2BIAA

Radiation damage of the schiff base in phosphoserine aminotransferase (structure g)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
360
structure length
360
Chain Sequence
b'VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
total genus 128
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2biaA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2biaA02
4F5FA 2AEVA 5FT8A 4RJ0A 1FC4A 1M0NA 4M2MA 1ASCA 1AY4A 4E77A 3JWAA 3AEJA 4ZWVA 4Q31A 3AELA 1C4KA 2EO5A 2Z9VA 1CJ0A 2W8UA 3DXWA 3VOMA 4A00A 3FVSA 4ZSWA 1GEWA 3B1DA 4RKCA 2BIAA 3NDNA 1D7RA 2BWOA 3AOWA 1S09A 1TOKA 5EAVA 2VMZA 4F5KA 2TPLA 4QGRA 3W1HA 4B98A 4UQVA 3QGUA 4WXBA 1BKGA 5G4IA 1B8GA 3HMUA 1ASAA 3MC6C 2HUUA 4XK1A 2CB1A 3JZLA 4ADBA 3UE8A 3LV2A 3TFTA 1M7YA 1RV4A 2HORA 4ZASA 1H0CA 5FT4A 5J8QA 1AMRA 1AHGA 2AY8A 2QA3A 3PPLA 1ELUA 1QJ5A 2DGMA 1LKCA 1CQ8A 1AJRA 3G7QA 4Y0HA 1AKBA 3ELPA 3NTJA 3F6TA 1EG5A 3DR7A 1AKCA 2BKWA 3FZ6A 3PD6B 4ZDPA 1CL1A 5IWQA 3VK3A 5F9SA 3JTXA 1BT4A 2E7IA 1UKJA 2VMTA 3NX3A 1O69A 5FT5A 1ZODA 1GC3A 2BIEA 4WB0A 1TOGA 3B8XA 3CQ4A 1IX8A 4XAUA 2VI9A 4XJLA 2VGZA 2W8TA 3R9AA 4BHDA 4J5UA 5EQCA 2W8VA 3WGCA 3QI6A 1YJYA 2DGKA 3HDOA 4E1OA 2W7LA 2DGLA 3GR9A 3L8AA 1WYTB 1B4XA 4GRXA 2ZC0A 3DYDA 5LH9A 4JEXA 1YOOA 1LC8A 4A0HA 3EIBA 3FVUA 4OYTA 4UOYA 5LHAA 5G0AA 1CQ7A 2ZSMA 1W7MA 4F5LA 1JF9A 4EB7A 2E7UA 2AATA 4MKKA 3TQXA 1ZOBA 5G2PA 1AAMA 1KKJA 1JS3A 3ASAA 1IAYA 5EIGA 1AIBA 3NYTA 4MGRA 1WYUA 3GETA 1SVVA 2FQ6A 3HL2A 3QM2A 2W7MA 1N2TA 2W8JA 4TN4A 3USFA 2EH6A 1AIAA 3GJUA 2D65A 3MBBA 5M49A 4IYOA 2Z9UA 4MQPA 4RIZA 4R8DA 5E3KA 3WGBA 3ZZJA 3GBXA 1FG3A 4CXRA 4XEWA 1DJEA 4AH3A 1LC5A 3EI7A 3BB8A 4EMYA 4A72A 1E5EA 1O4SA 3AOVA 4WYDA 1BS0A 3BV0A 1S0AA 3ASBA 1O61A 4K2BA 4UHNA 2QLRA 3LVLB 1DKAA 3WLXA 1SPAA 3AENA 1DGEA 3DZZA 4AZKA 3KGWA 1CZEA 1ARHA 1XEYA 4I8AA 3CAIA 4CXQA 2OATA 1MDZA 3MKJA 4ZSYA 3QPGA 2BYJA 3AEJC 3II0A 3RBLA 2R5CA 1OATA 3ATHA 1GC4A 2HP2A 1V2EA 1KMKA 1WYVA 2VGTA 2GB3A 4R5FA 4U1TA 4W1VA 4BQ0A 4W5KA 1PMOA 5HHYA 3HLMA 1M0QA 1E5FA 3GZDA 4F4EA 3D6KA 3Q8NA 4WLJA 4IY7A 2AY4A 4PFFA 2CJDA 2QBTA 1ASDA 1UU1A 4ZWMA 4WB0B 2C7TA 3WCOA 4LNJA 1XI9A 4XQ2A 4ZAHA 2AY5A 4MSOA 2VMQA 1SF2A 2YHKA 1U08A 3RQ1A 1I41A 4WBTA 3DODA 4KXKA 3F0HA 3LWSA 4WYCA 2JGTA 2G6WA 3PDBA 1AAWA 2JG2A 3CQ5A 3ISLA 3AEMA 3RBFA 2GSAA 1PFFA 3T32A 2YKXA 3A2BA 3JW9A 2HOZA 1AHFA 1CZCA 1GC0A 2VMRA 1KMJA 5I92A 1JG8A 4Y0IA 2AEUA 5EIGB 3KKIA 4RLGA 1IX6A 1WYUB 2JISA 4CVQA 1D7UA 2BI5A 3FVXA 3MAUA 3LG0A 1GDEA 