A;  2EGY A;  1TAT A;  1IFN A;  2KB7 P;  1RY3 A;  2FNU A;  1VDF A;  1LTJ B;  3AEO A;  2OKK A;  3MGN A;  1J04 A;  2WSE H;  2R5C A;  4Q75 A;  1C7N A;  1DJE A;  3W1I A;  3PA9 A;  2YCP A;  1ASL A;  9AAT A;  2ZFC A;  2OYI C;  1AHF A;  4WY4 C;  3VAX A;  1ZLL A;  2XU6 A;  4KHX A;  1WYT A;  5KTB A;  3AEM C;  1LTI C;  4ZSW A;  4EIJ A;  4A6T A;  2GQN A;  1OAT A;  4ATQ A;  1L0N K;  1NOH A;  1HGV A;  1GD9 A;  3EI6 A;  1HTL C;  2BIA A;  1QIS A;  3K7Y A;  1JTH A;  3OKS A;  3VK2 A;  3DR4 A;  3P32 A;  3P7K A;  2H7H A;  4OTL A;  1AY5 A;  1RF1 C;  4WBT A;  3B1E A;  3PIU A;  2HFE D;  2D65 A;  2VI8 A;  3FZ8 A;  2W7M A;  5M46 A;  4MSO A;  2YMY A;  3HD7 B;  2PP6 A;  2YKV A;  1N8P A;  3EZ1 A;  3Q8N A;  4JEW A;  4OMA A;  4F5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...