5KTBA

Structure of a complex between s. cerevisiae csm1 and mam1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
151
Chain Sequence
b'LLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSDYSIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monopolin complex subunit CSM1
molecule tags Replication
source organism Saccharomyces cerevisiae
publication title Molecular architecture of the yeast monopolin complex.
pubmed doi rcsb
total genus 51
structure length 151
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5ktbA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ktbA02
4ZKPA 1NKNA 3P8CD 3U59A 4N3YB 3OJAB 5BU5A 5BVZA 3N4XA 1X79B 5BU8B 4I1LA 3VP8A 3U1AA 4GIFA 2JEEA 3U1CA 2POHA 3VP9A 1WT6A 5KTBA 3N4RA 3BATA 3C9IA 2FXMA 3HRNA 4O9BA 4ZKUA 3N7NA 3BASA 4N78D 3N4SA 1IC2A
chains in the Genus database with same CATH superfamily
4RM1A 2GSAA 2YNYA 1AHEA 3P8MC 3WCNA 4LNJA 3N4XA 2QJYB 2C81A 1KFNA 1MV8A 3MAFA 2BASA 2WB6A 2YKUA 3H1HJ 2FYUK 1AIAA 2UWJE 1GC0A 3FFRA 3DR4A 3L75E 3LVMA 1ASLA 2W8VA 1NTZK 3HTKB 1I41A 3EFFK 2HORA 2CH2A 2R44A 3ELPA 2Q3EA 4ASWA 3ZRRA 3B5NC 5AVYB 4IYOB 2BCCG 3IHJA 8AATA 4WY4C 2JP3A 3NU8A 3CWBJ 1SQVJ 5H2FE 1NTKG 3AEDC 1SQBD 1MLZA 1JY2P 3L72G 4OMAA 5AVZB 2YKQA 1G7XA 1LTSC 2P58A 4ZDOA 1YIZA 3VMXA 5G2PA 1E5FA 3HDOA 2W7DA 1SQPG 2M5AA 2VMRA 2QB3A 1VQOP 1T3UA 3HTKA 1FU1A 4UQVA 2N1TC 4ZWVA 2HR3A 2GMSA 1KZUB 2Q3IA 1BE3D 1ARTA 5M4BA 1LWUA 2HFED 2AY1A 2HG5D 4JEYA 4R2NA 3I4JA 1GW3A 1GK4A 5APWA 3B1CA 2IZ0A 5BJ4A 1Q90D 3KGXA 5BU5A 3AEBC 3B71A 1J04A 4F5MA 3OAKA 1RF0C 2R5CB 2J5UA 1JO5A 1ASEA 4IFMA 4DQ6A 1KAFA 1KYOI 3Q3DA 3RBXA 4ADEA 3RBFA 1EC5A 2WK7A 3G0TA 4HVKA 3L72E 4KYOA 4XJPA 4R4LA 2D66A 1T6AA 4N78D 3D6YA 2H8PD 3WLXA 1JCDA 1GC3A 2R2NA 4IXZA 4GE4A 3AE7C 1GDTA 1SVVA 1AJSB 3MZWB 1KD1Q 2KNCA 1BCCD 2FXPA 2JEEA 3O8ZA 3NNKA 3FKDA 4F5JA 1EJIA 2PRRA 4W91A 1SQQD 4GOEA 2FQ6A 2B89A 5DJ9A 2M3BA 3AE8C 5G4IA 4U1TA 3E1IA 2OGUA 4IL6X 1BJOB 2Z4EA 2EO5A 3AEMA 3E6GA 2ZVNB 1KTMA 1I43A 2PO3A 2BWPA 4ADCA 1QITA 3OW2O 3A2AA 1ELQA 2FKIA 2VMNA 2XDJA 5IWQA 2YHKA 3ATHA 1YJSA 2OTJP 3CX5E 1SFCC 2G6WA 2WVRA 1SQVK 3PD6A 1FOSF 3BWNC 3L71G 3D6KA 2ZVOB 2DOUA 2FYUG 2AY4A 5CJ0A 3DODA 5G2QA 2KFPA 2ZY2A 2Y0EA 4WD2A 1G7WA 2BWNA 1OFCX 1S3JA 2JJLA 1LW5A 4F5LA 3OKSA 1NTZG 4NPDA 3RK2B 3L74J 3ECDA 3JWAA 1S5LX 1PIXA 1O69A 3FWLA 2IYPA 1YJZA 2X3LA 3MBBA 4ATQA 1NTZE 1QEXA 3D6ZA 1KILE 2ZJGA 3B1DA 4MQPA 4ZKUA 2W8UA 3PRJA 3WY7A 2VYCA 2W7LA 1DH3A 1H88A 2P67A 2WSFH 2I1JA 3Q5RA 4WYFA 3A0HE 4L75A 2FYUE 1X8YA 5KKZC 1ASFA 2N9YB 1DIPA 3CCSP 2YCPA 1AAMA 5KJ7A 1T3IA 3C1LA 4TN4A 2VRSA 1KB9I 1PGJA 4L73A 2KS1A 1OW8A 1PGOA 2ZT9D 1N8RQ 1FZBA 4PD4I 3CCMP 3MADA 4HYTB 5AW0B 1W7LA 3O6QB 4LNLA 1GEXA 1EDJA 4ZDLA 1I48A 1E79H 4PVFA 3P8CE 2KZIA 1BKGA 3H32B 2R5DA 3S4RA 2W7IA 1RF1B 4EYYQ 4P3MA 1BE3J 2O01N 4GDOA 1Q7YQ 1MLYA 3WU2H 1IFJA 2BYJA 1W2EA 3E1RA 4Y0IA 3RK3B 3FCRA 2VGVA 3L75J 3H1LG 2QRXA 7AATA 1WKHA 4JF1A 3RL0B 3L73J 3FTBA 5AW3B 2PFXA 3PDBB 4W80A 4Y0DA 5B5EE 2P7JA 4W1VA 1N7SD 2W90A 1KORA 3FQAA 4L0OA 4XA4A 3HD7B 1N2TA 3O6QA 3AE9C 4WYAA 3CWBD 2GQNA 2H7HA 3L75D 3EI9A 3GSBA 2BI5A 3E2ZA 5K5GB 3QI6A 2CJDA 1OHVA 2JO1A 2XNXA 1SZUA 3K28A 1L2PA 3AEEC 2ZJSE 3IFMA 1VQPP 4BHDA 1LGHB 1AKAA 2D5YA 1J1EB 3PIUA 1OW7A 1NH4A 1LT1A 3KDPB 2CPSA 1V2EA 1R5LA 1ZRTD 3HUSA 3VMZA 1OHYA 1JNMA 5AW8B 2F8JA 5AW4B 1WMKA 3LWSA 5HHYA 4M2KA 2O7CA 3HQTA 1L0NE 3PH0A 1M0NA 3AOWA 2YKVA 3AV7A 1NU1K 1X79B 4BRYB 1X0MA 1SQXG 2QMAA 4E1OA 1CW5A 2RN0A 3NDNA 3GF3A 3QN6A 2N1TA 1JOCA 1C4KA 3N7NA 3L70D 4D6TJ 4Y28J 4AQRD 4A6UA 4QMAA 3E2FA 5J8QA 3GLMA 5AW9B 4CVQA 1OXPA 3EZ1A 4ITXA 1XI9A 1MAPA 1VJOA 4ADDA 1QGKB 3HUSB 3LVJA 3KKIA 3RCHA 4UB6H 1GBNA 2VIBA 4RKDA 1IZNB 3LVKA 2VGTA 4DOJA 4H44C 1S9KE 4IXOA 3G8MA 4OT8A 3DXVA 1GMJA 1IAYA 1Z3ZA 4WXBA 4C7NA 1AIBA 3VN0A 2ZAEB 1GL2D 5B66H 2A45G 4C7NB 1GL2C 1EDKA 3EZSA 3UAKA 1BE3G 3L71E 1WYUB 1AVOA 3MAFB 3CX5I 1JS3A 4Q76A 1NTKE 1RE4C 1USDA 4MSOA 3BC8A 1FAVA 2P10A 4JBZA 2BI2A 3B46A 4IW7A 4W8IA 3CC2P 2EZ2A 5KLIC 4XK1A 5DB5A 4LW2A 2HPCB 1L4AC 1LTBC 4XJMA 2K3RA 1KFMA 1BSNA 1VQ6P 2W8WA 4A0RA 1BGYD 1PP9G 3CI9A 2K9YA 4OH8B 2ZYJA 3HMUA 3VTPC 5KJ7C 2Z1YA 3LW5J 1C7NA 3F0HA 1N8PA 1M4NA 3AEMC 3M9BA 3DZZA 2M0BA 4A0FA 2DR1A 3JW9A 1AY4A 1BJ4A 2Q9IA 2AY6A 1UU0A 3CL3D 3G9RA 2OYIB 2HP2A 1N73C 4A0GA 5HXXA 3B5ND 2PP6A 2OYHB 2W27A 1KB9D 3DC1A 2KLUA 2R0TA 3PDXA 2VGZA 3K5BA 3G3ZA 2Q7WA 4KJMA 4ZNCA 5CBNA 1U57A 1WYTB 1WT6A 1VQ8P 2DGMA 1G1IA 5I92A 2WSCH 5EFSA 1QLED 3Q8NA 3RK3E 1GZLA 3SWKA 1MDZA 2HUIA 2DKJA 2W7HA 2GB3A 1H0TB 3ASBA 3HUSC 3AEJA 4N3YB 1GL2A 1OXZA 3RK3D 3MAUA 3BATA 1BCCG 2JKVA 2QLRA 4D6TG 4JQ0D 1NU1G 2NRGA 3L72D 3RBLA 1E5WA 2K1AA 3W1IA 4IL6H 4ZSWA 1AA0A 1L0NJ 1HUCA 1VQ5P 1Z7DA 1YI2P 4JF0A 1ZRTE 1OZHA 1X0TA 1ZV8A 1OVVA 4YXDC 3EFGA 2KSEA 2Q7CA 2NZ2A 4OWFA 3AECC 1CI6A 1VF5B 4GEBA 1PPJD 1FOSE 4AH3A 4AZJA 1QISA 1L0LK 1EZVI 1S06A 1IAXA 2VMXA 1KQFB 1H1CA 3GWPA 5K8BA 4RJTA 2ZSMA 3TGUD 1FZCB 2ZSLA 3H25A 5AW5B 1PPJE 2YXQB 3NUIA 3CCEP 1M90Q 3CXHI 1YNUA 1ECXA 1D7MA 1T8ZA 2GMUA 1CS1A 1W23A 3F6TA 3TATA 3P32A 4H0LB 4H13C 3AELA 3L36A 1TOGA 4PJ0H 4Y0HA 3SWFA 4WY4B 2SPZA 1M56D 3H1KJ 1R8EA 5E79E 5TF5A 4K05A 2IBZE 4U2HA 1P84I 3PP5A 2R32A 3FVSA 1QVGO 1GU4A 2FYZA 4HKZH 3U1CA 3D70A 2QA4P 1S5LE 1CQ7A 3FGAD 3QH9A 5CCGA 2C9NY 2W7KA 5E79H 4ASVA 1IO4A 1B9HA 2FYNB 1XEYA 3BV0A 4I7ZB 3VOMA 1KILA 2K9JA 3E77A 2IFNA 4LW4A 4OGQD 1EG5A 1UIXA 1VDFA 3PD6B 2G8YA 5CMZA 1SVFA 5TISE 4N0WA 4AO9A 4OTLA 2AXTH 2HODB 3II0A 2W6JH 2Z9WA 1Y4IA 1L0LE 4WY4A 4C46A 2O1BA 1B5OA 1LP1A 1D7VA 2BCCE 2LXCB 1SQBK 2HOYA 2CFBA 3OP7A 1KYOH 1NO4A 1MFTA 1NU1E 3BWNA 4TMRA 3V2PA 2BYLA 1L0NK 2KB7P 1D7RA 2Q5UA 5AVSB 1I29A 3P7KA 2VMVA 4YPCA 2D7ZA 2D2CB 3HD7D 1KYOE 1DGEA 4XEWA 3LW5H 3E2ZB 1NTZD 3TFTA 1AHFA 3WX9A 4F5FA 3H1JG 3JC22 3AATA 3I5CA 2YIUB 4IOIH 3HE4A 2VGWA 4RKUJ 4LGDE 2HPCA 3CAIA 2WT7B 4IFFA 2XH1A 2JR8A 1LTAC 1QL1A 4DZOA 3AE5C 1ARGA 2QIWA 3DXWA 1X2AA 1AHXA 1YJNP 1JM0A 1C0NA 3BRVB 1M1KQ 2O3JA 4ATPA 1ZXGA 1DD3A 2PB2A 4K3AA 4E3RA 4WLJA 1D2FA 2C7TA 2JJEA 1GEYA 4UB8H 1LJ2A 4EMYA 4XE5B 4RITA 4F5GA 1B8GA 2YKOA 1VQKP 3JZLA 3NU7A 1YBKA 4LC3A 5BU8B 4U3FD 3TYYA 1EQBA 1Z56A 4UHNA 1DX7A 1TOEA 1KQLA 2VMQA 1SZSA 2Z5IA 4FFCA 3L70J 2BIGA 2L91A 1N7LA 2AEMA 4JEXA 4E77A 4HJGH 4EB5A 3W67A 2A06E 3NUBA 1ZLLA 1VPCA 3LY1A 3WKSA 1IFDA 1T2KC 1TOJA 4QGRA 2QEXP 3BCCJ 3PHLA 2AY7A 2WK9A 2POHA 3A7OA 2OQQA 2RMZA 4AYCA 1S4XA 4WY4D 1ZODA 2XKMA 3MD0A 2EPJA 4I2LC 2EZ1A 2O0RA 2ZT9C 4OC9A 5C6UA 5G4JA 3GF7A 3FQ8A 2FN6A 3KE3A 1YIJP 1FZGA 1N7SA 3AEJC 3TK1A 2KYVA 4ADBA 1NTMJ 1SQXK 1FZFA 3AE6C 4IL6E 2Q1KA 3JCUH 1SQPD 1GCKA 3H1ID 2D65A 3FFHA 4GKGA 1LWUB 1L0ND 3FQ7A 3EI7A 1PP9D 2KXPB 2BI9A 2R5EA 1ZC9A 3ASAA 1PMMA 2MKVA 1LTJC 3NYTA 1EXJA 4RAEA 4IFDK 5EUNA 3FVUA 1KQGB 4I1LA 2CSTA 4CXRA 4C7RA 3I16A 5EIGA 1M0PA 2EH6A 3M5UA 3ZZKA 1MDOA 1M57D 3W68A 3CPWO 1ZR4A 5DJUB 3V4QA 1BW0A 4LNMA 1L0NG 1S72P 1KQSO 2H43A 2E43A 1DJUA 2WSEJ 3PJ0A 1VQ4P 1U08A 4R8DA 3CBFA 5KJ7D 1AQ5A 3CCLP 3CX5H 2FFDB 3SFEC 3RL0C 1P3WA 1NAFA 3IF4A 2FFDA 2ZT9B 5FT4A 5C39A 3FZ7A 3HRNA 4WP0A 2WPRA 4OVNF 1IFNA 4F5IA 1EDIA 2PAJA 1JUNA 4A6RA 2WZ7A 2IZ1A 3VK2A 2B87B 2QE7H 3TNUB 2BEQD 3GZDA 4N6JA 3V4WA 2FYUJ 2YXRB 2QSRA 3KZIE 1FG7A 4H63Q 3EI6A 1MGVA 3WGCA 4CBRA 1T3JA 2QBTA 2BCCJ 3M9QA 1QX8A 2GM4A 1FDMA 2AY5A 1FC4A 2Z9VA 3CWBG 3CQ6A 3R4TA 2BI3A 2OKJA 5TISH 4K2MA 3FVXA 3II6A 4K2IA 4B98A 3F89A 1W5CE 3CCUP 1AJSA 3A2BA 1KILC 4JPZB 4OBVA 1P84D 3AEOA 3QBOA 1QGNA 3CCVP 2TPLA 2N9BA 3AE1C 5E3KA 3H1IJ 2FM1A 2M3EA 1RVUA 4D6TE 5B5EH 2XBNA 1PPJG 1SQQK 2E54A 3MC6A 3KHUA 2GUVA 1AKBA 3PAAA 1GEWA 3EI5A 2E74C 2RKLA 5APVA 4WBTA 4WXGA 5DX5A 2WK8A 1NTMG 3B5NA 5FT5A 4PJ0E 1K8AQ 1ARHA 3PGYA 2OGAA 4J5UA 4M3LA 2QJPB 1DKAA 1SP4A 