3N0LA 3COGA 4GSAA 2XH1A 5F8VA 1GBNA 3NUIA 2O1BA 2DR1A 1OHYA 2D7ZA 2FNIA 3JWBA 3MADA 4IYOB 3H7FA 3FQ8A 4F5GA 1AKAA 2EPJA 2W7FA 3FQ7A 4WYFA 2D64A 2C0RA 1Y4IA 4W91A 4GE7A 1M0OA 9AATA 1AMQA 4AOAA 1G4VA 3NYSA 4WXGA 1SFFA 1MAQA 1VP4A 3FDBA 4ITGA 3WX9A 2XBNA 3H14A 1BJNA 5TF5A 2CINA 4WYAA 2C44A 2OGEA 2QB3A 3AENB 2RFVA 3EIAA 5G2QA 4WP0A 2VGUA 1Z3ZA 1AMAA 2BI2A 1IX7A 2JJGA 1C7NA 3CBFA 3FSLA 4LNMA 3W1JA 2NMPA 2W7DA 5D5SA 4A0GA 1QJ3A 1QIRA 2R5CB 1BQDA 1TASA 4ADEA 4ADDA 3FFHA 1SZSA 3ACZA 3LY1A 1WYVB 3MAFA 3RUYA 3UAKA 2YRRA 2VLFA 1LC7A 3KGXA 4O6ZA 4Q6RA 3AEPA 3EI6A 2ZSLA 2VGVA 4Y0DA 4GEBA 3DRDA 2VIAA 3CQ6A 3BWNA 3DU4A 2CTZA 1BJOA 1J32A 7AATA 1QZ9A 3ZRQA 4XJMA 3LVKA 2CSTA 2WKAA 2Z1ZA 3GZCA 3HBXA 2FNUA 2OKKA 1QGNA 4FFCA 3TATA 4CBSA 4BA5A 2Z9WA 1MGVA 2R5EA 2F8JA 3VAXA 1RVYA 3IHJA 4CBRA 1ASEA 1N31A 2CH1A 2O7CA 4XJPA 1P3WA 3LVJA 1G4XA 3HQTA 1G7XA 1V72A 2DKBA 1M4NA 4M2JA 1W23A 3JU7A 1S06A 3FD0A 5E5IA 2D63A 1SZKA 1TATA 4GE9A 1LW4A 1YIZA 1M6SA 2ZUKA 2AY1A 2EZ1A 3RCHA 4MKJA 3WKSA 3MC6A 3P6KA 1G7WA 2QMAA 1ASNA 4F5HA 2HUIA 1GC2A 2Z9XA 4WXFA 2BI9A 1IUGA 5G4JA 1EQBA 1I29A 4AO9A 4NOGA 4GE4A 4ATPA 1UU2A 5C6UA 2C81A 3ECDA 3N75A 4MQRA 2WK9A 2BHXA 1ASBA 3ZRRA 4LW2A 3G8MA 2OGAA 3EUCA 1OXOA 3PGYA 1YIYA 2AY7A 2X8UA 3E77A 3R4TA 2W7EA 4RKDA 3FTBA 1O62A 3PIUA 2VIBA 1ARSA 2ZY3A 1WSTA 3ZZKA 4E3RA 3WCNA 1B5PA 1EJIA 3DR4A 4OMAA 4A6TA 3BCBA 1DJ9A 4PFNA 4ZDOA 2O0RA 4ATQA 1PMMA 3VK4A 2D66A 1B5OA 1JS6A 3A9YA 4ZLVA 5D95A 2ZY4A 3PJ0A 3LVMA 3L44A 2FM1A 1UU0A 1H1CA 4A6RA 3MAFB 2ORDA 4K2IA 3K7YA 1T3IA 4JEWA 4TV7A 2WK7A 2CY8A 1AY8A 3TCMA 3BN1A 1B9HA 3I5TA 1BJ4A 4JE5A 4KAMA 3E2ZA 4ISYA 1BJOB 4F5IA 5EUDA 1ASMA 2EZ2A 1C7GA 2GMSA 2VLHA 2YCTA 2EGYA 3KE3A 1KL2A 2YRIA 4OBUA 4GDYA 2Z1YA 1KL1A 1V2DA 4W8IA 5M4DA 2Q7WA 3AEOA 3MEBA 1AJSA 3BWOA 4JEZA 2W7JA 4N0BA 3P1TA 3NRAA 1BW0A 1ASGA 2BYLA 3OKSA 3PAAA 5E4ZA 3BCAA 2VGWA 1TOJA 2R2NA 1MDXA 4F5JA 3E6GA 4RAEA 1WKHA 1ARIA 2ZYJA 5M46A 3FRKA 2DKJA 2Z20A 3EI9A 3RCHB 4IXSA 2V0YA 4ITXA 1M0PA 4AO4A 1GCKA 2JJHA 4K2MA 5M4BA 2PB2A 3PA9A 4OT8A 4M2KA 1LK9A 1LS3A 1IBJA 4ZM3A 2AY2A 4JEYA 3BWNC 4HF8A 5DB5A 2JJEA 5DJ9A 3E9KA 1Z7DA 1GD9A 1GEYA 2VYCA 3GSBA 4XJOA 1X2AA 4MQQA 2X5DA 2PB0A 3A9XA 3F9TA 2VMWA 3N5MA 2BIGA 2VI8A 4N0WA 1PG8A 2VMPA 4ZM4A 2VMUA 1ELQA 2FN6A 4P7YA 4WLHA 4WYGA 3GWPA 5FT6A 5BJ3A 2CH2A 4BMKA 8AATA 4RM1A 5BJ4A 1TPLA 1IJIA 2FYFA 3ELEA 3FZ7A 4IW7A 5EUEA 1ZC9A 4P3MA 1MLYA 2W7GA 4B9BA 4EU1A 2VMNA 2GQNA 2YCPA 5EFSA 1RV3A 3FZ8A 3K40A 2YKVA 5HDMA 