5KTBA

Structure of a complex between s. cerevisiae csm1 and mam1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
151
Chain Sequence
LLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSDYSIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular architecture of the yeast monopolin complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords Monopolin complex subunit CSM1
total genus 51
structure length 151
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5ktbA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ktbA02
3N7NA 3C9IA 5BU5A 4ZKPA 1IC2A 4N78D 3U59A 3BASA 4GIFA 1NKNA 3HRNA 5KTBA 2JEEA 3P8CD 2POHA 3U1CA 5BVZA 3U1AA 4ZKUA 2FXMA 5BU8B 3VP9A 3OJAB 3N4SA 3BATA 1X79B 3VP8A 4I1LA 4N3YB 3N4RA 1WT6A 4O9BA 3N4XA
chains in the Genus database with same CATH superfamily
3GR9A 3ITKA 3VMZA 1H89A 3M91A 5KKZB 3F9TA 1FDOA 4PFFA 4OCAA 1M7YA 1P84E 3A0HH 2R5DA 3H1JD 3FZ7A 3G3ZA 3KQGA 4HJGH 5KAIE 3ZRRA 1FZAA 1LK9A 1NYHA 1MDXA 3SWFA 1GK6A 1LTGC 2VMZA 2KP8A 2NPSC 2W7FA 5M4DA 4A6RA 2VMYA 1AMAA 2IZ0A 3MP7B 1JCDA 2WSFJ 1FE6A 3BV0A 4RITA 1PPJD 4LW4A 3BCCD 2PB2A 3VK4A 3C9IA 2Q9IA 2KFPA 1CI6A 3SFEC 4R2NA 2W8JA 5KLVE 3DODA 1L0LD 3GSBA 3EZSA 1D7UA 1VPCA 1MGVA 5DJ9A 2E7IA 2W8TA 4PV1C 4AYCA 4C7NA 1IX6A 1LTIC 2C44A 3FFHA 2X5DA 3RL0g 1BCCD 2JJLA 1X9VA 3AATA 1KILD 1YAAA 2FYFA 7AATA 2YO3A 1IFMA 1R5SA 3A0BE 3NU8A 2KS1B 4XJLA 1N2TA 1KN7A 4WYCA 2P7JA 3NRAA 1OVUA 2W7MA 1SQVE 3ZDMA 3CC2P 1QJ5A 1ZRTD 1WYVB 4K2IA 3A0BH 2DKJA 1HBWA 3VMXA 2OGUA 2JJHA 2KS1A 3FXDA 1URQD 1TASA 3AE1C 3H6PA 1MFZA 2Y0EA 2WWWA 1VQ9P 2K9YA 1KZUB 4EYYQ 4JEVA 1LJ2A 3B1DA 3E9KA 3QN6A 2NRGA 1BDCA 1BE3D 4NPEA 1UKJA 1XI9A 2YKVA 4XA4A 4WYGA 1ASDA 1B8GA 1H0CA 3DXVA 3TGUG 1X22A 2PFXA 1BKGA 2QRXA 3BCCJ 1KL1A 2C81A 3FXEA 4FL0A 4D6TD 1W23A 3PA9A 3CCVP 3BWNA 3EI9A 2R3SA 3QGUA 3E1RA 1LKCA 4NPDA 5KJ7A 3D70A 2FFDA 3DC1A 3MAFB 4DCKA 1GC0A 1TPLA 4JYCA 1LWUB 3NYTA 3RGUA 4UOYA 3GHGC 3HE4A 5AW4B 3V2PA 1BQDA 1ZMEC 1RE4C 2WVRA 1L0LE 2WK9A 2I1JA 2AXTH 3CCQP 3GMAA 1BE3J 2W7DA 5G4JA 1V2FA 1PV3A 2GUVA 4KT0J 1YTZI 2AY6A 3AE7C 5AW8B 2ZFCA 2OYIC 2YNYA 1Q2NA 5DJTB 3VMYA 3ZZKA 1YITP 2IFNA 2AY2A 4UB8H 2E5TA 2KUBA 2WZ7A 1FS0E 4AZKA 1OWAA 3DR4A 3CX5H 1GCKA 4L75A 3BATA 1MAQA 3K28A 5CBOA 5IWQA 1JUNA 3FVUA 3V6IA 3DU4A 1U08A 4K2BA 1CSBA 2YKOA 1KC8Q 1GD9A 3CAIA 4Z1MH 1M1KQ 4I6MC 2WKAA 2HODB 2QM7A 3L74J 3RK3B 2EPJA 3O6QA 5H2FH 2FNIA 1VQ7P 3KZIE 4H44D 1S08A 2JJEA 4LC1A 1K05A 1FDMA 3M0DA 1IK7A 3H1LG 3TATA 3JTXA 4A0RA 5BU8B 4Q75A 3MADA 1NJIQ 2V0YA 3D6ZA 3AENA 4U2HA 2FY8A 1S2EA 3FVXA 2FYUJ 4W1VA 3PRJA 4DJGA 1IAYA 5AVZB 2HLOA 3GHGA 1CJ0A 5HHYA 1EDIA 3Q5SA 1NTMD 1NU1G 1KFNA 1PP9D 2VMSA 1W2EA 4RESB 1MLZA 1LT9B 5BVZA 1E5FA 1ASCA 2HZPA 1WYUB 2PB0A 1BSNA 4Y0HA 1Q86Q 1JF9A 3USFA 2NMPA 3BN1A 2VMVA 5CCHA 1KORA 2FYNB 2QJYC 1KQSO 1SS1A 2WPVB 1IC2A 5AW0B 4H0LD 2IYPA 4XE5B 1EXIA 2JKVA 1WYTA 1YOOA 2Z9WA 4A0HA 2Q1KA 1NVOA 2RN0A 1JO5A 5AVSB 2IZ1A 2WK7A 1SZKA 1YIJP 4TLFA 2D65A 5KLVD 3HDOA 5G4IA 4RKCA 1T3IA 4JQ0D 3CI9A 3D6YA 1VQNP 2P1JA 1VQMP 1NKZB 2O1KA 4L0OA 4WWIA 1O62A 2G6WA 3VK3A 1JCCA 2DGLA 4C7RA 3VMAA 4IX8A 2POHA 3HD7D 1BT4A 2QE7H 2C0RA 3PDBA 3H32A 2ZP7A 5CHXA 1P84D 4RJTA 2AY4A 4E3QA 3RI6A 1AHEA 1T3JA 1W7LA 3HE4B 5G0AA 1HF9A 1NTKJ 4DOJA 2OKJA 4PD4H 5BU5A 3G4SP 2BIGA 2O01J 5APYA 4F5LA 2VGVA 1V72A 4P7YA 5CBNA 2E54A 3TYYA 1V2DA 4K05A 1FG7A 4ADEA 3GF3A 5FT4A 4IFDK 1UU2A 1FDIA 1KV4A 1GC3A 2CB1A 2ZY4A 2W27A 1J1EB 3NUBA 1DEBA 3HUSC 1T3UA 2Y0DA 4R5ZA 1BJNA 1MFTA 5APQA 1AICA 2AY7A 4A72A 5FT5A 1FZCA 2FFDC 1SQXG 2FQ6A 3TNUA 1VF5B 1ARGA 2KZIA 3A2AA 4ASWA 1KYOH 1NTZG 1VQPP 2OYOA 2IBZG 2CPSA 1DIPA 2W7KA 1RF1A 4UHOA 2YO2A 3RBZA 1NOHA 1RV4A 3FTBA 4C7NB 1PMOA 1NTKD 2YKYA 3LV2A 2R32A 1RQUA 3IAOA 1IFDA 5DJ1A 5KLIB 3NYSA 1WRGA 4C46A 4ZKUA 1IO4A 3CMEP 3FVSA 1W5CE 4P3MA 4UHMA 4XK1A 1QISA 4OT8A 2N9YB 1JG8A 5AW7B 3I4JA 4AZJA 4GRXA 2YMKA 4Q31A 1G7XA 2CH2A 2PGDA 1EDJA 5DX5A 1FZFA 4BWNA 4W1WA 1SQVD 1GD2E 5APUA 5AW2B 5CCGD 1X0MA 3R2PA 1QL1A 1LTSC 5AVQB 1VEFA 2BYLA 4TT3H 2K9JB 2D63A 2D7YA 1BGYD 4Q6RA 4R5FA 2BWOA 1I29A 3CC4P 3DRDA 2MJZA 4I7ZB 3L44A 4JBZA 2FYUG 1EQBA 3H1KJ 3L71J 3RCHB 1GU4A 1M6SA 3NU7A 1N7SA 2QSRA 2VLHA 1LW5A 3I5CA 5KLVG 4XJMA 1WYVA 2BEQD 2YIUC 1I48A 4RLGA 3ZRQA 1X28A 1D7SA 1RF0C 3L73D 2B88A 3S1KA 3PP5A 4AUWA 3WY7A 1PP9G 4WBTA 3MEBA 3B5NB 1GMJA 2E7JA 3CL3D 2E74C 3ASBA 1IX7A 2M8RA 2VMPA 2Z4EA 2E76B 3KGXA 5BJ4A 1MDZA 1PGOA 1KYOI 5CJ0A 3OW2O 1NTZD 1AMRA 2TPLA 2XH1A 3Q8NA 2E5YA 3HE5A 3I5TA 1LS3A 3T32A 1RF0A 3FWNA 5GTHH 3BWOA 4N78E 3VP8A 4RKDA 4DBCA 4LW2A 2IYOA 1OW6A 3JZLA 2VIBA 2FNUA 3AEBC 1W2BO 5E79E 5GTHE 1N7SC 3OKSA 1JB0J 3LW5H 3RK2B 1SF2A 4MQRA 1QX8A 3T97A 4GT1A 1E79H 2ZSMA 1DTYA 2VGTA 1HGVA 2WITA 1MDOA 1NHLA 4F5MA 2BI5A 1CQ8A 1GW3A 1URQA 4LGDE 1L4AC 3N5MA 2PAJA 3NTNA 5TISH 2BWNA 2D7ZA 3MAFA 1J2JB 2AXTE 2Z9VA 3P6KA 3RBLA 3RK3E 1S07A 3A7OA 1N73A 1CZCA 1GBNA 1LTTC 1KILE 2DOUA 2CJGA 1SFCC 3L70E 2CSTA 3FDBA 3RK3D 1ECXA 3JC22 1YHQP 4XJOA 4OBVA 4ZKPA 2FYUK 1AY4A 1T6AA 3CQ5A 1Y9BA 2B9BA 1BJ4A 2MKVA 2GMSA 1C7GA 1VQ8P 3NYUA 3EWKA 2X5FA 3B8XA 4PFNA 4U3FG 1KB9D 3GWPA 4N3YB 1KL2A 4H0LC 2W83C 4PIWA 3L4FA 4OGQB 2PP6A 1YJYA 2OYIA 3QH9A 1G4XA 2QJPB 2XU6A 2YKXA 1H8AA 1N31A 3MTUE 3CCSP 2VYCA 2A06G 9AATA 1GL2A 2YRIA 1BE3G 2ZYJA 1ARIA 4I7ZC 3OJAB 5CCHC 1GEYA 4IW7A 3VN0A 3II6A 4WYFA 1WKHA 3WKRA 4RKUJ 3PD6B 2WT7A 2A45H 2ZXEB 4I8AA 3RL0C 4UHNA 1L0NJ 2IDBA 1SQBG 1ZV8A 1AIAA 2NPSB 1WYUA 4A6UA 3CX5I 4WXFA 3NNKA 2CFBA 1AHYA 3LVKA 1BE3E 1AKAA 3V2NA 1ZXGA 3BCCG 2YKQA 4F4EA 2BEZF 1EXJA 4JEYA 2NPSD 2M3EA 5CCGA 1BCCG 3IN6A 3COGA 1OHVA 3E1IA 1LC5A 1SQBE 1S0AA 3F6TA 1AAWA 3H1HD 4M3LA 3N75A 5G2PA 1BSHA 1JY3N 4PJ0E 3AOVA 1C7OA 5E4ZA 3RK2C 4ZAHA 2J59M 3S9OA 2YMYA 3L71D 1AVOA 1U7JA 2OTJP 8AATA 1GU5A 3EIBA 4YTPC 2HP2A 1TOIA 1RE3C 2RFVA 1ZOBA 2OKKA 3PPLA 2BWPA 1RF1C 3ATHA 3RQ1A 1S4XA 2HP1A 4B9BA 4MQQA 3HD7A 3E2ZB 3E2FA 4H13B 3CWBG 3EUCA 3VP9A 1HH0A 4GEBA 2WPQA 1ASMA 2EZ2A 2QBTA 3NMDA 1YQ3C 2WMMA 1QLED 4H13C 1RE4A 2KSJA 3VOPA 2N1TB 4ADBA 1OVRA 3WX9A 1J32A 2R2NA 1BGYJ 4ZLVA 2A06E 1YTZT 2P10A 1H88A 1WSTA 3TGUD 4KYOA 3AV7A 3W1HA 3BVHA 2Y9YA 3H1HJ 2VMXA 1FBMA 2NPSA 3P8MC 2FBWC 3CWBJ 4ASVA 1ELUA 4WB0B 2WSFH 1OIPA 4JF0A 3CPWO 3GF7A 1W7NA 2W8WA 4FFCA 1G4VA 2P58A 2JJGA 5K8BA 1KKJA 5E79H 3CQ6A 2JO1A 2M5AA 1ZP0C 3JWAA 2JDIH 2LXBA 3AECC 4GSAA 2XKMA 1LWUA 2KK7A 4WB4A 2IX7C 4K2MA 2AEJA 2E74B 4M2MA 1EDKA 5G09A 2CJDA 2ITAA 2YHKA 4HH2A 3AEOA 4ZDLA 4YXWH 2W8UA 1OVVA 1L0NK 3G8MA 3H1KG 2YCPA 5EFSA 1DD3A 1SQQK 4F5JA 1DJEA 1MAPA 3P7KA 4D6TE 2R5CA 3GZDA 3AEMC 1R5LA 1SQPK 1LT9C 4OTLA 3KE3A 5EIGB 4Y99B 2V7QJ 1SVVA 1CW5A 4WYDA 2E76D 4Y99C 4WP0A 3ACZA 1TATA 3L70D 2YKPA 2V7QH 4EB7A 2KXPB 1DJ9A 1I43A 4OWFA 4PD4E 3RUYA 3G6EP 2EYQA 1TOJA 2VRSA 3CCEP 1CS1A 3CXHH 5AX8A 3CCRP 3G7QA 3BCBA 3FQAA 1NU1D 1NTMG 3IHJA 1LC7A 1GTWA 4WY4C 2O01H 4GDOA 5TJHA 4UB6H 2O0RA 3V2RA 3AEAC 2I8DA 1KILC 3SWKA 2ZJGA 1RVUA 1AQTA 2AEMA 1SFFA 1JY3P 2ZYGA 2FXMA 3CWBD 4WVZA 2A1VA 1G1JA 1AJYA 3AE6C 1S5LX 2DGMA 1X79B 3PGYA 3B5NA 2BI3A 1ZLLA 5TISE 3WMM0 2QEXP 2QM8A 4ZDOA 5JAYA 1L0ND 1PP9E 3WUTA 3H1LE 5M46A 5GTIH 1K8AQ 2ZYAA 2ZT9B 2W6AA 3CWBE 4UQVA 2JWDA 1RHZB 4F5HA 1SZSA 4WXBA 1ASFA 1Z7DA 3FFRA 1JTHB 2OYIB 2DKBA 3AE9C 2BHXA 3KYQA 1AHGA 1NAFA 1SQPD 2VI9A 3GHGB 5FT8A 3H1HG 5EFWB 2ZY3A 3GETA 5EIGA 2FYUE 3OA7A 3JSVC 5D95A 3GJUA 2VMOA 2YOBA 3B5ND 2HUIA 2EZ1A 2W7EA 1AA0A 1VQKP 2RKLA 3MC6C 1Q82Q 1BJOB 2HOXA 5B66H 1DJUA 4OGQD 1KMIZ 2KLVA 2WSSH 3L74D 1QITA 2YXRB 3IR9A 1A02F 2BKWA 2W7LA 1FC2C 3N4RA 4U7JA 3BC8A 1B9HA 1CL2A 3PDXA 5EQCA 2ZT9C 5H2FE 2W6JH 1IUGA 1VJOA 1DH3A 1KB9I 2R5EA 4CBSA 1GDTA 5DB5A 4RAEA 3GZCA 2KNCA 3TF5A 3UAKA 1LWUC 1KMKA 1HJBA 1NU1J 1AY8A 2CY8A 3CBFA 1AJRA 1USDA 