4GE7A 3JCUE 3CWBE 2WPVB 4ITGA 4B86A 4W1XA 2YMKA 1EZVD 2P2UA 2X8UA 1UU1A 2HODA 4JEZA 3HL2A 2VIAA 4MN4C 1M0OA 1AFOA 3E2YA 1L4AD 1O62A 3VK3A 2AEUA 3GETA 1ARSA 4RESB 5G09A 1LTGC 1DJ9A 1U7JA 5BJ3A 4MKJA 1FZAA 3H1HE 2WQYC 2E75C 3H1LD 1BCCE 4GIFA 3A9XA 4RJYA 1ASMA 2Z20A 2I1KA 2QSIA 1J32A 2BHXA 1MDXA 3CLQA 1CI6B 1M8OB 1WYVA 1N7SC 3H1LE 3SSUA 1YIYA 4OYTA 4WWIA 3ZRPA 4GSAA 3OJAB 3BCCE 2C0WA 3H9XA 1V2FA 1KMKA 1OVUA 3RUYA 4YTPC 5EFWB 1ZP0C 3VP8A 3G71P 4DJGA 4XJLA 3MKJA 4CBSA 1SQVE 2Z9XA 3KPEA 2AY8A 3P1TA 1K04A 2ZXEB 1TATA 5CCHC 5AVXB 3CX5D 3LG0A 3NFQA 2VMSA 4GT1A 4RIZA 3QM2A 1AHYA 2Z61A 3D71A 4ZM4A 2KUBA 3MP7B 3TGUE 1FC2C 5AW7B 3TQXA 3V2RA 1ASCA 3BWOA 4P7YA 5APUA 3TSIA 5GTIE 1K73Q 3PA9A 3FZ8A 1G2CA 1J1DC 2FXOA 1G2CB 4XJOA 4F5KA 1DD4A 2ZY3A 1CZEA 2LR2A 1GC4A 4TT3H 2WSFJ 2AATA 5CHXA 1H8AA 2FYUD 2W8TA 3L71D 2IBZI 1NTKK 1V72A 2OYOA 1VQ9P 2K9JB 2Y0DA 3V2NA 3H1IG 3AEPA 4N78E 1JY2N 1AJYA 4BA4A 2OYIC 3M0DA 1TOKA 3KGWA 1NTME 1LW4A 2M8RA 1J1DB 1URQD 4R5FA 4MKKA 1AQTA 1MZ9A 2KIKA 1YQ3C 1JTHB 3KXDA 4PD4H 5GTHE 2ORDA 5M4DA 2KZJA 2VMTA 4LC1A 1FZEA 4EU1A 4Q6RA 3TDKA 2JJFA 3I56P 1SFCD 2E76B 3B8XA 4PV1C 1N2DC 1ZN5A 4UB8E 2CH1A 4ZAHA 1X29A 1SFCB 2E76D 3GW6A 2KSJA 3BCXA 4IXSA 5CJ4A 3AE3C 3FRKA 1AVYA 4WVZA 2AY3A 1KILB 1KB9E 1M32A 3U59A 1D7UA 3GG2A 2MJZA 1PP9J 3L73G 2R3SA 3L74D 3BB8A 1A02J 5FT8A 1KN7A 1W7NA 2E5YA 1Q2NA 3MHVA 1AHGA 1LP1B 5HDMA 2OTKE 2VLFA 1ASBA 2YCNA 3NRAA 3TGUJ 3RCHB 1RV4A 2E75B 1JMBA 1ELUA 4EDFA 1AY5A 1Q82Q 1KC8Q 2P1JA 1B9IA 2JJGA 4EI2A 2H88C 1FBMA 1LTTC 3LVLB 2HP1A 3VK4A 3QWOC 2VMUA 4OCAA 1OWAA 5AW6B 1X22A 2FFDC 2AY9A 1WRGA 2QJPC 3K7YA 2CINA 5CCHA 3FX0A 2E74B 1SQVG 1Y9BA 3F9TA 1BJNA 2OATA 1O61A 1NTKJ 3H1JD 1B5PA 3SWYA 4IX8A 5KTBA 3NX3A 1BSHA 1ZW0A 4BRYA 1WYTA 1J2JB 3L72J 3T97A 2YRIA 2VI8A 2XZRA 2M5AB 1FG3A 1CJ0A 1NU1J 1RQVA 3VYIA 2BKWA 4ZM3A 3CCRP 1OVRA 4YXWH 4I6MC 1BE3E 4A72A 1GW4A 4O6ZA 1OHWA 1LC7A 1QZ9A 1OW6A 3R2PA 2JDIH 1UIIA 1L0LJ 2XV5A 4UB6E 3CCQP 3WUTA 3DRDA 2E5TA 4OGQC 2V7QJ 2A06G 1IK9A 3FDBA 1P84H 3BCAA 3BASA 3N75A 4KHXA 1YITP 1W7MA 2WKAA 1S1CX 3PLNA 1KILD 5EUDA 1X28A 1YTZI 4AZKA 4R5ZA 4I7ZC 5GTIH 3I55P 3BN1A 1RY3A 3AE2C 4LLHA 1VP4A 2ZYGA 2IX7C 4WBAA 1FJPA 3WKRA 2CB1A 2W8JA 2B87A 2VI9A 1PL5A 1S07A 2D63A 2RFVA 1RF1C 3Q5SA 3P8CD 4A0HA 1PG8A 2OYIA 5EUEA 3HE5B 1AICA 2A45H 1HWTC 4A6TA 1N7SB 3QPGA 4EB7A 1H89A 1PZQA 1SQVD 2D64A 2CANA 1N86A 5H2FH 4W1WA 1ASGA 2D2CD 1DEBA 4OGQB 5AW2B 1ARIA 1K05A 3H6PA 1KL2A 1IFMA 2YCTA 2O1KA 5AVTB 1FE6A 1QVFO 1UKJA 4BMKA 3M9HA 1ZMEC 2OYHC 3EI8A 3FXDA 1FZCC 2NPSA 1AMRA 3S1KA 3I5TA 1M7LA 1Q86Q 3FWNA 3N4RA 1HTLC 1IX6A 3UE8A 1KYOD 1S5LH 1L4AA 1TPLA 3FZ6A 1VF5C 1MFZA 2CPBA 1WSTA 2DW3A 2JWAA 1QL2A 3A3YB 2NPSC 4ZWMA 1PGPA 4PD4E 3B5NB 1CQ6A 4AUWA 2I8DA 1M6SA 4JF7A 2OQXA 4XFJA 1ZR2A 1IBJA 2VMYA 4EFFA 4MQRA 3A0BE 1TU3F 5M49A 3ZDMA 3W1JA 2XU6A 3C9IA 2Y0CA 3H1KD 1QJ5A 1FS0E 2IBZD 3RGUA 4ZMDA 1HJBA 3ZRQA 3WMM0 1RHZB 1N73A 2VGSA 3DU4A 4BQ0A 1RV3A 2ZXXA 3A0BH 1HJ0A 2QJYC 2E7JA 3N0LA 1FDOA 2WPSA 1JMMA 1JF9A 3GZDC 3HLMA 4H44B 1DTYA 2A45I 1IVRA 1NVOA 1LT9B 1XTGB 3MTUE 1CQ8A 2E7IA 5KAFH 4M2JA 1DFOA 3A0HH 4NPEA 4DBCA 4IY7A 3A8UX 2Z1ZA 4UHMA 3GBXA 1JCCA 4R4MA 2FNUA 2Y9ZA 4ZSYA 1VEFA 5D5SA 1LTJA 3L75G 1NOHA 1BQAA 4JYBA 1FZCA 4Y99B 3LV2A 5DJ1A 1CZQA 3ELEA 4A00A 1N73B 4KXKA 3GR9A 2HUFA 3RQ1A 4PV1B 2Z9UA 1MUUA 1IUGA 2E76C 2C44A 1OMIA 4PV1D 1BJOA 1NJIQ 1GDEA 3EWKA 1NYHA 3RK2C 1KV4A 1NKNA 3V6IA 2J58A 3B4SA 3VMAA 4Z1MH 1ASAA 1GU5A 3NTNA 1WYVB 1ORDA 1IJDB 1SS1A 2QM8A 4W7ZA 5APTA 4I8AA 2IDBA 2BEZF 3E7KA 1SQXD 1PFFA 4B9BA 3EUCA 4MQQA 2E75D 1PGQA 2J59M 5L8RJ 3G7QA 3WZFA 2R5BA 2HOZA 1L4AB 4HF8A 2YO2A 1BJWA 2O1JA 1JTHA 5KAFE 3VAXA 3TCMA 3AOVA 3G6EP 3VP6A 5AVWB 3KZIH 2A1VA 2YRRA 5E4ZA 3RBZA 2WTYA 1RVYA 2VMZA 1SQQE 2ZYDA 5KLVJ 1TOIA 5M46A 3USSA 2FYFA 3HD7C 1L0LD 4TLFA 3KYQA 1NU1D 1M0QA 3QGUA 5F8VA 3L74G 1SQXJ 1RF0A 1W3UA 4HH2A 5CBOA 2YKYA 2ZP7A 4GRXA 1IJIA 1JY3O 2DKBA 3EQ2A 1VQNP 4M2MA 3A5TA 4WYCA 5E5IA 2N1TD 1HVVA 1BDDA 1FDIA 2FY8A 3BRTB 5TJHA 4EOTA 3HD7A 1SQBJ 4K2BA 2QA3A 2W6BA 2CK3H 3L70E 3FD0A 3R4YA 4UOYA 1RE3C 1LTIC 3NYUA 2OGEA 3MC6C 3H1JJ 2XNDH 1SFFA 1L0LG 1LC5A 3T97B 3L74E 1AAWA 1RE3A 2EGYA 1CZCA 4WLHA 1E5EA 3VP9A 3GJUA 3TFUA 4ZDPA 3WGBA 1S9KD 1YOOA 1DJEA 3HE5A 3H1HD 4UHOA 1HGZA 1VL2A 1ZOBA 3RL0g 2C9LY 4KAMA 1YJWP 3USFA 2IYOA 3MGNA 3WU2E 1AKCA 2BI1A 4Q31A 4H44D 3V2QA 1LWUC 3Q1MA 3L8AA 3ABVC 2W7FA 1VQLP 2E42A 1SQPE 1OIPA 4H13D 2QJKC 4OBUA 4WB0A 1EDLA 1CL2A 3H1IE 1S0AA 2KOGA 1WYUA 2V1PA 3LIDA 3H1JE 1Y47A 4RKCA 3ITKA 3WUUA 2HUUA 1IC2A 2WT7A 2VGUA 2FNIA 4NPFX 3QHXA 1GK6A 2X5FA 4CXQA 3UWCA 1S09A 2D61A 3PJSK 5EQCA 4GE9A 1KB9H 4PFFA 1BGYG 5AVRB 4AO4A 3BCCG 3LIEA 1RF1A 2CJGA 2OYHA 2ITAA 1S08A 5EAVA 5FT6A 1XTCC 3CXHE 5KLIB 2W7EA 2CTZA 3L73E 4WB4A 3RK3C 3BVHA 2ZY4A 1SQXE 3DYDA 1ZOYC 4J8LA 1JY3N 1RE4A 3HBXA 1HGVA 3C8VA 4A7PA 2OARA 1JG8A 2ZC0A 3Q5PA 1NGMB 3CD6P 1WKGA 3JTXA 4WYGA 2CJHA 2GA1A 5APXA 5KLVG 3AENA 3JSVC 3MEBA 3GZCA 2G3AA 3L44A 3RK2D 4ZLVA 1M1JC 1RH5B 2OTLP 1AX4A 2CY8A 1MAQA 3HT4A 3GHGC 1AJRA 4JEWA 2WPQA 1KMJA 4GOFA 1URQB 2W7JA 1N31A 3EIAA 1BGYE 1M1JA 1SQBG 1LS3A 1JS6A 1AMQA 2FYNC 3EIBA 3CQ5A 5KLVE 2WMMA 2OKKA 3COGA 3CMAP 9AATA 2AEVA 1EXIA 2BCCD 3G4SP 2JJHA 4XAUA 3ISLA 1ASNA 3OA7A 5EIGB 1P84E 1LK9A 4MY5A 1TASA 2DGKA 4E3QA 3N4SA 2LXBA 3CC4P 1BT4A 4U3FG 2KK7A 4NOGA 2NPSB 2GUSA 1C7OA 3TNUA 1IX8A 2R5CA 2YKPA 4H0LC 4H13B 3CMEP 2QJKB 4BA5A 1VQ7P 3H1HG 1K9MQ 1URQA 3MUDC 4JEVA 1NKZB 3L4FA 2D2CC 4DT0A 5B66E 3CCJP 5APYA 1YHQP 3M0AA 2C0RA 4DGTA 1LT9A 1J1EC 3S9OA 2FBWC 3VMYA 1LC8A 5AX8A 1URQC 2QB2A 5AVUB 1GL2B 2KS1B 4WYDA 4RLGA 4ISYA 2AXTE 1H0TA 1DEEG 2O01H 5DJTB 2FXMA 3E9KA 1H0CA 3B1EA 2Y9YA 1D7SA 1YAAA 1SLQA 3H1KG 1C7GA 2D7YA 3V5BA 4W5KA 4PIWA 1VF5D 1YQ4C 2PB0A 4CPGA 1KKJA 3AEGC 3DR7A 1JEKA 1UU2A 1T2KD 1AMAA 3FSLA 4Q75A 2LKMA 3H1KE 3WUVA 2WSCJ 1NTKD 2VMPA 2KI7B 1G4VA 1KL1A 3TF5A 2QM7A 5CCGD 1B4XA 5APSA 2KNCB 4L76A 1GD9A 4H51A 5F9SA 1G4XA 3AENB 1SQPJ 3PPLA 4IYOA 1SQBE 3BS8A 2WITA 1NHLA 1AY8A 3SFDC 1ASDA 1CSBA 3IR9A 2FKWB 1HF9A 3NYSA 4DCKA 1YTZT 2KLVA 1VQMP 1C9CA 1DGDA 4L74A 3HE4B 1AV1A 1M7YA 2JWDA 2E7UA 5CCHD 2A06D 3FDDA 2W83C 2BIEA 2RH0A 1SQQJ 3NMDA 1BDCA 1FJKA 2JISA 3WCOA 4O9BA 4F5HA 4F4EA 3MUDA 5KLVK 4HB1A 2HYNA 5D95A 3FXEA 2JGTA 1V2DA 2B88A 4U7JA 1LTJB 1NAYA 1BQDA 5KKZB 3N5MA 1BCCJ 1LNQA 2HZPA 3AE4C 4XQ2A 3L73D 4RO0A 5GTHH 1KMIZ 4PFNA 5CCGC 2IBZG 2EYQA 2IFMA 4GDYA 1HH0A 1Q81Q 1MKMA 4KT0J 3AEAC 2V4HA 3NXSA 4JYCA 2DGLA 2X5DA 2IPPA 1OXOA 2QVAA 2H89C 4U3FJ 1O4SA 5KLVD 2VMWA 3F5HA 5G0AA 1IX7A 2AY2A 2YIUC 5EAAA 2KP8A 3TGUG 3IN6A 3HVYA 5KAIE 3RL0D 3A9ZA 3JWBA 2L5GB 2W7GA 3UIAA 1W2BO 4GODA 2W7MA 3NTJA 3B8EB 1SZKA 3VOPA 5AVQB 5APQA 2E74D 1Y8AA 1USEA 4BWNA 2K37A 1U7MA 3L71J 1AMSA 3RI6A 2YKXA 1HBWA 4WXFA 3L37A 3H32A 1IFIA 3H7FA 3L70G 3A9YA 3GHGB 2C0XA 1S2EA 1LT9C 1NTZJ 3K40A 5JAYA 1PMOA 1CL1A 3AEFC 1SQPK 3CXHD 5KAIH 2WSEH 1BS0A 1TARA 2W6AA 1BGYJ 2ZYAA 4EIJA 1YJ9P 5BVZA 3PDBA 3L35A 2JG2A 2G7JA 2QG4A 3CXHH 3MIWA 2HLOA 2WWWA 2YMYA 2Z5HA 2ZFCA 4K35A 1KKPA 2Q6QA 3Q2YA 1IFPA 2V7QH 1NTMD 3ACZA 4PD4D 1QIRA 2K88A 1NTMK 4BXLA 4RJ0A 1QJ3A 2WSSH 4WYEA 3M06A 2ZUKA 3R9AA 2YO3A 5M1BA 2ZY5A 1JB0J 1LKCA 1OATA 3BCBA 3PTZA 4W7YA 1NWQA 1YYCA 2NPSD 3GHGA 2BWOA 2R3CA 1GTWA 3CC7P 2AXCA 3U1AA 1JY3P 1X9VA 1SQQG 3T32A 2AEJA 3IAOA 5AW1B 4WB0B 4H0LD 5AVVB 1RQUA 1YJYA 1R5SA 3BCCD 2AEFA 2N1TB 4U3FE 2NMPA 2V0YA 2HOXA 3H1LJ 1JY2O 4Y99C 1SFCA 3GMAA 1OX3A 1PP9E 2O01J 4ZKPA 2VLHA 2B9BA 3M91A 3CQ4A 2BIAA 4FL0A 4D6TD 2PGDA 1IK7A 1GD2E 1G1JA 2YOBA 3ZZJA 2W8ZA 3W1HA 4AOAA 3M0DC 1A02F 1GC2A 3KQGA 4ZASA 1SPAA 1SF2A 1EQ7A 1EZVE 1PV3A 3P6KA 1M1JB 1PFIA 2VMOA 1EZVG
chains in the Genus database with same CATH topology