3EI8A 2W7IA 4A0RA 1ASLA 4DQ6A 2HZPA 3WKRA 1WKGA 2VMXA 1ARGA 3NUBA 1J04A 1AX4A 1AICA 3I4JA 4AZJA 3DXVA 2R0TA 3HVYA 4UHMA 2BI3A 1AY5A 3BS8A 1CQ6A 2QB2A 2CANA 1BJWA 4IX8A 2AY6A 1D7VA 2OQXA 4RJYA 4EFFA 3EZ1A 3W1IA 2CFBA 1D2FA 2X5FA 3E2ZB 1OHVA 3I16A 4Q76A 4OTLA 4OBVA 4BA4A 2D61A 4E3QA 1AMSA 1BQAA 1YJSA 3EZSA 3WY7A 1SZUA 2ZY5A 4FL0A 3FDDA 5EUNA 2YKUA 1AHYA 1I48A 1DGDA 3FKDA 3PDBB 3AATA 1AJSB 1TOIA 2WK8A 2ZY2A 1MLZA 1W7NA 4RITA 4ADCA 2ZJGA 2OKJA 3A8UX 4PVFA 1TOEA 2CJHA 3AV7A 3GZDC 4OC9A 2BWPA 1MAPA 4PIWA 4WYEA 3UWCA 4UHOA 1S07A 4A0FA 4F5MA 4JE5D 1LW5A 4IXOA 4JF1A 5EAAA 2VMOA 2D7YA 1DTYA 2JJFA 2HP1A 3NU8A 1IAXA 3ZRPA 3A9ZA 2VMVA 1IVRA 1RVUA 4J8LA 1ASFA 4R5ZA 4TMRA 4EB5A 4A6UA 1VEFA 4JF0A 2YOBA 5HXXA 1C9CA 5DX5A 1KKPA 3OP7A 3PDXA 1VJOA 3AEMC 3FCRA 1ECXA 1DFOA 2AY3A 4W1WA 1OHWA 1YAAA 4IXZA 4HVKA 4U2HA 1W7LA 1QITA 1YJZA 2E54A 3NU7A 2HUFA 4DGTA 1B9IA 1FG7A 2CJGA 2BWNA 4KYOA 1AHXA 3TFUA 3QHXA 1I43A 1CS1A 4WD2A 1GEXA 1OXPA 3NYUA 2BI1A 1ORDA 2E7JA 1M32A 1MDOA 2PO3A 1D7SA 1CL2A 3E2FA 1X28A 4OCAA 4DBCA 4L0OA 3NNKA 3PD6A 5JAYA 1X29A 3FFRA 3BCXA 2X3LA 3RI6A 1N8PA 2W8WA 3B1EA 2VMYA 3FQAA 3K28A 4LW4A 4ZDLA 5AX8A 2YCNA 2Z67A 3G0TA 2GMUA 3DC1A 2YKYA 3QBOA 1C0NA 1ARTA 3VK2A 4W1XA 2VGSA 2D5YA 1C7OA 3E2YA 4MY5A 1QISA 2HOXA 2Z61A 5K8BA 2ZP7A 3B1CA 4Q75A 4LC3A 1WYTA 2W7KA 1DJUA 1YNUA 2V1PA 3WZFA 1V2FA 3B46A 3EI5A 3QN6A 3BC8A 1S08A 5DJ1A 4H51A 3VP6A 3HT4A 2HOYA 4JEVA 4LNLA 2VMSA 2DOUA 1TARA 4R2NA 3M5UA 2AY9A 5G09A 2W7HA 3IF2A 1W3UA 1X0MA 1AHEA
chains in the Genus database with same CATH superfamily
4F5FA 2AEVA 5FT8A 4RJ0A 1FC4A 1M0NA 4M2MA 1ASCA 1AY4A 4E77A 3JWAA 3AEJA 4ZWVA 4Q31A 3AELA 1C4KA 2EO5A 2Z9VA 1CJ0A 2W8UA 3DXWA 3VOMA 4A00A 3FVSA 4ZSWA 1GEWA 3B1DA 4RKCA 2BIAA 3NDNA 1D7RA 2BWOA 3AOWA 1S09A 1TOKA 5EAVA 2VMZA 4F5KA 2TPLA 4QGRA 3W1HA 4B98A 4UQVA 3QGUA 4WXBA 1BKGA 5G4IA 1B8GA 3HMUA 1ASAA 3MC6C 2HUUA 4XK1A 2CB1A 3JZLA 4ADBA 3UE8A 3LV2A 3TFTA 1M7YA 1RV4A 2HORA 4ZASA 1H0CA 5FT4A 5J8QA 1AMRA 1AHGA 2AY8A 2QA3A 3PPLA 1ELUA 1QJ5A 2DGMA 1LKCA 1CQ8A 1AJRA 3G7QA 4Y0HA 1AKBA 3ELPA 3NTJA 3F6TA 1EG5A 3DR7A 1AKCA 2BKWA 3FZ6A 3PD6B 4ZDPA 2FKIA 1CL1A 5IWQA 3VK3A 5F9SA 3JTXA 1BT4A 2E7IA 1UKJA 2VMTA 3NX3A 1O69A 5FT5A 1ZODA 1GC3A 2BIEA 4WB0A 1TOGA 3B8XA 3CQ4A 1IX8A 4XAUA 2VI9A 4XJLA 2VGZA 2W8TA 3R9AA 4BHDA 4J5UA 5EQCA 2W8VA 3WGCA 3QI6A 1YJYA 2DGKA 3HDOA 4E1OA 2W7LA 2DGLA 3GR9A 3L8AA 1WYTB 1B4XA 4GRXA 2ZC0A 3DYDA 5LH9A 4JEXA 1YOOA 1LC8A 4A0HA 3EIBA 3FVUA 4OYTA 4UOYA 