2BIAA

Radiation damage of the schiff base in phosphoserine aminotransferase (structure g)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
360
structure length
360
Chain Sequence
VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
total genus 128
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2biaA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2biaA02
3GZCA 5EUEA 1S09A 2VMPA 2CINA 1BJOA 2FQ6A 4F5JA 4MY5A 1U08A 1QGNA 1N8PA 1OXOA 2VGVA 1BJOB 3CBFA 3DC1A 3UE8A 1ZC9A 2W8JA 3AELA 3EIAA 5HHYA 3BV0A 4N0BA 4A0GA 4B9BA 3NYTA 3AOVA 3TQXA 7AATA 1AY4A 3NYUA 5M49A 1BQDA 3L44A 4GE4A 2VIAA 2CH2A 3BCBA 4WBTA 4ATQA 1BS0A 1BKGA 5EIGA 5E4ZA 4W1VA 3D6KA 4ZWMA 1LS3A 1UU2A 1GCKA 3VOMA 1JF9A 4LW4A 4TN4A 1IVRA 2R5CB 2W7EA 4IW7A 1AX4A 3MAFB 3EZ1A 1AHXA 1X2AA 1AJRA 2VMVA 3B1CA 3GZDA 1TATA 4OBVA 2BIAA 5G09A 1KL1A 2D65A 3LG0A 1ASEA 4JF0A 1IBJA 4E1OA 1LW4A 8AATA 3QBOA 3E2ZB 5EFSA 4E3QA 4JEWA 1PFFA 1I29A 2BYLA 3DU4A 1AICA 2VMZA 1C9CA 4Y0HA 2ZY2A 5E5IA 3W1IA 3GWPA 2FM1A 3KKIA 2OQXA 2EZ1A 1MLZA 3DXWA 4FFCA 4AZKA 4ZDLA 3EI9A 1LW5A 3E2ZA 4BHDA 4BMKA 1D7UA 1YNUA 4DGTA 1W7MA 4BA5A 2ZSLA 1ASBA 3E6GA 5DB5A 1WYTA 4R5FA 3KE3A 3E2YA 4OBUA 3LWSA 2QB2A 1ASAA 2FYFA 2E54A 4K2IA 4F5MA 5G0AA 1XI9A 2X8UA 4OTLA 4WB0B 5G4IA 1IX8A 1D7SA 1E5EA 3EI6A 4AH3A 4CBRA 2ORDA 2YKXA 1ASCA 3P1TA 2BWPA 1DGDA 1YAAA 3PD6B 2VGTA 1N2TA 4UQVA 4IXSA 1AY5A 1GC2A 1PMMA 4RJYA 2ZC0A 3ECDA 1FC4A 1S07A 3QHXA 3LVMA 4IX8A 3DODA 4RIZA 3WX9A 2BYJA 1QITA 3EZSA 2C44A 2HUIA 3EI5A 2BWNA 2AY6A 3EUCA 1MLYA 1ZOBA 4LW2A 5DJ1A 4GRXA 3DR4A 1AMRA 1OHWA 1Z7DA 2HZPA 2W7FA 2CJHA 3DZZA 3VP6A 4HVKA 3QM2A 1IX7A 3ASBA 3MADA 2DGLA 1W3UA 3FZ6A 1WYVA 4GDYA 3NUIA 2DGMA 2HP2A 4PFNA 4TMRA 3FFRA 3NTJA 4ZM3A 5AX8A 1M0OA 1MGVA 3FVUA 3M5UA 4RKDA 1AMQA 3QN6A 2R0TA 4RLGA 4ZLVA 1X28A 4ZAHA 3BWNC 3G8MA 3RQ1A 2DOUA 4ADBA 3FSLA 4EB7A 1W7NA 1C7GA 3N0LA 1TARA 1TOEA 2CJGA 2E7UA 3GBXA 3KGXA 2RFVA 3AEJA 4GSAA 5FT5A 4J5UA 3LY1A 3CQ5A 3ATHA 2VGSA 1SF2A 5K8BA 3NU8A 1GC0A 2WK9A 2YOBA 2BI9A 2Z9VA 1LK9A 4F5IA 5F8VA 2JJHA 1GEYA 2FNUA 3N75A 3FKDA 2W8VA 2CTZA 3MC6C 2JJEA 1EG5A 2HP1A 3ZRRA 1WYVB 1ELUA 2YCTA 3H14A 1V2DA 2YKVA 4WYFA 4XJMA 3JW9A 3ASAA 5EQCA 4CVQA 1CQ8A 3FDBA 4GE9A 1RVYA 3DR7A 1YJZA 2EGYA 3NU7A 2HORA 3Q8NA 2BKWA 5JAYA 1W23A 1BJWA 1AKBA 2D5YA 3ACZA 3MEBA 2OGEA 1ARTA 1ARIA 1OXPA 1AHYA 1ASLA 2QB3A 1AAWA 2DKJA 3DYDA 4R2NA 1CQ6A 2VGWA 1TOKA 4E3RA 5HDMA 3USFA 5LHAA 1ELQA 1H1CA 3G7QA 4L0OA 3AATA 1C7NA 4RKCA 4F4EA 4A6RA 2X5DA 4RM1A 4J8LA 2HUUA 1CJ0A 4XAUA 1N31A 2BIEA 2W7JA 1SFFA 2PO3A 4F5HA 3VK2A 3KGWA 4IXOA 4WXBA 2W8UA 3BN1A 1ASMA 4RJ0A 3L8AA 3ZRPA 2C81A 2HOZA 1AIAA 2W8TA 2C0RA 2D7ZA 2VLFA 3I16A 1ASFA 3OKSA 4RAEA 1AHGA 4EB5A 2AY3A 1UU0A 4A0RA 2FNIA 2Z61A 4PVFA 3DRDA 1AY8A 1SVVA 1KKJA 1BJNA 3FFHA 2R5EA 4XJOA 4O6ZA 1BW0A 2D7YA 3FCRA 1LC8A 2VMNA 3PDXA 3UWCA 1IJIA 3EI7A 3K28A 1MDXA 1ASNA 1M0QA 3DXVA 2BI5A 2AY7A 3JWBA 5F9SA 1GC4A 2VMXA 5BJ3A 2W7HA 3FVXA 1MAPA 2CH1A 1IAYA 1O62A 4W91A 4WXFA 2OKKA 5EAVA 3WGCA 1YOOA 3JZLA 1OATA 3E9KA 3NDNA 1B9HA 1C0NA 2BI1A 1ARSA 3R9AA 4MQRA 3CQ4A 3E77A 3EIBA 5G2QA 1O61A 2WKAA 4A6TA 1AMAA 1FG7A 3FZ7A 3HDOA 4WXGA 3FQAA 5E3KA 5DX5A 2QMAA 1QJ5A 2ZSMA 3PA9A 3N5MA 4OCAA 1CZEA 1AHEA 3JU7A 3B1EA 3RBLA 1Y4IA 1DJEA 5TF5A 1V2FA 3H7FA 1D2FA 1DFOA 3GSBA 2AY8A 4F5KA 4E77A 3AEOA 1DTYA 2JJGA 1T3IA 4P3MA 2VGZA 1VEFA 2W7GA 2F8JA 3QGUA 3WKRA 5C6UA 1S08A 1FG3A 4W5KA 3VK4A 3QPGA 1BJ4A 2YRIA 2XBNA 3AEPA 1WKHA 3I4JA 4ADCA 3IF2A 1B5PA 1H0CA 2JGTA 3MC6A 3B8XA 1GDEA 4WLHA 1ECXA 1EQBA 1YIZA 3CAIA 3WCOA 4AZJA 3FZ8A 3ZRQA 2D64A 3II0A 1B8GA 1ORDA 2JJFA 2O7CA 3A9ZA 3NNKA 2WK7A 4BQ0A 2OATA 3VAXA 1I43A 2VGUA 3GZDC 2AATA 2ZP7A 4KYOA 3PD6A 4JE5D 3E2FA 2GSAA 2BIGA 4WP0A 2XH1A 1C4KA 1LC7A 1TOIA 1M6SA 1QJ3A 2YHKA 4KAMA 1B4XA 4XEWA 2ZY3A 1WYUA 1TOJA 4JEVA 3TATA 4OYTA 5EUNA 4AO4A 3RI6A 4AOAA 2AEVA 1AHFA 1I48A 2Z1ZA 2QA3A 1SPAA 5M46A 1ASGA 4EU1A 4EFFA 2VI8A 5M4DA 3F9TA 3WCNA 4IXZA 3A9YA 3ZZKA 2EO5A 2CFBA 2OGAA 3TFTA 1O4SA 5EIGB 2VLHA 2ZUKA 4MKKA 5I92A 1CL2A 2W7KA 3VK3A 1CL1A 3WKSA 1B9IA 3G0TA 4ISYA 4AO9A 5BJ4A 2G6WA 5D5SA 4LC3A 5FT6A 1AKCA 3GETA 1M0PA 1ARGA 5FT4A 1MDZA 2VIBA 2GMUA 3ELEA 2HOYA 4WYAA 4R8DA 3BCAA 3WGBA 4LNJA 2VYCA 4ZASA 2VI9A 2O1BA 3RCHB 4DBCA 1J32A 2QLRA 4K2MA 2TPLA 4XQ2A 1WYUB 2D66A 3ELPA 4LNMA 2VMUA 1VP4A 2EZ2A 1QIRA 3NX3A 4ZSYA 2R2NA 1WSTA 4PIWA 1CQ7A 3FVSA 4JEZA 4F5GA 3AOWA 1M32A 2W7MA 1SZUA 1WYTB 3AEMA 4MKJA 3W1JA 4CBSA 4F5LA 1SZKA 1ZODA 2W7LA 3RBFA 3HT4A 4DQ6A 4M2KA 3IHJA 4OT8A 3MAUA 5FT8A 3CQ6A 2EH6A 2FN6A 5G2PA 3HVYA 2VMYA 4XK1A 2Z1YA 1LC5A 2VMTA 1TASA 3K40A 3COGA 3PGYA 3LV2A 3PJ0A 4ITXA 2BI2A 4LNLA 3AENA 3NYSA 4JE5A 1JS3A 4PFFA 2NMPA 3OP7A 4U2HA 4UHNA 4EMYA 1QZ9A 2X3LA 3W1HA 2W7IA 5DJ9A 1V2EA 4A0FA 2D63A 2GQNA 1V72A 1AIBA 3RUYA 2ZJGA 3FQ8A 1O69A 4Q75A 1ASDA 4Y0DA 3K7YA 1UU1A 4WLJA 3WZFA 1MDOA 1RV3A 4W1XA 5J8QA 4WYGA 3HBXA 1GEWA 3UAKA 1M7YA 2O0RA 1TOGA 4MQQA 4UHMA 4ATPA 3A9XA 4ZSWA 4ZDPA 4A6UA 2AY5A 4ZWVA 2AEUA 4MGRA 1UKJA 1X0MA 3F0HA 1AKAA 3HLMA 4ZM4A 1W7LA 2BWOA 1AMSA 2YRRA 4MQPA 5IWQA 2V1PA 1IAXA 3A2BA 3HL2A 3B46A 4B98A 1S06A 3BCXA 3PPLA 1P3WA 3BC8A 4WD2A 1OHYA 2YKYA 2JG2A 4TV7A 2OKJA 2CSTA 1DGEA 2X5FA 2AY1A 3PDBB 3MBBA 1OHVA 2R5CA 2Z9WA 3GJUA 3BWOA 3TFUA 1YIYA 5HXXA 4ITGA 4ZDOA 3ISLA 4WYCA 2E7IA 4W1WA 4Q76A 2Z67A 2W7DA 4QGRA 1AJSB 4XJLA 4UOYA 4A72A 3P6KA 4IYOA 4Q31A 3PAAA 3FQ7A 1G7WA 2CANA 4IYOB 1BQAA 2HOXA 4I8AA 2BHXA 1LKCA 1S0AA 1C7OA 4HF8A 1PMOA 1GEXA 2Z9XA 3R4TA 2E7JA 2Z20A 4R5ZA 4CXRA 3FDDA 1I41A 1TPLA 3LVLB 4M2JA 4WYEA 2VMWA 4IY7A 4WYDA 1D7VA 5G4JA 2YKUA 4H51A 4N0WA 4NOGA 1RV4A 1BT4A 2ZYJA 3FD0A 3FTBA 2PB2A 4MSOA 1VJOA 3LVKA 1G7XA 1EJIA 2EPJA 4JEYA 4W8IA 3ZZJA 4BA4A 2VMSA 2V0YA 3NRAA 1JS6A 4ADDA 1QISA 2BI3A 3AENB 2W8WA 1CS1A 4A00A 4RITA 3WY7A 5LH9A 2AY9A 4Y0IA 2VMQA 4WB0A 1GBNA 5M4BA 1M0NA 4M2MA 3HMUA 4P7YA 3LVJA 2YCPA 3F6TA 3AV7A 3PDBA 1E5FA 1CZCA 1AAMA 2Z9UA 5D95A 3B1DA 2D61A 1MAQA 2ZY4A 4JEXA 2DR1A 1GD9A 3I5TA 5EAAA 3MAFA 1Z3ZA 3JTXA 1G4XA 1J04A 1D7RA 1KMKA 5EUDA 2YCNA 3FRKA 4K2BA 1X29A 3JWAA 1KKPA 3QI6A 3PIUA 2GMSA 1DJ9A 3T32A 2ZY5A 3MKJA 4GE7A 2GB3A 2QBTA 1M4NA 1XEYA 4U1TA 1KMJA 2DKBA 2HUFA 4F5FA 2CJDA 2AY2A 2JISA 3AEMC 4A0HA 3TCMA 1IX6A 4XJPA 2PB0A 4KXKA 1B5OA 1RVUA 4UHOA 1IUGA 1DJUA 4ADEA 2CB1A 2CY8A 2DGKA 4CXQA 2VMOA 2C7TA 3NUBA 3BWNA 1GC3A 1JG8A 3RCHA 3WLXA 2AY4A 1DKAA 1YJYA 4OMAA 3AEJC 2VMRA 1ARHA 4OC9A 4GEBA 4FL0A 3HQTA 3A8UX 1PG8A 9AATA 3BB8A 2WK8A 4Q6RA 3GR9A 1SZSA 1WKGA 1G4VA 3BS8A 3EI8A 4JF1A 1YJSA 2Q7WA 1AJSA 1KL2A