1QL2A 3H25A 1K73Q 4W5KA 4YPCA 5G2QA 2W7HA 3CQ4A 1HUCA 2HG5D 4IXZA 1ZODA 5J8QA 1R8EA 3G0TA 3Q2YA 3MBBA 4JF1A 1L0LK 1ZW0A 3U59A 3JWBA 1TU3F 1N8PA 1EZVG 2IFMA 3O6QB 3V4WA 3Q1MA 4H44C 5FT6A 2LKMA 1PFFA 1M1JA 4ZASA 2SPZA 1L0NE 4NPFX 1WKGA 1SQQG 1M0OA 3MC6A 2EH6A 3QI6A 1BDDA 5M49A 2AATA 2ZYDA 3I55P 4Q76A 2KB7P 3BWNC 2JGTA 4OC9A 1SQPE 2LXCB 3RK2D 3OAKA 1SZUA 4WBAA 1KB9E 1IX8A 2JEEA 2CANA 4GE4A 1DFOA 1LTJB 5F9SA 1W7MA 2VMRA 4Y0IA 1NTZJ 2DR1A 4LNLA 1P84H 4H0LB 3ISLA 1CQ7A 4BA5A 4CXQA 1YQ4C 1QVGO 5CJ4A 4A0GA 3NUIA 2V4HA 1KTMA 1AQ5A 3PLNA 4PD4D 2R0TA 1PGJA 1RVYA 2D5YA 1S3JA 3AEEC 3KHUA 3L74G 3P8CD 1P84I 3HE5B 1T2KC 2BI2A 2ZAEB 1IJIA 4AOAA 1GL2D 1LTAC 4TMRA 4HYTB 1IK9A 2W6BA 3HTKB 2B87A 4WY4A 1FZGA 1M0QA 4GE9A 2E75C 1S5LE 4LNJA 2K88A 2YCTA 3KXDA 3IFMA 3ECDA 2WT7B 5EAAA 2BI1A 4LLHA 3L75G 3KKIA 1YJWP 3CX5D 1JM0A 1SQXJ 3EFFK 2YCNA 1U7MA 3HD7C 4AH3A 5CMZA 2WSCJ 1E5WA 4ADCA 1FZEA 4N6JA 1GEWA 1FZCC 4ZSYA 2F8JA 4K35A 2Q7CA 4JPZB 1CI6B 2WB6A 2GMUA 2L5GB 1EZVE 3A9XA 4MN4C 1CZEA 2X8UA 2HYNA 1VDFA 4EIJA 5B5EE 1FZCB 2C0WA 4DZOA 3C1LA 1UU0A 1DX7A 2N1TD 3L73G 1OATA 4IL6X 3U1AA 3USSA 1FOSF 1E5EA 4ZMDA 3FD0A 3AE2C 3C8VA 1RF1B 2FFDB 3A0HE 1S72P 4ZM4A 3HLMA 4O9BA 2JR8A 2EO5A 2VGUA 1G2CB 5KAIH 2C9NY 3HUSB 3WGBA 1MV8A 1IBJA 2UWJE 2BCCE 5KJ7D 1YYCA 4N0WA 1CL1A 4EMYA 3GLMA 5KTBA 2Z9XA 1N7LA 2X3LA 5AVUB 1YBKA 1SQQJ 2JG2A 3HL2A 1LNQA 2KIKA 3NXSA 1JMMA 1QIRA 2ZUKA 4RO0A 2P2UA 3F89A 3ASAA 1FC4A 1QVFO 3I56P 1ASLA 2B89A 1NO4A 4M2KA 3ELEA 1NTMK 5M4BA 3JCUE 4A00A 1OW7A 1GDEA 3EI7A 1N73C 2VGZA 1VQLP 3WGCA 1NU1E 1LTJC 2VMNA 4IOIH 1L2PA 3JCUH 1XTCC 1KFMA 4UB6E 2Q6QA 1K04A 1OMIA 1OW8A 4IXOA 3BS8A 1SQVG 1YNUA 1C0NA 3FZ8A 1LTJA 3PHLA 3GG2A 3SFDC 3T97B 2PO3A 3VP6A 3CCUP 3GBXA 1WYTB 1BCCJ 4WYAA 3KDPB 2OQXA 1BW0A 2CH1A 2FKWB 3MUDC 3EI6A 2A45I 1EZVD 1ORDA 4WLHA 2WPRA 3DXWA 4J8LA 2XNXA 3FX0A 2OGEA 4Y28J 2CPBA 4EI2A 1IFJA 2BASA 5TF5A 1DKAA 2K3RA 1MKMA 2XV5A 2QLRA 4Y0DA 4EB5A 1SQPJ 3F5HA 2HR3A 2W7JA 1HJ0A 1NH4A 3II0A 5EUDA 4OYTA 1RQVA 3VK2A 1IAXA 3CD6P 2Q7WA 1DGDA 1VF5D 1ZOYC 2ZSLA 3PDBB 1TOEA 3B46A 3H1IG 4DQ6A 2RMZA 3FZ6A 3PH0A 4H44B 1NTKK 4ISYA 4KJMA 1B4XA 2KOGA 2KZJA 3A5TA 1NWQA 3AEFC 3U1CA 4ZSWA 1AHFA 2BCCG 3LW5J 3L75D 1BS0A 4WXGA 1WMKA 3WUUA 3MUDA 1PMMA 4CXRA 3AE4C 2AY8A 2XNDH 4L76A 5M1BA 4J5UA 5C6UA 3E6GA 3A3YB 2HOYA 1JY2P 3AE8C 4IYOA 1B5PA 4ZM3A 3BCXA 4BQ0A 1AFOA 5HDMA 1EG5A 5KAFE 1IJDB 1K9MQ 3R9AA 2VI8A 4BHDA 3AOWA 2ZVNB 1SFCB 3TFTA 1OZHA 1JEKA 4XFJA 2QVAA 1ASNA 3CC7P 3HTKA 3AEPA 4U3FJ 5AW1B 2HUFA 3ZZJA 1WT6A 3ZRPA 3P32A 4RM1A 4O6ZA 1Q81Q 4M2JA 4OMAA 3FQ8A 3FRKA 4L73A 3BRTB 4IL6E 1YJZA 3UE8A 2WSEH 3RBFA 2O7CA 2K9JA 3M0DC 2XDJA 3LG0A 2J58A 2WSCH 5AVRB 1A02J 1SLQA 3M9BA 1KAFA 3L70J 1NTME 4ZNCA 1GC2A 1KILA 2CINA 4RJ0A 1AIBA 3VOMA 1FOSE 1PFIA 2Z20A 1SVFA 2AY5A 3ELPA 1KQGB 4EDFA 3B4SA 1D7MA 5APWA 1NGMB 3CMAP 3RCHA 3N0LA 1V2EA 3FDDA 2AEFA 3PJ0A 2R5BA 2YRRA 3EI5A 2E7UA 2Q3EA 2ZY5A 3QM2A 3LVLB 1FZBA 4H13D 2Z5HA 2Z1ZA 4MSOA 1NTKE 1YJNP 3LIEA 3JW9A 4DT0A 1EJIA 3LVJA 3V5BA 1L4AA 2VIAA 2Z9UA 3L70G 1LGHB 5APTA 2N9BA 3HUSA 1QGNA 1Z3ZA 3NX3A 2IBZE 2AEVA 3MKJA 3A9YA 1NTZE 3HD7B 2FKIA 3M06A 3GZDC 2O1JA 3B71A 2VMQA 3WUVA 1YI2P 1BGYG 2ZC0A 4W8IA 4LC3A 4QMAA 4U3FD 3TGUJ 1KKPA 3HT4A 1X8YA 1FG3A 3AE5C 1XTGB 2E75B 1ASBA 1S5LH 1IVRA 1G7WA 3QHXA 5AVWB 3WU2E 2QSIA 1VQ5P 3I16A 3WCOA 2FM1A 4PV1B 3CX5E 4PV1D 1P3WA 1AMSA 3L8AA 3DZZA 3Q3DA 1H1CA 4CVQA 3EZ1A 1PZQA 3QWOC 4BXLA 3L72E 2GB3A 3CLQA 5KLIC 2K37A 4GODA 3H9XA 4QGRA 4WLJA 3H1JJ 1ZR2A 2KYVA 5APXA 1ARHA 1AY5A 2M5AB 3EIAA 2HPCB 3L73E 1L4AD 1S9KE 4F5FA 3M9HA 2XBNA 1B9IA 1C7NA 2OGAA 2D66A 3A9ZA 1URQC 1M0NA 4IYOB 1KYOD 1USEA 5EUEA 1N73B 1J1DC 1JY3O 1M7LA 2DW3A 1SFCD 2BI9A 5KJ7C 4OVNF 1L4AB 2WSEJ 4MKKA 3M0AA 4BRYA 4F5GA 3RK3C 1PIXA 2XZRA 1KD1Q 5F8VA 3MHVA 3H1ID 1TARA 3NDNA 1SQBJ 1LW4A 2YXQB 1SQVK 4IFMA 4ATQA 1X2AA 1S09A 4EU1A 1RE3A 2C0XA 2H7HA 2Z61A 1C4KA 3HBXA 3W1IA 1IFIA 1QEXA 1S9KD 3GW6A 3MAUA 3MZWB 4AQRD 4KXKA 4WB0A 4MQPA 4AO4A 1JOCA 1EQ7A 1SQQE 3AENB 1M4NA 1X0TA 3H7FA 1L0LJ 3H1HE 2GA1A 2D2CC 3L72D 3HMUA 1QGKB 2W8VA 3K5BA 4HB1A 3V4QA 4CBRA 1MUUA 1DD4A 1W3UA 3S4RA 2FXOA 3FKDA 2EGYA 1SP4A 1SPAA 4PD4I 3H1KD 1KYOE 3CCLP 2A45G 5EAVA 4XQ2A 1CZQA 3E2ZA 1FJKA 3AEDC 1AVYA 1FJPA 1IFPA 1SFCA 3BASA 1EDLA 3K40A 2CTZA 3EI8A 1IFNA 5AVVB 4GDYA 2YIUB 4ZWMA 1GL2B 1NTZK 3P1TA 1IZNB 1PL5A 2QG4A 3CXHD 1AV1A 2VMWA 4JEXA 4I1LA 2BIAA 2AXCA 2H43A 4RJYA 1GC4A 1M32A 1NAYA 1PPJG 1NTMJ 4OBUA 5HXXA 3UWCA 2O01N 5AW5B 4R4MA 5KKZC 4GOEA 2CJHA 3AEJA 4W7ZA 2IPPA 1SQPG 1T8ZA 3EQ2A 5AVTB 2A06D 3DYDA 3W1JA 4ITGA 4I2LC 3H1JG 1RY3A 4RIZA 3H1IJ 2FN6A 1BJOA 1M57D 4U3FE 3TK1A 3PAAA 5APVA 2HODA 4GOFA 1URQB 1N7SD 1PGPA 1L0NG 4HF8A 2VGSA 4W1XA 2D61A 2OYHC 2KSEA 2BCCJ 1VP4A 2IBZD 2HOZA 1RH5B 2KLUA 2H89C 4JF7A 2ZVOB 4HKZH 4LNMA 3H1LD 2B87B 4WY4B 1SQXD 2OYHA 4BA4A 1AHXA 1D2FA 4B98A 1KILB 3TGUE 1HWTC 1LT1A 3UIAA 1Q90D 3A8UX 5CCGC 3SSUA 2ZXXA 3E7KA 4ZWVA 1H0TA 2OYHB 3NTJA 4JYBA 5KLVK 4YXDC 1GZLA 2R3CA 3LVMA 3E2YA 2WPSA 3BCCE 1SQXK 2HORA 1VQ4P 1TOKA 2WTYA 1PGQA 1VL2A 1ELQA 4WD2A 2KI7B 1M90Q 3WU2H 3L75E 1EZVI 4EFFA 5E5IA 2QJKB 3M5UA 3PIUA 4W80A 1AJSA 5AW9B 2ORDA 1BCCE 4H51A 4MY5A 1LT9A 1KB9H 1JY2O 4XAUA 1SQBD 3L35A 3TSIA 2E74D 2E42A 3AELA 2QMAA 1T2KD 2D2CB 2CK3H 3K7YA 5K5GB 3MGNA 2AY1A 1AAMA 1GL2C 2M3BA 3NFQA 2V1PA 4D6TG 4N78D 1HGZA 1S1CX 3W67A 2QB2A 1D7VA 3L74E 1H0TB 4OH8B 3D6KA 1PPJE 2OQQA 3RBXA 3B1CA 3H1KE 4JEZA 2LR2A 1LC8A 2N1TA 4AO9A 3R4YA 2P67A 2ZJSE 3VYIA 1QJ3A 5BJ3A 3L72J 3LIDA 1JY2N 2GM4A 4K3AA 1YJ9P 4F5IA 4W91A 2JISA 3H1JE 2WQYC 2ZT9D 1M56D 5D5SA 2ZY2A 5AW3B 1Y47A 1O61A 3BCAA 2E76C 3V2QA 2IBZI 1YIZA 1GK4A 1SQQD 3WKSA 3TQXA 3L36A 2O1BA 1PP9J 2J5UA 1D7RA 2PRRA 3PJSK 5AVXB 4L74A 4XEWA 2W7IA 1J1DB 1J1EC 3H32B 1AKCA 1MZ9A 5APSA 1OFCX 3VTPC 4BMKA 4WY4D 2FYUD 3F0HA 1YIYA 4ADDA 4E77A 5EUNA 4A6TA 5L8RJ 2QA3A 1X29A 1J04A 5E3KA 2OTLP 5AVYB 1HVVA 1ZC9A 1N2DC 1SQBK 3AEMA 1KMJA 3WZFA 1I41A 4F5KA 1M1JC 1AMQA 1Y4IA 1NU1K 2AY3A 4HVKA 1L0LG 2W7GA 3A2BA 1AX4A 2AY9A 3HQTA 1M8OB 2DGKA 1KQLA 2RH0A 1ZRTE 3MD0A 4KAMA 3MIWA 1M0PA 2FYNC 5C39A 3L71G 1ARSA 2JJFA 1HTLC 1TOGA 3L37A 4B86A 3HVYA 2H8PD 1YJSA 2C9LY 3L71E 4R4LA 2HFED 2QJYB 2BCCD 2Q3IA 2VLFA 4A7PA 5KAFH 3QBOA 3FGAD 4IY7A 2G7JA 4CPGA 2HPCA 2FYZA 1O69A 3G71P 5AW6B 3QPGA 3M9QA 4A0FA 1SQXE 1CQ6A 2Q5UA 3CXHE 1NKNA 2M0BA 3FSLA 3B1EA 2WK8A 1UIXA 4XJPA 4EOTA 1RV3A 2K1AA 4OGQC 1ASAA 3OP7A 2D2CD 2R44A 4NOGA 3TDKA 1GEXA 4ZDPA 1C9CA 4D6TJ 2W90A 2QB3A 2OTKE 1OXPA 1GW4A 4GE7A 1SQVJ 5DJUB 4DGTA 2D64A 2GQNA 1UIIA 2JP3A 1LTBC 1ASGA 2Z1YA 3L75J 1N86A 2Y0CA 1OXZA 4IFFA 4PVFA 1ASEA 2QJPC 2AEUA 2R5CB 1ZR4A 3CCMP 3N4SA 3DR7A 2OARA 1AKBA 1PG8A 3FWLA 3AEGC 2L91A 3PD6A 1Q7YQ 2BIEA 2FXPA 2YKUA 2VMUA 3TNUB 2Y9ZA 1VF5C 2G8YA 1XEYA 3EFGA 3HRNA 4JEWA 2H88C 2KNCB 2OATA 5GTIE 1M1JB 2N1TC 1EC5A 1Z56A 4ATPA 3TFUA 3FCRA 1OX3A 4GKGA 4TN4A 3H1IE 3Q5PA 2BYJA 4U1TA 4ITXA 1BJWA 5B66E 3BRVB 4UB8E 4MKJA 4R8DA 3O8ZA 4H63Q 1AJSB 4PJ0H 4GIFA 1BGYE 1O4SA 2VMTA 1S06A 1N7SB 3FQ7A 1JMBA 3H1LJ 2JWAA 3KPEA 1VQ6P 1LP1A 5I92A 1G1IA 4IL6H 1ZN5A 3KGWA 1DEEG 3L72G 5B5EH 3E77A 3KZIH 3P8CE 1OHYA 1JS6A 3SWYA 2G3AA 3G9RA 3N7NA 2QA4P 1OXOA 4E3RA 4BRYB 1FU1A 1JTHA 2GUSA 3L73J 2GSAA 3B8EB 3AEJC 3PTZA 2HUUA 2I1KA 1VQOP 3Q5RA 3R4TA 2C7TA 3VAXA 3IF4A 1FAVA 3TCMA 3W68A 1NTKG 3N4XA 3LY1A 3ABVC 1OHWA 3LWSA 2O3JA 2E75D 2E43A 1JS3A 1U57A 3D71A 3BB8A 1MLYA 4E1OA 3AE3C 1UU1A 3CCJP 1JNMA 3WCNA 4IXSA 2Z5IA 5CCHD 1ARTA 4KHXA 1LP1B 4W7YA 1DGEA 3CXHI 3WLXA 1N8RQ 1G2CA 1Y8AA 2W8ZA 1QZ9A 5KLVJ 2NZ2A 1BQAA 3RL0B 4WYEA 2VGWA 3RL0D 2QJKC 3B5NC 1B5OA 2QIWA 1KQFB
chains in the Genus database with same CATH topology