5LHAA 5G0AA 1CQ7A 2ZSMA 1W7MA 4F5LA 1JF9A 4EB7A 2E7UA 2AATA 4MKKA 3TQXA 1ZOBA 5G2PA 1AAMA 2A1VA 1KKJA 1JS3A 3ASAA 1IAYA 5EIGA 1AIBA 3NYTA 4MGRA 1WYUA 3GETA 1SVVA 2FQ6A 3HL2A 3QM2A 2W7MA 1N2TA 2W8JA 4TN4A 3USFA 2EH6A 1AIAA 3GJUA 2D65A 3MBBA 5M49A 4IYOA 2Z9UA 4MQPA 4RIZA 4R8DA 5E3KA 3WGBA 3ZZJA 3GBXA 1FG3A 4CXRA 4XEWA 1DJEA 4AH3A 1LC5A 3EI7A 3BB8A 4EMYA 4A72A 1E5EA 1O4SA 3AOVA 4WYDA 1BS0A 3BV0A 1S0AA 3ASBA 1O61A 4K2BA 4UHNA 2QLRA 3LVLB 1DKAA 3WLXA 1SPAA 3AENA 1DGEA 3DZZA 4AZKA 3KGWA 1CZEA 1ARHA 1XEYA 4I8AA 3CAIA 4CXQA 2OATA 1MDZA 3MKJA 4ZSYA 3QPGA 2BYJA 3AEJC 3II0A 3RBLA 2R5CA 1OATA 3ATHA 1GC4A 2HP2A 1V2EA 1KMKA 1WYVA 2VGTA 2GB3A 4R5FA 4U1TA 4W1VA 4BQ0A 4W5KA 1PMOA 5HHYA 3HLMA 1M0QA 1E5FA 2KFPA 3GZDA 4F4EA 3D6KA 3Q8NA 4WLJA 4K05A 4IY7A 2AY4A 4PFFA 2CJDA 2QBTA 1ASDA 1UU1A 4ZWMA 4WB0B 2C7TA 3WCOA 4LNJA 1XI9A 4XQ2A 4ZAHA 2AY5A 4MSOA 2VMQA 1SF2A 2YHKA 1U08A 3RQ1A 1I41A 4WBTA 3DODA 4KXKA 3F0HA 4H63Q 3LWSA 4WYCA 2JGTA 2G6WA 3PDBA 1AAWA 2JG2A 3CQ5A 3ISLA 3AEMA 3N7NA 3RBFA 2GSAA 1PFFA 3T32A 2YKXA 3A2BA 3JW9A 2HOZA 1AHFA 1CZCA 1GC0A 2VMRA 1KMJA 5I92A 1JG8A 4Y0IA 2AEUA 5EIGB 3KKIA 4RLGA 1IX6A 1WYUB 2JISA 4CVQA 1D7UA 2BI5A 3FVXA 3MAUA 3LG0A 1GDEA 3N0LA 3COGA 4GSAA 2XH1A 5F8VA 1GBNA 3NUIA 2O1BA 2DR1A 1OHYA 2D7ZA 2FNIA 3JWBA 3MADA 4IYOB 3H7FA 3FQ8A 4F5GA 1AKAA 2EPJA 2W7FA 3FQ7A 4WYFA 2D64A 2C0RA 1Y4IA 4W91A 4GE7A 1M0OA 9AATA 1AMQA 4AOAA 1G4VA 3NYSA 4WXGA 1SFFA 1MAQA 1VP4A 3FDBA 4ITGA 3WX9A 2XBNA 3H14A 1BJNA 5TF5A 2CINA 4WYAA 2C44A 2OGEA 2QB3A 3AENB 2RFVA 3EIAA 5G2QA 4WP0A 2VGUA 1Z3ZA 1AMAA 2BI2A 1IX7A 2JJGA 1C7NA 3CBFA 3FSLA 4LNMA 3W1JA 2NMPA 2W7DA 5D5SA 4A0GA 1QJ3A 1QIRA 2R5CB 1BQDA 1TASA 4ADEA 4ADDA 3FFHA 1SZSA 3ACZA 3LY1A 1WYVB 3MAFA 3RUYA 3UAKA 2YRRA 2VLFA 1LC7A 3KGXA 4O6ZA 4Q6RA 3AEPA 3EI6A 2ZSLA 2VGVA 4Y0DA 4GEBA 3DRDA 2VIAA 3CQ6A 3BWNA 3DU4A 2CTZA 1BJOA 1J32A 7AATA 1QZ9A 3ZRQA 4XJMA 3LVKA 2CSTA 2WKAA 2Z1ZA 3GZCA 3HBXA 2FNUA 2OKKA 1QGNA 4FFCA 3TATA 4CBSA 4BA5A 2Z9WA 1MGVA 2R5EA 2F8JA 3VAXA 1RVYA 3IHJA 4CBRA 1ASEA 1N31A 2CH1A 2O7CA 4XJPA 1P3WA 3LVJA 1G4XA 3HQTA 1G7XA 1V72A 2DKBA 1M4NA 4M2JA 1W23A 3JU7A 1S06A 3FD0A 5E5IA 2D63A 1SZKA 1TATA 4GE9A 1LW4A 1YIZA 1M6SA 2ZUKA 2AY1A 2EZ1A 3RCHA 4MKJA 3WKSA 3MC6A 3P6KA 1G7WA 2QMAA 1ASNA 4F5HA 2HUIA 1GC2A 2Z9XA 4WXFA 2BI9A 1IUGA 5G4JA 1EQBA 1I29A 4AO9A 4NOGA 4GE4A 4ATPA 1UU2A 5C6UA 2C81A 3ECDA 3N75A 5KTBA 3N4XA 4MQRA 2WK9A 2BHXA 1ASBA 3ZRRA 4LW2A 3G8MA 2OGAA 3EUCA 2EYQA 1OXOA 3PGYA 2QSRA 1YIYA 