chains in the Genus database with same CATH superfamily
3GZCA 5EUEA 1S09A 2VMPA 2CINA 1BJOA 2FQ6A 4F5JA 4MY5A 1U08A 1QGNA 1N8PA 1OXOA 2VGVA 1BJOB 3CBFA 3DC1A 3UE8A 1ZC9A 2W8JA 3AELA 3EIAA 5HHYA 3BV0A 4N0BA 4A0GA 4B9BA 3NYTA 3AOVA 3TQXA 7AATA 1AY4A 3NYUA 5M49A 1BQDA 3L44A 4GE4A 2VIAA 2CH2A 3BCBA 4WBTA 4ATQA 1BS0A 1BKGA 5EIGA 5E4ZA 4W1VA 3D6KA 4ZWMA 1LS3A 1UU2A 1GCKA 3VOMA 1JF9A 4LW4A 4TN4A 1IVRA 2R5CB 2W7EA 4IW7A 1AX4A 3MAFB 3EZ1A 1AHXA 1X2AA 1AJRA 2VMVA 3B1CA 3GZDA 1TATA 4OBVA 2BIAA 5G09A 1KL1A 2D65A 3LG0A 1ASEA 4JF0A 1IBJA 4E1OA 1LW4A 8AATA 3QBOA 3E2ZB 5EFSA 4E3QA 4JEWA 1PFFA 1I29A 2BYLA 3DU4A 1AICA 2VMZA 1C9CA 4Y0HA 2ZY2A 5E5IA 3W1IA 3GWPA 2FM1A 3KKIA 2OQXA 2EZ1A 1MLZA 3DXWA 4FFCA 4AZKA 4ZDLA 3EI9A 1LW5A 3E2ZA 4BHDA 4BMKA 1D7UA 1YNUA 4DGTA 1W7MA 4BA5A 2ZSLA 1ASBA 3E6GA 5DB5A 1WYTA 4R5FA 3KE3A 3E2YA 4OBUA 3LWSA 2QB2A 1ASAA 2FYFA 2E54A 4K2IA 4F5MA 5G0AA 1XI9A 2X8UA 4OTLA 4WB0B 5G4IA 1IX8A 1D7SA 1E5EA 3EI6A 4AH3A 4CBRA 2ORDA 2YKXA 1ASCA 3P1TA 2BWPA 1DGDA 1YAAA 3PD6B 2VGTA 1N2TA 4UQVA 4IXSA 1AY5A 1GC2A 1PMMA 4RJYA 2ZC0A 3ECDA 1FC4A 1S07A 3QHXA 3LVMA 4IX8A 3DODA 4RIZA 3WX9A 2BYJA 1QITA 2WB6A 3EZSA 2C44A 2HUIA 3EI5A 2BWNA 2AY6A 3EUCA 1MLYA 1ZOBA 4LW2A 5DJ1A 2EYQA 4GRXA 3DR4A 1AMRA 1OHWA 1Z7DA 2HZPA 2W7FA 2CJHA 3DZZA 3VP6A 4HVKA 3QM2A 1IX7A 3ASBA 3MADA 2DGLA 1W3UA 3FZ6A 1WYVA 4GDYA 3NUIA 2DGMA 2HP2A 4PFNA 4TMRA 3FFRA 3NTJA 4ZM3A 5AX8A 1M0OA 1MGVA 3FVUA 3M5UA 4RKDA 1AMQA 3QN6A 2R0TA 4RLGA 4ZLVA 1X28A 4ZAHA 3BWNC 3G8MA 3RQ1A 2DOUA 4ADBA 3FSLA 4EB7A 1W7NA 1C7GA 3N0LA 1TARA 1TOEA 2CJGA 2E7UA 3GBXA 3KGXA 2RFVA 3AEJA 4GSAA 5FT5A 4J5UA 3LY1A 3CQ5A 3ATHA 2VGSA 1SF2A 5K8BA 3NU8A 1GC0A 2WK9A 2YOBA 2BI9A 2Z9VA 2FKIA 1LK9A 4F5IA 5F8VA 2JJHA 1GEYA 2FNUA 3N75A 3FKDA 2W8VA 2CTZA 3MC6C 2JJEA 1EG5A 2HP1A 3ZRRA 1WYVB 1ELUA 2YCTA 3H14A 1V2DA 2YKVA 4WYFA 4XJMA 3JW9A 3ASAA 5EQCA 4CVQA 1CQ8A 3FDBA 4GE9A 1RVYA 3DR7A 1YJZA 2EGYA 3NU7A 2HORA 3Q8NA 2BKWA 5JAYA 1W23A 5KTBA 1BJWA 1AKBA 2D5YA 3ACZA 3MEBA 2OGEA 1ARTA 1ARIA 1OXPA 1AHYA 1ASLA 2QB3A 1AAWA 2DKJA 3DYDA 4R2NA 1CQ6A 2VGWA 1TOKA 4E3RA 5HDMA 3USFA 5LHAA 1ELQA 1H1CA 3G7QA 4L0OA 3AATA 1C7NA 4RKCA 4F4EA 4A6RA 2X5DA 4RM1A 4J8LA 2HUUA 1CJ0A 4XAUA 1N31A 2BIEA 2W7JA 1SFFA 2PO3A 4F5HA 3VK2A 3KGWA 4IXOA 4WXBA 2W8UA 3BN1A 1ASMA 4RJ0A 3L8AA 3ZRPA 2C81A 2HOZA 1AIAA 2W8TA 2C0RA 2D7ZA 2VLFA 3I16A 1ASFA 3OKSA 4RAEA 1AHGA 4EB5A 2AY3A 1UU0A 4A0RA 2FNIA 2Z61A 4PVFA 3DRDA 1AY8A 1SVVA 4K05A 1KKJA 1BJNA 3FFHA 2R5EA 4XJOA 4O6ZA 1BW0A 2D7YA 3FCRA 1LC8A 2VMNA 3PDXA 3UWCA 1IJIA 3EI7A 3K28A 1MDXA 1ASNA 1M0QA 3DXVA 2BI5A 2AY7A 3JWBA 5F9SA 1GC4A 2VMXA 5BJ3A 2W7HA 3FVXA 1MAPA 2CH1A 1IAYA 1O62A 4W91A 4WXFA 2OKKA 5EAVA 3WGCA 1YOOA 3JZLA 1OATA 3E9KA 3NDNA 1B9HA 1C0NA 2BI1A 1ARSA 3R9AA 4MQRA 3CQ4A 3E77A 3EIBA 5G2QA 1O61A 2WKAA 4A6TA 1AMAA 1FG7A 3FZ7A 3HDOA 4WXGA 3FQAA 5E3KA 5DX5A 2QMAA 1QJ5A 2ZSMA 3PA9A 3N5MA 4OCAA 1CZEA 1AHEA 3JU7A 3B1EA 3RBLA 1Y4IA 1DJEA 5TF5A 1V2FA 3H7FA 1D2FA 3N4SA 1DFOA 3GSBA 2AY8A 4F5KA 4E77A 3AEOA 1DTYA 2JJGA 1T3IA 4P3MA 2VGZA 1VEFA 2W7GA 2F8JA 3QGUA 3WKRA 5C6UA 1S08A 1FG3A 4W5KA 3VK4A 3QPGA 1BJ4A 2YRIA 2XBNA 3AEPA 1WKHA 3I4JA 4ADCA 3IF2A 1B5PA 1H0CA 2JGTA 3MC6A 3B8XA 1GDEA 4WLHA 1ECXA 1EQBA 1YIZA 3CAIA 3WCOA 4AZJA 3FZ8A 3ZRQA 2D64A 3II0A 3H9XA 1B8GA 1ORDA 4H63Q 2JJFA 2O7CA 3A9ZA 3NNKA 2WK7A 4BQ0A 2OATA 3VAXA 1I43A 2VGUA 3GZDC 2AATA 2ZP7A 4KYOA 3PD6A 4JE5D 3E2FA 2GSAA 2BIGA 4WP0A 2XH1A 1C4KA 1LC7A 1TOIA 1M6SA 1QJ3A 2YHKA 4KAMA 1B4XA 4XEWA 2ZY3A 1WYUA 1TOJA 4JEVA 3TATA 3N4XA 4OYTA 5EUNA 4AO4A 3RI6A 4AOAA 2AEVA 1AHFA 1I48A 2Z1ZA 2QA3A 1SPAA 5M46A 1ASGA 4EU1A 4EFFA 2VI8A 5M4DA 3F9TA 3WCNA 4IXZA 3A9YA 3ZZKA 2EO5A 2CFBA 2OGAA 3TFTA 1O4SA 5EIGB 2VLHA 2ZUKA 4MKKA 5I92A 1CL2A 2W7KA 3VK3A 1CL1A 3WKSA 1B9IA 3G0TA 4ISYA 4AO9A 5BJ4A 2G6WA 5D5SA 4LC3A 5FT6A 1AKCA 3GETA 1M0PA 1ARGA 5FT4A 1MDZA 2KFPA 2VIBA 2GMUA 3ELEA 2HOYA 4WYAA 4R8DA 3BCAA 3WGBA 4LNJA 2VYCA 4ZASA 2VI9A 2O1BA 3RCHB 4DBCA 1J32A 2QLRA 4K2MA 2TPLA 4XQ2A 1WYUB 2D66A 3ELPA 4LNMA 2VMUA 1VP4A 2EZ2A 1QIRA 3NX3A 4ZSYA 2R2NA 1WSTA 4PIWA 1CQ7A 3FVSA 4JEZA 4F5GA 3AOWA 1M32A 2W7MA 1SZUA 1WYTB 3AEMA 4MKJA 3W1JA 4CBSA 4F5LA 1SZKA 1ZODA 2W7LA 3RBFA 3HT4A 4DQ6A 4M2KA 3IHJA 4OT8A 3MAUA 5FT8A 3CQ6A 2EH6A 2FN6A 5G2PA 3HVYA 2VMYA 4XK1A 2Z1YA 1LC5A 2VMTA 1TASA 3K40A 3COGA 3PGYA 3LV2A 3PJ0A 4ITXA 2BI2A 4LNLA 3AENA 3NYSA 4JE5A 1JS3A 4PFFA 2NMPA 3OP7A 4U2HA 4UHNA 4EMYA 1QZ9A 2X3LA 3W1HA 2W7IA 5DJ9A 1V2EA 4A0FA 2D63A 2GQNA 1V72A 1AIBA 3RUYA 2ZJGA 3FQ8A 1O69A 4Q75A 1ASDA 4Y0DA 3K7YA 1UU1A 4WLJA 3N7NA 3WZFA 1MDOA 1RV3A 4W1XA 5J8QA 4WYGA 3HBXA 1GEWA 3UAKA 1M7YA 2O0RA 1TOGA 4MQQA 4UHMA 4ATPA 3A9XA 4ZSWA 4ZDPA 4A6UA 2AY5A 4ZWVA 2AEUA 4MGRA 1UKJA 1X0MA 3F0HA 1AKAA 2G7JA 3HLMA 4ZM4A 1W7LA 2BWOA 1AMSA 2YRRA 4MQPA 5IWQA 2V1PA 1IAXA 3A2BA 3HL2A 3B46A 4B98A 1S06A 3BCXA 3PPLA 1P3WA 3BC8A 4WD2A 1OHYA 2YKYA 2JG2A 4TV7A 2OKJA 2CSTA 1DGEA 2X5FA 2AY1A 3PDBB 3MBBA 1OHVA 2R5CA 2Z9WA 3GJUA 3BWOA 3TFUA 1YIYA 5HXXA 4ITGA 4ZDOA 3ISLA 4WYCA 2E7IA 4W1WA 4Q76A 2Z67A 2W7DA 4QGRA 1AJSB 4XJLA 4UOYA 4A72A 3P6KA 4IYOA 4Q31A 3PAAA 3FQ7A 1G7WA 2CANA 4IYOB 1BQAA 2HOXA 4I8AA 2BHXA 1LKCA 1S0AA 1C7OA 4HF8A 1PMOA 1GEXA 2Z9XA 3R4TA 2E7JA 2Z20A 4R5ZA 4CXRA 3FDDA 1I41A 1TPLA 3LVLB 4M2JA 