4RM1A 2GSAA 2YNYA 1AHEA 3P8MC 3WCNA 4LNJA 3N4XA 2C81A 1KFNA 1MV8A 3MAFA 2BASA 2WB6A 2YKUA 2FYUK 1AIAA 1GC0A 3FFRA 3DR4A 3LVMA 1ASLA 2W8VA 1NTZK 3HTKB 1I41A 2HORA 2CH2A 3ELPA 3ZRRA 3B5NC 5AVYB 4IYOB 3IHJA 8AATA 4WY4C 3NU8A 1MLZA 1JY2P 4OMAA 5AVZB 2YKQA 1G7XA 1LTSC 4ZDOA 1YIZA 3VMXA 5G2PA 1E5FA 3HDOA 2W7DA 2VMRA 2QB3A 1T3UA 3HTKA 1FU1A 4UQVA 2N1TC 4ZWVA 2GMSA 1KZUB 2Q3IA 1ARTA 5M4BA 1LWUA 2HFED 2AY1A 2HG5D 4JEYA 4R2NA 3I4JA 1GW3A 1GK4A 5APWA 3B1CA 5BJ4A 4F5MA 3KGXA 5BU5A 1J04A 3OAKA 1RF0C 2R5CB 1JO5A 1ASEA 4IFMA 4DQ6A 4ADEA 3RBFA 2WK7A 3G0TA 4HVKA 4KYOA 4XJPA 2D66A 4N78D 2H8PD 3WLXA 1JCDA 1GC3A 2R2NA 4IXZA 4GE4A 1GDTA 1SVVA 1AJSB 2JEEA 3O8ZA 3NNKA 3FKDA 4F5JA 1EJIA 4W91A 2FQ6A 5DJ9A 2M3BA 5G4IA 4U1TA 3E1IA 1BJOB 2Z4EA 2EO5A 3AEMA 3E6GA 1I43A 2PO3A 2BWPA 4ADCA 1QITA 3A2AA 1ELQA 2FKIA 2VMNA 2XDJA 5IWQA 2YHKA 3ATHA 1YJSA 1SFCC 2G6WA 1SQVK 3PD6A 1FOSF 3BWNC 3D6KA 2DOUA 2AY4A 5CJ0A 3DODA 5G2QA 2KFPA 2ZY2A 4WD2A 1G7WA 2BWNA 2JJLA 1LW5A 4F5LA 3OKSA 3RK2B 3ECDA 3JWAA 1O69A 1YJZA 2X3LA 3MBBA 4ATQA 2ZJGA 3B1DA 4MQPA 4ZKUA 2W8UA 3WY7A 2VYCA 2W7LA 1DH3A 1H88A 2P67A 2WSFH 2I1JA 4WYFA 1X8YA 1ASFA 2YCPA 1AAMA 5KJ7A 1T3IA 4TN4A 2VRSA 1FZBA 3MADA 4HYTB 5AW0B 1W7LA 4LNLA 1GEXA 4ZDLA 1I48A 4PVFA 3P8CE 1BKGA 3H32B 2R5DA 2W7IA 1RF1B 4P3MA 1MLYA 1IFJA 2BYJA 1W2EA 4Y0IA 3RK3B 3FCRA 2VGVA 7AATA 1WKHA 4JF1A 3RL0B 3FTBA 5AW3B 3PDBB 4W80A 4Y0DA 2P7JA 4W1VA 1N7SD 3FQAA 4L0OA 4XA4A 3HD7B 1N2TA 4WYAA 2GQNA 2H7HA 3EI9A 3GSBA 2BI5A 3E2ZA 3QI6A 2CJDA 1OHVA 2XNXA 1SZUA 3K28A 3IFMA 4BHDA 1LGHB 1AKAA 2D5YA 1J1EB 3PIUA 1NH4A 3KDPB 2CPSA 1V2EA 3HUSA 3VMZA 1OHYA 1JNMA 5AW8B 2F8JA 5AW4B 3LWSA 5HHYA 4M2KA 2O7CA 3HQTA 1M0NA 3AOWA 2YKVA 3AV7A 1NU1K 1X79B 1X0MA 2QMAA 4E1OA 1CW5A 3NDNA 3QN6A 2N1TA 1JOCA 1C4KA 3N7NA 4AQRD 4A6UA 3E2FA 5J8QA 5AW9B 4CVQA 1OXPA 3EZ1A 4ITXA 1XI9A 1MAPA 1VJOA 4ADDA 3HUSB 3LVJA 3KKIA 3RCHA 1GBNA 2VIBA 4RKDA 3LVKA 2VGTA 4DOJA 1S9KE 4IXOA 3G8MA 4OT8A 3DXVA 1IAYA 1Z3ZA 4WXBA 4C7NA 1AIBA 3VN0A 1GL2D 2A45G 4C7NB 1GL2C 3EZSA 3UAKA 1WYUB 3MAFB 1JS3A 4Q76A 1RE4C 4MSOA 3BC8A 1FAVA 2BI2A 4IW7A 3B46A 4W8IA 2EZ2A 4XK1A 5DB5A 4LW2A 2HPCB 1L4AC 1LTBC 4XJMA 1KFMA 2W8WA 4A0RA 3CI9A 4OH8B 2ZYJA 3HMUA 3VTPC 5KJ7C 2Z1YA 1C7NA 3F0HA 1N8PA 1M4NA 3AEMC 3M9BA 3DZZA 4A0FA 2DR1A 3JW9A 1AY4A 1BJ4A 2Q9IA 2AY6A 1UU0A 3CL3D 2OYIB 2HP2A 1N73C 4A0GA 5HXXA 3B5ND 2PP6A 2OYHB 2W27A 3DC1A 2R0TA 3PDXA 2VGZA 3G3ZA 2Q7WA 2DGMA 1WT6A 1WYTB 1G1IA 5I92A 2WSCH 5EFSA 3Q8NA 1GZLA 1MDZA 2HUIA 2DKJA 2W7HA 2GB3A 3ASBA 3HUSC 3AEJA 4N3YB 1GL2A 1OXZA 3RK3D 3MAUA 3BATA 2QLRA 3RBLA 1E5WA 3W1IA 4ZSWA 1HUCA 1Z7DA 4JF0A 1ZV8A 3EFGA 2Q7CA 1CI6A 4GEBA 4AH3A 1FOSE 4AZJA 1QISA 1L0LK 1S06A 1IAXA 2VMXA 1H1CA 3GWPA 5K8BA 2ZSMA 1FZCB 2ZSLA 5AW5B 3NUIA 1YNUA 1ECXA 1T8ZA 2GMUA 1CS1A 1W23A 3F6TA 3TATA 3P32A 3AELA 3L36A 1TOGA 4Y0HA 3SWFA 4WY4B 5TF5A 4K05A 4U2HA 3PP5A 2R32A 3FVSA 1GU4A 2FYZA 3U1CA 1CQ7A 5CCGA 2C9NY 2W7KA 1IO4A 1B9HA 1XEYA 3BV0A 3VOMA 1KILA 3E77A 2IFNA 4LW4A 1EG5A 1VDFA 3PD6B 5CMZA 1SVFA 4N0WA 4AO9A 4OTLA 2HODB 3II0A 2Z9WA 1Y4IA 4WY4A 4C46A 2O1BA 1B5OA 1D7VA 1SQBK 2HOYA 2CFBA 3OP7A 1NO4A 3BWNA 4TMRA 3V2PA 2BYLA 1L0NK 2KB7P 1D7RA 2Q5UA 5AVSB 1I29A 3P7KA 2VMVA 2D7ZA 3HD7D 1DGEA 4XEWA 3LW5H 3E2ZB 3TFTA 1AHFA 3WX9A 4F5FA 3AATA 3I5CA 3HE4A 2VGWA 4LGDE 2HPCA 3CAIA 2WT7B 4IFFA 2XH1A 1LTAC 1QL1A 4DZOA 1ARGA 3DXWA 1X2AA 1AHXA 1C0NA 3BRVB 4ATPA 2PB2A 4E3RA 4WLJA 1D2FA 2C7TA 2JJEA 1GEYA 4EMYA 4XE5B 4RITA 4F5GA 1B8GA 2YKOA 3JZLA 3NU7A 4LC3A 5BU8B 3TYYA 1EQBA 1Z56A 4UHNA 1DX7A 1TOEA 1KQLA 2VMQA 1SZSA 2Z5IA 4FFCA 2BIGA 1N7LA 4JEXA 4E77A 4EB5A 3NUBA 1ZLLA 1VPCA 3LY1A 3WKSA 1IFDA 1T2KC 1TOJA 4QGRA 2AY7A 2WK9A 2POHA 3A7OA 4AYCA 4WY4D 1ZODA 2XKMA 3MD0A 2EPJA 4I2LC 2EZ1A 2O0RA 4OC9A 5C6UA 5G4JA 3FQ8A 2FN6A 3KE3A 1FZGA 1N7SA 3AEJC 3TK1A 2KYVA 4ADBA 1SQXK 1FZFA 1GCKA 2D65A 3FFHA 4GKGA 1LWUB 3FQ7A 3EI7A 2BI9A 2R5EA 1ZC9A 3ASAA 1PMMA 1LTJC 3NYTA 4RAEA 4IFDK 5EUNA 3FVUA 4I1LA 2CSTA 4CXRA 4C7RA 3I16A 5EIGA 1M0PA 2EH6A 3M5UA 3ZZKA 1MDOA 3V4QA 1ZR4A 1BW0A 4LNMA 2H43A 2E43A 1DJUA 3PJ0A 1U08A 4R8DA 3CBFA 5KJ7D 1AQ5A 2FFDB 3RL0C 1P3WA 1NAFA 5FT4A 2FFDA 3FZ7A 3HRNA 4WP0A 2WPRA 1IFNA 4F5IA 2PAJA 1JUNA 4A6RA 2WZ7A 3VK2A 3TNUB 3GZDA 4N6JA 3V4WA 2QSRA 1FG7A 4H63Q 3EI6A 1MGVA 3WGCA 4CBRA 1T3JA 2QBTA 3M9QA 2GM4A 1FDMA 2AY5A 1FC4A 2Z9VA 3CQ6A 3R4TA 2BI3A 2OKJA 4K2MA 3FVXA 3II6A 4K2IA 4B98A 1AJSA 3A2BA 1KILC 4OBVA 3AEOA 3QBOA 1QGNA 2TPLA 2N9BA 5E3KA 2FM1A 1RVUA 2XBNA 1SQQK 2E54A 3MC6A 2GUVA 3PAAA 1AKBA 1GEWA 3EI5A 5DX5A 5APVA 4WBTA 4WXGA 2WK8A 3B5NA 5FT5A 1ARHA 3PGYA 2OGAA 4J5UA 4M3LA 1DKAA 1SP4A 4GE7A 4ITGA 4B86A 4W1XA 2P2UA 2X8UA 1UU1A 2HODA 4JEZA 3HL2A 2VIAA 1M0OA 1AFOA 3E2YA 1L4AD 1O62A 3VK3A 2AEUA 3GETA 1ARSA 4RESB 5G09A 1LTGC 1DJ9A 5BJ3A 4MKJA 1FZAA 4GIFA 3A9XA 4RJYA 1ASMA 2Z20A 2I1KA 1J32A 2BHXA 1MDXA 3CLQA 1CI6B 1WYVA 1N7SC 1YIYA 4OYTA 3ZRPA 4GSAA 3OJAB 2C0WA 3H9XA 1V2FA 1KMKA 3RUYA 3VP8A 4XJLA 3MKJA 4CBSA 2Z9XA 3KPEA 2AY8A 3P1TA 2ZXEB 1TATA 5CCHC 5AVXB 3LG0A 3NFQA 2VMSA 4GT1A 4RIZA 3QM2A 1AHYA 2Z61A 4ZM4A 5AW7B 3TQXA 3V2RA 1ASCA 3BWOA 4P7YA 5APUA 3TSIA 3PA9A 3FZ8A 1G2CA 1J1DC 1G2CB 4XJOA 4F5KA 2ZY3A 1CZEA 1GC4A 2AATA 5CHXA 1H8AA 2W8TA 1NTKK 1V72A 3V2NA 3AEPA 4N78E 1JY2N 4BA4A 2OYIC 3M0DA 1TOKA 3KGWA 1LW4A 2M8RA 1J1DB 1URQD 4R5FA 4MKKA 1MZ9A 1JTHB 2ORDA 5M4DA 2VMTA 4LC1A 1FZEA 4EU1A 4Q6RA 2JJFA 3B8XA 1SFCD 4ZAHA 1N2DC 1ZN5A 2CH1A 1X29A 1SFCB 2KSJA 3BCXA 4IXSA 5CJ4A 3FRKA 2AY3A 1KILB 1M32A 3U59A 1D7UA 2MJZA 3BB8A 1A02J 5FT8A 1W7NA 1AHGA 5HDMA 2VLFA 1ASBA 2YCNA 3NRAA 3RCHB 1RV4A 1ELUA 1AY5A 2P1JA 1B9IA 2JJGA 1FBMA 1LTTC 3LVLB 2HP1A 3VK4A 2VMUA 4OCAA 1OWAA 5AW6B 2FFDC 2AY9A 1WRGA 3K7YA 2CINA 5CCHA 3F9TA 1BJNA 2OATA 1O61A 1B5PA 3SWYA 4IX8A 5KTBA 3NX3A 1WYTA 1J2JB 3T97A 2YRIA 2VI8A 2XZRA 1FG3A 1CJ0A 3VYIA 2BKWA 4ZM3A 4I6MC 4A72A 1GW4A 4O6ZA 1OHWA 1LC7A 1QZ9A 3R2PA 2XV5A 3DRDA 1IK9A 3FDBA 3BCAA 3BASA 3N75A 4KHXA 1W7MA 2WKAA 1KILD 5EUDA 1X28A 1YTZI 4AZKA 4R5ZA 3BN1A 1RY3A 4LLHA 1VP4A 2IX7C 4WBAA 1FJPA 3WKRA 2CB1A 2W8JA 2VI9A 1S07A 2D63A 2RFVA 1RF1C 3P8CD 4A0HA 1PG8A 2OYIA 5EUEA 3HE5B 1AICA 2A45H 1HWTC 4A6TA 1N7SB 3QPGA 4EB7A 1H89A 2D64A 2CANA 1N86A 4W1WA 1ASGA 1DEBA 5AW2B 1ARIA 3H6PA 1KL2A 1IFMA 2YCTA 2O1KA 5AVTB 1UKJA 4BMKA 3M9HA 2OYHC 3EI8A 1FZCC 2NPSA 1AMRA 3I5TA 1M7LA 3N4RA 1HTLC 1IX6A 3UE8A 1L4AA 1TPLA 3FZ6A 1MFZA 2CPBA 1WSTA 1QL2A 3A3YB 2NPSC 4ZWMA 1CQ6A 3B5NB 4AUWA 1M6SA 4JF7A 2OQXA 1ZR2A 1IBJA 2VMYA 4EFFA 4MQRA 5M49A 3W1JA 2XU6A 3C9IA 1QJ5A 1HJBA 3ZRQA 3WMM0 1N73A 2VGSA 3DU4A 4BQ0A 1RV3A 2E7JA 3N0LA 2WPSA 1JMMA 1JF9A 3GZDC 3HLMA 1DTYA 2A45I 1IVRA 1LT9B 1XTGB 3MTUE 1CQ8A 2E7IA 4M2JA 1DFOA 4DBCA 4IY7A 3A8UX 2Z1ZA 4UHMA 3GBXA 1JCCA 2FNUA 4ZSYA 1VEFA 5D5SA 1LTJA 1NOHA 1BQAA 4JYBA 4Y99B 1FZCA 3LV2A 5DJ1A 1CZQA 3ELEA 4A00A 1N73B 4KXKA 3GR9A 2HUFA 3RQ1A 2Z9UA 1MUUA 1IUGA 2C44A 1BJOA 1GDEA 3RK2C 1NKNA 2J58A 1ASAA 1GU5A 3NTNA 1WYVB 1ORDA 1IJDB 2QM8A 4W7ZA 5APTA 4I8AA 1PFFA 4B9BA 3EUCA 4MQQA 2J59M 3WZFA 3G7QA 2R5BA 2HOZA 1L4AB 4HF8A 2YO2A 1BJWA 2O1JA 1JTHA 3VAXA 3TCMA 3AOVA 3VP6A 5AVWB 2A1VA 5E4ZA 2YRRA 2WTYA 1RVYA 2VMZA 1TOIA 5M46A 2FYFA 3HD7C 3KYQA 1M0QA 5F8VA 3QGUA 1RF0A 1W3UA 4HH2A 2YKYA 2ZP7A 4GRXA 1IJIA 1JY3O 2DKBA 3EQ2A 5E5IA 4M2MA 3A5TA 4WYCA 2N1TD 1HVVA 3BRTB 4EOTA 3HD7A 4K2BA 2QA3A 2W6BA 3FD0A 4UOYA 1RE3C 1LTIC 3NYUA 2OGEA 3MC6C 1SFFA 1LC5A 1AAWA 1RE3A 2EGYA 1CZCA 4WLHA 1E5EA 3VP9A 3GJUA 3TFUA 4ZDPA 3WGBA 1S9KD 1YOOA 1DJEA 3HE5A 4UHOA 1HGZA 1ZOBA 2C9LY 4KAMA 3USFA 3MGNA 1AKCA 2BI1A 4Q31A 3V2QA 1LWUC 3L8AA 2W7FA 2E42A 4OBUA 4WB0A 1CL2A 1S0AA 2KOGA 1WYUA 2V1PA 3LIDA 4RKCA 2HUUA 1IC2A 2WT7A 2VGUA 2FNIA 3QHXA 1GK6A 2X5FA 4CXQA 3UWCA 1S09A 2D61A 5EQCA 4GE9A 4PFFA 5AVRB 4AO4A 3LIEA 1RF1A 