2AY7A 2X8UA 3E77A 3R4TA 2W7EA 4RKDA 3FTBA 1O62A 3PIUA 2VIBA 1ARSA 2ZY3A 1WSTA 3ZZKA 4E3RA 3WCNA 1B5PA 1EJIA 3DR4A 4OMAA 4A6TA 3BCBA 1DJ9A 4PFNA 4ZDOA 2O0RA 4ATQA 1PMMA 3VK4A 2D66A 1B5OA 1JS6A 3A9YA 4ZLVA 5D95A 2ZY4A 3PJ0A 3LVMA 3L44A 2FM1A 1UU0A 1H1CA 4A6RA 3MAFB 2ORDA 4K2IA 3K7YA 1T3IA 4JEWA 4TV7A 2WK7A 2CY8A 1AY8A 3TCMA 3BN1A 1B9HA 3I5TA 1BJ4A 4JE5A 4KAMA 3E2ZA 4ISYA 1BJOB 4F5IA 5EUDA 1ASMA 2EZ2A 1C7GA 2GMSA 2VLHA 2YCTA 2EGYA 3KE3A 1KL2A 2YRIA 4OBUA 4GDYA 2Z1YA 1KL1A 1V2DA 4W8IA 5M4DA 2Q7WA 3AEOA 3MEBA 1AJSA 3BWOA 4JEZA 2W7JA 4N0BA 3P1TA 3NRAA 1BW0A 1ASGA 2BYLA 3OKSA 3PAAA 5E4ZA 3BCAA 2VGWA 1TOJA 2R2NA 1MDXA 4F5JA 3E6GA 4RAEA 1WKHA 1ARIA 2ZYJA 5M46A 3FRKA 2DKJA 2Z20A 3EI9A 3RCHB 4IXSA 2V0YA 4ITXA 1M0PA 4AO4A 1GCKA 2JJHA 4K2MA 5M4BA 2PB2A 3PA9A 4OT8A 4M2KA 1LK9A 1LS3A 1IBJA 4ZM3A 2AY2A 4JEYA 3BWNC 4HF8A 5DB5A 2JJEA 5DJ9A 3E9KA 1Z7DA 1GD9A 1GEYA 2VYCA 3GSBA 4XJOA 1X2AA 4MQQA 2G7JA 2X5DA 2PB0A 3A9XA 3F9TA 2VMWA 3N5MA 2BIGA 2VI8A 4N0WA 1PG8A 2VMPA 4ZM4A 2VMUA 1ELQA 2FN6A 4P7YA 4WLHA 4WYGA 3GWPA 5FT6A 5BJ3A 2CH2A 4BMKA 8AATA 3H9XA 4RM1A 5BJ4A 1TPLA 1IJIA 2FYFA 3ELEA 3FZ7A 4IW7A 5EUEA 1ZC9A 4P3MA 1MLYA 2W7GA 4B9BA 4EU1A 2VMNA 2GQNA 2YCPA 5EFSA 1RV3A 3FZ8A 3K40A 2YKVA 5HDMA 3EI8A 2W7IA 4A0RA 1ASLA 4DQ6A 2HZPA 3WKRA 1WKGA 2VMXA 1ARGA 3NUBA 1J04A 1AX4A 1AICA 3I4JA 4AZJA 3DXVA 2R0TA 3HVYA 4UHMA 2BI3A 1AY5A 3BS8A 1CQ6A 2QB2A 2CANA 1BJWA 4IX8A 2AY6A 1D7VA 2OQXA 4RJYA 4EFFA 3EZ1A 3W1IA 2CFBA 1D2FA 2X5FA 3E2ZB 1OHVA 3I16A 4Q76A 4OTLA 4OBVA 4BA4A 2D61A 4E3QA 1AMSA 1BQAA 1YJSA 1KAFA 3EZSA 3WY7A 1SZUA 2ZY5A 4FL0A 3FDDA 5EUNA 2YKUA 1AHYA 1I48A 1DGDA 3FKDA 3PDBB 3AATA 1AJSB 1TOIA 2WK8A 2ZY2A 1MLZA 1W7NA 4RITA 4ADCA 2ZJGA 2OKJA 3A8UX 4PVFA 1TOEA 2CJHA 3AV7A 3GZDC 4OC9A 2BWPA 1MAPA 4PIWA 4WYEA 3UWCA 4UHOA 1S07A 4A0FA 4F5MA 4JE5D 1LW5A 4IXOA 4JF1A 5EAAA 2VMOA 2D7YA 1DTYA 2JJFA 2HP1A 3NU8A 1IAXA 3ZRPA 3A9ZA 2VMVA 3N4SA 1IVRA 1RVUA 4J8LA 1ASFA 4R5ZA 4TMRA 4EB5A 4A6UA 1VEFA 4JF0A 2YOBA 5HXXA 1C9CA 5DX5A 1KKPA 3OP7A 3PDXA 1VJOA 3AEMC 3FCRA 1ECXA 1DFOA 2AY3A 4W1WA 1OHWA 1YAAA 4IXZA 4HVKA 4U2HA 1W7LA 1QITA 1YJZA 2E54A 3NU7A 2HUFA 4DGTA 1B9IA 1FG7A 2CJGA 2BWNA 4KYOA 1AHXA 3TFUA 3QHXA 1I43A 1CS1A 4WD2A 1GEXA 1OXPA 3NYUA 2BI1A 1ORDA 2E7JA 1M32A 1MDOA 2PO3A 1D7SA 1CL2A 3E2FA 1X28A 4OCAA 4DBCA 4L0OA 3NNKA 3PD6A 5JAYA 1X29A 3FFRA 3BCXA 2X3LA 3RI6A 1N8PA 2W8WA 3B1EA 2VMYA 3FQAA 3K28A 4LW4A 4ZDLA 5AX8A 2YCNA 2Z67A 3G0TA 2GMUA 3DC1A 2YKYA 3QBOA 1C0NA 1ARTA 3VK2A 4W1XA 2VGSA 2D5YA 1C7OA 3E2YA 4MY5A 1QISA 2HOXA 2Z61A 5K8BA 2ZP7A 3B1CA 4Q75A 4LC3A 1WYTA 2W7KA 2WB6A 1DJUA 1YNUA 2V1PA 3WZFA 1V2FA 3B46A 3EI5A 3QN6A 3BC8A 1S08A 5DJ1A 4H51A 3VP6A 3HT4A 2HOYA 4JEVA 4LNLA 2VMSA 2DOUA 1TARA 4R2NA 3N4RA 3M5UA 2AY9A 5G09A 2W7HA 3IF2A 1W3UA 1X0MA 1AHEA