4WYEA 2VMWA 4IY7A 4WYDA 1D7VA 5G4JA 2YKUA 4H51A 4N0WA 4NOGA 1RV4A 1BT4A 2ZYJA 3FD0A 3FTBA 2PB2A 4MSOA 1VJOA 3LVKA 1G7XA 1EJIA 2EPJA 4JEYA 4W8IA 3ZZJA 4BA4A 2VMSA 2V0YA 3NRAA 1JS6A 4ADDA 1QISA 2BI3A 3AENB 2W8WA 1CS1A 4A00A 4RITA 3WY7A 5LH9A 2AY9A 4Y0IA 2VMQA 4WB0A 1GBNA 5M4BA 1M0NA 4M2MA 3HMUA 4P7YA 3LVJA 2YCPA 3F6TA 3AV7A 3PDBA 1E5FA 1CZCA 1AAMA 2Z9UA 5D95A 3B1DA 2D61A 1MAQA 2ZY4A 4JEXA 2DR1A 1GD9A 3I5TA 5EAAA 3MAFA 1Z3ZA 3JTXA 1G4XA 1J04A 1D7RA 1KMKA 5EUDA 2YCNA 3FRKA 4K2BA 1X29A 3JWAA 1KKPA 3QI6A 3PIUA 2GMSA 1DJ9A 3T32A 2A1VA 2ZY5A 3MKJA 1KAFA 4GE7A 2GB3A 2QBTA 1M4NA 1XEYA 4U1TA 1KMJA 2DKBA 2HUFA 4F5FA 2CJDA 2AY2A 2JISA 3AEMC 4A0HA 3TCMA 1IX6A 4XJPA 2PB0A 4KXKA 1B5OA 1RVUA 4UHOA 1IUGA 1DJUA 4ADEA 2CB1A 2CY8A 2DGKA 4CXQA 2VMOA 2C7TA 3N4RA 3NUBA 3BWNA 1GC3A 1JG8A 3RCHA 3WLXA 2AY4A 1DKAA 1YJYA 4OMAA 3AEJC 2VMRA 1ARHA 4OC9A 4GEBA 4FL0A 3HQTA 3A8UX 1PG8A 9AATA 3BB8A 2WK8A 4Q6RA 3GR9A 1SZSA 1WKGA 1G4VA 3BS8A 3EI8A 4JF1A 2QSRA 1YJSA 2Q7WA 1AJSA 1KL2A
chains in the Genus database with same CATH topology
3GZCA 5EUEA 1S09A 2VMPA 2CINA 1BJOA 2FQ6A 4F5JA 4MY5A 1U08A 1QGNA 1N8PA 1OXOA 2VGVA 1BJOB 3CBFA 3DC1A 3UE8A 1ZC9A 2W8JA 3AELA 3EIAA 5HHYA 3BV0A 4N0BA 4A0GA 4B9BA 3NYTA 3AOVA 3TQXA 7AATA 1AY4A 3NYUA 5M49A 1BQDA 3L44A 4GE4A 2VIAA 2CH2A 3BCBA 4WBTA 4ATQA 1BS0A 1BKGA 5EIGA 5E4ZA 4W1VA 3D6KA 4ZWMA 1LS3A 1UU2A 1GCKA 3VOMA 1JF9A 4LW4A 4TN4A 1IVRA 2R5CB 2W7EA 4IW7A 1AX4A 3MAFB 3EZ1A 1AHXA 1X2AA 1AJRA 2VMVA 3B1CA 3GZDA 1TATA 4OBVA 2BIAA 5G09A 1KL1A 2D65A 3LG0A 1ASEA 4JF0A 1IBJA 4E1OA 1LW4A 8AATA 3QBOA 3E2ZB 5EFSA 4E3QA 4JEWA 1PFFA 1I29A 2BYLA 3DU4A 1AICA 2VMZA 1C9CA 4Y0HA 2ZY2A 5E5IA 3W1IA 3GWPA 2FM1A 3KKIA 2OQXA 2EZ1A 1MLZA 3DXWA 4FFCA 4AZKA 4ZDLA 3EI9A 1LW5A 3E2ZA 4BHDA 4BMKA 1D7UA 1YNUA 4DGTA 1W7MA 4BA5A 2ZSLA 1ASBA 3E6GA 5DB5A 1WYTA 4R5FA 3KE3A 3E2YA 4OBUA 3LWSA 2QB2A 1ASAA 2FYFA 2E54A 4K2IA 4F5MA 5G0AA 1XI9A 2X8UA 4OTLA 4WB0B 5G4IA 1IX8A 1D7SA 1E5EA 3EI6A 4AH3A 4CBRA 2ORDA 2YKXA 1ASCA 3P1TA 2BWPA 1DGDA 1YAAA 3PD6B 2VGTA 1N2TA 4UQVA 4IXSA 1AY5A 1GC2A 1PMMA 4RJYA 2ZC0A 3ECDA 1FC4A 1S07A 3QHXA 3LVMA 4IX8A 3DODA 4RIZA 3WX9A 2BYJA 1QITA 2WB6A 3EZSA 2C44A 2HUIA 3EI5A 2BWNA 2AY6A 3EUCA 1MLYA 1ZOBA 4LW2A 5DJ1A 2EYQA 4GRXA 3DR4A 1AMRA 1OHWA 1Z7DA 2HZPA 2W7FA 2CJHA 3DZZA 3VP6A 4HVKA 3QM2A 1IX7A 3ASBA 3MADA 2DGLA 1W3UA 3FZ6A 1WYVA 4GDYA 3NUIA 2DGMA 2HP2A 4PFNA 4TMRA 3FFRA 3NTJA 4ZM3A 5AX8A 1M0OA 1MGVA 3FVUA 3M5UA 4RKDA 1AMQA 3QN6A 2R0TA 4RLGA 4ZLVA 1X28A 4ZAHA 3BWNC 3G8MA 3RQ1A 2DOUA 4ADBA 3FSLA 4EB7A 1W7NA 1C7GA 3N0LA 1TARA 1TOEA 2CJGA 2E7UA 3GBXA 3KGXA 2RFVA 3AEJA 4GSAA 5FT5A 4J5UA 3LY1A 3CQ5A 3ATHA 2VGSA 1SF2A 5K8BA 3NU8A 1GC0A 2WK9A 2YOBA 2BI9A 2Z9VA 2FKIA 1LK9A 4F5IA 5F8VA 2JJHA 1GEYA 2FNUA 3N75A 3FKDA 2W8VA 2CTZA 3MC6C 2JJEA 1EG5A 2HP1A 3ZRRA 1WYVB 1ELUA 2YCTA 3H14A 1V2DA 2YKVA 4WYFA 4XJMA 3JW9A 3ASAA 5EQCA 4CVQA 1CQ8A 3FDBA 4GE9A 1RVYA 3DR7A 1YJZA 2EGYA 3NU7A 2HORA 3Q8NA 2BKWA 5JAYA 1W23A 5KTBA 1BJWA 1AKBA 2D5YA 3ACZA 3MEBA 2OGEA 1ARTA 1ARIA 1OXPA 1AHYA 1ASLA 2QB3A 1AAWA 2DKJA 3DYDA 4R2NA 1CQ6A 2VGWA 1TOKA 4E3RA 5HDMA 3USFA 5LHAA 1ELQA 1H1CA 3G7QA 4L0OA 3AATA 1C7NA 4RKCA 4F4EA 4A6RA 2X5DA 4RM1A 4J8LA 2HUUA 1CJ0A 4XAUA 1N31A 2BIEA 2W7JA 1SFFA 2PO3A 4F5HA 3VK2A 3KGWA 4IXOA 4WXBA 2W8UA 3BN1A 1ASMA 4RJ0A 3L8AA 3ZRPA 2C81A 2HOZA 1AIAA 2W8TA 2C0RA 2D7ZA 2VLFA 3I16A 1ASFA 3OKSA 4RAEA 1AHGA 4EB5A 2AY3A 1UU0A 4A0RA 2FNIA 2Z61A 4PVFA 3DRDA 1AY8A 1SVVA 4K05A 1KKJA 1BJNA 3FFHA 2R5EA 4XJOA 4O6ZA 1BW0A 2D7YA 3FCRA 1LC8A 2VMNA 3PDXA 3UWCA 1IJIA 3EI7A 3K28A 1MDXA 1ASNA 1M0QA 3DXVA 2BI5A 2AY7A 3JWBA 5F9SA 1GC4A 2VMXA 5BJ3A 2W7HA 3FVXA 1MAPA 2CH1A 1IAYA 1O62A 4W91A 4WXFA 2OKKA 5EAVA 3WGCA 1YOOA 3JZLA 1OATA 3E9KA 3NDNA 1B9HA 1C0NA 2BI1A 1ARSA 3R9AA 4MQRA 3CQ4A 3E77A 3EIBA 5G2QA 1O61A 2WKAA 4A6TA 1AMAA 1FG7A 3FZ7A 3HDOA 4WXGA 3FQAA 5E3KA 5DX5A 2QMAA 1QJ5A 2ZSMA 3PA9A 3N5MA 4OCAA 1CZEA 1AHEA 3JU7A 3B1EA 3RBLA 1Y4IA 1DJEA 5TF5A 1V2FA 3H7FA 1D2FA 3N4SA 1DFOA 3GSBA 2AY8A 4F5KA 4E77A 3AEOA 1DTYA 2JJGA 1T3IA 4P3MA 2VGZA 1VEFA 2W7GA 2F8JA 3QGUA 3WKRA 5C6UA 1S08A 1FG3A 4W5KA 3VK4A 3QPGA 1BJ4A 2YRIA 2XBNA 3AEPA 1WKHA 3I4JA 4ADCA 3IF2A 1B5PA 1H0CA 2JGTA 3MC6A 3B8XA 1GDEA 4WLHA 1ECXA 1EQBA 1YIZA 3CAIA 3WCOA 4AZJA 3FZ8A 3ZRQA 2D64A 3II0A 3H9XA 1B8GA 1ORDA 4H63Q 2JJFA 2O7CA 3A9ZA 3NNKA 2WK7A 4BQ0A 2OATA 3VAXA 1I43A 2VGUA 3GZDC 2AATA 2ZP7A 4KYOA 3PD6A 4JE5D 3E2FA 2GSAA 2BIGA 4WP0A 2XH1A 1C4KA 1LC7A 1TOIA 1M6SA 1QJ3A 2YHKA 4KAMA 1B4XA 4XEWA 2ZY3A 1WYUA 1TOJA 4JEVA 3TATA 3N4XA 4OYTA 5EUNA 4AO4A 3RI6A 4AOAA 2AEVA 1AHFA 1I48A 2Z1ZA 2QA3A 1SPAA 5M46A 1ASGA 4EU1A 4EFFA 2VI8A 5M4DA 3F9TA 3WCNA 4IXZA 3A9YA 3ZZKA 2EO5A 2CFBA 2OGAA 3TFTA 1O4SA 5EIGB 2VLHA 2ZUKA 4MKKA 5I92A 1CL2A 2W7KA 3VK3A 1CL1A 3WKSA 1B9IA 3G0TA 4ISYA 4AO9A 5BJ4A 2G6WA 5D5SA 4LC3A 5FT6A 1AKCA 3GETA 1M0PA 1ARGA 5FT4A 1MDZA 2KFPA 2VIBA 2GMUA 3ELEA 2HOYA 4WYAA 4R8DA 3BCAA 3WGBA 4LNJA 2VYCA 4ZASA 2VI9A 2O1BA 3RCHB 4DBCA 1J32A 2QLRA 4K2MA 2TPLA 4XQ2A 1WYUB 2D66A 3ELPA 4LNMA 2VMUA 1VP4A 2EZ2A 1QIRA 3NX3A 4ZSYA 2R2NA 1WSTA 4PIWA 1CQ7A 3FVSA 4JEZA 4F5GA 3AOWA 1M32A 2W7MA 1SZUA 1WYTB 3AEMA 4MKJA 3W1JA 4CBSA 4F5LA 1SZKA 1ZODA 2W7LA 3RBFA 3HT4A 4DQ6A 4M2KA 3IHJA 4OT8A 3MAUA 5FT8A 3CQ6A 2EH6A 2FN6A 5G2PA 3HVYA 2VMYA 4XK1A 2Z1YA 1LC5A 2VMTA 1TASA 3K40A 3COGA 3PGYA 3LV2A 3PJ0A 4ITXA 2BI2A 4LNLA 3AENA 3NYSA 4JE5A 1JS3A 4PFFA 2NMPA 3OP7A 4U2HA 4UHNA 4EMYA 1QZ9A 2X3LA 3W1HA 2W7IA 5DJ9A 1V2EA 4A0FA 2D63A 2GQNA 1V72A 1AIBA 3RUYA 2ZJGA 3FQ8A 1O69A 4Q75A 1ASDA 4Y0DA 3K7YA 1UU1A 4WLJA 3N7NA 3WZFA 1MDOA 1RV3A 4W1XA 5J8QA 4WYGA 3HBXA 1GEWA 3UAKA 1M7YA 2O0RA 1TOGA 4MQQA 4UHMA 4ATPA 3A9XA 4ZSWA 4ZDPA 4A6UA 2AY5A 4ZWVA 2AEUA 4MGRA 1UKJA 1X0MA 3F0HA 1AKAA 2G7JA 3HLMA 4ZM4A 1W7LA 2BWOA 1AMSA 2YRRA 4MQPA 5IWQA 2V1PA 1IAXA 3A2BA 3HL2A 3B46A 4B98A 1S06A 3BCXA 3PPLA 1P3WA 3BC8A 4WD2A 1OHYA 