3GR9A 3VMZA 1H89A 3M91A 3F9TA 4PFFA 4OCAA 1M7YA 2R5DA 3FZ7A 3G3ZA 3KQGA 3ZRRA 1FZAA 1LK9A 1MDXA 3SWFA 1GK6A 1LTGC 2VMZA 2KP8A 2NPSC 2W7FA 5M4DA 4A6RA 2VMYA 1AMAA 1JCDA 3BV0A 4RITA 4LW4A 2PB2A 3VK4A 3C9IA 2Q9IA 2KFPA 1CI6A 4R2NA 2W8JA 3DODA 3GSBA 3EZSA 1D7UA 1VPCA 1MGVA 5DJ9A 2E7IA 2W8TA 4C7NA 4AYCA 1IX6A 1LTIC 2C44A 3FFHA 2X5DA 2JJLA 1X9VA 3AATA 1KILD 1YAAA 2FYFA 7AATA 2YO3A 1IFMA 3NU8A 4XJLA 1N2TA 4WYCA 2P7JA 3NRAA 2W7MA 1QJ5A 1WYVB 4K2IA 2DKJA 1HBWA 3VMXA 2JJHA 1URQD 1TASA 3H6PA 1MFZA 2WWWA 1KZUB 4JEVA 3B1DA 3E9KA 3QN6A 4WYGA 1UKJA 1XI9A 2YKVA 4XA4A 1ASDA 1B8GA 1H0CA 3DXVA 1BKGA 1KL1A 2C81A 4FL0A 1W23A 3PA9A 3BWNA 3EI9A 3QGUA 1LKCA 5KJ7A 2FFDA 3DC1A 3MAFB 1GC0A 1TPLA 4JYCA 1LWUB 3NYTA 4UOYA 3GHGC 3HE4A 5AW4B 3V2PA 1BQDA 1RE4C 2WK9A 2I1JA 2W7DA 5G4JA 1V2FA 2GUVA 1YTZI 2AY6A 5AW8B 2ZFCA 2OYIC 2YNYA 3VMYA 3ZZKA 2IFNA 2AY2A 2WZ7A 4AZKA 1OWAA 3DR4A 1GCKA 3BATA 1MAQA 3K28A 5IWQA 1JUNA 3FVUA 3DU4A 1U08A 4K2BA 1CSBA 2YKOA 1GD9A 3CAIA 4I6MC 2WKAA 2HODB 2QM7A 3RK3B 2EPJA 2FNIA 1S08A 2JJEA 4LC1A 1FDMA 3M0DA 3TATA 4A0RA 3JTXA 4Q75A 5BU8B 3MADA 2V0YA 3AENA 4U2HA 3FVXA 4W1VA 1IAYA 5AVZB 2HLOA 3GHGA 1CJ0A 5HHYA 1KFNA 2VMSA 1W2EA 4RESB 1MLZA 1LT9B 5BVZA 1E5FA 1ASCA 2HZPA 1WYUB 2PB0A 4Y0HA 1JF9A 3USFA 2NMPA 3BN1A 2VMVA 5CCHA 1IC2A 5AW0B 1WYTA 1YOOA 4XE5B 2Z9WA 4A0HA 1JO5A 5AVSB 2WK7A 1SZKA 2D65A 3HDOA 5G4IA 4RKCA 1T3IA 3CI9A 2P1JA 1NKZB 2O1KA 4L0OA 1O62A 2G6WA 3VK3A 1JCCA 2DGLA 4C7RA 4IX8A 2POHA 3HD7D 1BT4A 2C0RA 3PDBA 3H32A 2ZP7A 5CHXA 2AY4A 4E3QA 3RI6A 1AHEA 1T3JA 1W7LA 3HE4B 5G0AA 4DOJA 2OKJA 5BU5A 2BIGA 5APYA 4F5LA 2VGVA 1V72A 4P7YA 2E54A 3TYYA 1V2DA 4K05A 1FG7A 4ADEA 5FT4A 4IFDK 1UU2A 1GC3A 2CB1A 2ZY4A 2W27A 1J1EB 3NUBA 1DEBA 3HUSC 1T3UA 4R5ZA 1BJNA 5APQA 1AICA 2AY7A 4A72A 5FT5A 1FZCA 2FFDC 2FQ6A 3TNUA 1ARGA 3A2AA 2CPSA 2W7KA 1RF1A 4UHOA 2YO2A 1NOHA 1RV4A 3FTBA 4C7NB 1PMOA 2YKYA 3LV2A 2R32A 5DJ1A 1IFDA 3NYSA 1WRGA 4C46A 4ZKUA 1IO4A 3FVSA 4P3MA 4UHMA 4XK1A 1QISA 4OT8A 1JG8A 5AW7B 3I4JA 4AZJA 4GRXA 4Q31A 1G7XA 2CH2A 5DX5A 1FZFA 4W1WA 1GD2E 5APUA 5AW2B 5CCGD 1X0MA 3R2PA 1QL1A 1LTSC 5AVQB 1VEFA 2BYLA 2D63A 2D7YA 4Q6RA 4R5FA 2BWOA 1I29A 3DRDA 2MJZA 3L44A 1EQBA 3RCHB 1GU4A 1M6SA 3NU7A 1N7SA 2QSRA 2VLHA 1LW5A 3I5CA 4XJMA 4RLGA 1WYVA 1I48A 3ZRQA 1X28A 1D7SA 1RF0C 3PP5A 4AUWA 3WY7A 4WBTA 3MEBA 3B5NB 2E7JA 3CL3D 3ASBA 1IX7A 2M8RA 2VMPA 2Z4EA 3KGXA 5BJ4A 1MDZA 5CJ0A 1AMRA 2TPLA 2XH1A 3Q8NA 3HE5A 3I5TA 1LS3A 3T32A 1RF0A 3BWOA 4N78E 3VP8A 4RKDA 4DBCA 4LW2A 3JZLA 2VIBA 2FNUA 1N7SC 3OKSA 3LW5H 3RK2B 1SF2A 4MQRA 3T97A 4GT1A 2ZSMA 1DTYA 2VGTA 1HGVA 2WITA 1MDOA 1NHLA 4F5MA 2BI5A 1CQ8A 1GW3A 1URQA 4LGDE 1L4AC 3N5MA 2PAJA 3NTNA 2BWNA 2D7ZA 3MAFA 1J2JB 2Z9VA 3P6KA 3RBLA 1S07A 3A7OA 1N73A 1CZCA 1GBNA 1LTTC 2DOUA 2CJGA 1SFCC 2CSTA 3FDBA 3RK3D 1ECXA 4XJOA 4OBVA 4ZKPA 2FYUK 1AY4A 3CQ5A 1BJ4A 2GMSA 1C7GA 3NYUA 3B8XA 2X5FA 4PFNA 3GWPA 4N3YB 1KL2A 4PIWA 3L4FA 2PP6A 1YJYA 2OYIA 1G4XA 2XU6A 2YKXA 1H8AA 1N31A 3MTUE 2VYCA 9AATA 1GL2A 2YRIA 2ZYJA 1ARIA 3OJAB 5CCHC 1GEYA 4IW7A 3VN0A 3II6A 4WYFA 1WKHA 3WKRA 3PD6B 2WT7A 2A45H 2ZXEB 4I8AA 3RL0C 4UHNA 1ZV8A 1AIAA 2NPSB 1WYUA 4A6UA 4WXFA 3NNKA 2CFBA 1AHYA 3LVKA 1AKAA 3V2NA 2YKQA 4F4EA 4JEYA 2NPSD 5CCGA 3COGA 1OHVA 3E1IA 1LC5A 1S0AA 3F6TA 1AAWA 4M3LA 3N75A 5G2PA 1JY3N 3AOVA 1C7OA 5E4ZA 3RK2C 4ZAHA 2J59M 2YMYA 8AATA 1GU5A 3EIBA 2HP2A 1TOIA 1RE3C 2RFVA 1ZOBA 2OKKA 3PPLA 2BWPA 1RF1C 3ATHA 3RQ1A 2HP1A 4B9BA 4MQQA 3HD7A 3E2ZB 3E2FA 3EUCA 3VP9A 1HH0A 4GEBA 2WPQA 1ASMA 2EZ2A 2QBTA 3NMDA 1RE4A 2KSJA 3VOPA 2N1TB 4ADBA 3WX9A 1J32A 2R2NA 4ZLVA 1YTZT 1H88A 1WSTA 4KYOA 3AV7A 3W1HA 3BVHA 2VMXA 1FBMA 2NPSA 3P8MC 1ELUA 4WB0B 2WSFH 4JF0A 2W8WA 1W7NA 4FFCA 1G4VA 2JJGA 5K8BA 1KKJA 3CQ6A 3JWAA 4GSAA 2XKMA 1LWUA 4WB4A 2IX7C 4K2MA 4M2MA 5G09A 2CJDA 2YHKA 4HH2A 3AEOA 4ZDLA 2W8UA 1L0NK 3G8MA 2YCPA 5EFSA 1SQQK 4F5JA 1DJEA 1MAPA 3P7KA 2R5CA 3GZDA 3AEMC 1SQPK 1LT9C 4OTLA 3KE3A 5EIGB 4Y99B 1SVVA 1CW5A 4WYDA 4Y99C 4WP0A 3ACZA 1TATA 2YKPA 4EB7A 1DJ9A 1I43A 3RUYA 2EYQA 1TOJA 2VRSA 1CS1A 5AX8A 3G7QA 3BCBA 3FQAA 3IHJA 1LC7A 1GTWA 4WY4C 2O01H 2O0RA 3V2RA 1KILC 2ZJGA 1RVUA 1SFFA 1JY3P 2FXMA 2A1VA 1G1JA 2DGMA 1X79B 3PGYA 3B5NA 2BI3A 1ZLLA 3WMM0 2QM8A 4ZDOA 5JAYA 5M46A 2W6AA 4UQVA 4F5HA 1SZSA 4WXBA 1ASFA 1Z7DA 3FFRA 1JTHB 2OYIB 2DKBA 2BHXA 3KYQA 1AHGA 1NAFA 2VI9A 3GHGB 5FT8A 2ZY3A 3GETA 5EIGA 3OA7A 5D95A 3GJUA 2VMOA 2YOBA 3B5ND 2HUIA 2EZ1A 2W7EA 3MC6C 1BJOB 2HOXA 1DJUA 2KLVA 1QITA 3IR9A 1A02F 2BKWA 2W7LA 3N4RA 3BC8A 1B9HA 1CL2A 3PDXA 5EQCA 1IUGA 1VJOA 1DH3A 2R5EA 4CBSA 1GDTA 5DB5A 4RAEA 3GZCA 3UAKA 1LWUC 1KMKA 1HJBA 1AY8A 2CY8A 3CBFA 1AJRA 1QL2A 4W5KA 5G2QA 2W7HA 3CQ4A 1HUCA 2HG5D 4IXZA 1ZODA 5J8QA 3G0TA 3MBBA 4JF1A 1L0LK 3U59A 3JWBA 1N8PA 2IFMA 3V4WA 5FT6A 2LKMA 1PFFA 1M1JA 4ZASA 1WKGA 1M0OA 3MC6A 2EH6A 3QI6A 5M49A 2AATA 4Q76A 2KB7P 3BWNC 2JGTA 4OC9A 3RK2D 3OAKA 1SZUA 4WBAA 1IX8A 2JEEA 2CANA 4GE4A 1DFOA 1LTJB 5F9SA 1W7MA 2VMRA 4Y0IA 2DR1A 4LNLA 3ISLA 1CQ7A 4BA5A 4CXQA 4A0GA 5CJ4A 3NUIA 1AQ5A 2R0TA 1RVYA 2D5YA 3P8CD 3HE5B 1T2KC 2BI2A 1IJIA 4AOAA 1GL2D 1LTAC 4TMRA 4HYTB 1IK9A 2W6BA 3HTKB 4WY4A 1FZGA 1M0QA 4GE9A 4LNJA 2YCTA 3IFMA 3ECDA 2WT7B 5EAAA 2BI1A 4LLHA 3KKIA 2YCNA 3HD7C 4AH3A 5CMZA 1E5WA 4ADCA 1FZEA 4N6JA 1GEWA 1FZCC 4ZSYA 2F8JA 2Q7CA 1CI6B 2WB6A 2GMUA 2L5GB 3A9XA 1CZEA 2X8UA 2HYNA 1VDFA 4EIJA 1FZCB 2C0WA 4DZOA 1UU0A 1DX7A 2N1TD 1OATA 3U1AA 1FOSF 1E5EA 3FD0A 1RF1B 2FFDB 4ZM4A 3HLMA 4O9BA 2EO5A 2VGUA 1G2CB 2C9NY 3HUSB 3WGBA 1MV8A 1IBJA 5KJ7D 1YYCA 4N0WA 1CL1A 4EMYA 5KTBA 2Z9XA 1N7LA 2X3LA 5AVUB 2JG2A 3HL2A 2ZUKA 3NXSA 1JMMA 1QIRA 2P2UA 3ASAA 1FC4A 1ASLA 1NO4A 4M2KA 3ELEA 1NTMK 5M4BA 4A00A 1GDEA 3EI7A 1N73C 2VGZA 3WGCA 1LTJC 2VMNA 1XTCC 1KFMA 4IXOA 3BS8A 1YNUA 1C0NA 3FZ8A 1LTJA 2PO3A 3VP6A 3GBXA 1WYTB 4WYAA 3KDPB 2OQXA 1BW0A 2CH1A 2FKWB 3EI6A 2A45I 1ORDA 4WLHA 2WPRA 3DXWA 4J8LA 2XNXA 2OGEA 2CPBA 1IFJA 2BASA 5TF5A 1DKAA 2XV5A 2QLRA 4Y0DA 4EB5A 2W7JA 1NH4A 3II0A 5EUDA 4OYTA 3VK2A 1IAXA 2Q7WA 1DGDA 2ZSLA 3PDBB 1TOEA 3B46A 4DQ6A 3FZ6A 1NTKK 4ISYA 1B4XA 2KOGA 3A5TA 1NWQA 3U1CA 4ZSWA 1AHFA 1BS0A 4WXGA 3MUDA 1PMMA 4CXRA 2AY8A 4J5UA 5C6UA 3E6GA 3A3YB 2HOYA 1JY2P 4IYOA 1B5PA 4ZM3A 3BCXA 4BQ0A 1AFOA 5HDMA 1EG5A 1IJDB 3R9AA 2VI8A 4BHDA 3AOWA 3TFTA 1SFCB 1ASNA 3HTKA 3AEPA 2HUFA 5AW1B 3ZZJA 1WT6A 3ZRPA 3P32A 4RM1A 4O6ZA 4M2JA 4OMAA 3FQ8A 3FRKA 3BRTB 1YJZA 3UE8A 2WSEH 3RBFA 2O7CA 3M0DC 2XDJA 3LG0A 2J58A 2WSCH 5AVRB 1A02J 1SLQA 3M9BA 1GC2A 1KILA 2CINA 4RJ0A 1AIBA 3VOMA 1FOSE 1PFIA 2Z20A 1SVFA 2AY5A 3ELPA 5APWA 3RCHA 3N0LA 1V2EA 3FDDA 3PJ0A 2R5BA 2YRRA 3EI5A 2E7UA 2ZY5A 3QM2A 3LVLB 1FZBA 2Z5HA 2Z1ZA 4MSOA 3LIEA 3JW9A 1EJIA 3LVJA 3V5BA 1L4AA 2VIAA 2Z9UA 1LGHB 5APTA 2N9BA 3HUSA 1QGNA 1Z3ZA 3NX3A 2AEVA 3MKJA 3A9YA 3HD7B 2FKIA 3M06A 3GZDC 2O1JA 2VMQA 2ZC0A 4W8IA 4LC3A 1KKPA 3HT4A 1X8YA 1FG3A 1XTGB 1ASBA 1IVRA 1G7WA 3QHXA 5AVWB 3I16A 3WCOA 2FM1A 1P3WA 1AMSA 3L8AA 3DZZA 1H1CA 4CVQA 3EZ1A 2GB3A 3CLQA 3H9XA 4QGRA 4WLJA 1ZR2A 2KYVA 5APXA 1ARHA 1AY5A 3EIAA 2HPCB 1L4AD 1S9KE 4F5FA 3M9HA 2XBNA 1B9IA 1C7NA 2OGAA 2D66A 3A9ZA 1URQC 1M0NA 4IYOB 5EUEA 1N73B 1J1DC 1JY3O 1M7LA 1SFCD 2BI9A 5KJ7C 4MKKA 1L4AB 3M0AA 4F5GA 3RK3C 2XZRA 5F8VA 1TARA 3NDNA 1LW4A 1SQVK 4IFMA 4ATQA 1X2AA 1S09A 4EU1A 1RE3A 2C0XA 2H7HA 2Z61A 1C4KA 3HBXA 3W1IA 1IFIA 1S9KD 3MAUA 4AQRD 4KXKA 4WB0A 4MQPA 4AO4A 1JOCA 1EQ7A 3AENB 1M4NA 3H7FA 3HMUA 2W8VA 3V4QA 4CBRA 1MUUA 1W3UA 3FKDA 2EGYA 1SP4A 1SPAA 2A45G 5EAVA 4XQ2A 1CZQA 3E2ZA 1FJKA 1FJPA 1SFCA 3BASA 3K40A 2CTZA 3EI8A 1IFNA 5AVVB 4GDYA 4ZWMA 1GL2B 1NTZK 3P1TA 2VMWA 4JEXA 4I1LA 2BIAA 2H43A 4RJYA 1GC4A 1M32A 4OBUA 5HXXA 3UWCA 5AW5B 2CJHA 3AEJA 4W7ZA 2IPPA 1T8ZA 3EQ2A 5AVTB 3DYDA 3W1JA 4ITGA 4I2LC 1RY3A 4RIZA 2FN6A 1BJOA 3TK1A 3PAAA 5APVA 2HODA 1URQB 1N7SD 4HF8A 2VGSA 