2CJGA 2OYHA 1S08A 5EAVA 5FT6A 1XTCC 2W7EA 2CTZA 4WB4A 3RK3C 3BVHA 2ZY4A 3DYDA 4J8LA 1JY3N 1RE4A 3HBXA 1HGVA 2OARA 1JG8A 2ZC0A 1WKGA 3JTXA 4WYGA 2CJHA 5APXA 3AENA 3MEBA 3GZCA 3L44A 3RK2D 4ZLVA 1M1JC 1AX4A 2CY8A 1MAQA 3HT4A 3GHGC 1AJRA 4JEWA 2WPQA 1KMJA 1URQB 2W7JA 1N31A 3EIAA 1M1JA 1LS3A 1JS6A 1AMQA 3EIBA 3CQ5A 2OKKA 3COGA 9AATA 2AEVA 2JJHA 4XAUA 3ISLA 1ASNA 3OA7A 5EIGB 1LK9A 4MY5A 1TASA 2DGKA 4E3QA 3N4SA 1BT4A 4NOGA 2NPSB 2GUSA 1C7OA 3TNUA 1IX8A 2R5CA 2YKPA 4BA5A 1URQA 4JEVA 1NKZB 3L4FA 5APYA 3M0AA 2C0RA 4DGTA 1LT9A 1J1EC 3VMYA 1LC8A 5AX8A 1URQC 2QB2A 5AVUB 1GL2B 4WYDA 4RLGA 4ISYA 2O01H 2FXMA 3E9KA 1H0CA 3B1EA 1D7SA 1YAAA 1SLQA 1C7GA 4W5KA 2D7YA 3V5BA 4PIWA 2PB0A 1KKJA 3DR7A 1UU2A 1T2KD 1AMAA 3FSLA 4Q75A 2LKMA 2VMPA 1G4VA 1KL1A 2QM7A 5CCGD 1B4XA 5APSA 4H51A 1GD9A 5F9SA 1G4XA 3AENB 3PPLA 4IYOA 3BS8A 2WITA 1NHLA 1AY8A 1ASDA 1CSBA 3IR9A 2FKWB 3NYSA 1YTZT 2KLVA 1C9CA 1DGDA 3HE4B 1M7YA 2E7UA 5CCHD 3FDDA 2BIEA 3NMDA 1FJKA 2JISA 3WCOA 4O9BA 4F5HA 4F4EA 3MUDA 5KLVK 2HYNA 5D95A 2JGTA 1V2DA 1LTJB 1BQDA 3N5MA 2HZPA 4XQ2A 4PFNA 5CCGC 2EYQA 2IFMA 4GDYA 1HH0A 3NXSA 4JYCA 2DGLA 2X5DA 2IPPA 1OXOA 1O4SA 2VMWA 5G0AA 1IX7A 2AY2A 5EAAA 2KP8A 3HVYA 3RL0D 3A9ZA 3JWBA 2L5GB 2W7GA 3UIAA 2W7MA 3NTJA 3B8EB 1SZKA 3VOPA 5AVQB 5APQA 1AMSA 3RI6A 2YKXA 1HBWA 4WXFA 3L37A 3H32A 1IFIA 3H7FA 3A9YA 3GHGB 2C0XA 1LT9C 3K40A 5JAYA 1PMOA 1CL1A 1SQPK 2WSEH 1BS0A 1TARA 2W6AA 4EIJA 5BVZA 3PDBA 3L35A 2JG2A 2G7JA 3MIWA 2HLOA 2WWWA 2YMYA 2Z5HA 2ZFCA 1KKPA 3ACZA 1QIRA 1NTMK 4RJ0A 1QJ3A 4WYEA 3M06A 2ZUKA 3R9AA 2YO3A 2ZY5A 1LKCA 1OATA 3BCBA 4W7YA 1NWQA 1YYCA 2NPSD 3GHGA 2BWOA 2R3CA 1GTWA 3U1AA 1JY3P 1X9VA 3T32A 5AW1B 4WB0B 5AVVB 1YJYA 2N1TB 2NMPA 2V0YA 2HOXA 1JY2O 4Y99C 1SFCA 4ZKPA 2VLHA 3M91A 3CQ4A 2BIAA 4FL0A 1GD2E 3ZZJA 1G1JA 2YOBA 3W1HA 4AOAA 3M0DC 1A02F 1GC2A 3KQGA 4ZASA 1SPAA 1SF2A 1EQ7A 3P6KA 1M1JB 1PFIA 2VMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKP A;  1NKN A;  3P8C D;  3U59 A;  4N3Y B;  3OJA B;  5BU5 A;  5BVZ A;  3N4X A;  1X79 B;  5BU8 B;  4I1L A;  3VP8 A;  3U1A A;  4GIF A;  2JEE A;  3U1C A;  2POH A;  3VP9 A;  1WT6 A;  5KTB A;  3N4R A;  3BAT A;  3C9I A;  2FXM A;  3HRN A;  4O9B A;  4ZKU A;  3N7N A;  3BAS A;  4N78 D;  3N4S A;  1IC2 A; 
#chains in the Genus database with same CATH topology
 4RM1 A;  2GSA A;  2YNY A;  1AHE A;  3P8M C;  3WCN A;  4LNJ A;  3N4X A;  2QJY B;  2C81 A;  1KFN A;  1MV8 A;  3MAF A;  2BAS A;  2WB6 A;  2YKU A;  3H1H J;  2FYU K;  1AIA A;  2UWJ E;  1GC0 A;  3FFR A;  3DR4 A;  3L75 E;  3LVM A;  1ASL A;  2W8V A;  1NTZ K;  3HTK B;  1I41 A;  3EFF K;  2HOR A;  2CH2 A;  2R44 A;  3ELP A;  2Q3E A;  4ASW A;  3ZRR A;  3B5N C;  5AVY B;  4IYO B;  2BCC G;  3IHJ A;  8AAT A;  4WY4 C;  2JP3 A;  3NU8 A;  3CWB J;  1SQV J;  5H2F E;  1NTK G;  3AED C;  1SQB D;  1MLZ A;  1JY2 P;  3L72 G;  4OMA A;  5AVZ B;  2YKQ A;  1G7X A;  1LTS C;  2P58 A;  4ZDO A;  1YIZ A;  3VMX A;  5G2P A;  1E5F A;  3HDO A;  2W7D A;  1SQP G;  2M5A A;  2VMR A;  2QB3 A;  1VQO P;  1T3U A;  3HTK A;  1FU1 A;  4UQV A;  2N1T C;  4ZWV A;  2HR3 A;  2GMS A;  1KZU B;  2Q3I A;  1BE3 D;  1ART A;  5M4B A;  1LWU A;  2HFE D;  2AY1 A;  2HG5 D;  4JEY A;  4R2N A;  3I4J A;  1GW3 A;  1GK4 A;  5APW A;  3B1C A;  2IZ0 A;  5BJ4 A;  1Q90 D;  3KGX A;  5BU5 A;  3AEB C;  3B71 A;  1J04 A;  4F5M A;  3OAK A;  1RF0 C;  2R5C B;  2J5U A;  1JO5 A;  1ASE A;  4IFM A;  4DQ6 A;  1KAF A;  1KYO I;  3Q3D A;  3RBX A;  4ADE A;  3RBF A;  1EC5 A;  2WK7 A;  3G0T A;  4HVK A;  3L72 E;  4KYO A;  4XJP A;  4R4L A;  2D66 A;  1T6A A;  4N78 D;  3D6Y A;  2H8P D;  3WLX A;  1JCD A;  1GC3 A;  2R2N A;  4IXZ A;  4GE4 A;  3AE7 C;  1GDT A;  1SVV A;  1AJS B;  3MZW B;  1KD1 Q;  2KNC A;  1BCC D;  2FXP A;  2JEE A;  3O8Z A;  3NNK A;  3FKD A;  4F5J A;  1EJI A;  2PRR A;  4W91 A;  1SQQ D;  4GOE A;  2FQ6 A;  2B89 A;  5DJ9 A;  2M3B A;  3AE8 C;  5G4I A;  4U1T A;  3E1I A;  2OGU A;  4IL6 X;  1BJO B;  2Z4E A;  2EO5 A;  3AEM A;  3E6G A;  2ZVN B;  1KTM A;  1I43 A;  2PO3 A;  2BWP A;  4ADC A;  1QIT A;  3OW2 O;  3A2A A;  1ELQ A;  2FKI A;  2VMN A;  2XDJ A;  5IWQ A;  2YHK A;  3ATH A;  1YJS A;  2OTJ P;  3CX5 E;  1SFC C;  2G6W A;  2WVR A;  1SQV K;  3PD6 A;  1FOS F;  3BWN C;  3L71 G;  3D6K A;  2ZVO B;  2DOU A;  2FYU G;  2AY4 A;  5CJ0 A;  3DOD A;  5G2Q A;  2KFP A;  2ZY2 A;  2Y0E A;  4WD2 A;  1G7W A;  2BWN A;  1OFC X;  1S3J A;  2JJL A;  1LW5 A;  4F5L A;  3OKS A;  1NTZ G;  4NPD A;  3RK2 B;  3L74 J;  3ECD A;  3JWA A;  1S5L X;  1PIX A;  1O69 A;  3FWL A;  2IYP A;  1YJZ A;  2X3L A;  3MBB A;  4ATQ A;  1NTZ E;  1QEX A;  3D6Z A;  1KIL E;  2ZJG A;  3B1D A;  4MQP A;  4ZKU A;  2W8U A;  3PRJ A;  3WY7 A;  2VYC A;  2W7L A;  1DH3 A;  1H88 A;  2P67 A;  2WSF H;  2I1J A;  3Q5R A;  4WYF A;  3A0H E;  4L75 A;  2FYU E;  1X8Y A;  5KKZ C;  1ASF A;  2N9Y B;  1DIP A;  3CCS P;  2YCP A;  1AAM A;  5KJ7 A;  1T3I A;  3C1L A;  4TN4 A;  2VRS A;  1KB9 I;  1PGJ A;  4L73 A;  2KS1 A;  1OW8 A;  1PGO A;  2ZT9 D;  1N8R Q;  1FZB A;  4PD4 I;  3CCM P;  3MAD A;  4HYT B;  5AW0 B;  1W7L A;  3O6Q B;  4LNL A;  1GEX A;  1EDJ A;  4ZDL A;  1I48 A;  1E79 H;  4PVF A;  3P8C E;  2KZI A;  1BKG A;  3H32 B;  2R5D A;  3S4R A;  2W7I A;  1RF1 B;  4EYY Q;  4P3M A;  1BE3 J;  2O01 N;  4GDO A;  1Q7Y Q;  1MLY A;  3WU2 H;  1IFJ A;  2BYJ A;  1W2E A;  3E1R A;  4Y0I A;  3RK3 B;  3FCR A;  2VGV A;  3L75 J;  3H1L G;  2QRX A;  7AAT A;  1WKH A;  4JF1 A;  3RL0 B;  3L73 J;  3FTB A;  5AW3 B;  2PFX A;  3PDB B;  4W80 A;  4Y0D A;  5B5E E;  2P7J A;  4W1V A;  1N7S D;  2W90 A;  1KOR A;  3FQA A;  4L0O A;  4XA4 A;  3HD7 B;  1N2T A;  3O6Q A;  3AE9 C;  4WYA A;  3CWB D;  2GQN A;  2H7H A;  3L75 D;  3EI9 A;  3GSB A;  2BI5 A;  3E2Z A;  5K5G B;  3QI6 A;  2CJD A;  1OHV A;  2JO1 A;  2XNX A;  1SZU A;  3K28 A;  1L2P A;  3AEE C;  2ZJS E;  3IFM A;  1VQP P;  4BHD A;  1LGH B;  1AKA A;  2D5Y A;  1J1E B;  3PIU A;  1OW7 A;  1NH4 A;  1LT1 A;  3KDP B;  2CPS A;  1V2E A;  1R5L A;  1ZRT D;  3HUS A;  3VMZ A;  1OHY A;  1JNM A;  5AW8 B;  2F8J A;  5AW4 B;  1WMK A;  3LWS A;  5HHY A;  4M2K A;  2O7C A;  3HQT A;  1L0N E;  3PH0 A;  1M0N A;  3AOW A;  2YKV A;  3AV7 A;  1NU1 K;  1X79 B;  4BRY B;  1X0M A;  1SQX G;  2QMA A;  4E1O A;  1CW5 A;  2RN0 A;  3NDN A;  3GF3 A;  3QN6 A;  2N1T A;  1JOC A;  1C4K A;  3N7N A;  3L70 D;  4D6T J;  4Y28 J;  4AQR D;  4A6U A;  4QMA A;  3E2F A;  5J8Q A;  3GLM A;  5AW9 B;  4CVQ A;  1OXP A;  3EZ1 A;  4ITX A;  1XI9 A;  1MAP A;  1VJO A;  4ADD A;  1QGK B;  3HUS B;  3LVJ A;  3KKI A;  3RCH A;  4UB6 H;  1GBN A;  2VIB A;  4RKD A;  1IZN B;  3LVK A;  2VGT A;  4DOJ A;  4H44 C;  1S9K E;  4IXO A;  3G8M A;  4OT8 A;  3DXV A;  1GMJ A;  1IAY A;  1Z3Z A;  4WXB A;  4C7N A;  1AIB A;  3VN0 A;  2ZAE B;  1GL2 D;  5B66 H;  2A45 G;  4C7N B;  1GL2 C;  1EDK A;  3EZS A;  3UAK A;  1BE3 G;  3L71 E;  1WYU B;  1AVO A;  3MAF B;  3CX5 I;  1JS3 A;  4Q76 A;  1NTK E;  1RE4 C;  1USD A;  4MSO A;  3BC8 A;  1FAV A;  2P10 A;  4JBZ A;  2BI2 A;  3B46 A;  4IW7 A;  4W8I A;  3CC2 P;  2EZ2 A;  5KLI C;  4XK1 A;  5DB5 A;  4LW2 A;  2HPC B;  1L4A C;  1LTB C;  4XJM A;  2K3R A;  1KFM A;  1BSN A;  1VQ6 P;  2W8W A;  4A0R A;  1BGY D;  1PP9 G;  3CI9 A;  2K9Y A;  4OH8 B;  2ZYJ A;  3HMU A;  3VTP C;  5KJ7 C;  2Z1Y A;  3LW5 J;  1C7N A;  3F0H A;  1N8P A;  1M4N A;  3AEM C;  3M9B A;  3DZZ A;  2M0B A;  4A0F A;  2DR1 A;  3JW9 A;  1AY4 A;  1BJ4 A;  2Q9I A;  2AY6 A;  1UU0 A;  3CL3 D;  3G9R A;  2OYI B;  2HP2 A;  1N73 C;  4A0G A;  5HXX A;  3B5N D;  2PP6 A;  2OYH B;  2W27 A;  1KB9 D;  3DC1 A;  2KLU A;  2R0T A;  3PDX A;  2VGZ A;  3K5B A;  3G3Z A;  2Q7W A;  4KJM A;  4ZNC A;  5CBN A;  1U57 A;  1WYT B;  1WT6 A;  1VQ8 P;  2DGM A;  1G1I A;  5I92 A;  2WSC H;  5EFS A;  1QLE D;  3Q8N A;  3RK3 E;  1GZL A;  3SWK A;  1MDZ A;  2HUI A;  2DKJ A;  2W7H A;  2GB3 A;  1H0T B;  3ASB A;  3HUS C;  3AEJ A;  4N3Y B;  1GL2 A;  1OXZ A;  3RK3 D;  3MAU A;  3BAT A;  1BCC G;  2JKV A;  2QLR A;  4D6T G;  4JQ0 D;  1NU1 G;  2NRG A;  3L72 D;  3RBL A;  1E5W A;  2K1A A;  3W1I A;  4IL6 H;  4ZSW A;  1AA0 A;  1L0N J;  1HUC A;  1VQ5 P;  1Z7D A;  1YI2 P;  4JF0 A;  1ZRT E;  1OZH A;  1X0T A;  1ZV8 A;  1OVV A;  4YXD C;  3EFG A;  2KSE A;  2Q7C A;  2NZ2 A;  4OWF A;  3AEC C;  1CI6 A;  1VF5 B;  4GEB A;  1PPJ D;  1FOS E;  4AH3 A;  4AZJ A;  1QIS A;  1L0L K;  1EZV I;  1S06 A;  1IAX A;  2VMX A;  1KQF B;  1H1C A;  3GWP A;  5K8B A;  4RJT A;  2ZSM A;  3TGU D;  1FZC B;  2ZSL A;  3H25 A;  5AW5 B;  1PPJ E;  2YXQ B;  3NUI A;  3CCE P;  1M90 Q;  3CXH I;  1YNU A;  1ECX A;  1D7M A;  1T8Z A;  2GMU A;  1CS1 A;  1W23 A;  3F6T A;  3TAT A;  3P32 A;  4H0L B;  4H13 C;  3AEL A;  3L36 A;  1TOG A;  4PJ0 H;  4Y0H A;  3SWF A;  4WY4 B;  2SPZ A;  1M56 D;  3H1K J;  1R8E A;  5E79 E;  5TF5 A;  4K05 A;  2IBZ E;  4U2H A;  1P84 I;  3PP5 A;  2R32 A;  3FVS A;  1QVG O;  1GU4 A;  2FYZ A;  4HKZ H;  3U1C A;  3D70 A;  2QA4 P;  1S5L E;  1CQ7 A;  3FGA D;  3QH9 A;  5CCG A;  2C9N Y;  2W7K A;  5E79 H;  4ASV A;  1IO4 A;  1B9H A;  2FYN B;  1XEY A;  3BV0 A;  4I7Z B;  3VOM A;  1KIL A;  2K9J A;  3E77 A;  2IFN A;  4LW4 A;  4OGQ D;  1EG5 A;  1UIX A;  1VDF A;  3PD6 B;  2G8Y A;  5CMZ A;  1SVF A;  5TIS E;  4N0W A;  4AO9 A;  4OTL A;  2AXT H;  2HOD B;  3II0 A;  2W6J H;  2Z9W A;  1Y4I A;  1L0L E;  4WY4 A;  4C46 A;  2O1B A;  1B5O A;  1LP1 A;  1D7V A;  2BCC E;  2LXC B;  1SQB K;  2HOY A;  2CFB A;  3OP7 A;  1KYO H;  1NO4 A;  1MFT A;  1NU1 E;  3BWN A;  4TMR A;  3V2P A;  2BYL A;  1L0N K;  2KB7 P;  1D7R A;  2Q5U A;  5AVS B;  1I29 A;  3P7K A;  2VMV A;  4YPC A;  2D7Z A;  2D2C B;  3HD7 D;  1KYO E;  1DGE A;  4XEW A;  3LW5 H;  3E2Z B;  1NTZ D;  3TFT A;  1AHF A;  3WX9 A;  4F5F A;  3H1J G;  3JC2 2;  3AAT A;  3I5C A;  2YIU B;  4IOI H;  3HE4 A;  2VGW A;  4RKU J;  4LGD E;  2HPC A;  3CAI A;  2WT7 B;  4IFF A;  2XH1 A;  2JR8 A;  1LTA C;  1QL1 A;  4DZO A;  3AE5 C;  1ARG A;  2QIW A;  3DXW A;  1X2A A;  1AHX A;  1YJN P;  1JM0 A;  1C0N A;  3BRV B;  1M1K Q;  2O3J A;  4ATP A;  1ZXG A;  1DD3 A;  2PB2 A;  4K3A A;  4E3R A;  4WLJ A;  1D2F A;  2C7T A;  2JJE A;  1GEY A;  4UB8 H;  1LJ2 A;  4EMY A;  4XE5 B;  4RIT A;  4F5G A;  1B8G A;  2YKO A;  1VQK P;  3JZL A;  3NU7 A;  1YBK A;  4LC3 A;  5BU8 B;  4U3F D;  3TYY A;  1EQB A;  1Z56 A;  4UHN A;  1DX7 A;  1TOE A;  1KQL A;  2VMQ A;  1SZS A;  2Z5I A;  4FFC A;  3L70 J;  2BIG A;  2L91 A;  1N7L A;  2AEM A;  4JEX A;  4E77 A;  4HJG H;  4EB5 A;  3W67 A;  2A06 E;  3NUB A;  1ZLL A;  1VPC A;  3LY1 A;  3WKS A;  1IFD A;  1T2K C;  1TOJ A;  4QGR A;  2QEX P;  3BCC J;  3PHL A;  2AY7 A;  2WK9 A;  2POH A;  3A7O A;  2OQQ A;  2RMZ A;  4AYC A;  1S4X A;  4WY4 D;  1ZOD A;  2XKM A;  3MD0 A;  2EPJ A;  4I2L C;  2EZ1 A;  2O0R A;  2ZT9 C;  4OC9 A;  5C6U A;  5G4J A;  3GF7 A;  3FQ8 A;  2FN6 A;  3KE3 A;  1YIJ P;  1FZG A;  1N7S A;  3AEJ C;  3TK1 A;  2KYV A;  4ADB A;  1NTM J;  1SQX K;  1FZF A;  3AE6 C;  4IL6 E;  2Q1K A;  3JCU H;  1SQP D;  1GCK A;  3H1I D;  2D65 A;  3FFH A;  4GKG A;  1LWU B;  1L0N D;  3FQ7 A;  3EI7 A;  1PP9 D;  2KXP B;  2BI9 A;  2R5E A;  1ZC9 A;  3ASA A;  1PMM A;  2MKV A;  1LTJ C;  3NYT A;  1EXJ A;  4RAE A;  4IFD K;  5EUN A;  3FVU A;  1KQG B;  4I1L A;  2CST A;  4CXR A;  4C7R A;  3I16 A;  5EIG A;  1M0P A;  2EH6 A;  3M5U A;  3ZZK A;  1MDO A;  1M57 D;  3W68 A;  3CPW O;  1ZR4 A;  5DJU B;  3V4Q A;  1BW0 A;  4LNM A;  1L0N G;  1S72 P;  1KQS O;  2H43 A;  2E43 A;  1DJU A;  2WSE J;  3PJ0 A;  1VQ4 P;  1U08 A;  4R8D A;  3CBF A;  5KJ7 D;  1AQ5 A;  3CCL P;  3CX5 H;  2FFD B;  3SFE C;  3RL0 C;  1P3W A;  1NAF A;  3IF4 A;  2FFD A;  2ZT9 B;  5FT4 A;  5C39 A;  3FZ7 A;  3HRN A;  4WP0 A;  2WPR A;  4OVN F;  1IFN A;  4F5I A;  1EDI A;  2PAJ A;  1JUN A;  4A6R A;  2WZ7 A;  2IZ1 A;  3VK2 A;  2B87 B;  2QE7 H;  3TNU B;  2BEQ D;  3GZD A;  4N6J A;  3V4W A;  2FYU J;  2YXR B;  2QSR A;  3KZI E;  1FG7 A;  4H63 Q;  3EI6 A;  1MGV A;  3WGC A;  4CBR A;  1T3J A;  2QBT A;  2BCC J;  3M9Q A;  1QX8 A;  2GM4 A;  1FDM A;  2AY5 A;  1FC4 A;  2Z9V A;  3CWB G;  3CQ6 A;  3R4T A;  2BI3 A;  2OKJ A;  5TIS H;  4K2M A;  3FVX A;  3II6 A;  4K2I A;  4B98 A;  3F89 A;  1W5C E;  3CCU P;  1AJS A;  3A2B A;  1KIL C;  4JPZ B;  4OBV A;  1P84 D;  3AEO A;  3QBO A;  1QGN A;  3CCV P;  2TPL A;  2N9B A;  3AE1 C;  5E3K A;  3H1I J;  2FM1 A;  2M3E A;  1RVU A;  4D6T E;  5B5E H;  2XBN A;  1PPJ G;  1SQQ K;  2E54 A;  3MC6 A;  3KHU A;  2GUV A;  1AKB A;  3PAA A;  1GEW A;  3EI5 A;  2E74 C;  2RKL A;  5APV A;  4WBT A;  4WXG A;  5DX5 A;  2WK8 A;  1NTM G;  3B5N A;  5FT5 A;  4PJ0 E;  1K8A Q;  1ARH A;  3PGY A;  2OGA A;  4J5U A;  4M3L A;  2QJP B;  1DKA A;  1SP4 A;  4GE7 A;  3JCU E;  3CWB E;  2WPV B;  4ITG A;  4B86 A;  4W1X A;  2YMK A;  1EZV D;  2P2U A;  2X8U A;  1UU1 A;  2HOD A;  4JEZ A;  3HL2 A;  2VIA A;  4MN4 C;  1M0O A;  1AFO A;  3E2Y A;  1L4A D;  1O62 A;  3VK3 A;  2AEU A;  3GET A;  1ARS A;  4RES B;  5G09 A;  1LTG C;  1DJ9 A;  1U7J A;  5BJ3 A;  4MKJ A;  1FZA A;  3H1H E;  2WQY C;  2E75 C;  3H1L D;  1BCC E;  4GIF A;  3A9X A;  4RJY A;  1ASM A;  2Z20 A;  2I1K A;  2QSI A;  1J32 A;  2BHX A;  1MDX A;  3CLQ A;  1CI6 B;  1M8O B;  1WYV A;  1N7S C;  3H1L E;  3SSU A;  1YIY A;  4OYT A;  4WWI A;  3ZRP A;  4GSA A;  3OJA B;  3BCC E;  2C0W A;  3H9X A;  1V2F A;  1KMK A;  1OVU A;  3RUY A;  4YTP C;  5EFW B;  1ZP0 C;  3VP8 A;  3G71 P;  4DJG A;  4XJL A;  3MKJ A;  4CBS A;  1SQV E;  2Z9X A;  3KPE A;  2AY8 A;  3P1T A;  1K04 A;  2ZXE B;  1TAT A;  5CCH C;  5AVX B;  3CX5 D;  3LG0 A;  3NFQ A;  2VMS A;  4GT1 A;  4RIZ A;  3QM2 A;  1AHY A;  2Z61 A;  3D71 A;  4ZM4 A;  2KUB A;  3MP7 B;  3TGU E;  1FC2 C;  5AW7 B;  3TQX A;  3V2R A;  1ASC A;  3BWO A;  4P7Y A;  5APU A;  3TSI A;  5GTI E;  1K73 Q;  3PA9 A;  3FZ8 A;  1G2C A;  1J1D C;  2FXO A;  1G2C B;  4XJO A;  4F5K A;  1DD4 A;  2ZY3 A;  1CZE A;  2LR2 A;  1GC4 A;  4TT3 H;  2WSF J;  2AAT A;  5CHX A;  1H8A A;  2FYU D;  2W8T A;  3L71 D;  2IBZ I;  1NTK K;  1V72 A;  2OYO A;  1VQ9 P;  2K9J B;  2Y0D A;  3V2N A;  3H1I G;  3AEP A;  4N78 E;  1JY2 N;  1AJY A;  4BA4 A;  2OYI C;  3M0D A;  1TOK A;  3KGW A;  1NTM E;  1LW4 A;  2M8R A;  1J1D B;  1URQ D;  4R5F A;  4MKK A;  1AQT A;  1MZ9 A;  2KIK A;  1YQ3 C;  1JTH B;  3KXD A;  4PD4 H;  5GTH E;  2ORD A;  5M4D A;  2KZJ A;  2VMT A;  4LC1 A;  1FZE A;  4EU1 A;  4Q6R A;  3TDK A;  2JJF A;  3I56 P;  1SFC D;  2E76 B;  3B8X A;  4PV1 C;  1N2D C;  1ZN5 A;  4UB8 E;  2CH1 A;  4ZAH A;  1X29 A;  1SFC B;  2E76 D;  3GW6 A;  2KSJ A;  3BCX A;  4IXS A;  5CJ4 A;  3AE3 C;  3FRK A;  1AVY A;  4WVZ A;  2AY3 A;  1KIL B;  1KB9 E;  1M32 A;  3U59 A;  1D7U A;  3GG2 A;  2MJZ A;  1PP9 J;  3L73 G;  2R3S A;  3L74 D;  3BB8 A;  1A02 J;  5FT8 A;  1KN7 A;  1W7N A;  2E5Y A;  1Q2N A;  3MHV A;  1AHG A;  1LP1 B;  5HDM A;  2OTK E;  2VLF A;  1ASB A;  2YCN A;  3NRA A;  3TGU J;  3RCH B;  1RV4 A;  2E75 B;  1JMB A;  1ELU A;  4EDF A;  1AY5 A;  1Q82 Q;  1KC8 Q;  2P1J A;  1B9I A;  2JJG A;  4EI2 A;  2H88 C;  1FBM A;  1LTT C;  3LVL B;  2HP1 A;  3VK4 A;  3QWO C;  2VMU A;  4OCA A;  1OWA A;  5AW6 B;  1X22 A;  2FFD C;  2AY9 A;  1WRG A;  2QJP C;  3K7Y A;  2CIN A;  5CCH A;  3FX0 A;  2E74 B;  1SQV G;  1Y9B A;  3F9T A;  1BJN A;  2OAT A;  1O61 A;  1NTK J;  3H1J D;  1B5P A;  3SWY A;  4IX8 A;  5KTB A;  3NX3 A;  1BSH A;  1ZW0 A;  4BRY A;  1WYT A;  1J2J B;  3L72 J;  3T97 A;  2YRI A;  2VI8 A;  2XZR A;  2M5A B;  1FG3 A;  1CJ0 A;  1NU1 J;  1RQV A;  3VYI A;  2BKW A;  4ZM3 A;  3CCR P;  1OVR A;  4YXW H;  4I6M C;  1BE3 E;  4A72 A;  1GW4 A;  4O6Z A;  1OHW A;  1LC7 A;  