2YKYA 2JG2A 4TV7A 2OKJA 2CSTA 1DGEA 2X5FA 2AY1A 3PDBB 3MBBA 1OHVA 2R5CA 2Z9WA 3GJUA 3BWOA 3TFUA 1YIYA 5HXXA 4ITGA 4ZDOA 3ISLA 4WYCA 2E7IA 4W1WA 4Q76A 2Z67A 2W7DA 4QGRA 1AJSB 4XJLA 4UOYA 4A72A 3P6KA 4IYOA 4Q31A 3PAAA 3FQ7A 1G7WA 2CANA 4IYOB 1BQAA 2HOXA 4I8AA 2BHXA 1LKCA 1S0AA 1C7OA 4HF8A 1PMOA 1GEXA 2Z9XA 3R4TA 2E7JA 2Z20A 4R5ZA 4CXRA 3FDDA 1I41A 1TPLA 3LVLB 4M2JA 4WYEA 2VMWA 4IY7A 4WYDA 1D7VA 5G4JA 2YKUA 4H51A 4N0WA 4NOGA 1RV4A 1BT4A 2ZYJA 3FD0A 3FTBA 2PB2A 4MSOA 1VJOA 3LVKA 1G7XA 1EJIA 2EPJA 4JEYA 4W8IA 3ZZJA 4BA4A 2VMSA 2V0YA 3NRAA 1JS6A 4ADDA 1QISA 2BI3A 3AENB 2W8WA 1CS1A 4A00A 4RITA 3WY7A 5LH9A 2AY9A 4Y0IA 2VMQA 4WB0A 1GBNA 5M4BA 1M0NA 4M2MA 3HMUA 4P7YA 3LVJA 2YCPA 3F6TA 3AV7A 3PDBA 1E5FA 1CZCA 1AAMA 2Z9UA 5D95A 3B1DA 2D61A 1MAQA 2ZY4A 4JEXA 2DR1A 1GD9A 3I5TA 5EAAA 3MAFA 1Z3ZA 3JTXA 1G4XA 1J04A 1D7RA 1KMKA 5EUDA 2YCNA 3FRKA 4K2BA 1X29A 3JWAA 1KKPA 3QI6A 3PIUA 2GMSA 1DJ9A 3T32A 2A1VA 2ZY5A 3MKJA 4GE7A 2GB3A 2QBTA 1M4NA 1XEYA 4U1TA 1KMJA 2DKBA 2HUFA 4F5FA 2CJDA 2AY2A 2JISA 3AEMC 4A0HA 3TCMA 1IX6A 4XJPA 2PB0A 4KXKA 1B5OA 1RVUA 4UHOA 1IUGA 1DJUA 4ADEA 2CB1A 2CY8A 2DGKA 4CXQA 2VMOA 2C7TA 3N4RA 3NUBA 3BWNA 1GC3A 1JG8A 3RCHA 3WLXA 2AY4A 1DKAA 1YJYA 4OMAA 3AEJC 2VMRA 1ARHA 4OC9A 4GEBA 4FL0A 3HQTA 3A8UX 1PG8A 9AATA 3BB8A 2WK8A 4Q6RA 3GR9A 1SZSA 1WKGA 1G4VA 3BS8A 3EI8A 4JF1A 2QSRA 1YJSA 2Q7WA 1AJSA 1KL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZC A;  5EUE A;  1S09 A;  2VMP A;  2CIN A;  1BJO A;  2FQ6 A;  4F5J A;  4MY5 A;  1U08 A;  1QGN A;  1N8P A;  1OXO A;  2VGV A;  1BJO B;  3CBF A;  3DC1 A;  3UE8 A;  1ZC9 A;  2W8J A;  3AEL A;  3EIA A;  5HHY A;  3BV0 A;  4N0B A;  4A0G A;  4B9B A;  3NYT A;  3AOV A;  3TQX A;  7AAT A;  1AY4 A;  3NYU A;  5M49 A;  1BQD A;  3L44 A;  4GE4 A;  2VIA A;  2CH2 A;  3BCB A;  4WBT A;  4ATQ A;  1BS0 A;  1BKG A;  5EIG A;  5E4Z A;  4W1V A;  3D6K A;  4ZWM A;  1LS3 A;  1UU2 A;  1GCK A;  3VOM A;  1JF9 A;  4LW4 A;  4TN4 A;  1IVR A;  2R5C B;  2W7E A;  4IW7 A;  1AX4 A;  3MAF B;  3EZ1 A;  1AHX A;  1X2A A;  1AJR A;  2VMV A;  3B1C A;  3GZD A;  1TAT A;  4OBV A;  2BIA A;  5G09 A;  1KL1 A;  2D65 A;  3LG0 A;  1ASE A;  4JF0 A;  1IBJ A;  4E1O A;  1LW4 A;  8AAT A;  3QBO A;  3E2Z B;  5EFS A;  4E3Q A;  4JEW A;  1PFF A;  1I29 A;  2BYL A;  3DU4 A;  1AIC A;  2VMZ A;  1C9C A;  4Y0H A;  2ZY2 A;  5E5I A;  3W1I A;  3GWP A;  2FM1 A;  3KKI A;  2OQX A;  2EZ1 A;  1MLZ A;  3DXW A;  4FFC A;  4AZK A;  4ZDL A;  3EI9 A;  1LW5 A;  3E2Z A;  4BHD A;  4BMK A;  1D7U A;  1YNU A;  4DGT A;  1W7M A;  4BA5 A;  2ZSL A;  1ASB A;  3E6G A;  5DB5 A;  1WYT A;  4R5F A;  3KE3 A;  3E2Y A;  4OBU A;  3LWS A;  2QB2 A;  1ASA A;  2FYF A;  2E54 A;  4K2I A;  4F5M A;  5G0A A;  1XI9 A;  2X8U A;  4OTL A;  4WB0 B;  5G4I A;  1IX8 A;  1D7S A;  1E5E A;  3EI6 A;  4AH3 A;  4CBR A;  2ORD A;  2YKX A;  1ASC A;  3P1T A;  2BWP A;  1DGD A;  1YAA A;  3PD6 B;  2VGT A;  1N2T A;  4UQV A;  4IXS A;  1AY5 A;  1GC2 A;  1PMM A;  4RJY A;  2ZC0 A;  3ECD A;  1FC4 A;  1S07 A;  3QHX A;  3LVM A;  4IX8 A;  3DOD A;  4RIZ A;  3WX9 A;  2BYJ A;  1QIT A;  3EZS A;  2C44 A;  2HUI A;  3EI5 A;  2BWN A;  2AY6 A;  3EUC A;  1MLY A;  1ZOB A;  4LW2 A;  5DJ1 A;  4GRX A;  3DR4 A;  1AMR A;  1OHW A;  1Z7D A;  2HZP A;  2W7F A;  2CJH A;  3DZZ A;  3VP6 A;  4HVK A;  3QM2 A;  1IX7 A;  3ASB A;  3MAD A;  2DGL A;  1W3U A;  3FZ6 A;  1WYV A;  4GDY A;  3NUI A;  2DGM A;  2HP2 A;  4PFN A;  4TMR A;  3FFR A;  3NTJ A;  4ZM3 A;  5AX8 A;  1M0O A;  1MGV A;  3FVU A;  3M5U A;  4RKD A;  1AMQ A;  3QN6 A;  2R0T A;  4RLG A;  4ZLV A;  1X28 A;  4ZAH A;  3BWN C;  3G8M A;  3RQ1 A;  2DOU A;  4ADB A;  3FSL A;  4EB7 A;  1W7N A;  1C7G A;  3N0L A;  1TAR A;  1TOE A;  2CJG A;  2E7U A;  3GBX A;  3KGX A;  2RFV A;  3AEJ A;  4GSA A;  5FT5 A;  4J5U A;  3LY1 A;  3CQ5 A;  3ATH A;  2VGS A;  1SF2 A;  5K8B A;  3NU8 A;  1GC0 A;  2WK9 A;  2YOB A;  2BI9 A;  2Z9V A;  1LK9 A;  4F5I A;  5F8V A;  2JJH A;  1GEY A;  2FNU A;  3N75 A;  3FKD A;  2W8V A;  2CTZ A;  3MC6 C;  2JJE A;  1EG5 A;  2HP1 A;  3ZRR A;  1WYV B;  1ELU A;  2YCT A;  3H14 A;  1V2D A;  2YKV A;  4WYF A;  4XJM A;  3JW9 A;  3ASA A;  5EQC A;  4CVQ A;  1CQ8 A;  3FDB A;  4GE9 A;  1RVY A;  3DR7 A;  1YJZ A;  2EGY A;  3NU7 A;  2HOR A;  3Q8N A;  2BKW A;  5JAY A;  1W23 A;  1BJW A;  1AKB A;  2D5Y A;  3ACZ A;  3MEB A;  2OGE A;  1ART A;  1ARI A;  1OXP A;  1AHY A;  1ASL A;  2QB3 A;  1AAW A;  2DKJ A;  3DYD A;  4R2N A;  1CQ6 A;  2VGW A;  1TOK A;  4E3R A;  5HDM A;  3USF A;  5LHA A;  1ELQ A;  1H1C A;  3G7Q A;  4L0O A;  3AAT A;  1C7N A;  4RKC A;  4F4E A;  4A6R A;  2X5D A;  4RM1 A;  4J8L A;  2HUU A;  1CJ0 A;  4XAU A;  1N31 A;  2BIE A;  2W7J A;  1SFF A;  2PO3 A;  4F5H A;  3VK2 A;  3KGW A;  4IXO A;  4WXB A;  2W8U A;  3BN1 A;  1ASM A;  4RJ0 A;  3L8A A;  3ZRP A;  2C81 A;  2HOZ A;  1AIA A;  2W8T A;  2C0R A;  2D7Z A;  2VLF A;  3I16 A;  1ASF A;  3OKS A;  4RAE A;  1AHG A;  4EB5 A;  2AY3 A;  1UU0 A;  4A0R A;  2FNI A;  2Z61 A;  4PVF A;  3DRD A;  1AY8 A;  1SVV A;  1KKJ A;  1BJN A;  3FFH A;  2R5E A;  4XJO A;  4O6Z A;  1BW0 A;  2D7Y A;  3FCR A;  1LC8 A;  2VMN A;  3PDX A;  3UWC A;  1IJI A;  3EI7 A;  3K28 A;  1MDX A;  1ASN A;  1M0Q A;  3DXV A;  2BI5 A;  2AY7 A;  3JWB A;  5F9S A;  1GC4 A;  2VMX A;  5BJ3 A;  2W7H A;  3FVX A;  1MAP A;  2CH1 A;  1IAY A;  1O62 A;  4W91 A;  4WXF A;  2OKK A;  5EAV A;  3WGC A;  1YOO A;  3JZL A;  1OAT A;  3E9K A;  3NDN A;  1B9H A;  1C0N A;  2BI1 A;  1ARS A;  3R9A A;  4MQR A;  3CQ4 A;  3E77 A;  3EIB A;  5G2Q A;  1O61 A;  2WKA A;  4A6T A;  1AMA A;  1FG7 A;  3FZ7 A;  3HDO A;  4WXG A;  3FQA A;  5E3K A;  5DX5 A;  2QMA A;  1QJ5 A;  2ZSM A;  3PA9 A;  3N5M A;  4OCA A;  1CZE A;  1AHE A;  3JU7 A;  3B1E A;  3RBL A;  1Y4I A;  1DJE A;  5TF5 A;  1V2F A;  3H7F A;  1D2F A;  1DFO A;  3GSB A;  2AY8 A;  4F5K A;  4E77 A;  3AEO A;  1DTY A;  2JJG A;  1T3I A;  4P3M A;  2VGZ A;  