chains in the Genus database with same CATH topology
4F5FA 2AEVA 5FT8A 4RJ0A 1FC4A 1M0NA 4M2MA 1ASCA 1AY4A 4E77A 3JWAA 3AEJA 4ZWVA 4Q31A 3AELA 1C4KA 2EO5A 2Z9VA 1CJ0A 2W8UA 3DXWA 3VOMA 4A00A 3FVSA 4ZSWA 1GEWA 3B1DA 4RKCA 2BIAA 3NDNA 1D7RA 2BWOA 3AOWA 1S09A 1TOKA 5EAVA 2VMZA 4F5KA 2TPLA 4QGRA 3W1HA 4B98A 4UQVA 3QGUA 4WXBA 1BKGA 5G4IA 1B8GA 3HMUA 1ASAA 3MC6C 2HUUA 4XK1A 2CB1A 3JZLA 4ADBA 3UE8A 3LV2A 3TFTA 1M7YA 1RV4A 2HORA 4ZASA 1H0CA 5FT4A 5J8QA 1AMRA 1AHGA 2AY8A 2QA3A 3PPLA 1ELUA 1QJ5A 2DGMA 1LKCA 1CQ8A 1AJRA 3G7QA 4Y0HA 1AKBA 3ELPA 3NTJA 3F6TA 1EG5A 3DR7A 1AKCA 2BKWA 3FZ6A 3PD6B 4ZDPA 2FKIA 1CL1A 5IWQA 3VK3A 5F9SA 3JTXA 1BT4A 2E7IA 1UKJA 2VMTA 3NX3A 1O69A 5FT5A 1ZODA 1GC3A 2BIEA 4WB0A 1TOGA 3B8XA 3CQ4A 1IX8A 4XAUA 2VI9A 4XJLA 2VGZA 2W8TA 3R9AA 4BHDA 4J5UA 5EQCA 2W8VA 3WGCA 3QI6A 1YJYA 2DGKA 3HDOA 4E1OA 2W7LA 2DGLA 3GR9A 3L8AA 1WYTB 1B4XA 4GRXA 2ZC0A 3DYDA 5LH9A 4JEXA 1YOOA 1LC8A 4A0HA 3EIBA 3FVUA 4OYTA 4UOYA 5LHAA 5G0AA 1CQ7A 2ZSMA 1W7MA 4F5LA 1JF9A 4EB7A 2E7UA 2AATA 4MKKA 3TQXA 1ZOBA 5G2PA 1AAMA 2A1VA 1KKJA 1JS3A 3ASAA 1IAYA 5EIGA 1AIBA 3NYTA 4MGRA 1WYUA 3GETA 1SVVA 2FQ6A 3HL2A 3QM2A 2W7MA 1N2TA 2W8JA 4TN4A 3USFA 2EH6A 1AIAA 3GJUA 2D65A 3MBBA 5M49A 4IYOA 2Z9UA 4MQPA 4RIZA 4R8DA 5E3KA 3WGBA 3ZZJA 3GBXA 1FG3A 4CXRA 4XEWA 1DJEA 4AH3A 1LC5A 3EI7A 3BB8A 4EMYA 4A72A 1E5EA 1O4SA 3AOVA 4WYDA 1BS0A 3BV0A 1S0AA 3ASBA 1O61A 4K2BA 4UHNA 2QLRA 3LVLB 1DKAA 3WLXA 1SPAA 3AENA 1DGEA 3DZZA 4AZKA 3KGWA 1CZEA 1ARHA 1XEYA 4I8AA 3CAIA 4CXQA 2OATA 1MDZA 3MKJA 4ZSYA 3QPGA 2BYJA 3AEJC 3II0A 3RBLA 2R5CA 1OATA 3ATHA 1GC4A 2HP2A 1V2EA 1KMKA 1WYVA 2VGTA 2GB3A 4R5FA 4U1TA 4W1VA 4BQ0A 4W5KA 1PMOA 5HHYA 3HLMA 1M0QA 1E5FA 2KFPA 3GZDA 4F4EA 3D6KA 3Q8NA 4WLJA 4K05A 4IY7A 2AY4A 4PFFA 2CJDA 2QBTA 1ASDA 1UU1A 4ZWMA 4WB0B 2C7TA 3WCOA 4LNJA 1XI9A 4XQ2A 4ZAHA 2AY5A 4MSOA 2VMQA 1SF2A 2YHKA 1U08A 3RQ1A 1I41A 4WBTA 3DODA 4KXKA 3F0HA 4H63Q 3LWSA 4WYCA 2JGTA 2G6WA 3PDBA 1AAWA 2JG2A 3CQ5A 3ISLA 3AEMA 3N7NA 3RBFA 2GSAA 1PFFA 3T32A 2YKXA 3A2BA 3JW9A 2HOZA 1AHFA 1CZCA 1GC0A 2VMRA 1KMJA 5I92A 1JG8A 4Y0IA 2AEUA 5EIGB 3KKIA 4RLGA 1IX6A 1WYUB 2JISA 4CVQA 1D7UA 2BI5A 3FVXA 3MAUA 3LG0A 1GDEA 