1QZ9 A;  1OW6 A;  3R2P A;  2JDI H;  1UII A;  1L0L J;  2XV5 A;  4UB6 E;  3CCQ P;  3WUT A;  3DRD A;  2E5T A;  4OGQ C;  2V7Q J;  2A06 G;  1IK9 A;  3FDB A;  1P84 H;  3BCA A;  3BAS A;  3N75 A;  4KHX A;  1YIT P;  1W7M A;  2WKA A;  1S1C X;  3PLN A;  1KIL D;  5EUD A;  1X28 A;  1YTZ I;  4AZK A;  4R5Z A;  4I7Z C;  5GTI H;  3I55 P;  3BN1 A;  1RY3 A;  3AE2 C;  4LLH A;  1VP4 A;  2ZYG A;  2IX7 C;  4WBA A;  1FJP A;  3WKR A;  2CB1 A;  2W8J A;  2B87 A;  2VI9 A;  1PL5 A;  1S07 A;  2D63 A;  2RFV A;  1RF1 C;  3Q5S A;  3P8C D;  4A0H A;  1PG8 A;  2OYI A;  5EUE A;  3HE5 B;  1AIC A;  2A45 H;  1HWT C;  4A6T A;  1N7S B;  3QPG A;  4EB7 A;  1H89 A;  1PZQ A;  1SQV D;  2D64 A;  2CAN A;  1N86 A;  5H2F H;  4W1W A;  1ASG A;  2D2C D;  1DEB A;  4OGQ B;  5AW2 B;  1ARI A;  1K05 A;  3H6P A;  1KL2 A;  1IFM A;  2YCT A;  2O1K A;  5AVT B;  1FE6 A;  1QVF O;  1UKJ A;  4BMK A;  3M9H A;  1ZME C;  2OYH C;  3EI8 A;  3FXD A;  1FZC C;  2NPS A;  1AMR A;  3S1K A;  3I5T A;  1M7L A;  1Q86 Q;  3FWN A;  3N4R A;  1HTL C;  1IX6 A;  3UE8 A;  1KYO D;  1S5L H;  1L4A A;  1TPL A;  3FZ6 A;  1VF5 C;  1MFZ A;  2CPB A;  1WST A;  2DW3 A;  2JWA A;  1QL2 A;  3A3Y B;  2NPS C;  4ZWM A;  1PGP A;  4PD4 E;  3B5N B;  1CQ6 A;  4AUW A;  2I8D A;  1M6S A;  4JF7 A;  2OQX A;  4XFJ A;  1ZR2 A;  1IBJ A;  2VMY A;  4EFF A;  4MQR A;  3A0B E;  1TU3 F;  5M49 A;  3ZDM A;  3W1J A;  2XU6 A;  3C9I A;  2Y0C A;  3H1K D;  1QJ5 A;  1FS0 E;  2IBZ D;  3RGU A;  4ZMD A;  1HJB A;  3ZRQ A;  3WMM 0;  1RHZ B;  1N73 A;  2VGS A;  3DU4 A;  4BQ0 A;  1RV3 A;  2ZXX A;  3A0B H;  1HJ0 A;  2QJY C;  2E7J A;  3N0L A;  1FDO A;  2WPS A;  1JMM A;  1JF9 A;  3GZD C;  3HLM A;  4H44 B;  1DTY A;  2A45 I;  1IVR A;  1NVO A;  1LT9 B;  1XTG B;  3MTU E;  1CQ8 A;  2E7I A;  5KAF H;  4M2J A;  1DFO A;  3A0H H;  4NPE A;  4DBC A;  4IY7 A;  3A8U X;  2Z1Z A;  4UHM A;  3GBX A;  1JCC A;  4R4M A;  2FNU A;  2Y9Z A;  4ZSY A;  1VEF A;  5D5S A;  1LTJ A;  3L75 G;  1NOH A;  1BQA A;  4JYB A;  1FZC A;  4Y99 B;  3LV2 A;  5DJ1 A;  1CZQ A;  3ELE A;  4A00 A;  1N73 B;  4KXK A;  3GR9 A;  2HUF A;  3RQ1 A;  4PV1 B;  2Z9U A;  1MUU A;  1IUG A;  2E76 C;  2C44 A;  1OMI A;  4PV1 D;  1BJO A;  1NJI Q;  1GDE A;  3EWK A;  1NYH A;  3RK2 C;  1KV4 A;  1NKN A;  3V6I A;  2J58 A;  3B4S A;  3VMA A;  4Z1M H;  1ASA A;  1GU5 A;  3NTN A;  1WYV B;  1ORD A;  1IJD B;  1SS1 A;  2QM8 A;  4W7Z A;  5APT A;  4I8A A;  2IDB A;  2BEZ F;  3E7K A;  1SQX D;  1PFF A;  4B9B A;  3EUC A;  4MQQ A;  2E75 D;  1PGQ A;  2J59 M;  5L8R J;  3G7Q A;  3WZF A;  2R5B A;  2HOZ A;  1L4A B;  4HF8 A;  2YO2 A;  1BJW A;  2O1J A;  1JTH A;  5KAF E;  3VAX A;  3TCM A;  3AOV A;  3G6E P;  3VP6 A;  5AVW B;  3KZI H;  2A1V A;  2YRR A;  5E4Z A;  3RBZ A;  2WTY A;  1RVY A;  2VMZ A;  1SQQ E;  2ZYD A;  5KLV J;  1TOI A;  5M46 A;  3USS A;  2FYF A;  3HD7 C;  1L0L D;  4TLF A;  3KYQ A;  1NU1 D;  1M0Q A;  3QGU A;  5F8V A;  3L74 G;  1SQX J;  1RF0 A;  1W3U A;  4HH2 A;  5CBO A;  2YKY A;  2ZP7 A;  4GRX A;  1IJI A;  1JY3 O;  2DKB A;  3EQ2 A;  1VQN P;  4M2M A;  3A5T A;  4WYC A;  5E5I A;  2N1T D;  1HVV A;  1BDD A;  1FDI A;  2FY8 A;  3BRT B;  5TJH A;  4EOT A;  3HD7 A;  1SQB J;  4K2B A;  2QA3 A;  2W6B A;  2CK3 H;  3L70 E;  3FD0 A;  3R4Y A;  4UOY A;  1RE3 C;  1LTI C;  3NYU A;  2OGE A;  3MC6 C;  3H1J J;  2XND H;  1SFF A;  1L0L G;  1LC5 A;  3T97 B;  3L74 E;  1AAW A;  1RE3 A;  2EGY A;  1CZC A;  4WLH A;  1E5E A;  3VP9 A;  3GJU A;  3TFU A;  4ZDP A;  3WGB A;  1S9K D;  1YOO A;  1DJE A;  3HE5 A;  3H1H D;  4UHO A;  1HGZ A;  1VL2 A;  1ZOB A;  3RL0 g;  2C9L Y;  4KAM A;  1YJW P;  3USF A;  2IYO A;  3MGN A;  3WU2 E;  1AKC A;  2BI1 A;  4Q31 A;  4H44 D;  3V2Q A;  1LWU C;  3Q1M A;  3L8A A;  3ABV C;  2W7F A;  1VQL P;  2E42 A;  1SQP E;  1OIP A;  4H13 D;  2QJK C;  4OBU A;  4WB0 A;  1EDL A;  1CL2 A;  3H1I E;  1S0A A;  2KOG A;  1WYU A;  2V1P A;  3LID A;  3H1J E;  1Y47 A;  4RKC A;  3ITK A;  3WUU A;  2HUU A;  1IC2 A;  2WT7 A;  2VGU A;  2FNI A;  4NPF X;  3QHX A;  1GK6 A;  2X5F A;  4CXQ A;  3UWC A;  1S09 A;  2D61 A;  3PJS K;  5EQC A;  4GE9 A;  1KB9 H;  4PFF A;  1BGY G;  5AVR B;  4AO4 A;  3BCC G;  3LIE A;  1RF1 A;  2CJG A;  2OYH A;  2ITA A;  1S08 A;  5EAV A;  5FT6 A;  1XTC C;  3CXH E;  5KLI B;  2W7E A;  2CTZ A;  3L73 E;  4WB4 A;  3RK3 C;  3BVH A;  2ZY4 A;  1SQX E;  3DYD A;  1ZOY C;  4J8L A;  1JY3 N;  1RE4 A;  3HBX A;  1HGV A;  3C8V A;  4A7P A;  2OAR A;  1JG8 A;  2ZC0 A;  3Q5P A;  1NGM B;  3CD6 P;  1WKG A;  3JTX A;  4WYG A;  2CJH A;  2GA1 A;  5APX A;  5KLV G;  3AEN A;  3JSV C;  3MEB A;  3GZC A;  2G3A A;  3L44 A;  3RK2 D;  4ZLV A;  1M1J C;  1RH5 B;  2OTL P;  1AX4 A;  2CY8 A;  1MAQ A;  3HT4 A;  3GHG C;  1AJR A;  4JEW A;  2WPQ A;  1KMJ A;  4GOF A;  1URQ B;  2W7J A;  1N31 A;  3EIA A;  1BGY E;  1M1J A;  1SQB G;  1LS3 A;  1JS6 A;  1AMQ A;  2FYN C;  3EIB A;  3CQ5 A;  5KLV E;  2WMM A;  2OKK A;  3COG A;  3CMA P;  9AAT A;  2AEV A;  1EXI A;  2BCC D;  3G4S P;  2JJH A;  4XAU A;  3ISL A;  1ASN A;  3OA7 A;  5EIG B;  1P84 E;  1LK9 A;  4MY5 A;  1TAS A;  2DGK A;  4E3Q A;  3N4S A;  2LXB A;  3CC4 P;  1BT4 A;  4U3F G;  2KK7 A;  4NOG A;  2NPS B;  2GUS A;  1C7O A;  3TNU A;  1IX8 A;  2R5C A;  2YKP A;  4H0L C;  4H13 B;  3CME P;  2QJK B;  4BA5 A;  1VQ7 P;  3H1H G;  1K9M Q;  1URQ A;  3MUD C;  4JEV A;  1NKZ B;  3L4F A;  2D2C C;  4DT0 A;  5B66 E;  3CCJ P;  5APY A;  1YHQ P;  3M0A A;  2C0R A;  4DGT A;  1LT9 A;  1J1E C;  3S9O A;  2FBW C;  3VMY A;  1LC8 A;  5AX8 A;  1URQ C;  2QB2 A;  5AVU B;  1GL2 B;  2KS1 B;  4WYD A;  4RLG A;  4ISY A;  2AXT E;  1H0T A;  1DEE G;  2O01 H;  5DJT B;  2FXM A;  3E9K A;  1H0C A;  3B1E A;  2Y9Y A;  1D7S A;  1YAA A;  1SLQ A;  3H1K G;  1C7G A;  2D7Y A;  3V5B A;  4W5K A;  4PIW A;  1VF5 D;  1YQ4 C;  2PB0 A;  4CPG A;  1KKJ A;  3AEG C;  3DR7 A;  1JEK A;  1UU2 A;  1T2K D;  1AMA A;  3FSL A;  4Q75 A;  2LKM A;  3H1K E;  3WUV A;  2WSC J;  1NTK D;  2VMP A;  2KI7 B;  1G4V A;  1KL1 A;  3TF5 A;  2QM7 A;  5CCG D;  1B4X A;  5APS A;  2KNC B;  4L76 A;  1GD9 A;  4H51 A;  5F9S A;  1G4X A;  3AEN B;  1SQP J;  3PPL A;  4IYO A;  1SQB E;  3BS8 A;  2WIT A;  1NHL A;  1AY8 A;  3SFD C;  1ASD A;  1CSB A;  3IR9 A;  2FKW B;  1HF9 A;  3NYS A;  4DCK A;  1YTZ T;  2KLV A;  1VQM P;  1C9C A;  1DGD A;  4L74 A;  3HE4 B;  1AV1 A;  1M7Y A;  2JWD A;  2E7U A;  5CCH D;  2A06 D;  3FDD A;  2W83 C;  2BIE A;  2RH0 A;  1SQQ J;  3NMD A;  1BDC A;  1FJK A;  2JIS A;  3WCO A;  4O9B A;  4F5H A;  4F4E A;  3MUD A;  5KLV K;  4HB1 A;  2HYN A;  5D95 A;  3FXE A;  2JGT A;  1V2D A;  2B88 A;  4U7J A;  1LTJ B;  1NAY A;  1BQD A;  5KKZ B;  3N5M A;  1BCC J;  1LNQ A;  2HZP A;  3AE4 C;  4XQ2 A;  3L73 D;  4RO0 A;  5GTH H;  1KMI Z;  4PFN A;  5CCG C;  2IBZ G;  2EYQ A;  2IFM A;  4GDY A;  1HH0 A;  1Q81 Q;  1MKM A;  4KT0 J;  3AEA C;  2V4H A;  3NXS A;  4JYC A;  2DGL A;  2X5D A;  2IPP A;  1OXO A;  2QVA A;  2H89 C;  4U3F J;  1O4S A;  5KLV D;  2VMW A;  3F5H A;  5G0A A;  1IX7 A;  2AY2 A;  2YIU C;  5EAA A;  2KP8 A;  3TGU G;  3IN6 A;  3HVY A;  5KAI E;  3RL0 D;  3A9Z A;  3JWB A;  2L5G B;  2W7G A;  3UIA A;  1W2B O;  4GOD A;  2W7M A;  3NTJ A;  3B8E B;  1SZK A;  3VOP A;  5AVQ B;  5APQ A;  2E74 D;  1Y8A A;  1USE A;  4BWN A;  2K37 A;  1U7M A;  3L71 J;  1AMS A;  3RI6 A;  2YKX A;  1HBW A;  4WXF A;  3L37 A;  3H32 A;  1IFI A;  3H7F A;  3L70 G;  3A9Y A;  3GHG B;  2C0X A;  1S2E A;  1LT9 C;  1NTZ J;  3K40 A;  5JAY A;  1PMO A;  1CL1 A;  3AEF C;  1SQP K;  3CXH D;  5KAI H;  2WSE H;  1BS0 A;  1TAR A;  2W6A A;  1BGY J;  2ZYA A;  4EIJ A;  1YJ9 P;  5BVZ A;  3PDB A;  3L35 A;  2JG2 A;  2G7J A;  2QG4 A;  3CXH H;  3MIW A;  2HLO A;  2WWW A;  2YMY A;  2Z5H A;  2ZFC A;  4K35 A;  1KKP A;  2Q6Q A;  3Q2Y A;  1IFP A;  2V7Q H;  1NTM D;  3ACZ A;  4PD4 D;  1QIR A;  2K88 A;  1NTM K;  4BXL A;  4RJ0 A;  1QJ3 A;  2WSS H;  4WYE A;  3M06 A;  2ZUK A;  3R9A A;  2YO3 A;  5M1B A;  2ZY5 A;  1JB0 J;  1LKC A;  1OAT A;  3BCB A;  3PTZ A;  4W7Y A;  1NWQ A;  1YYC A;  2NPS D;  3GHG A;  2BWO A;  2R3C A;  1GTW A;  3CC7 P;  2AXC A;  3U1A A;  1JY3 P;  1X9V A;  1SQQ G;  3T32 A;  2AEJ A;  3IAO A;  5AW1 B;  4WB0 B;  4H0L D;  5AVV B;  1RQU A;  1YJY A;  1R5S A;  3BCC D;  2AEF A;  2N1T B;  4U3F E;  2NMP A;  2V0Y A;  2HOX A;  3H1L J;  1JY2 O;  4Y99 C;  1SFC A;  3GMA A;  1OX3 A;  1PP9 E;  2O01 J;  4ZKP A;  2VLH A;  2B9B A;  3M91 A;  3CQ4 A;  2BIA A;  4FL0 A;  4D6T D;  2PGD A;  1IK7 A;  1GD2 E;  1G1J A;  2YOB A;  3ZZJ A;  2W8Z A;  3W1H A;  4AOA A;  3M0D C;  1A02 F;  1GC2 A;  3KQG A;  4ZAS A;  1SPA A;  1SF2 A;  1EQ7 A;  1EZV E;  1PV3 A;  3P6K A;  1M1J B;  1PFI A;  2VMO A;  1EZV G; 