1VEF A;  2W7G A;  2F8J A;  3QGU A;  3WKR A;  5C6U A;  1S08 A;  1FG3 A;  4W5K A;  3VK4 A;  3QPG A;  1BJ4 A;  2YRI A;  2XBN A;  3AEP A;  1WKH A;  3I4J A;  4ADC A;  3IF2 A;  1B5P A;  1H0C A;  2JGT A;  3MC6 A;  3B8X A;  1GDE A;  4WLH A;  1ECX A;  1EQB A;  1YIZ A;  3CAI A;  3WCO A;  4AZJ A;  3FZ8 A;  3ZRQ A;  2D64 A;  3II0 A;  1B8G A;  1ORD A;  2JJF A;  2O7C A;  3A9Z A;  3NNK A;  2WK7 A;  4BQ0 A;  2OAT A;  3VAX A;  1I43 A;  2VGU A;  3GZD C;  2AAT A;  2ZP7 A;  4KYO A;  3PD6 A;  4JE5 D;  3E2F A;  2GSA A;  2BIG A;  4WP0 A;  2XH1 A;  1C4K A;  1LC7 A;  1TOI A;  1M6S A;  1QJ3 A;  2YHK A;  4KAM A;  1B4X A;  4XEW A;  2ZY3 A;  1WYU A;  1TOJ A;  4JEV A;  3TAT A;  4OYT A;  5EUN A;  4AO4 A;  3RI6 A;  4AOA A;  2AEV A;  1AHF A;  1I48 A;  2Z1Z A;  2QA3 A;  1SPA A;  5M46 A;  1ASG A;  4EU1 A;  4EFF A;  2VI8 A;  5M4D A;  3F9T A;  3WCN A;  4IXZ A;  3A9Y A;  3ZZK A;  2EO5 A;  2CFB A;  2OGA A;  3TFT A;  1O4S A;  5EIG B;  2VLH A;  2ZUK A;  4MKK A;  5I92 A;  1CL2 A;  2W7K A;  3VK3 A;  1CL1 A;  3WKS A;  1B9I A;  3G0T A;  4ISY A;  4AO9 A;  5BJ4 A;  2G6W A;  5D5S A;  4LC3 A;  5FT6 A;  1AKC A;  3GET A;  1M0P A;  1ARG A;  5FT4 A;  1MDZ A;  2VIB A;  2GMU A;  3ELE A;  2HOY A;  4WYA A;  4R8D A;  3BCA A;  3WGB A;  4LNJ A;  2VYC A;  4ZAS A;  2VI9 A;  2O1B A;  3RCH B;  4DBC A;  1J32 A;  2QLR A;  4K2M A;  2TPL A;  4XQ2 A;  1WYU B;  2D66 A;  3ELP A;  4LNM A;  2VMU A;  1VP4 A;  2EZ2 A;  1QIR A;  3NX3 A;  4ZSY A;  2R2N A;  1WST A;  4PIW A;  1CQ7 A;  3FVS A;  4JEZ A;  4F5G A;  3AOW A;  1M32 A;  2W7M A;  1SZU A;  1WYT B;  3AEM A;  4MKJ A;  3W1J A;  4CBS A;  4F5L A;  1SZK A;  1ZOD A;  2W7L A;  3RBF A;  3HT4 A;  4DQ6 A;  4M2K A;  3IHJ A;  4OT8 A;  3MAU A;  5FT8 A;  3CQ6 A;  2EH6 A;  2FN6 A;  5G2P A;  3HVY A;  2VMY A;  4XK1 A;  2Z1Y A;  1LC5 A;  2VMT A;  1TAS A;  3K40 A;  3COG A;  3PGY A;  3LV2 A;  3PJ0 A;  4ITX A;  2BI2 A;  4LNL A;  3AEN A;  3NYS A;  4JE5 A;  1JS3 A;  4PFF A;  2NMP A;  3OP7 A;  4U2H A;  4UHN A;  4EMY A;  1QZ9 A;  2X3L A;  3W1H A;  2W7I A;  5DJ9 A;  1V2E A;  4A0F A;  2D63 A;  2GQN A;  1V72 A;  1AIB A;  3RUY A;  2ZJG A;  3FQ8 A;  1O69 A;  4Q75 A;  1ASD A;  4Y0D A;  3K7Y A;  1UU1 A;  4WLJ A;  3WZF A;  1MDO A;  1RV3 A;  4W1X A;  5J8Q A;  4WYG A;  3HBX A;  1GEW A;  3UAK A;  1M7Y A;  2O0R A;  1TOG A;  4MQQ A;  4UHM A;  4ATP A;  3A9X A;  4ZSW A;  4ZDP A;  4A6U A;  2AY5 A;  4ZWV A;  2AEU A;  4MGR A;  1UKJ A;  1X0M A;  3F0H A;  1AKA A;  3HLM A;  4ZM4 A;  1W7L A;  2BWO A;  1AMS A;  2YRR A;  4MQP A;  5IWQ A;  2V1P A;  1IAX A;  3A2B A;  3HL2 A;  3B46 A;  4B98 A;  1S06 A;  3BCX A;  3PPL A;  1P3W A;  3BC8 A;  4WD2 A;  1OHY A;  2YKY A;  2JG2 A;  4TV7 A;  2OKJ A;  2CST A;  1DGE A;  2X5F A;  2AY1 A;  3PDB B;  3MBB A;  1OHV A;  2R5C A;  2Z9W A;  3GJU A;  3BWO A;  3TFU A;  1YIY A;  5HXX A;  4ITG A;  4ZDO A;  3ISL A;  4WYC A;  2E7I A;  4W1W A;  4Q76 A;  2Z67 A;  2W7D A;  4QGR A;  1AJS B;  4XJL A;  4UOY A;  4A72 A;  3P6K A;  4IYO A;  4Q31 A;  3PAA A;  3FQ7 A;  1G7W A;  2CAN A;  4IYO B;  1BQA A;  2HOX A;  4I8A A;  2BHX A;  1LKC A;  1S0A A;  1C7O A;  4HF8 A;  1PMO A;  1GEX A;  2Z9X A;  3R4T A;  2E7J A;  2Z20 A;  4R5Z A;  4CXR A;  3FDD A;  1I41 A;  1TPL A;  3LVL B;  4M2J A;  4WYE A;  2VMW A;  4IY7 A;  4WYD A;  1D7V A;  5G4J A;  2YKU A;  4H51 A;  4N0W A;  4NOG A;  1RV4 A;  1BT4 A;  2ZYJ A;  3FD0 A;  3FTB A;  2PB2 A;  4MSO A;  1VJO A;  3LVK A;  1G7X A;  1EJI A;  2EPJ A;  4JEY A;  4W8I A;  3ZZJ A;  4BA4 A;  2VMS A;  2V0Y A;  3NRA A;  1JS6 A;  4ADD A;  1QIS A;  2BI3 A;  3AEN B;  2W8W A;  1CS1 A;  4A00 A;  4RIT A;  3WY7 A;  5LH9 A;  2AY9 A;  4Y0I A;  2VMQ A;  4WB0 A;  1GBN A;  5M4B A;  1M0N A;  4M2M A;  3HMU A;  4P7Y A;  3LVJ A;  2YCP A;  3F6T A;  3AV7 A;  3PDB A;  1E5F A;  1CZC A;  1AAM A;  2Z9U A;  5D95 A;  3B1D A;  2D61 A;  1MAQ A;  2ZY4 A;  4JEX A;  2DR1 A;  1GD9 A;  3I5T A;  5EAA A;  3MAF A;  1Z3Z A;  3JTX A;  1G4X A;  1J04 A;  1D7R A;  1KMK A;  5EUD A;  2YCN A;  3FRK A;  4K2B A;  1X29 A;  3JWA A;  1KKP A;  3QI6 A;  3PIU A;  2GMS A;  1DJ9 A;  3T32 A;  2ZY5 A;  3MKJ A;  4GE7 A;  2GB3 A;  2QBT A;  1M4N A;  1XEY A;  4U1T A;  1KMJ A;  2DKB A;  2HUF A;  4F5F A;  2CJD A;  2AY2 A;  2JIS A;  3AEM C;  4A0H A;  3TCM A;  1IX6 A;  4XJP A;  2PB0 A;  4KXK A;  1B5O A;  1RVU A;  4UHO A;  1IUG A;  1DJU A;  4ADE A;  2CB1 A;  2CY8 A;  2DGK A;  4CXQ A;  2VMO A;  2C7T A;  3NUB A;  3BWN A;  1GC3 A;  1JG8 A;  3RCH A;  3WLX A;  2AY4 A;  1DKA A;  1YJY A;  4OMA A;  3AEJ C;  2VMR A;  1ARH A;  4OC9 A;  4GEB A;  4FL0 A;  3HQT A;  3A8U X;  1PG8 A;  9AAT A;  3BB8 A;  2WK8 A;  4Q6R A;  3GR9 A;  1SZS A;  1WKG A;  1G4V A;  3BS8 A;  3EI8 A;  4JF1 A;  1YJS A;  2Q7W A;  1AJS A;  1KL2 A; 
#chains in the Genus database with same CATH topology
 3GZC A;  5EUE A;  1S09 A;  2VMP A;  2CIN A;  1BJO A;  2FQ6 A;  4F5J A;  4MY5 A;  1U08 A;  1QGN A;  1N8P A;  1OXO A;  2VGV A;  1BJO B;  3CBF A;  3DC1 A;  3UE8 A;  1ZC9 A;  2W8J A;  3AEL A;  3EIA A;  5HHY A;  3BV0 A;  4N0B A;  4A0G A;  4B9B A;  3NYT A;  3AOV A;  3TQX A;  7AAT A;  1AY4 A;  3NYU A;  5M49 A;  1BQD A;  3L44 A;  4GE4 A;  2VIA A;  2CH2 A;  3BCB A;  4WBT A;  4ATQ A;  1BS0 A;  1BKG A;  5EIG A;  5E4Z A;  4W1V A;  3D6K A;  4ZWM A;  1LS3 A;  1UU2 A;  1GCK A;  3VOM A;  1JF9 A;  4LW4 A;  4TN4 A;  1IVR A;  2R5C B;  2W7E A;  4IW7 A;  1AX4 A;  3MAF B;  3EZ1 A;  1AHX A;  1X2A A;  1AJR A;  2VMV A;  3B1C A;  3GZD A;  1TAT A;  4OBV A;  2BIA A;  5G09 A;  1KL1 A;  2D65 A;  3LG0 A;  1ASE A;  4JF0 A;  1IBJ A;  4E1O A;  1LW4 A;  8AAT A;  3QBO A;  3E2Z B;  5EFS A;  4E3Q A;  4JEW A;  1PFF A;  1I29 A;  2BYL A;  3DU4 A;  1AIC A;  2VMZ A;  1C9C A;  4Y0H A;  2ZY2 A;  5E5I A;  3W1I A;  3GWP A;  2FM1 A;  3KKI A;  2OQX A;  2EZ1 A;  1MLZ A;  3DXW A;  4FFC A;  4AZK A;  4ZDL A;  3EI9 A;  1LW5 A;  3E2Z A;  4BHD A;  4BMK A;  1D7U A;  1YNU A;  