4W1XA 2D61A 2OYHC 1VP4A 2HOZA 4JF7A 4LNMA 4WY4B 2OYHA 4BA4A 1AHXA 1D2FA 4B98A 1KILB 1HWTC 3UIAA 3A8UX 5CCGC 4ZWVA 2OYHB 3NTJA 4JYBA 5KLVK 1GZLA 2R3CA 3LVMA 3E2YA 2WPSA 1SQXK 2HORA 1TOKA 2WTYA 1ELQA 4WD2A 4EFFA 5E5IA 3M5UA 3PIUA 4W80A 1AJSA 5AW9B 2ORDA 4H51A 4MY5A 1LT9A 1JY2O 4XAUA 3L35A 3TSIA 2E42A 3AELA 2QMAA 1T2KD 3K7YA 3MGNA 2AY1A 1AAMA 1GL2C 2M3BA 3NFQA 2V1PA 4N78D 1HGZA 2QB2A 1D7VA 4OH8B 3D6KA 3B1CA 4JEZA 1LC8A 2N1TA 4AO9A 2P67A 3VYIA 1QJ3A 5BJ3A 3LIDA 1JY2N 2GM4A 4F5IA 4W91A 2JISA 5D5SA 2ZY2A 5AW3B 1O61A 3BCAA 3V2QA 1YIZA 1GK4A 3WKSA 3TQXA 3L36A 2O1BA 1D7RA 5AVXB 4XEWA 2W7IA 1J1DB 1J1EC 3H32B 1AKCA 1MZ9A 5APSA 3VTPC 4BMKA 4WY4D 3F0HA 1YIYA 4ADDA 4E77A 5EUNA 4A6TA 2QA3A 1X29A 1J04A 5E3KA 5AVYB 1HVVA 1ZC9A 1N2DC 1SQBK 3AEMA 1KMJA 3WZFA 1I41A 4F5KA 1M1JC 1AMQA 1Y4IA 1NU1K 2AY3A 4HVKA 2W7GA 3A2BA 1AX4A 2AY9A 3HQTA 2DGKA 1KQLA 3MD0A 4KAMA 3MIWA 1M0PA 1ARSA 2JJFA 1HTLC 1TOGA 3L37A 4B86A 3HVYA 2H8PD 1YJSA 2C9LY 2HFED 2Q3IA 2VLFA 3QBOA 4IY7A 2G7JA 2HPCA 2FYZA 1O69A 5AW6B 3QPGA 3M9QA 4A0FA 1CQ6A 2Q5UA 1NKNA 3FSLA 3B1EA 2WK8A 4XJPA 4EOTA 1RV3A 1ASAA 3OP7A 4NOGA 1GEXA 4ZDPA 1C9CA 2QB3A 1OXPA 1GW4A 4GE7A 4DGTA 2D64A 2GQNA 1LTBC 1ASGA 2Z1YA 1N86A 1OXZA 4IFFA 4PVFA 1ASEA 2AEUA 2R5CB 1ZR4A 3N4SA 3DR7A 2OARA 1AKBA 1PG8A 3PD6A 2BIEA 2YKUA 2VMUA 3TNUB 1XEYA 3EFGA 3HRNA 4JEWA 2OATA 1M1JB 2N1TC 1Z56A 4ATPA 3TFUA 3FCRA 4GKGA 4TN4A 2BYJA 4U1TA 4ITXA 1BJWA 3BRVB 4MKJA 4R8DA 3O8ZA 4H63Q 1AJSB 4GIFA 1O4SA 2VMTA 3FQ7A 1N7SB 1S06A 3KPEA 5I92A 1G1IA 1ZN5A 3KGWA 3E77A 1OHYA 3P8CE 1JS6A 3SWYA 3N7NA 1OXOA 4E3RA 1FU1A 1JTHA 2GUSA 2GSAA 3B8EB 3AEJC 2HUUA 2I1KA 3R4TA 2C7TA 3VAXA 1FAVA 3TCMA 3N4XA 3LY1A 1OHWA 3LWSA 2E43A 1JS3A 3BB8A 1MLYA 4E1OA 1UU1A 1JNMA 3WCNA 4IXSA 2Z5IA 5CCHD 1ARTA 4KHXA 4W7YA 1DGEA 3WLXA 1G2CA 1QZ9A 4WYEA 1BQAA 3RL0B 2VGWA 3RL0D 3B5NC 1B5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7N A;  3C9I A;  5BU5 A;  4ZKP A;  1IC2 A;  4N78 D;  3U59 A;  3BAS A;  4GIF A;  1NKN A;  3HRN A;  5KTB A;  2JEE A;  3P8C D;  2POH A;  3U1C A;  5BVZ A;  3U1A A;  4ZKU A;  2FXM A;  5BU8 B;  3VP9 A;  3OJA B;  3N4S A;  3BAT A;  1X79 B;  3VP8 A;  4I1L A;  4N3Y B;  3N4R A;  1WT6 A;  4O9B A;  3N4X A; 
#chains in the Genus database with same CATH topology
 3GR9 A;  3ITK A;  3VMZ A;  1H89 A;  3M91 A;  5KKZ B;  3F9T A;  1FDO A;  4PFF A;  4OCA A;  1M7Y A;  1P84 E;  3A0H H;  2R5D A;  3H1J D;  3FZ7 A;  3G3Z A;  3KQG A;  4HJG H;  5KAI E;  3ZRR A;  1FZA A;  1LK9 A;  1NYH A;  1MDX A;  3SWF A;  1GK6 A;  1LTG C;  2VMZ A;  2KP8 A;  2NPS C;  2W7F A;  5M4D A;  4A6R A;  2VMY A;  1AMA A;  2IZ0 A;  3MP7 B;  1JCD A;  2WSF J;  1FE6 A;  3BV0 A;  4RIT A;  1PPJ D;  4LW4 A;  3BCC D;  2PB2 A;  3VK4 A;  3C9I A;  2Q9I A;  2KFP A;  1CI6 A;  3SFE C;  4R2N A;  2W8J A;  5KLV E;  3DOD A;  1L0L D;  3GSB A;  3EZS A;  1D7U A;  1VPC A;  1MGV A;  5DJ9 A;  2E7I A;  2W8T A;  4PV1 C;  4AYC A;  4C7N A;  1IX6 A;  1LTI C;  2C44 A;  3FFH A;  2X5D A;  3RL0 g;  1BCC D;  2JJL A;  1X9V A;  3AAT A;  1KIL D;  1YAA A;  2FYF A;  7AAT A;  2YO3 A;  1IFM A;  1R5S A;  3A0B E;  3NU8 A;  2KS1 B;  4XJL A;  1N2T A;  1KN7 A;  4WYC A;  2P7J A;  3NRA A;  1OVU A;  2W7M A;  1SQV E;  3ZDM A;  3CC2 P;  1QJ5 A;  1ZRT D;  1WYV B;  4K2I A;  3A0B H;  2DKJ A;  1HBW A;  3VMX A;  2OGU A;  2JJH A;  2KS1 A;  3FXD A;  1URQ D;  1TAS A;  3AE1 C;  3H6P A;  1MFZ A;  2Y0E A;  2WWW A;  1VQ9 P;  2K9Y A;  1KZU B;  4EYY Q;  4JEV A;  1LJ2 A;  3B1D A;  3E9K A;  3QN6 A;  2NRG A;  1BDC A;  1BE3 D;  4NPE A;  1UKJ A;  1XI9 A;  2YKV A;  4XA4 A;  4WYG A;  1ASD A;  1B8G A;  1H0C A;  3DXV A;  3TGU G;  1X22 A;  2PFX A;  1BKG A;  2QRX A;  3BCC J;  1KL1 A;  2C81 A;  3FXE A;  4FL0 A;  4D6T D;  1W23 A;  3PA9 A;  3CCV P;  3BWN A;  3EI9 A;  2R3S A;  3QGU A;  3E1R A;  1LKC A;  4NPD A;  5KJ7 A;  3D70 A;  2FFD A;  3DC1 A;  3MAF B;  4DCK A;  1GC0 A;  1TPL A;  4JYC A;  1LWU B;  3NYT A;  3RGU A;  4UOY A;  3GHG C;  3HE4 A;  5AW4 B;  3V2P A;  1BQD A;  1ZME C;  1RE4 C;  2WVR A;  1L0L E;  2WK9 A;  2I1J A;  2AXT H;  3CCQ P;  3GMA A;  1BE3 J;  2W7D A;  5G4J A;  1V2F A;  1PV3 A;  2GUV A;  4KT0 J;  1YTZ I;  2AY6 A;  3AE7 C;  5AW8 B;  2ZFC A;  2OYI C;  2YNY A;  1Q2N A;  5DJT B;  3VMY A;  3ZZK A;  1YIT P;  2IFN A;  2AY2 A;  4UB8 H;  2E5T A;  2KUB A;  2WZ7 A;  1FS0 E;  4AZK A;  1OWA A;  3DR4 A;  3CX5 H;  1GCK A;  4L75 A;  3BAT A;  1MAQ A;  3K28 A;  5CBO A;  5IWQ A;  1JUN A;  3FVU A;  3V6I A;  3DU4 A;  1U08 A;  4K2B A;  1CSB A;  2YKO A;  1KC8 Q;  1GD9 A;  3CAI A;  4Z1M H;  1M1K Q;  4I6M C;  2WKA A;  2HOD B;  2QM7 A;  3L74 J;  3RK3 B;  2EPJ A;  3O6Q A;  5H2F H;  2FNI A;  1VQ7 P;  3KZI E;  4H44 D;  1S08 A;  2JJE A;  4LC1 A;  1K05 A;  1FDM A;  3M0D A;  1IK7 A;  3H1L G;  3TAT A;  3JTX A;  4A0R A;  5BU8 B;  4Q75 A;  3MAD A;  1NJI Q;  2V0Y A;  3D6Z A;  3AEN A;  4U2H A;  2FY8 A;  1S2E A;  3FVX A;  2FYU J;  4W1V A;  3PRJ A;  4DJG A;  1IAY A;  5AVZ B;  2HLO A;  3GHG A;  1CJ0 A;  5HHY A;  1EDI A;  3Q5S A;  1NTM D;  1NU1 G;  1KFN A;  1PP9 D;  2VMS A;  1W2E A;  4RES B;  1MLZ A;  1LT9 B;  5BVZ A;  1E5F A;  1ASC A;  2HZP A;  1WYU B;  2PB0 A;  1BSN A;  4Y0H A;  1Q86 Q;  1JF9 A;  3USF A;  2NMP A;  3BN1 A;  2VMV A;  5CCH A;  1KOR A;  2FYN B;  2QJY C;  1KQS O;  1SS1 A;  2WPV B;  1IC2 A;  5AW0 B;  4H0L D;  2IYP A;  4XE5 B;  1EXI A;  2JKV A;  1WYT A;  1YOO A;  2Z9W A;  4A0H A;  2Q1K A;  1NVO A;  2RN0 A;  1JO5 A;  5AVS B;  2IZ1 A;  2WK7 A;  1SZK A;  1YIJ P;  4TLF A;  2D65 A;  5KLV D;  3HDO A;  5G4I A;  4RKC A;  1T3I A;  4JQ0 D;  3CI9 A;  3D6Y A;  1VQN P;  2P1J A;  1VQM P;  1NKZ B;  2O1K A;  4L0O A;  4WWI A;  1O62 A;  2G6W A;  3VK3 A;  1JCC A;  2DGL A;  4C7R A;  3VMA A;  4IX8 A;  2POH A;  3HD7 D;  1BT4 A;  2QE7 H;  2C0R A;  3PDB A;  3H32 A;  2ZP7 A;  5CHX A;  1P84 D;  4RJT A;  2AY4 A;  4E3Q A;  3RI6 A;  1AHE A;  1T3J A;  1W7L A;  3HE4 B;  5G0A A;  1HF9 A;  1NTK J;  4DOJ A;  2OKJ A;  4PD4 H;  5BU5 A;  3G4S P;  2BIG A;  2O01 J;  5APY A;  4F5L A;  2VGV A;  1V72 A;  4P7Y A;  5CBN A;  2E54 A;  3TYY A;  1V2D A;  4K05 A;  1FG7 A;  4ADE A;  3GF3 A;  5FT4 A;  4IFD K;  1UU2 A;  1FDI A;  1KV4 A;  1GC3 A;  2CB1 A;  2ZY4 A;  2W27 A;  1J1E B;  3NUB A;  1DEB A;  3HUS C;  1T3U A;  2Y0D A;  4R5Z A;  1BJN A;  1MFT A;  5APQ A;  1AIC A;  2AY7 A;  4A72 A;  5FT5 A;  1FZC A;  2FFD C;  1SQX G;  2FQ6 A;  3TNU A;  1VF5 B;  1ARG A;  2KZI A;  3A2A A;  4ASW A;  1KYO H;  1NTZ G;  1VQP P;  2OYO A;  2IBZ G;  2CPS A;  1DIP A;  2W7K A;  1RF1 A;  4UHO A;  2YO2 A;  3RBZ A;  1NOH A;  1RV4 A;  3FTB A;  4C7N B;  1PMO A;  1NTK D;  2YKY A;  3LV2 A;  2R32 A;  1RQU A;  3IAO A;  1IFD A;  5DJ1 A;  5KLI B;  3NYS A;  1WRG A;  4C46 A;  4ZKU A;  1IO4 A;  3CME P;  3FVS A;  1W5C E;  4P3M A;  4UHM A;  4XK1 A;  1QIS A;  4OT8 A;  2N9Y B;  1JG8 A;  5AW7 B;  3I4J A;  4AZJ A;  4GRX A;  2YMK A;  4Q31 A;  1G7X A;  2CH2 A;  2PGD A;  1EDJ A;  5DX5 A;  1FZF A;  4BWN A;  4W1W A;  1SQV D;  1GD2 E;  5APU A;  5AW2 B;  5CCG D;  1X0M A;  3R2P A;  1QL1 A;  1LTS C;  5AVQ B;  1VEF A;  2BYL A;  4TT3 H;  2K9J B;  2D63 A;  2D7Y A;  1BGY D;  4Q6R A;  4R5F A;  2BWO A;  1I29 A;  3CC4 P;  3DRD A;  2MJZ A;  4I7Z B;  3L44 A;  4JBZ A;  2FYU G;  1EQB A;  3H1K J;  3L71 J;  3RCH B;  1GU4 A;  1M6S A;  3NU7 A;  1N7S A;  2QSR A;  2VLH A;  1LW5 A;  3I5C A;  5KLV G;  4XJM A;  1WYV A;  2BEQ D;  2YIU C;  1I48 A;  4RLG A;  3ZRQ A;  1X28 A;  1D7S A;  1RF0 C;  3L73 D;  2B88 A;  3S1K A;  3PP5 A;  4AUW A;  3WY7 A;  1PP9 G;  4WBT A;  3MEB A;  3B5N B;  1GMJ A;  2E7J A;  3CL3 D;  2E74 C;  3ASB A;  1IX7 A;  2M8R A;  2VMP A;  2Z4E A;  2E76 B;  3KGX A;  5BJ4 A;  1MDZ A;  1PGO A;  1KYO I;  5CJ0 A;  3OW2 O;  1NTZ D;  1AMR A;  