3N0LA 3COGA 4GSAA 2XH1A 5F8VA 1GBNA 3NUIA 2O1BA 2DR1A 1OHYA 2D7ZA 2FNIA 3JWBA 3MADA 4IYOB 3H7FA 3FQ8A 4F5GA 1AKAA 2EPJA 2W7FA 3FQ7A 4WYFA 2D64A 2C0RA 1Y4IA 4W91A 4GE7A 1M0OA 9AATA 1AMQA 4AOAA 1G4VA 3NYSA 4WXGA 1SFFA 1MAQA 1VP4A 3FDBA 4ITGA 3WX9A 2XBNA 3H14A 1BJNA 5TF5A 2CINA 4WYAA 2C44A 2OGEA 2QB3A 3AENB 2RFVA 3EIAA 5G2QA 4WP0A 2VGUA 1Z3ZA 1AMAA 2BI2A 1IX7A 2JJGA 1C7NA 3CBFA 3FSLA 4LNMA 3W1JA 2NMPA 2W7DA 5D5SA 4A0GA 1QJ3A 1QIRA 2R5CB 1BQDA 1TASA 4ADEA 4ADDA 3FFHA 1SZSA 3ACZA 3LY1A 1WYVB 3MAFA 3RUYA 3UAKA 2YRRA 2VLFA 1LC7A 3KGXA 4O6ZA 4Q6RA 3AEPA 3EI6A 2ZSLA 2VGVA 4Y0DA 4GEBA 3DRDA 2VIAA 3CQ6A 3BWNA 3DU4A 2CTZA 1BJOA 1J32A 7AATA 1QZ9A 3ZRQA 4XJMA 3LVKA 2CSTA 2WKAA 2Z1ZA 3GZCA 3HBXA 2FNUA 2OKKA 1QGNA 4FFCA 3TATA 4CBSA 4BA5A 2Z9WA 1MGVA 2R5EA 2F8JA 3VAXA 1RVYA 3IHJA 4CBRA 1ASEA 1N31A 2CH1A 2O7CA 4XJPA 1P3WA 3LVJA 1G4XA 3HQTA 1G7XA 1V72A 2DKBA 1M4NA 4M2JA 1W23A 3JU7A 1S06A 3FD0A 5E5IA 2D63A 1SZKA 1TATA 4GE9A 1LW4A 1YIZA 1M6SA 2ZUKA 2AY1A 2EZ1A 3RCHA 4MKJA 3WKSA 3MC6A 3P6KA 1G7WA 2QMAA 1ASNA 4F5HA 2HUIA 1GC2A 2Z9XA 4WXFA 2BI9A 1IUGA 5G4JA 1EQBA 1I29A 4AO9A 4NOGA 4GE4A 4ATPA 1UU2A 5C6UA 2C81A 3ECDA 3N75A 5KTBA 3N4XA 4MQRA 2WK9A 2BHXA 1ASBA 3ZRRA 4LW2A 3G8MA 2OGAA 3EUCA 2EYQA 1OXOA 3PGYA 2QSRA 1YIYA 2AY7A 2X8UA 3E77A 3R4TA 2W7EA 4RKDA 3FTBA 1O62A 3PIUA 2VIBA 1ARSA 2ZY3A 1WSTA 3ZZKA 4E3RA 3WCNA 1B5PA 1EJIA 3DR4A 4OMAA 4A6TA 3BCBA 1DJ9A 4PFNA 4ZDOA 2O0RA 4ATQA 1PMMA 3VK4A 2D66A 1B5OA 1JS6A 3A9YA 4ZLVA 5D95A 2ZY4A 3PJ0A 3LVMA 3L44A 2FM1A 1UU0A 1H1CA 4A6RA 3MAFB 2ORDA 4K2IA 3K7YA 1T3IA 4JEWA 4TV7A 2WK7A 2CY8A 1AY8A 3TCMA 3BN1A 1B9HA 3I5TA 1BJ4A 4JE5A 4KAMA 3E2ZA 4ISYA 1BJOB 4F5IA 5EUDA 1ASMA 2EZ2A 1C7GA 2GMSA 2VLHA 2YCTA 2EGYA 3KE3A 1KL2A 2YRIA 4OBUA 4GDYA 2Z1YA 1KL1A 1V2DA 4W8IA 5M4DA 2Q7WA 3AEOA 3MEBA 1AJSA 3BWOA 4JEZA 2W7JA 4N0BA 3P1TA 3NRAA 1BW0A 1ASGA 2BYLA 3OKSA 3PAAA 5E4ZA 3BCAA 2VGWA 1TOJA 2R2NA 1MDXA 4F5JA 3E6GA 4RAEA 1WKHA 1ARIA 2ZYJA 5M46A 3FRKA 2DKJA 2Z20A 3EI9A 3RCHB 4IXSA 2V0YA 4ITXA 1M0PA 4AO4A 1GCKA 2JJHA 4K2MA 5M4BA 2PB2A 3PA9A 4OT8A 4M2KA 1LK9A 1LS3A 1IBJA 4ZM3A 2AY2A 4JEYA 3BWNC 4HF8A 5DB5A 2JJEA 5DJ9A 3E9KA 1Z7DA 1GD9A 1GEYA 2VYCA 3GSBA 4XJOA 1X2AA 4MQQA 2G7JA 2X5DA 2PB0A 3A9XA 3F9TA 2VMWA 3N5MA 2BIGA 2VI8A 4N0WA 1PG8A 2VMPA 4ZM4A 2VMUA 1ELQA 2FN6A 4P7YA 4WLHA 4WYGA 3GWPA 5FT6A 5BJ3A 2CH2A 4BMKA 8AATA 3H9XA 4RM1A 5BJ4A 1TPLA 1IJIA 2FYFA 3ELEA 3FZ7A 4IW7A 5EUEA 1ZC9A 4P3MA 1MLYA 2W7GA 4B9BA 4EU1A 2VMNA 2GQNA 2YCPA 