4DGT A;  1W7M A;  4BA5 A;  2ZSL A;  1ASB A;  3E6G A;  5DB5 A;  1WYT A;  4R5F A;  3KE3 A;  3E2Y A;  4OBU A;  3LWS A;  2QB2 A;  1ASA A;  2FYF A;  2E54 A;  4K2I A;  4F5M A;  5G0A A;  1XI9 A;  2X8U A;  4OTL A;  4WB0 B;  5G4I A;  1IX8 A;  1D7S A;  1E5E A;  3EI6 A;  4AH3 A;  4CBR A;  2ORD A;  2YKX A;  1ASC A;  3P1T A;  2BWP A;  1DGD A;  1YAA A;  3PD6 B;  2VGT A;  1N2T A;  4UQV A;  4IXS A;  1AY5 A;  1GC2 A;  1PMM A;  4RJY A;  2ZC0 A;  3ECD A;  1FC4 A;  1S07 A;  3QHX A;  3LVM A;  4IX8 A;  3DOD A;  4RIZ A;  3WX9 A;  2BYJ A;  1QIT A;  2WB6 A;  3EZS A;  2C44 A;  2HUI A;  3EI5 A;  2BWN A;  2AY6 A;  3EUC A;  1MLY A;  1ZOB A;  4LW2 A;  5DJ1 A;  2EYQ A;  4GRX A;  3DR4 A;  1AMR A;  1OHW A;  1Z7D A;  2HZP A;  2W7F A;  2CJH A;  3DZZ A;  3VP6 A;  4HVK A;  3QM2 A;  1IX7 A;  3ASB A;  3MAD A;  2DGL A;  1W3U A;  3FZ6 A;  1WYV A;  4GDY A;  3NUI A;  2DGM A;  2HP2 A;  4PFN A;  4TMR A;  3FFR A;  3NTJ A;  4ZM3 A;  5AX8 A;  1M0O A;  1MGV A;  3FVU A;  3M5U A;  4RKD A;  1AMQ A;  3QN6 A;  2R0T A;  4RLG A;  4ZLV A;  1X28 A;  4ZAH A;  3BWN C;  3G8M A;  3RQ1 A;  2DOU A;  4ADB A;  3FSL A;  4EB7 A;  1W7N A;  1C7G A;  3N0L A;  1TAR A;  1TOE A;  2CJG A;  2E7U A;  3GBX A;  3KGX A;  2RFV A;  3AEJ A;  4GSA A;  5FT5 A;  4J5U A;  3LY1 A;  3CQ5 A;  3ATH A;  2VGS A;  1SF2 A;  5K8B A;  3NU8 A;  1GC0 A;  2WK9 A;  2YOB A;  2BI9 A;  2Z9V A;  2FKI A;  1LK9 A;  4F5I A;  5F8V A;  2JJH A;  1GEY A;  2FNU A;  3N75 A;  3FKD A;  2W8V A;  2CTZ A;  3MC6 C;  2JJE A;  1EG5 A;  2HP1 A;  3ZRR A;  1WYV B;  1ELU A;  2YCT A;  3H14 A;  1V2D A;  2YKV A;  4WYF A;  4XJM A;  3JW9 A;  3ASA A;  5EQC A;  4CVQ A;  1CQ8 A;  3FDB A;  4GE9 A;  1RVY A;  3DR7 A;  1YJZ A;  2EGY A;  3NU7 A;  2HOR A;  3Q8N A;  2BKW A;  5JAY A;  1W23 A;  5KTB A;  1BJW A;  1AKB A;  2D5Y A;  3ACZ A;  3MEB A;  2OGE A;  1ART A;  1ARI A;  1OXP A;  1AHY A;  1ASL A;  2QB3 A;  1AAW A;  2DKJ A;  3DYD A;  4R2N A;  1CQ6 A;  2VGW A;  1TOK A;  4E3R A;  5HDM A;  3USF A;  5LHA A;  1ELQ A;  1H1C A;  3G7Q A;  4L0O A;  3AAT A;  1C7N A;  4RKC A;  4F4E A;  4A6R A;  2X5D A;  4RM1 A;  4J8L A;  2HUU A;  1CJ0 A;  4XAU A;  1N31 A;  2BIE A;  2W7J A;  1SFF A;  2PO3 A;  4F5H A;  3VK2 A;  3KGW A;  4IXO A;  4WXB A;  2W8U A;  3BN1 A;  1ASM A;  4RJ0 A;  3L8A A;  3ZRP A;  2C81 A;  2HOZ A;  1AIA A;  2W8T A;  2C0R A;  2D7Z A;  2VLF A;  3I16 A;  1ASF A;  3OKS A;  4RAE A;  1AHG A;  4EB5 A;  2AY3 A;  1UU0 A;  4A0R A;  2FNI A;  2Z61 A;  4PVF A;  3DRD A;  1AY8 A;  1SVV A;  4K05 A;  1KKJ A;  1BJN A;  3FFH A;  2R5E A;  4XJO A;  4O6Z A;  1BW0 A;  2D7Y A;  3FCR A;  1LC8 A;  2VMN A;  3PDX A;  3UWC A;  1IJI A;  3EI7 A;  3K28 A;  1MDX A;  1ASN A;  1M0Q A;  3DXV A;  2BI5 A;  2AY7 A;  3JWB A;  5F9S A;  1GC4 A;  2VMX A;  5BJ3 A;  2W7H A;  3FVX A;  1MAP A;  2CH1 A;  1IAY A;  1O62 A;  4W91 A;  4WXF A;  2OKK A;  5EAV A;  3WGC A;  1YOO A;  3JZL A;  1OAT A;  3E9K A;  3NDN A;  1B9H A;  1C0N A;  2BI1 A;  1ARS A;  3R9A A;  4MQR A;  3CQ4 A;  3E77 A;  3EIB A;  5G2Q A;  1O61 A;  2WKA A;  4A6T A;  1AMA A;  1FG7 A;  3FZ7 A;  3HDO A;  4WXG A;  3FQA A;  5E3K A;  5DX5 A;  2QMA A;  1QJ5 A;  2ZSM A;  3PA9 A;  3N5M A;  4OCA A;  1CZE A;  1AHE A;  3JU7 A;  3B1E A;  3RBL A;  1Y4I A;  1DJE A;  5TF5 A;  1V2F A;  3H7F A;  1D2F A;  3N4S A;  1DFO A;  3GSB A;  2AY8 A;  4F5K A;  4E77 A;  3AEO A;  1DTY A;  2JJG A;  1T3I A;  4P3M A;  2VGZ A;  1VEF A;  2W7G A;  2F8J A;  3QGU A;  3WKR A;  5C6U A;  1S08 A;  1FG3 A;  4W5K A;  3VK4 A;  3QPG A;  1BJ4 A;  2YRI A;  2XBN A;  3AEP A;  1WKH A;  3I4J A;  4ADC A;  3IF2 A;  1B5P A;  1H0C A;  2JGT A;  3MC6 A;  3B8X A;  1GDE A;  4WLH A;  1ECX A;  1EQB A;  1YIZ A;  3CAI A;  3WCO A;  4AZJ A;  3FZ8 A;  3ZRQ A;  2D64 A;  3II0 A;  3H9X A;  1B8G A;  1ORD A;  4H63 Q;  2JJF A;  2O7C A;  3A9Z A;  3NNK A;  2WK7 A;  4BQ0 A;  2OAT A;  3VAX A;  1I43 A;  2VGU A;  3GZD C;  2AAT A;  2ZP7 A;  4KYO A;  3PD6 A;  4JE5 D;  3E2F A;  2GSA A;  2BIG A;  4WP0 A;  2XH1 A;  1C4K A;  1LC7 A;  1TOI A;  1M6S A;  1QJ3 A;  2YHK A;  4KAM A;  1B4X A;  4XEW A;  2ZY3 A;  1WYU A;  1TOJ A;  4JEV A;  3TAT A;  3N4X A;  4OYT A;  5EUN A;  4AO4 A;  3RI6 A;  4AOA A;  2AEV A;  1AHF A;  1I48 A;  2Z1Z A;  2QA3 A;  1SPA A;  5M46 A;  1ASG A;  4EU1 A;  4EFF A;  2VI8 A;  5M4D A;  3F9T A;  3WCN A;  4IXZ A;  3A9Y A;  3ZZK A;  2EO5 A;  2CFB A;  2OGA A;  3TFT A;  1O4S A;  5EIG B;  2VLH A;  2ZUK A;  4MKK A;  5I92 A;  1CL2 A;  2W7K A;  3VK3 A;  1CL1 A;  3WKS A;  1B9I A;  3G0T A;  4ISY A;  4AO9 A;  5BJ4 A;  2G6W A;  5D5S A;  4LC3 A;  5FT6 A;  1AKC A;  3GET A;  1M0P A;  1ARG A;  5FT4 A;  1MDZ A;  2KFP A;  2VIB A;  2GMU A;  3ELE A;  2HOY A;  4WYA A;  4R8D A;  3BCA A;  3WGB A;  4LNJ A;  2VYC A;  4ZAS A;  2VI9 A;  2O1B A;  3RCH B;  4DBC A;  1J32 A;  2QLR A;  4K2M A;  2TPL A;  4XQ2 A;  1WYU B;  2D66 A;  3ELP A;  4LNM A;  2VMU A;  1VP4 A;  2EZ2 A;  1QIR A;  3NX3 A;  4ZSY A;  2R2N A;  1WST A;  4PIW A;  1CQ7 A;  3FVS A;  4JEZ A;  4F5G A;  3AOW A;  1M32 A;  2W7M A;  1SZU A;  1WYT B;  3AEM A;  4MKJ A;  3W1J A;  4CBS A;  4F5L A;  1SZK A;  1ZOD A;  2W7L A;  3RBF A;  3HT4 A;  4DQ6 A;  4M2K A;  3IHJ A;  4OT8 A;  3MAU A;  5FT8 A;  3CQ6 A;  2EH6 A;  2FN6 A;  5G2P A;  3HVY A;  2VMY A;  4XK1 A;  2Z1Y A;  1LC5 A;  2VMT A;  1TAS A;  3K40 A;  3COG A;  3PGY A;  3LV2 A;  3PJ0 A;  4ITX A;  2BI2 A;  4LNL A;  3AEN A;  3NYS A;  4JE5 A;  1JS3 A;  4PFF A;  2NMP A;  3OP7 A;  4U2H A;  4UHN A;  4EMY A;  1QZ9 A;  2X3L A;  3W1H A;  2W7I A;  5DJ9 A;  1V2E A;  4A0F A;  2D63 A;  2GQN A;  1V72 A;  1AIB A;  3RUY A;  2ZJG A;  3FQ8 A;  1O69 A;  4Q75 A;  1ASD A;  4Y0D A;  3K7Y A;  1UU1 A;  4WLJ A;  3N7N A;  3WZF A;  1MDO A;  1RV3 A;  4W1X A;  5J8Q A;  4WYG A;  3HBX A;  1GEW A;  3UAK A;  1M7Y A;  2O0R A;  1TOG A;  4MQQ A;  4UHM A;  4ATP A;  3A9X A;  4ZSW A;  4ZDP A;  4A6U A;  2AY5 A;  4ZWV A;  2AEU A;  4MGR A;  1UKJ A;  1X0M A;  3F0H A;  1AKA A;  2G7J A;  3HLM A;  4ZM4 A;  1W7L A;  2BWO A;  1AMS A;  2YRR A;  4MQP A;  5IWQ A;  2V1P A;  1IAX A;  3A2B A;  3HL2 A;  3B46 A;  4B98 A;  1S06 A;  3BCX A;  3PPL A;  1P3W A;  3BC8 A;  4WD2 A;  1OHY A;  2YKY A;  2JG2 A;  4TV7 A;  2OKJ A;  2CST A;  1DGE A;  2X5F A;  2AY1 A;  3PDB B;  3MBB A;  1OHV A;  2R5C A;  2Z9W A;  3GJU A;  3BWO A;  3TFU A;  1YIY A;  5HXX A;  4ITG A;  4ZDO A;  3ISL A;  4WYC A;  2E7I A;  4W1W A;  4Q76 A;  2Z67 A;  2W7D A;  4QGR A;  1AJS B;  4XJL A;  4UOY A;  4A72 A;  3P6K A;  4IYO A;  4Q31 A;  3PAA A;  3FQ7 A;  1G7W A;  2CAN A;  4IYO B;  1BQA A;  2HOX A;  4I8A A;  2BHX A;  1LKC A;  1S0A A;  1C7O A;  4HF8 A;  1PMO A;  1GEX A;  2Z9X A;  3R4T A;  2E7J A;  2Z20 A;  4R5Z A;  4CXR A;  3FDD A;  1I41 A;  1TPL A;  3LVL B;  4M2J A;  4WYE A;  2VMW A;  4IY7 A;  4WYD A;  1D7V A;  5G4J A;  2YKU A;  4H51 A;  4N0W A;  4NOG A;  1RV4 A;  1BT4 A;  2ZYJ A;  3FD0 A;  3FTB A;  2PB2 A;  4MSO A;  1VJO A;  3LVK A;  1G7X A;  1EJI A;  2EPJ A;  4JEY A;  4W8I A;  3ZZJ A;  4BA4 A;  2VMS A;  2V0Y A;  3NRA A;  1JS6 A;  4ADD A;  1QIS A;  2BI3 A;  3AEN B;  2W8W A;  1CS1 A;  4A00 A;  4RIT A;  3WY7 A;  5LH9 A;  2AY9 A;  4Y0I A;  2VMQ A;  4WB0 A;  1GBN A;  5M4B A;  1M0N A;  4M2M A;  3HMU A;  4P7Y A;  3LVJ A;  2YCP A;  3F6T A;  3AV7 A;  3PDB A;  1E5F A;  1CZC A;  1AAM A;  2Z9U A;  5D95 A;  3B1D A;  2D61 A;  1MAQ A;  2ZY4 A;  4JEX A;  2DR1 A;  1GD9 A;  3I5T A;  5EAA A;  3MAF A;  1Z3Z A;  3JTX A;  1G4X A;  1J04 A;  1D7R A;  1KMK A;  5EUD A;  2YCN A;  3FRK A;  4K2B A;  1X29 A;  3JWA A;  1KKP A;  3QI6 A;  3PIU A;  2GMS A;  1DJ9 A;  3T32 A;  2A1V A;  2ZY5 A;  3MKJ A;  1KAF A;  4GE7 A;  2GB3 A;  2QBT A;  1M4N A;  1XEY A;  4U1T A;  1KMJ A;  2DKB A;  2HUF A;  4F5F A;  2CJD A;  2AY2 A;  2JIS A;  3AEM C;  4A0H A;  3TCM A;  1IX6 A;  4XJP A;  2PB0 A;  4KXK A;  1B5O A;  1RVU A;  4UHO A;  1IUG A;  1DJU A;  4ADE A;  2CB1 A;  2CY8 A;  2DGK A;  4CXQ A;  2VMO A;  2C7T A;  3N4R A;  3NUB A;  3BWN A;  1GC3 A;  1JG8 A;  3RCH A;  3WLX A;  2AY4 A;  1DKA A;  1YJY A;  4OMA A;  3AEJ C;  2VMR A;  1ARH A;  4OC9 A;  4GEB A;  4FL0 A;  3HQT A;  3A8U X;  1PG8 A;  9AAT A;  3BB8 A;  2WK8 A;  4Q6R A;  3GR9 A;  1SZS A;  1WKG A;  1G4V A;  3BS8 A;  3EI8 A;  4JF1 A;  2QSR A;  1YJS A;  2Q7W A;  1AJS A;  1KL2 A; 
#chains in the Genus database with same CATH homology
 3GZC A;  5EUE A;  1S09 A;  2VMP A;  2CIN A;  1BJO A;  2FQ6 A;  4F5J A;  4MY5 A;  1U08 A;  1QGN A;  1N8P A;  1OXO A;  2VGV A;  1BJO B;  3CBF A;  3DC1 A;  3UE8 A;  1ZC9 A;  2W8J A;  3AEL A;  3EIA A;  5HHY A;  3BV0 A;  4N0B A;  4A0G A;  4B9B A;  3NYT A;  3AOV A;  3TQX A;  7AAT A;  1AY4 A;  3NYU A;  5M49 A;  1BQD A;  3L44 A;  4GE4 A;  2VIA A;  2CH2 A;  3BCB A;  4WBT A;  4ATQ A;  1BS0 A;  1BKG A;  5EIG A;  5E4Z A;  4W1V A;  3D6K A;  4ZWM A;  1LS3 A;  1UU2 A;  1GCK A;  3VOM A;  1JF9 A;  4LW4 A;  4TN4 A;  1IVR A;  2R5C B;  2W7E A;  4IW7 A;  1AX4 A;  3MAF B;  3EZ1 A;  1AHX A;  1X2A A;  1AJR A;  2VMV A;  3B1C A;  3GZD A;  1TAT A;  4OBV A;  2BIA A;  5G09 A;  1KL1 A;  2D65 A;  3LG0 A;  1ASE A;  4JF0 A;  1IBJ A;  4E1O A;  1LW4 A;  8AAT A;  3QBO A;  3E2Z B;  5EFS A;  4E3Q A;  4JEW A;  1PFF A;  1I29 A;  2BYL A;  3DU4 A;  1AIC A;  2VMZ A;  1C9C A;  4Y0H A;  2ZY2 A;  5E5I A;  3W1I A;  3GWP A;  2FM1 A;  3KKI A;  2OQX A;  2EZ1 A;  1MLZ A;  3DXW A;  4FFC A;  4AZK A;  4ZDL A;  3EI9 A;  1LW5 A;  3E2Z A;  4BHD A;  4BMK A;  1D7U A;  1YNU A;  4DGT A;  1W7M A;  4BA5 A;  2ZSL A;  1ASB A;  3E6G A;  5DB5 A;  1WYT A;  4R5F A;  3KE3 A;  3E2Y A;  4OBU A;  3LWS A;  2QB2 A;  1ASA A;  2FYF A;  2E54 A;  4K2I A;  4F5M A;  5G0A A;  1XI9 A;  2X8U A;  4OTL A;  4WB0 B;  5G4I A;  1IX8 A;  1D7S A;  1E5E A;  3EI6 A;  4AH3 A;  4CBR A;  2ORD A;  2YKX A;  1ASC A;  3P1T A;  2BWP A;  1DGD A;  1YAA A;  3PD6 B;  2VGT A;  1N2T A;  4UQV A;  4IXS A;  1AY5 A;  1GC2 A;  1PMM A;  4RJY A;  2ZC0 A;  3ECD A;  1FC4 A;  1S07 A;  3QHX A;  3LVM A;  4IX8 A;  3DOD A;  4RIZ A;  3WX9 A;  2BYJ A;  1QIT A;  2WB6 A;  3EZS A;  2C44 A;  2HUI A;  3EI5 A;  2BWN A;  2AY6 A;  3EUC A;  1MLY A;  1ZOB A;  4LW2 A;  5DJ1 A;  2EYQ A;  4GRX A;  3DR4 A;  1AMR A;  1OHW A;  1Z7D A;  2HZP A;  2W7F A;  2CJH A;  3DZZ A;  3VP6 A;  4HVK A;  3QM2 A;  1IX7 A;  3ASB A;  3MAD A;  2DGL A;  1W3U A;  3FZ6 A;  1WYV A;  4GDY A;  3NUI A;  2DGM A;  2HP2 A;  4PFN A;  4TMR A;  3FFR A;  3NTJ A;  4ZM3 A;  5AX8 A;  1M0O A;  1MGV A;  3FVU A;  3M5U A;  4RKD A;  1AMQ A;  3QN6 A;  2R0T A;  4RLG A;  4ZLV A;  1X28 A;  4ZAH A;  3BWN C;  3G8M A;  3RQ1 A;  2DOU A;  4ADB A;  3FSL A;  4EB7 A;  1W7N A;  1C7G A;  3N0L A;  1TAR A;  1TOE A;  2CJG A;  2E7U A;  3GBX A;  3KGX A;  2RFV A;  3AEJ A;  4GSA A;  5FT5 A;  4J5U A;  3LY1 A;  3CQ5 A;  3ATH A;  2VGS A;  1SF2 A;  5K8B A;  3NU8 A;  1GC0 A;  2WK9 A;  2YOB A;  2BI9 A;  2Z9V A;  2FKI A;  1LK9 A;  4F5I A;  5F8V A;  2JJH A;  1GEY A;  2FNU A;  3N75 A;  3FKD A;  2W8V A;  2CTZ A;  3MC6 C;  2JJE A;  1EG5 A;  2HP1 A;  3ZRR A;  1WYV B;  1ELU A;  2YCT A;  3H14 A;  1V2D A;  2YKV A;  4WYF A;  4XJM A;  3JW9 A;  3ASA A;  5EQC A;  4CVQ A;  1CQ8 A;  3FDB A;  4GE9 A;  1RVY A;  3DR7 A;  1YJZ A;  2EGY A;  3NU7 A;  2HOR A;  3Q8N A;  2BKW A;  5JAY A;  1W23 A;  5KTB A;  1BJW A;  1AKB A;  2D5Y A;  3ACZ A;  3MEB A;  2OGE A;  1ART A;  1ARI A;  1OXP A;  1AHY A;  1ASL A;  2QB3 A;  1AAW A;  2DKJ A;  3DYD A;  4R2N A;  1CQ6 A;  2VGW A;  1TOK A;  4E3R A;  5HDM A;  3USF A;  5LHA A;  1ELQ A;  1H1C A;  3G7Q A;  4L0O A;  3AAT A;  1C7N A;  4RKC A;  4F4E A;  4A6R A;  2X5D A;  4RM1 A;  4J8L A;  2HUU A;  1CJ0 A;  4XAU A;  1N31 A;  2BIE A;  2W7J A;  1SFF A;  2PO3 A;  4F5H A;  3VK2 A;  3KGW A;  4IXO A;  4WXB A;  2W8U A;  3BN1 A;  1ASM A;  4RJ0 A;  3L8A A;  3ZRP A;  2C81 A;  2HOZ A;  1AIA A;  2W8T A;  2C0R A;  2D7Z A;  2VLF A;  3I16 A;  1ASF A;  3OKS