2TPL A;  2XH1 A;  3Q8N A;  2E5Y A;  3HE5 A;  3I5T A;  1LS3 A;  3T32 A;  1RF0 A;  3FWN A;  5GTH H;  3BWO A;  4N78 E;  3VP8 A;  4RKD A;  4DBC A;  4LW2 A;  2IYO A;  1OW6 A;  3JZL A;  2VIB A;  2FNU A;  3AEB C;  1W2B O;  5E79 E;  5GTH E;  1N7S C;  3OKS A;  1JB0 J;  3LW5 H;  3RK2 B;  1SF2 A;  4MQR A;  1QX8 A;  3T97 A;  4GT1 A;  1E79 H;  2ZSM A;  1DTY A;  2VGT A;  1HGV A;  2WIT A;  1MDO A;  1NHL A;  4F5M A;  2BI5 A;  1CQ8 A;  1GW3 A;  1URQ A;  4LGD E;  1L4A C;  3N5M A;  2PAJ A;  3NTN A;  5TIS H;  2BWN A;  2D7Z A;  3MAF A;  1J2J B;  2AXT E;  2Z9V A;  3P6K A;  3RBL A;  3RK3 E;  1S07 A;  3A7O A;  1N73 A;  1CZC A;  1GBN A;  1LTT C;  1KIL E;  2DOU A;  2CJG A;  1SFC C;  3L70 E;  2CST A;  3FDB A;  3RK3 D;  1ECX A;  3JC2 2;  1YHQ P;  4XJO A;  4OBV A;  4ZKP A;  2FYU K;  1AY4 A;  1T6A A;  3CQ5 A;  1Y9B A;  2B9B A;  1BJ4 A;  2MKV A;  2GMS A;  1C7G A;  1VQ8 P;  3NYU A;  3EWK A;  2X5F A;  3B8X A;  4PFN A;  4U3F G;  1KB9 D;  3GWP A;  4N3Y B;  1KL2 A;  4H0L C;  2W83 C;  4PIW A;  3L4F A;  4OGQ B;  2PP6 A;  1YJY A;  2OYI A;  3QH9 A;  1G4X A;  2QJP B;  2XU6 A;  2YKX A;  1H8A A;  1N31 A;  3MTU E;  3CCS P;  2VYC A;  2A06 G;  9AAT A;  1GL2 A;  2YRI A;  1BE3 G;  2ZYJ A;  1ARI A;  4I7Z C;  3OJA B;  5CCH C;  1GEY A;  4IW7 A;  3VN0 A;  3II6 A;  4WYF A;  1WKH A;  3WKR A;  4RKU J;  3PD6 B;  2WT7 A;  2A45 H;  2ZXE B;  4I8A A;  3RL0 C;  4UHN A;  1L0N J;  2IDB A;  1SQB G;  1ZV8 A;  1AIA A;  2NPS B;  1WYU A;  4A6U A;  3CX5 I;  4WXF A;  3NNK A;  2CFB A;  1AHY A;  3LVK A;  1BE3 E;  1AKA A;  3V2N A;  1ZXG A;  3BCC G;  2YKQ A;  4F4E A;  2BEZ F;  1EXJ A;  4JEY A;  2NPS D;  2M3E A;  5CCG A;  1BCC G;  3IN6 A;  3COG A;  1OHV A;  3E1I A;  1LC5 A;  1SQB E;  1S0A A;  3F6T A;  1AAW A;  3H1H D;  4M3L A;  3N75 A;  5G2P A;  1BSH A;  1JY3 N;  4PJ0 E;  3AOV A;  1C7O A;  5E4Z A;  3RK2 C;  4ZAH A;  2J59 M;  3S9O A;  2YMY A;  3L71 D;  1AVO A;  1U7J A;  2OTJ P;  8AAT A;  1GU5 A;  3EIB A;  4YTP C;  2HP2 A;  1TOI A;  1RE3 C;  2RFV A;  1ZOB A;  2OKK A;  3PPL A;  2BWP A;  1RF1 C;  3ATH A;  3RQ1 A;  1S4X A;  2HP1 A;  4B9B A;  4MQQ A;  3HD7 A;  3E2Z B;  3E2F A;  4H13 B;  3CWB G;  3EUC A;  3VP9 A;  1HH0 A;  4GEB A;  2WPQ A;  1ASM A;  2EZ2 A;  2QBT A;  3NMD A;  1YQ3 C;  2WMM A;  1QLE D;  4H13 C;  1RE4 A;  2KSJ A;  3VOP A;  2N1T B;  4ADB A;  1OVR A;  3WX9 A;  1J32 A;  2R2N A;  1BGY J;  4ZLV A;  2A06 E;  1YTZ T;  2P10 A;  1H88 A;  1WST A;  3TGU D;  4KYO A;  3AV7 A;  3W1H A;  3BVH A;  2Y9Y A;  3H1H J;  2VMX A;  1FBM A;  2NPS A;  3P8M C;  2FBW C;  3CWB J;  4ASV A;  1ELU A;  4WB0 B;  2WSF H;  1OIP A;  4JF0 A;  3CPW O;  3GF7 A;  1W7N A;  2W8W A;  4FFC A;  1G4V A;  2P58 A;  2JJG A;  5K8B A;  1KKJ A;  5E79 H;  3CQ6 A;  2JO1 A;  2M5A A;  1ZP0 C;  3JWA A;  2JDI H;  2LXB A;  3AEC C;  4GSA A;  2XKM A;  1LWU A;  2KK7 A;  4WB4 A;  2IX7 C;  4K2M A;  2AEJ A;  2E74 B;  4M2M A;  1EDK A;  5G09 A;  2CJD A;  2ITA A;  2YHK A;  4HH2 A;  3AEO A;  4ZDL A;  4YXW H;  2W8U A;  1OVV A;  1L0N K;  3G8M A;  3H1K G;  2YCP A;  5EFS A;  1DD3 A;  1SQQ K;  4F5J A;  1DJE A;  1MAP A;  3P7K A;  4D6T E;  2R5C A;  3GZD A;  3AEM C;  1R5L A;  1SQP K;  1LT9 C;  4OTL A;  3KE3 A;  5EIG B;  4Y99 B;  2V7Q J;  1SVV A;  1CW5 A;  4WYD A;  2E76 D;  4Y99 C;  4WP0 A;  3ACZ A;  1TAT A;  3L70 D;  2YKP A;  2V7Q H;  4EB7 A;  2KXP B;  1DJ9 A;  1I43 A;  4OWF A;  4PD4 E;  3RUY A;  3G6E P;  2EYQ A;  1TOJ A;  2VRS A;  3CCE P;  1CS1 A;  3CXH H;  5AX8 A;  3CCR P;  3G7Q A;  3BCB A;  3FQA A;  1NU1 D;  1NTM G;  3IHJ A;  1LC7 A;  1GTW A;  4WY4 C;  2O01 H;  4GDO A;  5TJH A;  4UB6 H;  2O0R A;  3V2R A;  3AEA C;  2I8D A;  1KIL C;  3SWK A;  2ZJG A;  1RVU A;  1AQT A;  2AEM A;  1SFF A;  1JY3 P;  2ZYG A;  2FXM A;  3CWB D;  4WVZ A;  2A1V A;  1G1J A;  1AJY A;  3AE6 C;  1S5L X;  2DGM A;  1X79 B;  3PGY A;  3B5N A;  2BI3 A;  1ZLL A;  5TIS E;  3WMM 0;  2QEX P;  2QM8 A;  4ZDO A;  5JAY A;  1L0N D;  1PP9 E;  3WUT A;  3H1L E;  5M46 A;  5GTI H;  1K8A Q;  2ZYA A;  2ZT9 B;  2W6A A;  3CWB E;  4UQV A;  2JWD A;  1RHZ B;  4F5H A;  1SZS A;  4WXB A;  1ASF A;  1Z7D A;  3FFR A;  1JTH B;  2OYI B;  2DKB A;  3AE9 C;  2BHX A;  3KYQ A;  1AHG A;  1NAF A;  1SQP D;  2VI9 A;  3GHG B;  5FT8 A;  3H1H G;  5EFW B;  2ZY3 A;  3GET A;  5EIG A;  2FYU E;  3OA7 A;  3JSV C;  5D95 A;  3GJU A;  2VMO A;  2YOB A;  3B5N D;  2HUI A;  2EZ1 A;  2W7E A;  1AA0 A;  1VQK P;  2RKL A;  3MC6 C;  1Q82 Q;  1BJO B;  2HOX A;  5B66 H;  1DJU A;  4OGQ D;  1KMI Z;  2KLV A;  2WSS H;  3L74 D;  1QIT A;  2YXR B;  3IR9 A;  1A02 F;  2BKW A;  2W7L A;  1FC2 C;  3N4R A;  4U7J A;  3BC8 A;  1B9H A;  1CL2 A;  3PDX A;  5EQC A;  2ZT9 C;  5H2F E;  2W6J H;  1IUG A;  1VJO A;  1DH3 A;  1KB9 I;  2R5E A;  4CBS A;  1GDT A;  5DB5 A;  4RAE A;  3GZC A;  2KNC A;  3TF5 A;  3UAK A;  1LWU C;  1KMK A;  1HJB A;  1NU1 J;  1AY8 A;  2CY8 A;  3CBF A;  1AJR A;  1USD A;  1QL2 A;  3H25 A;  1K73 Q;  4W5K A;  4YPC A;  5G2Q A;  2W7H A;  3CQ4 A;  1HUC A;  2HG5 D;  4IXZ A;  1ZOD A;  5J8Q A;  1R8E A;  3G0T A;  3Q2Y A;  3MBB A;  4JF1 A;  1L0L K;  1ZW0 A;  3U59 A;  3JWB A;  1TU3 F;  1N8P A;  1EZV G;  2IFM A;  3O6Q B;  3V4W A;  3Q1M A;  4H44 C;  5FT6 A;  2LKM A;  1PFF A;  1M1J A;  4ZAS A;  2SPZ A;  1L0N E;  4NPF X;  1WKG A;  1SQQ G;  1M0O A;  3MC6 A;  2EH6 A;  3QI6 A;  1BDD A;  5M49 A;  2AAT A;  2ZYD A;  3I55 P;  4Q76 A;  2KB7 P;  3BWN C;  2JGT A;  4OC9 A;  1SQP E;  2LXC B;  3RK2 D;  3OAK A;  1SZU A;  4WBA A;  1KB9 E;  1IX8 A;  2JEE A;  2CAN A;  4GE4 A;  1DFO A;  1LTJ B;  5F9S A;  1W7M A;  2VMR A;  4Y0I A;  1NTZ J;  2DR1 A;  4LNL A;  1P84 H;  4H0L B;  3ISL A;  1CQ7 A;  4BA5 A;  4CXQ A;  1YQ4 C;  1QVG O;  5CJ4 A;  4A0G A;  3NUI A;  2V4H A;  1KTM A;  1AQ5 A;  3PLN A;  4PD4 D;  2R0T A;  1PGJ A;  1RVY A;  2D5Y A;  1S3J A;  3AEE C;  3KHU A;  3L74 G;  3P8C D;  1P84 I;  3HE5 B;  1T2K C;  2BI2 A;  2ZAE B;  1IJI A;  4AOA A;  1GL2 D;  1LTA C;  4TMR A;  4HYT B;  1IK9 A;  2W6B A;  3HTK B;  2B87 A;  4WY4 A;  1FZG A;  1M0Q A;  4GE9 A;  2E75 C;  1S5L E;  4LNJ A;  2K88 A;  2YCT A;  3KXD A;  3IFM A;  3ECD A;  2WT7 B;  5EAA A;  2BI1 A;  4LLH A;  3L75 G;  3KKI A;  1YJW P;  3CX5 D;  1JM0 A;  1SQX J;  3EFF K;  2YCN A;  1U7M A;  3HD7 C;  4AH3 A;  5CMZ A;  2WSC J;  1E5W A;  4ADC A;  1FZE A;  4N6J A;  1GEW A;  1FZC C;  4ZSY A;  2F8J A;  4K35 A;  2Q7C A;  4JPZ B;  1CI6 B;  2WB6 A;  2GMU A;  2L5G B;  1EZV E;  3A9X A;  4MN4 C;  1CZE A;  2X8U A;  2HYN A;  1VDF A;  4EIJ A;  5B5E E;  1FZC B;  2C0W A;  4DZO A;  3C1L A;  1UU0 A;  1DX7 A;  2N1T D;  3L73 G;  1OAT A;  4IL6 X;  3U1A A;  3USS A;  1FOS F;  1E5E A;  4ZMD A;  3FD0 A;  3AE2 C;  3C8V A;  1RF1 B;  2FFD B;  3A0H E;  1S72 P;  4ZM4 A;  3HLM A;  4O9B A;  2JR8 A;  2EO5 A;  2VGU A;  1G2C B;  5KAI H;  2C9N Y;  3HUS B;  3WGB A;  1MV8 A;  1IBJ A;  2UWJ E;  2BCC E;  5KJ7 D;  1YYC A;  4N0W A;  1CL1 A;  4EMY A;  3GLM A;  5KTB A;  2Z9X A;  1N7L A;  2X3L A;  5AVU B;  1YBK A;  1SQQ J;  2JG2 A;  3HL2 A;  1LNQ A;  2KIK A;  3NXS A;  1JMM A;  1QIR A;  2ZUK A;  4RO0 A;  2P2U A;  3F89 A;  3ASA A;  1FC4 A;  1QVF O;  3I56 P;  1ASL A;  2B89 A;  1NO4 A;  4M2K A;  3ELE A;  1NTM K;  5M4B A;  3JCU E;  4A00 A;  1OW7 A;  1GDE A;  3EI7 A;  1N73 C;  2VGZ A;  1VQL P;  3WGC A;  1NU1 E;  1LTJ C;  2VMN A;  4IOI H;  1L2P A;  3JCU H;  1XTC C;  1KFM A;  4UB6 E;  2Q6Q A;  1K04 A;  1OMI A;  1OW8 A;  4IXO A;  3BS8 A;  1SQV G;  1YNU A;  1C0N A;  3FZ8 A;  1LTJ A;  3PHL A;  3GG2 A;  3SFD C;  3T97 B;  2PO3 A;  3VP6 A;  3CCU P;  3GBX A;  1WYT B;  1BCC J;  4WYA A;  3KDP B;  2OQX A;  1BW0 A;  2CH1 A;  2FKW B;  3MUD C;  3EI6 A;  2A45 I;  1EZV D;  1ORD A;  4WLH A;  2WPR A;  3DXW A;  4J8L A;  2XNX A;  3FX0 A;  2OGE A;  4Y28 J;  2CPB