#chains in the Genus database with same CATH homology
 4RM1 A;  2GSA A;  2YNY A;  1AHE A;  3P8M C;  3WCN A;  4LNJ A;  3N4X A;  2C81 A;  1KFN A;  1MV8 A;  3MAF A;  2BAS A;  2WB6 A;  2YKU A;  2FYU K;  1AIA A;  1GC0 A;  3FFR A;  3DR4 A;  3LVM A;  1ASL A;  2W8V A;  1NTZ K;  3HTK B;  1I41 A;  2HOR A;  2CH2 A;  3ELP A;  3ZRR A;  3B5N C;  5AVY B;  4IYO B;  3IHJ A;  8AAT A;  4WY4 C;  3NU8 A;  1MLZ A;  1JY2 P;  4OMA A;  5AVZ B;  2YKQ A;  1G7X A;  1LTS C;  4ZDO A;  1YIZ A;  3VMX A;  5G2P A;  1E5F A;  3HDO A;  2W7D A;  2VMR A;  2QB3 A;  1T3U A;  3HTK A;  1FU1 A;  4UQV A;  2N1T C;  4ZWV A;  2GMS A;  1KZU B;  2Q3I A;  1ART A;  5M4B A;  1LWU A;  2HFE D;  2AY1 A;  2HG5 D;  4JEY A;  4R2N A;  3I4J A;  1GW3 A;  1GK4 A;  5APW A;  3B1C A;  5BJ4 A;  4F5M A;  3KGX A;  5BU5 A;  1J04 A;  3OAK A;  1RF0 C;  2R5C B;  1JO5 A;  1ASE A;  4IFM A;  4DQ6 A;  4ADE A;  3RBF A;  2WK7 A;  3G0T A;  4HVK A;  4KYO A;  4XJP A;  2D66 A;  4N78 D;  2H8P D;  3WLX A;  1JCD A;  1GC3 A;  2R2N A;  4IXZ A;  4GE4 A;  1GDT A;  1SVV A;  1AJS B;  2JEE A;  3O8Z A;  3NNK A;  3FKD A;  4F5J A;  1EJI A;  4W91 A;  2FQ6 A;  5DJ9 A;  2M3B A;  5G4I A;  4U1T A;  3E1I A;  1BJO B;  2Z4E A;  2EO5 A;  3AEM A;  3E6G A;  1I43 A;  2PO3 A;  2BWP A;  4ADC A;  1QIT A;  3A2A A;  1ELQ A;  2FKI A;  2VMN A;  2XDJ A;  5IWQ A;  2YHK A;  3ATH A;  1YJS A;  1SFC C;  2G6W A;  1SQV K;  3PD6 A;  1FOS F;  3BWN C;  3D6K A;  2DOU A;  2AY4 A;  5CJ0 A;  3DOD A;  5G2Q A;  2KFP A;  2ZY2 A;  4WD2 A;  1G7W A;  2BWN A;  2JJL A;  1LW5 A;  4F5L A;  3OKS A;  3RK2 B;  3ECD A;  3JWA A;  1O69 A;  1YJZ A;  2X3L A;  3MBB A;  4ATQ A;  2ZJG A;  3B1D A;  4MQP A;  4ZKU A;  2W8U A;  3WY7 A;  2VYC A;  2W7L A;  1DH3 A;  1H88 A;  2P67 A;  2WSF H;  2I1J A;  4WYF A;  1X8Y A;  1ASF A;  2YCP A;  1AAM A;  5KJ7 A;  1T3I A;  4TN4 A;  2VRS A;  1FZB A;  3MAD A;  4HYT B;  5AW0 B;  1W7L A;  4LNL A;  1GEX A;  4ZDL A;  1I48 A;  4PVF A;  3P8C E;  1BKG A;  3H32 B;  2R5D A;  2W7I A;  1RF1 B;  4P3M A;  1MLY A;  1IFJ A;  2BYJ A;  1W2E A;  4Y0I A;  3RK3 B;  3FCR A;  2VGV A;  7AAT A;  1WKH A;  4JF1 A;  3RL0 B;  3FTB A;  5AW3 B;  3PDB B;  4W80 A;  4Y0D A;  2P7J A;  4W1V A;  1N7S D;  3FQA A;  4L0O A;  4XA4 A;  3HD7 B;  1N2T A;  4WYA A;  2GQN A;  2H7H A;  3EI9 A;  3GSB A;  2BI5 A;  3E2Z A;  3QI6 A;  2CJD A;  1OHV A;  2XNX A;  1SZU A;  3K28 A;  3IFM A;  4BHD A;  1LGH B;  1AKA A;  2D5Y A;  1J1E B;  3PIU A;  1NH4 A;  3KDP B;  2CPS A;  1V2E A;  3HUS A;  3VMZ A;  1OHY A;  1JNM A;  5AW8 B;  2F8J A;  5AW4 B;  3LWS A;  5HHY A;  4M2K A;  2O7C A;  3HQT A;  1M0N A;  3AOW A;  2YKV A;  3AV7 A;  1NU1 K;  1X79 B;  1X0M A;  2QMA A;  4E1O A;  1CW5 A;  3NDN A;  3QN6 A;  2N1T A;  1JOC A;  1C4K A;  3N7N A;  4AQR D;  4A6U A;  3E2F A;  5J8Q A;  5AW9 B;  4CVQ A;  1OXP A;  3EZ1 A;  4ITX A;  1XI9 A;  1MAP A;  1VJO A;  4ADD A;  3HUS B;  3LVJ A;  3KKI A;  3RCH A;  1GBN A;  2VIB A;  4RKD A;  3LVK A;  2VGT A;  4DOJ A;  1S9K E;  4IXO A;  3G8M A;  4OT8 A;  3DXV A;  1IAY A;  1Z3Z A;  4WXB A;  4C7N A;  1AIB A;  3VN0 A;  1GL2 D;  2A45 G;  4C7N B;  1GL2 C;  3EZS A;  3UAK A;  1WYU B;  3MAF B;  1JS3 A;  4Q76 A;  1RE4 C;  4MSO A;  3BC8 A;  1FAV A;  2BI2 A;  4IW7 A;  3B46 A;  4W8I A;  2EZ2 A;  4XK1 A;  5DB5 A;  4LW2 A;  2HPC B;  1L4A C;  1LTB C;  4XJM A;  1KFM A;  2W8W A;  4A0R A;  3CI9 A;  4OH8 B;  2ZYJ A;  3HMU A;  3VTP C;  5KJ7 C;  2Z1Y A;  1C7N A;  3F0H A;  1N8P A;  1M4N A;  3AEM C;  3M9B A;  3DZZ A;  4A0F A;  2DR1 A;  3JW9 A;  1AY4 A;  1BJ4 A;  2Q9I A;  2AY6 A;  1UU0 A;  3CL3 D;  2OYI B;  2HP2 A;  1N73 C;  4A0G A;  5HXX A;  3B5N D;  2PP6 A;  2OYH B;  2W27 A;  3DC1 A;  2R0T A;  3PDX A;  2VGZ A;  3G3Z A;  2Q7W A;  2DGM A;  1WT6 A;  1WYT B;  1G1I A;  5I92 A;  2WSC H;  5EFS A;  3Q8N A;  1GZL A;  1MDZ A;  2HUI A;  2DKJ A;  2W7H A;  2GB3 A;  3ASB A;  3HUS C;  3AEJ A;  4N3Y B;  1GL2 A;  1OXZ A;  3RK3 D;  3MAU A;  3BAT A;  2QLR A;  3RBL A;  1E5W A;  3W1I A;  4ZSW A;  1HUC A;  1Z7D A;  4JF0 A;  1ZV8 A;  3EFG A;  2Q7C A;  1CI6 A;  4GEB A;  4AH3 A;  1FOS E;  4AZJ A;  1QIS A;  1L0L K;  1S06 A;  1IAX A;  2VMX A;  1H1C A;  3GWP A;  5K8B A;  2ZSM A;  1FZC B;  2ZSL A;  5AW5 B;  3NUI A;  1YNU A;  1ECX A;  1T8Z A;  2GMU A;  1CS1 A;  1W23 A;  3F6T A;  3TAT A;  3P32 A;  3AEL A;  3L36 A;  1TOG A;  4Y0H A;  3SWF A;  4WY4 B;  5TF5 A;  4K05 A;  4U2H A;  3PP5 A;  2R32 A;  3FVS A;  1GU4 A;  2FYZ A;  3U1C A;  1CQ7 A;  5CCG A;  2C9N Y;  2W7K A;  1IO4 A;  1B9H A;  1XEY A;  3BV0 A;  3VOM A;  1KIL A;  3E77 A;  2IFN A;  4LW4 A;  1EG5 A;  1VDF A;  3PD6 B;  5CMZ A;  1SVF A;  4N0W A;  4AO9 A;  4OTL A;  2HOD B;  3II0 A;  2Z9W A;  1Y4I A;  4WY4 A;  4C46 A;  2O1B A;  1B5O A;  1D7V A;  1SQB K;  2HOY A;  2CFB A;  3OP7 A;  1NO4 A;  3BWN A;  4TMR A;  3V2P A;  2BYL A;  1L0N K;  2KB7 P;  1D7R A;  2Q5U A;  5AVS B;  1I29 A;  3P7K A;  2VMV A;  2D7Z A;  3HD7 D;  1DGE A;  4XEW A;  3LW5 H;  3E2Z B;  3TFT A;  1AHF A;  3WX9 A;  4F5F A;  3AAT A;  3I5C A;  3HE4 A;  2VGW A;  4LGD E;  2HPC A;  3CAI A;  2WT7 B;  4IFF A;  2XH1 A;  1LTA C;  1QL1 A;  4DZO A;  1ARG A;  3DXW A;  1X2A A;  1AHX A;  1C0N A;  3BRV B;  4ATP A;  2PB2 A;  4E3R A;  4WLJ A;  1D2F A;  2C7T A;  2JJE A;  1GEY A;  4EMY A;  4XE5 B;  4RIT A;  4F5G A;  1B8G A;  2YKO A;  3JZL A;  3NU7 A;  4LC3 A;  5BU8 B;  3TYY A;  1EQB A;  1Z56 A;  4UHN A;  1DX7 A;  1TOE A;  1KQL A;  2VMQ A;  1SZS A;  2Z5I A;  4FFC A;  2BIG A;  1N7L A;  4JEX A;  4E77 A;  4EB5 A;  3NUB A;  1ZLL A;  1VPC A;  3LY1 A;  3WKS A;  1IFD A;  1T2K C;  1TOJ A;  4QGR A;  2AY7 A;  2WK9 A;  2POH A;  3A7O A;  4AYC A;  4WY4 D;  1ZOD A;  2XKM A;  3MD0 A;  2EPJ A;  4I2L C;  2EZ1 A;  2O0R A;  4OC9 A;  5C6U A;  5G4J A;  3FQ8 A;  2FN6 A;  3KE3 A;  1FZG A;  1N7S A;  3AEJ C;  3TK1 A;  2KYV A;  4ADB A;  1SQX K;  1FZF A;  1GCK A;  2D65 A;  3FFH A;  4GKG A;  1LWU B;  3FQ7 A;  3EI7 A;  2BI9 A;  2R5E A;  1ZC9 A;  3ASA A;  1PMM A;  1LTJ C;  3NYT A;  4RAE A;  4IFD K;  5EUN A;  3FVU A;  4I1L A;  2CST A;  4CXR A;  4C7R A;  3I16 A;  5EIG A;  1M0P A;  2EH6 A;  3M5U A;  3ZZK A;  1MDO A;  3V4Q A;  1ZR4 A;  1BW0 A;  4LNM A;  2H43 A;  2E43 A;  1DJU A;  3PJ0 A;  1U08 A;  4R8D A;  3CBF A;  5KJ7 D;  1AQ5 A;  2FFD B;  3RL0 C;  1P3W A;  1NAF A;  5FT4 A;  2FFD A;  3FZ7 A;  3HRN A;  4WP0 A;  2WPR A;  1IFN A;  4F5I A;  2PAJ A;  1JUN A;  4A6R A;  2WZ7 A;  3VK2 A;  3TNU B;  3GZD A;  4N6J A;  3V4W A;  2QSR A;  1FG7 A;  4H63 Q;  3EI6 A;  1MGV A;  3WGC A;  4CBR A;  1T3J A;  2QBT A;  3M9Q A;  2GM4 A;  1FDM A;  2AY5 A;  1FC4 A;  2Z9V A;  3CQ6 A;  3R4T A;  2BI3 A;  2OKJ A;  4K2M A;  3FVX A;  3II6 A;  4K2I A;  4B98 A;  1AJS A;  3A2B A;  1KIL C;  4OBV A;  3AEO A;  3QBO A;  1QGN A;  2TPL A;  2N9B A;  5E3K A;  2FM1 A;  1RVU A;  2XBN A;  1SQQ K;  2E54 A;  3MC6 A;  2GUV A;  3PAA A;  1AKB A;  1GEW A;  3EI5 A;  5DX5 