A;  4RAE A;  1AHG A;  4EB5 A;  2AY3 A;  1UU0 A;  4A0R A;  2FNI A;  2Z61 A;  4PVF A;  3DRD A;  1AY8 A;  1SVV A;  4K05 A;  1KKJ A;  1BJN A;  3FFH A;  2R5E A;  4XJO A;  4O6Z A;  1BW0 A;  2D7Y A;  3FCR A;  1LC8 A;  2VMN A;  3PDX A;  3UWC A;  1IJI A;  3EI7 A;  3K28 A;  1MDX A;  1ASN A;  1M0Q A;  3DXV A;  2BI5 A;  2AY7 A;  3JWB A;  5F9S A;  1GC4 A;  2VMX A;  5BJ3 A;  2W7H A;  3FVX A;  1MAP A;  2CH1 A;  1IAY A;  1O62 A;  4W91 A;  4WXF A;  2OKK A;  5EAV A;  3WGC A;  1YOO A;  3JZL A;  1OAT A;  3E9K A;  3NDN A;  1B9H A;  1C0N A;  2BI1 A;  1ARS A;  3R9A A;  4MQR A;  3CQ4 A;  3E77 A;  3EIB A;  5G2Q A;  1O61 A;  2WKA A;  4A6T A;  1AMA A;  1FG7 A;  3FZ7 A;  3HDO A;  4WXG A;  3FQA A;  5E3K A;  5DX5 A;  2QMA A;  1QJ5 A;  2ZSM A;  3PA9 A;  3N5M A;  4OCA A;  1CZE A;  1AHE A;  3JU7 A;  3B1E A;  3RBL A;  1Y4I A;  1DJE A;  5TF5 A;  1V2F A;  3H7F A;  1D2F A;  3N4S A;  1DFO A;  3GSB A;  2AY8 A;  4F5K A;  4E77 A;  3AEO A;  1DTY A;  2JJG A;  1T3I A;  4P3M A;  2VGZ A;  1VEF A;  2W7G A;  2F8J A;  3QGU A;  3WKR A;  5C6U A;  1S08 A;  1FG3 A;  4W5K A;  3VK4 A;  3QPG A;  1BJ4 A;  2YRI A;  2XBN A;  3AEP A;  1WKH A;  3I4J A;  4ADC A;  3IF2 A;  1B5P A;  1H0C A;  2JGT A;  3MC6 A;  3B8X A;  1GDE A;  4WLH A;  1ECX A;  1EQB A;  1YIZ A;  3CAI A;  3WCO A;  4AZJ A;  3FZ8 A;  3ZRQ A;  2D64 A;  3II0 A;  3H9X A;  1B8G A;  1ORD A;  4H63 Q;  2JJF A;  2O7C A;  3A9Z A;  3NNK A;  2WK7 A;  4BQ0 A;  2OAT A;  3VAX A;  1I43 A;  2VGU A;  3GZD C;  2AAT A;  2ZP7 A;  4KYO A;  3PD6 A;  4JE5 D;  3E2F A;  2GSA A;  2BIG A;  4WP0 A;  2XH1 A;  1C4K A;  1LC7 A;  1TOI A;  1M6S A;  1QJ3 A;  2YHK A;  4KAM A;  1B4X A;  4XEW A;  2ZY3 A;  1WYU A;  1TOJ A;  4JEV A;  3TAT A;  3N4X A;  4OYT A;  5EUN A;  4AO4 A;  3RI6 A;  4AOA A;  2AEV A;  1AHF A;  1I48 A;  2Z1Z A;  2QA3 A;  1SPA A;  5M46 A;  1ASG A;  4EU1 A;  4EFF A;  2VI8 A;  5M4D A;  3F9T A;  3WCN A;  4IXZ A;  3A9Y A;  3ZZK A;  2EO5 A;  2CFB A;  2OGA A;  3TFT A;  1O4S A;  5EIG B;  2VLH A;  2ZUK A;  4MKK A;  5I92 A;  1CL2 A;  2W7K A;  3VK3 A;  1CL1 A;  3WKS A;  1B9I A;  3G0T A;  4ISY A;  4AO9 A;  5BJ4 A;  2G6W A;  5D5S A;  4LC3 A;  5FT6 A;  1AKC A;  3GET A;  1M0P A;  1ARG A;  5FT4 A;  1MDZ A;  2KFP A;  2VIB A;  2GMU A;  3ELE A;  2HOY A;  4WYA A;  4R8D A;  3BCA A;  3WGB A;  4LNJ A;  2VYC A;  4ZAS A;  2VI9 A;  2O1B A;  3RCH B;  4DBC A;  1J32 A;  2QLR A;  4K2M A;  2TPL A;  4XQ2 A;  1WYU B;  2D66 A;  3ELP A;  4LNM A;  2VMU A;  1VP4 A;  2EZ2 A;  1QIR A;  3NX3 A;  4ZSY A;  2R2N A;  1WST A;  4PIW A;  1CQ7 A;  3FVS A;  4JEZ A;  4F5G A;  3AOW A;  1M32 A;  2W7M A;  1SZU A;  1WYT B;  3AEM A;  4MKJ A;  3W1J A;  4CBS A;  4F5L A;  1SZK A;  1ZOD A;  2W7L A;  3RBF A;  3HT4 A;  4DQ6 A;  4M2K A;  3IHJ A;  4OT8 A;  3MAU A;  5FT8 A;  3CQ6 A;  2EH6 A;  2FN6 A;  5G2P A;  3HVY A;  2VMY A;  4XK1 A;  2Z1Y A;  1LC5 A;  2VMT A;  1TAS A;  3K40 A;  3COG A;  3PGY A;  3LV2 A;  3PJ0 A;  4ITX A;  2BI2 A;  4LNL A;  3AEN A;  3NYS A;  4JE5 A;  1JS3 A;  4PFF A;  2NMP A;  3OP7 A;  4U2H A;  4UHN A;  4EMY A;  1QZ9 A;  2X3L A;  3W1H A;  2W7I A;  5DJ9 A;  1V2E A;  4A0F A;  2D63 A;  2GQN A;  1V72 A;  1AIB A;  3RUY A;  2ZJG A;  3FQ8 A;  1O69 A;  4Q75 A;  1ASD A;  4Y0D A;  3K7Y A;  1UU1 A;  4WLJ A;  3N7N A;  3WZF A;  1MDO A;  1RV3 A;  4W1X A;  5J8Q A;  4WYG A;  3HBX A;  1GEW A;  3UAK A;  1M7Y A;  2O0R A;  1TOG A;  4MQQ A;  4UHM A;  4ATP A;  3A9X A;  4ZSW A;  4ZDP A;  4A6U A;  2AY5 A;  4ZWV A;  2AEU A;  4MGR A;  1UKJ A;  1X0M A;  3F0H A;  1AKA A;  2G7J A;  3HLM A;  4ZM4 A;  1W7L A;  2BWO A;  1AMS A;  2YRR A;  4MQP A;  5IWQ A;  2V1P A;  1IAX A;  3A2B A;  3HL2 A;  3B46 A;  4B98 A;  1S06 A;  3BCX A;  3PPL A;  1P3W A;  3BC8 A;  4WD2 A;  1OHY A;  2YKY A;  2JG2 A;  4TV7 A;  2OKJ A;  2CST A;  1DGE A;  2X5F A;  2AY1 A;  3PDB B;  3MBB A;  1OHV A;  2R5C A;  2Z9W A;  3GJU A;  3BWO A;  3TFU A;  1YIY A;  5HXX A;  4ITG A;  4ZDO A;  3ISL A;  4WYC A;  2E7I A;  4W1W A;  4Q76 A;  2Z67 A;  2W7D A;  4QGR A;  1AJS B;  4XJL A;  4UOY A;  4A72 A;  3P6K A;  4IYO A;  4Q31 A;  3PAA A;  3FQ7 A;  1G7W A;  2CAN A;  4IYO B;  1BQA A;  2HOX A;  4I8A A;  2BHX A;  1LKC A;  1S0A A;  1C7O A;  4HF8 A;  1PMO A;  1GEX A;  2Z9X A;  3R4T A;  2E7J A;  2Z20 A;  4R5Z A;  4CXR A;  3FDD A;  1I41 A;  1TPL A;  3LVL B;  4M2J A;  4WYE A;  2VMW A;  4IY7 A;  4WYD A;  1D7V A;  5G4J A;  2YKU A;  4H51 A;  4N0W A;  4NOG A;  1RV4 A;  1BT4 A;  2ZYJ A;  3FD0 A;  3FTB A;  2PB2 A;  4MSO A;  1VJO A;  3LVK A;  1G7X A;  1EJI A;  2EPJ A;  4JEY A;  4W8I A;  3ZZJ A;  4BA4 A;  2VMS A;  2V0Y A;  3NRA A;  1JS6 A;  4ADD A;  1QIS A;  2BI3 A;  3AEN B;  2W8W A;  1CS1 A;  4A00 A;  4RIT A;  3WY7 A;  5LH9 A;  2AY9 A;  4Y0I A;  2VMQ A;  4WB0 A;  1GBN A;  5M4B A;  1M0N A;  4M2M A;  3HMU A;  4P7Y A;  3LVJ A;  2YCP A;  3F6T A;  3AV7 A;  3PDB A;  1E5F A;  1CZC A;  1AAM A;  2Z9U A;  5D95 A;  3B1D A;  2D61 A;  1MAQ A;  2ZY4 A;  4JEX A;  2DR1 A;  1GD9 A;  3I5T A;  5EAA A;  3MAF A;  1Z3Z A;  3JTX A;  1G4X A;  1J04 A;  1D7R A;  1KMK A;  5EUD A;  2YCN A;  3FRK A;  4K2B A;  1X29 A;  3JWA A;  1KKP A;  3QI6 A;  3PIU A;  2GMS A;  1DJ9 A;  3T32 A;  2A1V A;  2ZY5 A;  3MKJ A;  4GE7 A;  2GB3 A;  2QBT A;  1M4N A;  1XEY A;  4U1T A;  1KMJ A;  2DKB A;  2HUF A;  4F5F A;  2CJD A;  2AY2 A;  2JIS A;  3AEM C;  4A0H A;  3TCM A;  1IX6 A;  4XJP A;  2PB0 A;  4KXK A;  1B5O A;  1RVU A;  4UHO A;  1IUG A;  1DJU A;  4ADE A;  2CB1 A;  2CY8 A;  2DGK A;  4CXQ A;  2VMO A;  2C7T A;  3N4R A;  3NUB A;  3BWN A;  1GC3 A;  1JG8 A;  3RCH A;  3WLX A;  2AY4 A;  1DKA A;  1YJY A;  4OMA A;  3AEJ C;  2VMR A;  1ARH A;  4OC9 A;  4GEB A;  4FL0 A;  3HQT A;  3A8U X;  1PG8 A;  9AAT A;  3BB8 A;  2WK8 A;  4Q6R A;  3GR9 A;  1SZS A;  1WKG A;  1G4V A;  3BS8 A;  3EI8 A;  4JF1 A;  2QSR A;  1YJS A;  2Q7W A;  1AJS A;  1KL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...