A;  4EI2 A;  1IFJ A;  2BAS A;  5TF5 A;  1DKA A;  2K3R A;  1MKM A;  2XV5 A;  2QLR A;  4Y0D A;  4EB5 A;  1SQP J;  3F5H A;  2HR3 A;  2W7J A;  1HJ0 A;  1NH4 A;  3II0 A;  5EUD A;  4OYT A;  1RQV A;  3VK2 A;  1IAX A;  3CD6 P;  2Q7W A;  1DGD A;  1VF5 D;  1ZOY C;  2ZSL A;  3PDB B;  1TOE A;  3B46 A;  3H1I G;  4DQ6 A;  2RMZ A;  3FZ6 A;  3PH0 A;  4H44 B;  1NTK K;  4ISY A;  4KJM A;  1B4X A;  2KOG A;  2KZJ A;  3A5T A;  1NWQ A;  3AEF C;  3U1C A;  4ZSW A;  1AHF A;  2BCC G;  3LW5 J;  3L75 D;  1BS0 A;  4WXG A;  1WMK A;  3WUU A;  3MUD A;  1PMM A;  4CXR A;  3AE4 C;  2AY8 A;  2XND H;  4L76 A;  5M1B A;  4J5U A;  5C6U A;  3E6G A;  3A3Y B;  2HOY A;  1JY2 P;  3AE8 C;  4IYO A;  1B5P A;  4ZM3 A;  3BCX A;  4BQ0 A;  1AFO A;  5HDM A;  1EG5 A;  5KAF E;  1IJD B;  1K9M Q;  3R9A A;  2VI8 A;  4BHD A;  3AOW A;  2ZVN B;  1SFC B;  3TFT A;  1OZH A;  1JEK A;  4XFJ A;  2QVA A;  1ASN A;  3CC7 P;  3HTK A;  3AEP A;  4U3F J;  5AW1 B;  2HUF A;  3ZZJ A;  1WT6 A;  3ZRP A;  3P32 A;  4RM1 A;  4O6Z A;  1Q81 Q;  4M2J A;  4OMA A;  3FQ8 A;  3FRK A;  4L73 A;  3BRT B;  4IL6 E;  1YJZ A;  3UE8 A;  2WSE H;  3RBF A;  2O7C A;  2K9J A;  3M0D C;  2XDJ A;  3LG0 A;  2J58 A;  2WSC H;  5AVR B;  1A02 J;  1SLQ A;  3M9B A;  1KAF A;  3L70 J;  1NTM E;  4ZNC A;  1GC2 A;  1KIL A;  2CIN A;  4RJ0 A;  1AIB A;  3VOM A;  1FOS E;  1PFI A;  2Z20 A;  1SVF A;  2AY5 A;  3ELP A;  1KQG B;  4EDF A;  3B4S A;  1D7M A;  5APW A;  1NGM B;  3CMA P;  3RCH A;  3N0L A;  1V2E A;  3FDD A;  2AEF A;  3PJ0 A;  2R5B A;  2YRR A;  3EI5 A;  2E7U A;  2Q3E A;  2ZY5 A;  3QM2 A;  3LVL B;  1FZB A;  4H13 D;  2Z5H A;  2Z1Z A;  4MSO A;  1NTK E;  1YJN P;  3LIE A;  3JW9 A;  4DT0 A;  1EJI A;  3LVJ A;  3V5B A;  1L4A A;  2VIA A;  2Z9U A;  3L70 G;  1LGH B;  5APT A;  2N9B A;  3HUS A;  1QGN A;  1Z3Z A;  3NX3 A;  2IBZ E;  2AEV A;  3MKJ A;  3A9Y A;  1NTZ E;  3HD7 B;  2FKI A;  3M06 A;  3GZD C;  2O1J A;  3B71 A;  2VMQ A;  3WUV A;  1YI2 P;  1BGY G;  2ZC0 A;  4W8I A;  4LC3 A;  4QMA A;  4U3F D;  3TGU J;  1KKP A;  3HT4 A;  1X8Y A;  1FG3 A;  3AE5 C;  1XTG B;  2E75 B;  1ASB A;  1S5L H;  1IVR A;  1G7W A;  3QHX A;  5AVW B;  3WU2 E;  2QSI A;  1VQ5 P;  3I16 A;  3WCO A;  2FM1 A;  4PV1 B;  3CX5 E;  4PV1 D;  1P3W A;  1AMS A;  3L8A A;  3DZZ A;  3Q3D A;  1H1C A;  4CVQ A;  3EZ1 A;  1PZQ A;  3QWO C;  4BXL A;  3L72 E;  2GB3 A;  3CLQ A;  5KLI C;  2K37 A;  4GOD A;  3H9X A;  4QGR A;  4WLJ A;  3H1J J;  1ZR2 A;  2KYV A;  5APX A;  1ARH A;  1AY5 A;  2M5A B;  3EIA A;  2HPC B;  3L73 E;  1L4A D;  1S9K E;  4F5F A;  3M9H A;  2XBN A;  1B9I A;  1C7N A;  2OGA A;  2D66 A;  3A9Z A;  1URQ C;  1M0N A;  4IYO B;  1KYO D;  1USE A;  5EUE A;  1N73 B;  1J1D C;  1JY3 O;  1M7L A;  2DW3 A;  1SFC D;  2BI9 A;  5KJ7 C;  4OVN F;  1L4A B;  2WSE J;  4MKK A;  3M0A A;  4BRY A;  4F5G A;  3RK3 C;  1PIX A;  2XZR A;  1KD1 Q;  5F8V A;  3MHV A;  3H1I D;  1TAR A;  3NDN A;  1SQB J;  1LW4 A;  2YXQ B;  1SQV K;  4IFM A;  4ATQ A;  1X2A A;  1S09 A;  4EU1 A;  1RE3 A;  2C0X A;  2H7H A;  2Z61 A;  1C4K A;  3HBX A;  3W1I A;  1IFI A;  1QEX A;  1S9K D;  3GW6 A;  3MAU A;  3MZW B;  4AQR D;  4KXK A;  4WB0 A;  4MQP A;  4AO4 A;  1JOC A;  1EQ7 A;  1SQQ E;  3AEN B;  1M4N A;  1X0T A;  3H7F A;  1L0L J;  3H1H E;  2GA1 A;  2D2C C;  3L72 D;  3HMU A;  1QGK B;  2W8V A;  3K5B A;  4HB1 A;  3V4Q A;  4CBR A;  1MUU A;  1DD4 A;  1W3U A;  3S4R A;  2FXO A;  3FKD A;  2EGY A;  1SP4 A;  1SPA A;  4PD4 I;  3H1K D;  1KYO E;  3CCL P;  2A45 G;  5EAV A;  4XQ2 A;  1CZQ A;  3E2Z A;  1FJK A;  3AED C;  1AVY A;  1FJP A;  1IFP A;  1SFC A;  3BAS A;  1EDL A;  3K40 A;  2CTZ A;  3EI8 A;  1IFN A;  5AVV B;  4GDY A;  2YIU B;  4ZWM A;  1GL2 B;  1NTZ K;  3P1T A;  1IZN B;  1PL5 A;  2QG4 A;  3CXH D;  1AV1 A;  2VMW A;  4JEX A;  4I1L A;  2BIA A;  2AXC A;  2H43 A;  4RJY A;  1GC4 A;  1M32 A;  1NAY A;  1PPJ G;  1NTM J;  4OBU A;  5HXX A;  3UWC A;  2O01 N;  5AW5 B;  4R4M A;  5KKZ C;  4GOE A;  2CJH A;  3AEJ A;  4W7Z A;  2IPP A;  1SQP G;  1T8Z A;  3EQ2 A;  5AVT B;  2A06 D;  3DYD A;  3W1J A;  4ITG A;  4I2L C;  3H1J G;  1RY3 A;  4RIZ A;  3H1I J;  2FN6 A;  1BJO A;  1M57 D;  4U3F E;  3TK1 A;  3PAA A;  5APV A;  2HOD A;  4GOF A;  1URQ B;  1N7S D;  1PGP A;  1L0N G;  4HF8 A;  2VGS A;  4W1X A;  2D61 A;  2OYH C;  2KSE A;  2BCC J;  1VP4 A;  2IBZ D;  2HOZ A;  1RH5 B;  2KLU A;  2H89 C;  4JF7 A;  2ZVO B;  4HKZ H;  4LNM A;  3H1L D;  2B87 B;  4WY4 B;  1SQX D;  2OYH A;  4BA4 A;  1AHX A;  1D2F A;  4B98 A;  1KIL B;  3TGU E;  1HWT C;  1LT1 A;  3UIA A;  1Q90 D;  3A8U X;  5CCG C;  3SSU A;  2ZXX A;  3E7K A;  4ZWV A;  1H0T A;  2OYH B;  3NTJ A;  4JYB A;  5KLV K;  4YXD C;  1GZL A;  2R3C A;  3LVM A;  3E2Y A;  2WPS A;  3BCC E;  1SQX K;  2HOR A;  1VQ4 P;  1TOK A;  2WTY A;  1PGQ A;  1VL2 A;  1ELQ A;  4WD2 A;  2KI7 B;  1M90 Q;  3WU2 H;  3L75 E;  1EZV I;  4EFF A;  5E5I A;  2QJK B;  3M5U A;  3PIU A;  4W80 A;  1AJS A;  5AW9 B;  2ORD A;  1BCC E;  4H51 A;  4MY5 A;  1LT9 A;  1KB9 H;  1JY2 O;  4XAU A;  1SQB D;  3L35 A;  3TSI A;  2E74 D;  2E42 A;  3AEL A;  2QMA A;  1T2K D;  2D2C B;  2CK3 H;  3K7Y A;  5K5G B;  3MGN A;  2AY1 A;  1AAM A;  1GL2 C;  2M3B A;  3NFQ A;  2V1P A;  4D6T G;  4N78 D;  1HGZ A;  1S1C X;  3W67 A;  2QB2 A;  1D7V A;  3L74 E;  1H0T B;  4OH8 B;  3D6K A;  1PPJ E;  2OQQ A;  3RBX A;  3B1C A;  3H1K E;  4JEZ A;  2LR2 A;  1LC8 A;  2N1T A;  4AO9 A;  3R4Y A;  2P67 A;  2ZJS E;  3VYI A;  1QJ3 A;  5BJ3 A;  3L72 J;  3LID A;  1JY2 N;  2GM4 A;  4K3A A;  1YJ9 P;  4F5I A;  4W91 A;  2JIS A;  3H1J E;  2WQY C;  2ZT9 D;  1M56 D;  5D5S A;  2ZY2 A;  5AW3 B;  1Y47 A;  1O61 A;  3BCA A;  2E76 C;  3V2Q A;  2IBZ I;  1YIZ A;  1GK4 A;  1SQQ D;  3WKS A;  3TQX A;  3L36 A;  2O1B A;  1PP9 J;  2J5U A;  1D7R A;  2PRR A;  3PJS K;  5AVX B;  4L74 A;  4XEW A;  2W7I A;  1J1D B;  1J1E C;  3H32 B;  1AKC A;  1MZ9 A;  5APS A;  1OFC X;  3VTP C;  4BMK A;  4WY4 D;  2FYU D;  3F0H A;  1YIY A;  4ADD A;  4E77 A;  5EUN A;  4A6T A;  5L8R J;  2QA3 A;  1X29 A;  1J04 A;  5E3K A;  2OTL P;  5AVY B;  1HVV A;  1ZC9 A;  1N2D C;  1SQB K;  3AEM A;  1KMJ A;  3WZF A;  1I41 A;  4F5K A;  1M1J C;  1AMQ A;  1Y4I A;  1NU1 K;  2AY3 A;  4HVK A;  1L0L G;  2W7G A;  3A2B A;  1AX4 A;  2AY9 A;  3HQT A;  1M8O B;  2DGK A;  1KQL A;  2RH0 A;  1ZRT E;  3MD0 A;  4KAM A;  3MIW A;  1M0P A;  2FYN C;  5C39 A;  3L71 G;  1ARS A;  2JJF A;  1HTL C;  1TOG A;  3L37 A;  4B86 A;  3HVY A;  2H8P D;  1YJS A;  2C9L Y;  3L71 E;  4R4L A;  2HFE D;  2QJY B;  2BCC D;  2Q3I A;  2VLF A;  4A7P A;  5KAF H;  3QBO A;  3FGA D;  4IY7 A;  2G7J A;  4CPG A;  2HPC A;  2FYZ A;  1O69 A;  3G71 P;  5AW6 B;  3QPG A;  3M9Q A;  4A0F A;  1SQX E;  1CQ6 A;  2Q5U A;  3CXH E;  1NKN A;  2M0B A;  3FSL A;  3B1E A;  2WK8 A;  1UIX A;  4XJP A;  4EOT A;  1RV3 A;  2K1A A;  4OGQ C;  1ASA A;  3OP7 A;  2D2C D;  2R44 A;  4NOG A;  3TDK A;  1GEX A;  4ZDP A;  1C9C A;  4D6T J;  2W90 A;  2QB3 A;  2OTK E;  1OXP A;  1GW4 A;  4GE7 A;  1SQV J;  5DJU B;  4DGT A;  2D64 A;  2GQN A;  1UII A;  2JP3 A;  1LTB C;  1ASG A;  2Z1Y A;  3L75 J;  1N86 A;  2Y0C A;  1OXZ A;  4IFF A;  4PVF A;  1ASE A;  2QJP C;  2AEU A;  2R5C B;  1ZR4 A;  3CCM P;  3N4S A;  3DR7 A;  2OAR A;  1AKB A;  1PG8 A;  3FWL A;  3AEG C;  2L91 A;  3PD6 A;  1Q7Y Q;  2BIE A;  2FXP A;  2YKU A;  2VMU A;  3TNU B;  2Y9Z A;  1VF5 C;  2G8Y A;  1XEY A;  3EFG A;  3HRN A;  4JEW A;  2H88 C;  2KNC B;  2OAT A;  5GTI E;  1M1J B;  2N1T C;  1EC5 A;  1Z56 A;  4ATP A;  3TFU A;  3FCR A;  1OX3 A;  4GKG A;  4TN4 A;  3H1I E;  3Q5P A;  2BYJ A;  4U1T A;  4ITX A;  1BJW A;  5B66 E;  3BRV B;  4UB8 E;  4MKJ A;  4R8D A;  3O8Z A;  4H63 Q;  1AJS B;  4PJ0 H;  4GIF A;  1BGY E;  1O4S A;  2VMT A;  1S06 A;  1N7S B;  3FQ7 A;  1JMB A;  3H1L J;  2JWA A;  3KPE A;  1VQ6 P;  1LP1 A;  5I92 A;  1G1I A;  4IL6 H;  1ZN5 A;  3KGW A;  1DEE G;  3L72 G;  5B5E H;  3E77 A;  3KZI H;  3P8C E;  1OHY A;  1JS6 A;  3SWY A;  2G3A A;  3G9R A;  3N7N A;  2QA4 P;  1OXO A;  4E3R A;  4BRY B;  1FU1 A;  1JTH A;  2GUS A;  3L73 J;  2GSA A;  3B8E B;  3AEJ C;  3PTZ A;  2HUU A;  2I1K A;  1VQO P;  3Q5R A;  3R4T A;  2C7T A;  3VAX A;  3IF4 A;  1FAV A;  3TCM A;  3W68 A;  1NTK G;  3N4X A;  3LY1 A;  3ABV C;  1OHW A;  3LWS A;  2O3J A;  2E75 D;  2E43 A;  1JS3 A;  1U57 A;  3D71 A;  3BB8 A;  1MLY A;  4E1O A;  3AE3 C;  1UU1 A;  3CCJ P;  1JNM A;  3WCN A;  4IXS A;  2Z5I A;  5CCH D;  1ART A;  4KHX A;  1LP1 B;  4W7Y A;  1DGE A;  3CXH I;  3WLX A;  1N8R Q;  1G2C A;  1Y8A A;  2W8Z A;  1QZ9 A;  5KLV J;  2NZ2 A;  1BQA A;  3RL0 B;  4WYE A;  2VGW A;  3RL0 D;  2QJK C;  3B5N C;  1B5O A;  2QIW A;  1KQF B; 