A;  5APV A;  4WBT A;  4WXG A;  2WK8 A;  3B5N A;  5FT5 A;  1ARH A;  3PGY A;  2OGA A;  4J5U A;  4M3L A;  1DKA A;  1SP4 A;  4GE7 A;  4ITG A;  4B86 A;  4W1X A;  2P2U A;  2X8U A;  1UU1 A;  2HOD A;  4JEZ A;  3HL2 A;  2VIA A;  1M0O A;  1AFO A;  3E2Y A;  1L4A D;  1O62 A;  3VK3 A;  2AEU A;  3GET A;  1ARS A;  4RES B;  5G09 A;  1LTG C;  1DJ9 A;  5BJ3 A;  4MKJ A;  1FZA A;  4GIF A;  3A9X A;  4RJY A;  1ASM A;  2Z20 A;  2I1K A;  1J32 A;  2BHX A;  1MDX A;  3CLQ A;  1CI6 B;  1WYV A;  1N7S C;  1YIY A;  4OYT A;  3ZRP A;  4GSA A;  3OJA B;  2C0W A;  3H9X A;  1V2F A;  1KMK A;  3RUY A;  3VP8 A;  4XJL A;  3MKJ A;  4CBS A;  2Z9X A;  3KPE A;  2AY8 A;  3P1T A;  2ZXE B;  1TAT A;  5CCH C;  5AVX B;  3LG0 A;  3NFQ A;  2VMS A;  4GT1 A;  4RIZ A;  3QM2 A;  1AHY A;  2Z61 A;  4ZM4 A;  5AW7 B;  3TQX A;  3V2R A;  1ASC A;  3BWO A;  4P7Y A;  5APU A;  3TSI A;  3PA9 A;  3FZ8 A;  1G2C A;  1J1D C;  1G2C B;  4XJO A;  4F5K A;  2ZY3 A;  1CZE A;  1GC4 A;  2AAT A;  5CHX A;  1H8A A;  2W8T A;  1NTK K;  1V72 A;  3V2N A;  3AEP A;  4N78 E;  1JY2 N;  4BA4 A;  2OYI C;  3M0D A;  1TOK A;  3KGW A;  1LW4 A;  2M8R A;  1J1D B;  1URQ D;  4R5F A;  4MKK A;  1MZ9 A;  1JTH B;  2ORD A;  5M4D A;  2VMT A;  4LC1 A;  1FZE A;  4EU1 A;  4Q6R A;  2JJF A;  3B8X A;  1SFC D;  4ZAH A;  1N2D C;  1ZN5 A;  2CH1 A;  1X29 A;  1SFC B;  2KSJ A;  3BCX A;  4IXS A;  5CJ4 A;  3FRK A;  2AY3 A;  1KIL B;  1M32 A;  3U59 A;  1D7U A;  2MJZ A;  3BB8 A;  1A02 J;  5FT8 A;  1W7N A;  1AHG A;  5HDM A;  2VLF A;  1ASB A;  2YCN A;  3NRA A;  3RCH B;  1RV4 A;  1ELU A;  1AY5 A;  2P1J A;  1B9I A;  2JJG A;  1FBM A;  1LTT C;  3LVL B;  2HP1 A;  3VK4 A;  2VMU A;  4OCA A;  1OWA A;  5AW6 B;  2FFD C;  2AY9 A;  1WRG A;  3K7Y A;  2CIN A;  5CCH A;  3F9T A;  1BJN A;  2OAT A;  1O61 A;  1B5P A;  3SWY A;  4IX8 A;  5KTB A;  3NX3 A;  1WYT A;  1J2J B;  3T97 A;  2YRI A;  2VI8 A;  2XZR A;  1FG3 A;  1CJ0 A;  3VYI A;  2BKW A;  4ZM3 A;  4I6M C;  4A72 A;  1GW4 A;  4O6Z A;  1OHW A;  1LC7 A;  1QZ9 A;  3R2P A;  2XV5 A;  3DRD A;  1IK9 A;  3FDB A;  3BCA A;  3BAS A;  3N75 A;  4KHX A;  1W7M A;  2WKA A;  1KIL D;  5EUD A;  1X28 A;  1YTZ I;  4AZK A;  4R5Z A;  3BN1 A;  1RY3 A;  4LLH A;  1VP4 A;  2IX7 C;  4WBA A;  1FJP A;  3WKR A;  2CB1 A;  2W8J A;  2VI9 A;  1S07 A;  2D63 A;  2RFV A;  1RF1 C;  3P8C D;  4A0H A;  1PG8 A;  2OYI A;  5EUE A;  3HE5 B;  1AIC A;  2A45 H;  1HWT C;  4A6T A;  1N7S B;  3QPG A;  4EB7 A;  1H89 A;  2D64 A;  2CAN A;  1N86 A;  4W1W A;  1ASG A;  1DEB A;  5AW2 B;  1ARI A;  3H6P A;  1KL2 A;  1IFM A;  2YCT A;  2O1K A;  5AVT B;  1UKJ A;  4BMK A;  3M9H A;  2OYH C;  3EI8 A;  1FZC C;  2NPS A;  1AMR A;  3I5T A;  1M7L A;  3N4R A;  1HTL C;  1IX6 A;  3UE8 A;  1L4A A;  1TPL A;  3FZ6 A;  1MFZ A;  2CPB A;  1WST A;  1QL2 A;  3A3Y B;  2NPS C;  4ZWM A;  1CQ6 A;  3B5N B;  4AUW A;  1M6S A;  4JF7 A;  2OQX A;  1ZR2 A;  1IBJ A;  2VMY A;  4EFF A;  4MQR A;  5M49 A;  3W1J A;  2XU6 A;  3C9I A;  1QJ5 A;  1HJB A;  3ZRQ A;  3WMM 0;  1N73 A;  2VGS A;  3DU4 A;  4BQ0 A;  1RV3 A;  2E7J A;  3N0L A;  2WPS A;  1JMM A;  1JF9 A;  3GZD C;  3HLM A;  1DTY A;  2A45 I;  1IVR A;  1LT9 B;  1XTG B;  3MTU E;  1CQ8 A;  2E7I A;  4M2J A;  1DFO A;  4DBC A;  4IY7 A;  3A8U X;  2Z1Z A;  4UHM A;  3GBX A;  1JCC A;  2FNU A;  4ZSY A;  1VEF A;  5D5S A;  1LTJ A;  1NOH A;  1BQA A;  4JYB A;  4Y99 B;  1FZC A;  3LV2 A;  5DJ1 A;  1CZQ A;  3ELE A;  4A00 A;  1N73 B;  4KXK A;  3GR9 A;  2HUF A;  3RQ1 A;  2Z9U A;  1MUU A;  1IUG A;  2C44 A;  1BJO A;  1GDE A;  3RK2 C;  1NKN A;  2J58 A;  1ASA A;  1GU5 A;  3NTN A;  1WYV B;  1ORD A;  1IJD B;  2QM8 A;  4W7Z A;  5APT A;  4I8A A;  1PFF A;  4B9B A;  3EUC A;  4MQQ A;  2J59 M;  3WZF A;  3G7Q A;  2R5B A;  2HOZ A;  1L4A B;  4HF8 A;  2YO2 A;  1BJW A;  2O1J A;  1JTH A;  3VAX A;  3TCM A;  3AOV A;  3VP6 A;  5AVW B;  2A1V A;  5E4Z A;  2YRR A;  2WTY A;  1RVY A;  2VMZ A;  1TOI A;  5M46 A;  2FYF A;  3HD7 C;  3KYQ A;  1M0Q A;  5F8V A;  3QGU A;  1RF0 A;  1W3U A;  4HH2 A;  2YKY A;  2ZP7 A;  4GRX A;  1IJI A;  1JY3 O;  2DKB A;  3EQ2 A;  5E5I A;  4M2M A;  3A5T A;  4WYC A;  2N1T D;  1HVV A;  3BRT B;  4EOT A;  3HD7 A;  4K2B A;  2QA3 A;  2W6B A;  3FD0 A;  4UOY A;  1RE3 C;  1LTI C;  3NYU A;  2OGE A;  3MC6 C;  1SFF A;  1LC5 A;  1AAW A;  1RE3 A;  2EGY A;  1CZC A;  4WLH A;  1E5E A;  3VP9 A;  3GJU A;  3TFU A;  4ZDP A;  3WGB A;  1S9K D;  1YOO A;  1DJE A;  3HE5 A;  4UHO A;  1HGZ A;  1ZOB A;  2C9L Y;  4KAM A;  3USF A;  3MGN A;  1AKC A;  2BI1 A;  4Q31 A;  3V2Q A;  1LWU C;  3L8A A;  2W7F A;  2E42 A;  4OBU A;  4WB0 A;  1CL2 A;  1S0A A;  2KOG A;  1WYU A;  2V1P A;  3LID A;  4RKC A;  2HUU A;  1IC2 A;  2WT7 A;  2VGU A;  2FNI A;  3QHX A;  1GK6 A;  2X5F A;  4CXQ A;  3UWC A;  1S09 A;  2D61 A;  5EQC A;  4GE9 A;  4PFF A;  5AVR B;  4AO4 A;  3LIE A;  1RF1 A;  2CJG A;  2OYH A;  1S08 A;  5EAV A;  5FT6 A;  1XTC C;  2W7E A;  2CTZ A;  4WB4 A;  3RK3 C;  3BVH A;  2ZY4 A;  3DYD A;  4J8L A;  1JY3 N;  1RE4 A;  3HBX A;  1HGV A;  2OAR A;  1JG8 A;  2ZC0 A;  1WKG A;  3JTX A;  4WYG A;  2CJH A;  5APX A;  3AEN A;  3MEB A;  3GZC A;  3L44 A;  3RK2 D;  4ZLV A;  1M1J C;  1AX4 A;  2CY8 A;  1MAQ A;  3HT4 A;  3GHG C;  1AJR A;  4JEW A;  2WPQ A;  1KMJ A;  1URQ B;  2W7J A;  1N31 A;  3EIA A;  1M1J A;  1LS3 A;  1JS6 A;  1AMQ A;  3EIB A;  3CQ5 A;  2OKK A;  3COG A;  9AAT A;  2AEV A;  2JJH A;  4XAU A;  3ISL A;  1ASN A;  3OA7 A;  5EIG B;  1LK9 A;  4MY5 A;  1TAS A;  2DGK A;  4E3Q A;  3N4S A;  1BT4 A;  4NOG A;  2NPS B;  2GUS A;  1C7O A;  3TNU A;  1IX8 A;  2R5C A;  2YKP A;  4BA5 A;  1URQ A;  4JEV A;  1NKZ B;  3L4F A;  5APY A;  3M0A A;  2C0R A;  4DGT A;  1LT9 A;  1J1E C;  3VMY A;  1LC8 A;  5AX8 A;  1URQ C;  2QB2 A;  5AVU B;  1GL2 B;  4WYD A;  4RLG A;  4ISY A;  2O01 H;  2FXM A;  3E9K A;  1H0C A;  3B1E A;  1D7S A;  1YAA A;  1SLQ A;  1C7G A;  4W5K A;  2D7Y A;  3V5B A;  4PIW A;  2PB0 A;  1KKJ A;  3DR7 A;  1UU2 A;  1T2K D;  1AMA A;  3FSL A;  4Q75 A;  2LKM A;  2VMP A;  1G4V A;  1KL1 A;  2QM7 A;  5CCG D;  1B4X A;  5APS A;  4H51 A;  1GD9 A;  5F9S A;  1G4X A;  3AEN B;  3PPL A;  4IYO A;  3BS8 A;  2WIT A;  1NHL A;  1AY8 A;  1ASD A;  1CSB A;  3IR9 A;  2FKW B;  3NYS A;  1YTZ T;  2KLV A;  1C9C A;  1DGD A;  3HE4 B;  1M7Y A;  2E7U A;  5CCH D;  3FDD A;  2BIE A;  3NMD A;  1FJK A;  2JIS A;  3WCO A;  4O9B A;  4F5H A;  4F4E A;  3MUD A;  5KLV K;  2HYN A;  5D95 A;  2JGT A;  1V2D A;  1LTJ B;  1BQD A;  3N5M A;  2HZP A;  4XQ2 A;  4PFN A;  5CCG C;  2EYQ A;  2IFM A;  4GDY A;  1HH0 A;  3NXS A;  4JYC A;  2DGL A;  2X5D A;  2IPP A;  1OXO A;  1O4S A;  2VMW A;  5G0A A;  1IX7 A;  2AY2 A;  5EAA A;  2KP8 A;  3HVY A;  3RL0 D;  3A9Z A;  3JWB A;  2L5G B;  2W7G A;  3UIA A;  2W7M A;  3NTJ A;  3B8E B;  1SZK A;  3VOP A;  5AVQ B;  5APQ A;  1AMS A;  3RI6 A;  2YKX A;  1HBW A;  4WXF A;  3L37 A;  3H32 A;  1IFI A;  3H7F A;  3A9Y A;  3GHG B;  2C0X A;  1LT9 C;  3K40 A;  5JAY A;  1PMO A;  1CL1 A;  1SQP K;  2WSE H;  1BS0 A;  1TAR A;  2W6A A;  4EIJ A;  5BVZ A;  3PDB A;  3L35 A;  2JG2 A;  2G7J A;  3MIW A;  2HLO A;  2WWW A;  2YMY A;  2Z5H A;  2ZFC A;  1KKP A;  3ACZ A;  1QIR A;  1NTM K;  4RJ0 A;  1QJ3 A;  4WYE A;  3M06 A;  2ZUK A;  3R9A A;  2YO3 A;  2ZY5 A;  1LKC A;  1OAT A;  3BCB A;  4W7Y A;  1NWQ A;  1YYC A;  2NPS D;  3GHG A;  2BWO A;  2R3C A;  1GTW A;  3U1A A;  1JY3 P;  1X9V A;  3T32 A;  5AW1 B;  4WB0 B;  5AVV B;  1YJY A;  2N1T B;  2NMP A;  2V0Y A;  2HOX A;  1JY2 O;  4Y99 C;  1SFC A;  4ZKP A;  2VLH A;  3M91 A;  3CQ4 A;  2BIA A;  4FL0 A;  1GD2 E;  3ZZJ A;  1G1J A;  2YOB A;  3W1H A;  4AOA A;  3M0D C;  1A02 F;  1GC2 A;  3KQG A;  4ZAS A;  1SPA A;  1SF2 A;  1EQ7 A;  3P6K A;  1M1J B;  1PFI A;  2VMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...