#chains in the Genus database with same CATH homology
 3GR9 A;  3VMZ A;  1H89 A;  3M91 A;  3F9T A;  4PFF A;  4OCA A;  1M7Y A;  2R5D A;  3FZ7 A;  3G3Z A;  3KQG A;  3ZRR A;  1FZA A;  1LK9 A;  1MDX A;  3SWF A;  1GK6 A;  1LTG C;  2VMZ A;  2KP8 A;  2NPS C;  2W7F A;  5M4D A;  4A6R A;  2VMY A;  1AMA A;  1JCD A;  3BV0 A;  4RIT A;  4LW4 A;  2PB2 A;  3VK4 A;  3C9I A;  2Q9I A;  2KFP A;  1CI6 A;  4R2N A;  2W8J A;  3DOD A;  3GSB A;  3EZS A;  1D7U A;  1VPC A;  1MGV A;  5DJ9 A;  2E7I A;  2W8T A;  4C7N A;  4AYC A;  1IX6 A;  1LTI C;  2C44 A;  3FFH A;  2X5D A;  2JJL A;  1X9V A;  3AAT A;  1KIL D;  1YAA A;  2FYF A;  7AAT A;  2YO3 A;  1IFM A;  3NU8 A;  4XJL A;  1N2T A;  4WYC A;  2P7J A;  3NRA A;  2W7M A;  1QJ5 A;  1WYV B;  4K2I A;  2DKJ A;  1HBW A;  3VMX A;  2JJH A;  1URQ D;  1TAS A;  3H6P A;  1MFZ A;  2WWW A;  1KZU B;  4JEV A;  3B1D A;  3E9K A;  3QN6 A;  4WYG A;  1UKJ A;  1XI9 A;  2YKV A;  4XA4 A;  1ASD A;  1B8G A;  1H0C A;  3DXV A;  1BKG A;  1KL1 A;  2C81 A;  4FL0 A;  1W23 A;  3PA9 A;  3BWN A;  3EI9 A;  3QGU A;  1LKC A;  5KJ7 A;  2FFD A;  3DC1 A;  3MAF B;  1GC0 A;  1TPL A;  4JYC A;  1LWU B;  3NYT A;  4UOY A;  3GHG C;  3HE4 A;  5AW4 B;  3V2P A;  1BQD A;  1RE4 C;  2WK9 A;  2I1J A;  2W7D A;  5G4J A;  1V2F A;  2GUV A;  1YTZ I;  2AY6 A;  5AW8 B;  2ZFC A;  2OYI C;  2YNY A;  3VMY A;  3ZZK A;  2IFN A;  2AY2 A;  2WZ7 A;  4AZK A;  1OWA A;  3DR4 A;  1GCK A;  3BAT A;  1MAQ A;  3K28 A;  5IWQ A;  1JUN A;  3FVU A;  3DU4 A;  1U08 A;  4K2B A;  1CSB A;  2YKO A;  1GD9 A;  3CAI A;  4I6M C;  2WKA A;  2HOD B;  2QM7 A;  3RK3 B;  2EPJ A;  2FNI A;  1S08 A;  2JJE A;  4LC1 A;  1FDM A;  3M0D A;  3TAT A;  4A0R A;  3JTX A;  4Q75 A;  5BU8 B;  3MAD A;  2V0Y A;  3AEN A;  4U2H A;  3FVX A;  4W1V A;  1IAY A;  5AVZ B;  2HLO A;  3GHG A;  1CJ0 A;  5HHY A;  1KFN A;  2VMS A;  1W2E A;  4RES B;  1MLZ A;  1LT9 B;  5BVZ A;  1E5F A;  1ASC A;  2HZP A;  1WYU B;  2PB0 A;  4Y0H A;  1JF9 A;  3USF A;  2NMP A;  3BN1 A;  2VMV A;  5CCH A;  1IC2 A;  5AW0 B;  1WYT A;  1YOO A;  4XE5 B;  2Z9W A;  4A0H A;  1JO5 A;  5AVS B;  2WK7 A;  1SZK A;  2D65 A;  3HDO A;  5G4I A;  4RKC A;  1T3I A;  3CI9 A;  2P1J A;  1NKZ B;  2O1K A;  4L0O A;  1O62 A;  2G6W A;  3VK3 A;  1JCC A;  2DGL A;  4C7R A;  4IX8 A;  2POH A;  3HD7 D;  1BT4 A;  2C0R A;  3PDB A;  3H32 A;  2ZP7 A;  5CHX A;  2AY4 A;  4E3Q A;  3RI6 A;  1AHE A;  1T3J A;  1W7L A;  3HE4 B;  5G0A A;  4DOJ A;  2OKJ A;  5BU5 A;  2BIG A;  5APY A;  4F5L A;  2VGV A;  1V72 A;  4P7Y A;  2E54 A;  3TYY A;  1V2D A;  4K05 A;  1FG7 A;  4ADE A;  5FT4 A;  4IFD K;  1UU2 A;  1GC3 A;  2CB1 A;  2ZY4 A;  2W27 A;  1J1E B;  3NUB A;  1DEB A;  3HUS C;  1T3U A;  4R5Z A;  1BJN A;  5APQ A;  1AIC A;  2AY7 A;  4A72 A;  5FT5 A;  1FZC A;  2FFD C;  2FQ6 A;  3TNU A;  1ARG A;  3A2A A;  2CPS A;  2W7K A;  1RF1 A;  4UHO A;  2YO2 A;  1NOH A;  1RV4 A;  3FTB A;  4C7N B;  1PMO A;  2YKY A;  3LV2 A;  2R32 A;  5DJ1 A;  1IFD A;  3NYS A;  1WRG A;  4C46 A;  4ZKU A;  1IO4 A;  3FVS A;  4P3M A;  4UHM A;  4XK1 A;  1QIS A;  4OT8 A;  1JG8 A;  5AW7 B;  3I4J A;  4AZJ A;  4GRX A;  4Q31 A;  1G7X A;  2CH2 A;  5DX5 A;  1FZF A;  4W1W A;  1GD2 E;  5APU A;  5AW2 B;  5CCG D;  1X0M A;  3R2P A;  1QL1 A;  1LTS C;  5AVQ B;  1VEF A;  2BYL A;  2D63 A;  2D7Y A;  4Q6R A;  4R5F A;  2BWO A;  1I29 A;  3DRD A;  2MJZ A;  3L44 A;  1EQB A;  3RCH B;  1GU4 A;  1M6S A;  3NU7 A;  1N7S A;  2QSR A;  2VLH A;  1LW5 A;  3I5C A;  4XJM A;  4RLG A;  1WYV A;  1I48 A;  3ZRQ A;  1X28 A;  1D7S A;  1RF0 C;  3PP5 A;  4AUW A;  3WY7 A;  4WBT A;  3MEB A;  3B5N B;  2E7J A;  3CL3 D;  3ASB A;  1IX7 A;  2M8R A;  2VMP A;  2Z4E A;  3KGX A;  5BJ4 A;  1MDZ A;  5CJ0 A;  1AMR A;  2TPL A;  2XH1 A;  3Q8N A;  3HE5 A;  3I5T A;  1LS3 A;  3T32 A;  1RF0 A;  3BWO A;  4N78 E;  3VP8 A;  4RKD A;  4DBC A;  4LW2 A;  3JZL A;  2VIB A;  2FNU A;  1N7S C;  3OKS A;  3LW5 H;  3RK2 B;  1SF2 A;  4MQR A;  3T97 A;  4GT1 A;  2ZSM A;  1DTY A;  2VGT A;  1HGV A;  2WIT A;  1MDO A;  1NHL A;  4F5M A;  2BI5 A;  1CQ8 A;  1GW3 A;  1URQ A;  4LGD E;  1L4A C;  3N5M A;  2PAJ A;  3NTN A;  2BWN A;  2D7Z A;  3MAF A;  1J2J B;  2Z9V A;  3P6K A;  3RBL A;  1S07 A;  3A7O A;  1N73 A;  1CZC A;  1GBN A;  1LTT C;  2DOU A;  2CJG A;  1SFC C;  2CST A;  3FDB A;  3RK3 D;  1ECX A;  4XJO A;  4OBV A;  4ZKP A;  2FYU K;  1AY4 A;  3CQ5 A;  1BJ4 A;  2GMS A;  1C7G A;  3NYU A;  3B8X A;  2X5F A;  4PFN A;  3GWP A;  4N3Y B;  1KL2 A;  4PIW A;  3L4F A;  2PP6 A;  1YJY A;  2OYI A;  1G4X A;  2XU6 A;  2YKX A;  1H8A A;  1N31 A;  3MTU E;  2VYC A;  9AAT A;  1GL2 A;  2YRI A;  2ZYJ A;  1ARI A;  3OJA B;  5CCH C;  1GEY A;  4IW7 A;  3VN0 A;  3II6 A;  4WYF A;  1WKH A;  3WKR A;  3PD6 B;  2WT7 A;  2A45 H;  2ZXE B;  4I8A A;  3RL0 C;  4UHN A;  1ZV8 A;  1AIA A;  2NPS B;  1WYU A;  4A6U A;  4WXF A;  3NNK A;  2CFB A;  1AHY A;  3LVK A;  1AKA A;  3V2N A;  2YKQ A;  4F4E A;  4JEY A;  2NPS D;  5CCG A;  3COG A;  1OHV A;  3E1I A;  1LC5 A;  1S0A A;  3F6T A;  1AAW A;  4M3L A;  3N75 A;  5G2P A;  1JY3 N;  3AOV A;  1C7O A;  5E4Z A;  3RK2 C;  4ZAH A;  2J59 M;  2YMY A;  8AAT A;  1GU5 A;  3EIB A;  2HP2 A;  1TOI A;  1RE3 C;  2RFV A;  1ZOB A;  2OKK A;  3PPL A;  2BWP A;  1RF1 C;  3ATH A;  3RQ1 A;  2HP1 A;  4B9B A;  4MQQ A;  3HD7 A;  3E2Z B;  3E2F A;  3EUC A;  3VP9 A;  1HH0 A;  4GEB A;  2WPQ A;  1ASM A;  2EZ2 A;  2QBT A;  3NMD A;  1RE4 A;  2KSJ A;  3VOP A;  2N1T B;  4ADB A;  3WX9 A;  1J32 A;  2R2N A;  4ZLV A;  1YTZ T;  1H88 A;  1WST A;  4KYO A;  3AV7 A;  3W1H A;  3BVH A;  2VMX A;  1FBM A;  2NPS A;  3P8M C;  1ELU A;  4WB0 B;  2WSF H;  4JF0 A;  2W8W A;  1W7N A;  4FFC A;  1G4V A;  2JJG A;  5K8B A;  1KKJ A;  3CQ6 A;  3JWA A;  4GSA A;  2XKM A;  1LWU A;  4WB4 A;  2IX7 C;  4K2M A;  4M2M A;  5G09 A;  2CJD A;  2YHK A;  4HH2 A;  3AEO A;  4ZDL A;  2W8U A;  1L0N K;  3G8M A;  2YCP A;  5EFS A;  1SQQ K;  4F5J A;  1DJE A;  1MAP A;  3P7K A;  2R5C A;  3GZD A;  3AEM C;  1SQP K;  1LT9 C;  4OTL A;  3KE3 A;  5EIG B;  4Y99 B;  1SVV A;  1CW5 A;  4WYD A;  4Y99 C;  4WP0 A;  3ACZ A;  1TAT A;  2YKP A;  4EB7 A;  1DJ9 A;  1I43 A;  3RUY A;  2EYQ A;  1TOJ A;  2VRS A;  1CS1 A;  5AX8 A;  3G7Q A;  3BCB A;  3FQA A;  3IHJ A;  1LC7 A;  1GTW A;  4WY4 C;  2O01 H;  2O0R A;  3V2R A;  1KIL C;  2ZJG A;  1RVU A;  1SFF A;  1JY3 P;  2FXM A;  2A1V A;  1G1J A;  2DGM A;  1X79 B;  3PGY A;  3B5N A;  2BI3 A;  1ZLL A;  3WMM 0;  2QM8 A;  4ZDO A;  5JAY A;  5M46 A;  2W6A A;  4UQV A;  4F5H A;  1SZS A;  4WXB A;  1ASF A;  1Z7D A;  3FFR A;  1JTH B;  2OYI B;  2DKB A;  2BHX A;  3KYQ A;  1AHG A;  1NAF A;  2VI9 A;  3GHG B;  5FT8 A;  2ZY3 A;  3GET A;  5EIG A;  3OA7 A;  5D95 A;  3GJU A;  2VMO A;  2YOB A;  3B5N D;  2HUI A;  2EZ1 A;  2W7E A;  3MC6 C;  1BJO B;  2HOX A;  1DJU A;  2KLV A;  1QIT A;  3IR9 A;  1A02 F;  2BKW A;  2W7L A;  3N4R A;  3BC8 A;  1B9H A;  1CL2 A;  3PDX A;  5EQC A;  1IUG A;  1VJO A;  1DH3 A;  2R5E A;  4CBS A;  1GDT A;  5DB5 A;  4RAE A;  3GZC A;  3UAK A;  1LWU C;  1KMK A;  1HJB A;  1AY8 A;  2CY8 A;  3CBF A;  1AJR A;  1QL2 A;  4W5K A;  5G2Q A;  2W7H A;  3CQ4 A;  1HUC A;  2HG5 D;  4IXZ A;  1ZOD A;  5J8Q A;  3G0T A;  3MBB A;  4JF1 A;  1L0L K;  3U59 A;  3JWB A;  1N8P A;  2IFM A;  3V4W A;  5FT6 A;  2LKM A;  1PFF A;  1M1J A;  4ZAS A;  1WKG A;  1M0O A;  3MC6 A;  2EH6 A;  3QI6 A;  5M49 A;  2AAT A;  4Q76 A;  2KB7 P;  3BWN C;  2JGT A;  4OC9 A;  3RK2 D;  3OAK A;  1SZU A;  4WBA A;  1IX8 A;  2JEE A;  2CAN A;  4GE4 A;  1DFO A;  1LTJ B;  5F9S A;  1W7M A;  2VMR A;  4Y0I A;  2DR1 A;  4LNL A;  3ISL A;  1CQ7 A;  4BA5 A;  4CXQ A;  4A0G A;  5CJ4 A;  3NUI A;  1AQ5 A;  2R0T A;  1RVY A;  2D5Y A;  3P8C D;  3HE5 B;  1T2K C;  2BI2 A;  1IJI A;  4AOA A;  1GL2 D;  1LTA C;  4TMR A;  4HYT B;  1IK9 A;  2W6B A;  3HTK B;  4WY4 A;  1FZG A;  1M0Q A;  4GE9 A;  4LNJ A;  2YCT A;  3IFM A;  3ECD A;  2WT7 B;  5EAA A;  2BI1 A;  4LLH A;  3KKI A;  2YCN A;  3HD7 C;  4AH3 A;  5CMZ A;  1E5W A;  4ADC A;  1FZE A;  4N6J A;  1GEW A;  1FZC C;  4ZSY A;  2F8J A;  2Q7C A;  1CI6 B;  2WB6 A;  2GMU A;  2L5G B;  3A9X A;  1CZE A;  2X8U A;  2HYN A;  1VDF A;  4EIJ A;  1FZC B;  2C0W A;  4DZO A;  1UU0 A;  1DX7 A;  2N1T D;  1OAT A;  3U1A A;  1FOS F;  1E5E A;  3FD0 A;  1RF1 B;  2FFD B;  4ZM4 A;  3HLM A;  4O9B A;  2EO5 A;  2VGU A;  1G2C B;  2C9N Y;  3HUS B;  3WGB A;  1MV8 A;  1IBJ A;  5KJ7 D;  1YYC A;  4N0W A;  1CL1 A;  4EMY A;  5KTB A;  2Z9X A;  1N7L A;  2X3L A;  5AVU B;  2JG2 A;  3HL2 A;  2ZUK A;  3NXS A;  1JMM A;  1QIR A;  2P2U A;  3ASA A;  1FC4 A;  1ASL A;  1NO4 A;  4M2K A;  3ELE A;  1NTM K;  5M4B A;  4A00 A;  1GDE A;  3EI7 A;  1N73 C;  2VGZ A;  3WGC A;  1LTJ C;  2VMN A;  1XTC C;  1KFM A;  4IXO A;  3BS8 A;  1YNU A;  1C0N A;  3FZ8 A;  1LTJ A;  2PO3 A;  3VP6 A;  3GBX A;  1WYT B;  4WYA A;  3KDP B;  2OQX A;  1BW0 A;  2CH1 A;  2FKW B;  3EI6 A;  2A45 I;  1ORD A;  4WLH A;  2WPR A;  3DXW A;  4J8L A;  2XNX A;  2OGE A;  2CPB A;  1IFJ A;  2BAS A;  5TF5 A;  1DKA A;  2XV5 A;  2QLR A;  4Y0D A;  4EB5 A;  2W7J A;  1NH4 A;  3II0 A;  5EUD A;  4OYT A;  3VK2 A;  1IAX A;  2Q7W A;  1DGD A;  2ZSL A;  3PDB B;  1TOE A;  3B46 A;  4DQ6 A;  3FZ6 A;  1NTK K;  4ISY A;  1B4X A;  2KOG A;  3A5T A;  1NWQ A;  3U1C A;  4ZSW A;  1AHF A;  1BS0 A;  4WXG A;  3MUD A;  1PMM A;  4CXR A;  2AY8 A;  4J5U A;  5C6U A;  3E6G A;  3A3Y B;  2HOY A;  1JY2 P;  4IYO A;  1B5P A;  4ZM3 A;  3BCX A;  4BQ0 A;  1AFO A;  5HDM A;  1EG5 A;  1IJD B;  3R9A A;  2VI8 A;  4BHD A;  3AOW A;  3TFT A;  1SFC B;  1ASN A;  3HTK A;  3AEP A;  2HUF A;  5AW1 B;  3ZZJ A;  1WT6 A;  3ZRP A;  3P32 A;  4RM1 A;  4O6Z A;  4M2J A;  4OMA A;  3FQ8 A;  3FRK A;  3BRT B;  1YJZ A;  3UE8 A;  2WSE H;  3RBF A;  2O7C A;  3M0D C;  2XDJ A;  3LG0 A;  2J58 A;  2WSC H;  5AVR B;  1A02 J;  1SLQ A;  3M9B A;  1GC2 A;  1KIL A;  2CIN A;  4RJ0 A;  1AIB A;  3VOM A;  1FOS E;  1PFI A;  2Z20 A;  1SVF A;  2AY5 A;  3ELP A;  5APW A;  3RCH A;  3N0L A;  1V2E A;  3FDD A;  3PJ0 A;  2R5B A;  2YRR A;  3EI5 A;  2E7U A;  2ZY5 A;  3QM2 A;  3LVL B;  1FZB A;  2Z5H A;  2Z1Z A;  4MSO A;  3LIE A;  3JW9 A;  1EJI A;  3LVJ A;  3V5B A;  1L4A A;  2VIA A;  2Z9U A;  1LGH B;  5APT A;  2N9B A;  3HUS A;  1QGN A;  1Z3Z A;  3NX3 A;  2AEV A;  3MKJ A;  3A9Y A;  3HD7 B;  2FKI A;  3M06 A;  3GZD C;  2O1J A;  2VMQ A;  2ZC0 A;  4W8I A;  4LC3 A;  1KKP A;  3HT4 A;  1X8Y A;  1FG3 A;  1XTG B;  1ASB A;  1IVR A;  1G7W A;  3QHX A;  5AVW B;  3I16 A;  3WCO A;  2FM1 A;  1P3W A;  1AMS A;  3L8A A;  3DZZ A;  1H1C A;  4CVQ A;  3EZ1 A;  2GB3 A;  3CLQ A;  3H9X A;  4QGR A;  4WLJ A;  1ZR2 A;  2KYV A;  5APX A;  1ARH A;  1AY5 A;  3EIA A;  2HPC B;  1L4A D;  1S9K E;  4F5F A;  3M9H A;  2XBN A;  1B9I A;  1C7N A;  2OGA A;  2D66 A;  3A9Z A;  1URQ C;  1M0N A;  4IYO B;  5EUE A;  1N73 B;  1J1D C;  1JY3 O;  1M7L A;  1SFC D;  2BI9 A;  5KJ7 C;  4MKK A;  1L4A B;  3M0A A;  4F5G A;  3RK3 C;  2XZR A;  5F8V A;  1TAR A;  3NDN A;  1LW4 A;  1SQV K;  4IFM A;  4ATQ A;  1X2A A;  1S09 A;  4EU1 A;  1RE3 A;  2C0X A;  2H7H A;  2Z61 A;  1C4K A;  3HBX A;  3W1I A;  1IFI A;  1S9K D;  3MAU A;  4AQR D;  4KXK A;  4WB0 A;  4MQP A;  4AO4 A;  1JOC A;  1EQ7 A;  3AEN B;  1M4N A;  3H7F A;  3HMU A;  2W8V A;  3V4Q A;  4CBR A;  1MUU A;  1W3U A;  3FKD A;  2EGY A;  1SP4 A;  1SPA A;  2A45 G;  5EAV A;  4XQ2 A;  1CZQ A;  3E2Z A;  1FJK A;  1FJP A;  1SFC A;  3BAS A;  3K40 A;  2CTZ A;  3EI8 A;  1IFN A;  5AVV B;  4GDY A;  4ZWM A;  1GL2 B;  1NTZ K;  3P1T A;  2VMW A;  4JEX A;  4I1L A;  2BIA A;  2H43 A;  4RJY A;  1GC4 A;  1M32 A;  4OBU A;  5HXX A;  3UWC A;  5AW5 B;  2CJH A;  3AEJ A;  4W7Z A;  2IPP A;  1T8Z A;  3EQ2 A;  5AVT B;  3DYD A;  3W1J A;  4ITG A;  4I2L C;  1RY3 A;  4RIZ A;  2FN6 A;  1BJO A;  3TK1 A;  3PAA A;  5APV A;  2HOD A;  1URQ B;  1N7S D;  4HF8 A;  2VGS A;  4W1X A;  2D61 A;  2OYH C;  1VP4 A;  2HOZ A;  4JF7 A;  4LNM A;  4WY4 B;  2OYH A;  4BA4 A;  1AHX A;  1D2F A;  4B98 A;  1KIL B;  1HWT C;  3UIA A;  3A8U X;  5CCG C;  4ZWV A;  2OYH B;  3NTJ A;  4JYB A;  5KLV K;  1GZL A;  2R3C A;  3LVM A;  3E2Y A;  2WPS A;  1SQX K;  2HOR A;  1TOK A;  2WTY A;  1ELQ A;  4WD2 A;  4EFF A;  5E5I A;  3M5U A;  3PIU A;  4W80 A;  1AJS A;  5AW9 B;  2ORD A;  4H51 A;  4MY5 A;  1LT9 A;  1JY2 O;  4XAU A;  3L35 A;  3TSI A;  2E42 A;  3AEL A;  2QMA A;  1T2K D;  3K7Y A;  3MGN A;  2AY1 A;  1AAM A;  1GL2 C;  2M3B A;  3NFQ A;  2V1P A;  4N78 D;  1HGZ A;  2QB2 A;  1D7V A;  4OH8 B;  3D6K A;  3B1C A;  4JEZ A;  1LC8 A;  2N1T A;  4AO9 A;  2P67 A;  3VYI A;  1QJ3 A;  5BJ3 A;  3LID A;  1JY2 N;  2GM4 A;  4F5I A;  4W91 A;  2JIS A;  5D5S A;  2ZY2 A;  5AW3 B;  1O61 A;  3BCA A;  3V2Q A;  1YIZ A;  1GK4 A;  3WKS A;  3TQX A;  3L36 A;  2O1B A;  1D7R A;  5AVX B;  4XEW A;  2W7I A;  1J1D B;  1J1E C;  3H32 B;  1AKC A;  1MZ9 A;  5APS A;  3VTP C;  4BMK A;  4WY4 D;  3F0H A;  1YIY A;  4ADD A;  4E77 A;  5EUN A;  4A6T A;  2QA3 A;  1X29 A;  1J04 A;  5E3K A;  5AVY B;  1HVV A;  1ZC9 A;  1N2D C;  1SQB K;  3AEM A;  1KMJ A;  3WZF A;  1I41 A;  4F5K A;  1M1J C;  1AMQ A;  1Y4I A;  1NU1 K;  2AY3 A;  4HVK A;  2W7G A;  3A2B A;  1AX4 A;  2AY9 A;  3HQT A;  2DGK A;  1KQL A;  3MD0 A;  4KAM A;  3MIW A;  1M0P A;  1ARS A;  2JJF A;  1HTL C;  1TOG A;  3L37 A;  4B86 A;  3HVY A;  2H8P D;  1YJS A;  2C9L Y;  2HFE D;  2Q3I A;  2VLF A;  3QBO A;  4IY7 A;  2G7J A;  2HPC A;  2FYZ A;  1O69 A;  5AW6 B;  3QPG A;  3M9Q A;  4A0F A;  1CQ6 A;  2Q5U A;  1NKN A;  3FSL A;  3B1E A;  2WK8 A;  4XJP A;  4EOT A;  1RV3 A;  1ASA A;  3OP7 A;  4NOG A;  1GEX A;  4ZDP A;  1C9C A;  2QB3 A;  1OXP A;  1GW4 A;  4GE7 A;  4DGT A;  2D64 A;  2GQN A;  1LTB C;  1ASG A;  2Z1Y A;  1N86 A;  1OXZ A;  4IFF A;  4PVF A;  1ASE A;  2AEU A;  2R5C B;  1ZR4 A;  3N4S A;  3DR7 A;  2OAR A;  1AKB A;  1PG8 A;  3PD6 A;  2BIE A;  2YKU A;  2VMU A;  3TNU B;  1XEY A;  3EFG A;  3HRN A;  4JEW A;  2OAT A;  1M1J B;  2N1T C;  1Z56 A;  4ATP A;  3TFU A;  3FCR A;  4GKG A;  4TN4 A;  2BYJ A;  4U1T A;  4ITX A;  1BJW A;  3BRV B;  4MKJ A;  4R8D A;  3O8Z A;  4H63 Q;  1AJS B;  4GIF A;  1O4S A;  2VMT A;  3FQ7 A;  1N7S B;  1S06 A;  3KPE A;  5I92 A;  1G1I A;  1ZN5 A;  3KGW A;  3E77 A;  1OHY A;  3P8C E;  1JS6 A;  3SWY A;  3N7N A;  1OXO A;  4E3R A;  1FU1 A;  1JTH A;  2GUS A;  2GSA A;  3B8E B;  3AEJ C;  2HUU A;  2I1K A;  3R4T A;  2C7T A;  3VAX A;  1FAV A;  3TCM A;  3N4X A;  3LY1 A;  1OHW A;  3LWS A;  2E43 A;  1JS3 A;  3BB8 A;  1MLY A;  4E1O A;  1UU1 A;  1JNM A;  3WCN A;  4IXS A;  2Z5I A;  5CCH D;  1ART A;  4KHX A;  4W7Y A;  1DGE A;  3WLX A;  1G2C A;  1QZ9 A;  4WYE A;  1BQA A;  3RL0 B;  2VGW A;  3RL0 D;  3B5N C;  1B5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...