5EFSA 1RV3A 3FZ8A 3K40A 2YKVA 5HDMA 3EI8A 2W7IA 4A0RA 1ASLA 4DQ6A 2HZPA 3WKRA 1WKGA 2VMXA 1ARGA 3NUBA 1J04A 1AX4A 1AICA 3I4JA 4AZJA 3DXVA 2R0TA 3HVYA 4UHMA 2BI3A 1AY5A 3BS8A 1CQ6A 2QB2A 2CANA 1BJWA 4IX8A 2AY6A 1D7VA 2OQXA 4RJYA 4EFFA 3EZ1A 3W1IA 2CFBA 1D2FA 2X5FA 3E2ZB 1OHVA 3I16A 4Q76A 4OTLA 4OBVA 4BA4A 2D61A 4E3QA 1AMSA 1BQAA 1YJSA 3EZSA 3WY7A 1SZUA 2ZY5A 4FL0A 3FDDA 5EUNA 2YKUA 1AHYA 1I48A 1DGDA 3FKDA 3PDBB 3AATA 1AJSB 1TOIA 2WK8A 2ZY2A 1MLZA 1W7NA 4RITA 4ADCA 2ZJGA 2OKJA 3A8UX 4PVFA 1TOEA 2CJHA 3AV7A 3GZDC 4OC9A 2BWPA 1MAPA 4PIWA 4WYEA 3UWCA 4UHOA 1S07A 4A0FA 4F5MA 4JE5D 1LW5A 4IXOA 4JF1A 5EAAA 2VMOA 2D7YA 1DTYA 2JJFA 2HP1A 3NU8A 1IAXA 3ZRPA 3A9ZA 2VMVA 3N4SA 1IVRA 1RVUA 4J8LA 1ASFA 4R5ZA 4TMRA 4EB5A 4A6UA 1VEFA 4JF0A 2YOBA 5HXXA 1C9CA 5DX5A 1KKPA 3OP7A 3PDXA 1VJOA 3AEMC 3FCRA 1ECXA 1DFOA 2AY3A 4W1WA 1OHWA 1YAAA 4IXZA 4HVKA 4U2HA 1W7LA 1QITA 1YJZA 2E54A 3NU7A 2HUFA 4DGTA 1B9IA 1FG7A 2CJGA 2BWNA 4KYOA 1AHXA 3TFUA 3QHXA 1I43A 1CS1A 4WD2A 1GEXA 1OXPA 3NYUA 2BI1A 1ORDA 2E7JA 1M32A 1MDOA 2PO3A 1D7SA 1CL2A 3E2FA 1X28A 4OCAA 4DBCA 4L0OA 3NNKA 3PD6A 5JAYA 1X29A 3FFRA 3BCXA 2X3LA 3RI6A 1N8PA 2W8WA 3B1EA 2VMYA 3FQAA 3K28A 4LW4A 4ZDLA 5AX8A 2YCNA 2Z67A 3G0TA 2GMUA 3DC1A 2YKYA 3QBOA 1C0NA 1ARTA 3VK2A 4W1XA 2VGSA 2D5YA 1C7OA 3E2YA 4MY5A 1QISA 2HOXA 2Z61A 5K8BA 2ZP7A 3B1CA 4Q75A 4LC3A 1WYTA 2W7KA 2WB6A 1DJUA 1YNUA 2V1PA 3WZFA 1V2FA 3B46A 3EI5A 3QN6A 3BC8A 1S08A 5DJ1A 4H51A 3VP6A 3HT4A 2HOYA 4JEVA 4LNLA 2VMSA 2DOUA 1TARA 4R2NA 3N4RA 3M5UA 2AY9A 5G09A 2W7HA 3IF2A 1W3UA 1X0MA 1AHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F5F A;  2AEV A;  5FT8 A;  4RJ0 A;  1FC4 A;  1M0N A;  4M2M A;  1ASC A;  1AY4 A;  4E77 A;  3JWA A;  3AEJ A;  4ZWV A;  4Q31 A;  3AEL A;  1C4K A;  2EO5 A;  2Z9V A;  1CJ0 A;  2W8U A;  3DXW A;  3VOM A;  4A00 A;  3FVS A;  4ZSW A;  1GEW A;  3B1D A;  4RKC A;  2BIA A;  3NDN A;  1D7R A;  2BWO A;  3AOW A;  1S09 A;  1TOK A;  5EAV A;  2VMZ A;  4F5K A;  2TPL A;  4QGR A;  3W1H A;  4B98 A;  4UQV A;  3QGU A;  4WXB A;  1BKG A;  5G4I A;  1B8G A;  3HMU A;  1ASA A;  3MC6 C;  2HUU A;  4XK1 A;  2CB1 A;  3JZL A;  4ADB A;  3UE8 A;  3LV2 A;  3TFT A;  1M7Y A;  1RV4 A;  2HOR A;  4ZAS A;  1H0C A;  5FT4 A;  5J8Q A;  1AMR A;  1AHG A;  2AY8 A;  2QA3 A;  3PPL A;  1ELU A;  1QJ5 A;  2DGM A;  1LKC A;  1CQ8 A;  1AJR A;  3G7Q A;  4Y0H A;  1AKB A;  3ELP A;  3NTJ A;  3F6T A;  1EG5 A;  3DR7 A;  1AKC A;  2BKW A;  3FZ6 A;  3PD6 B;  4ZDP A;  1CL1 A;  5IWQ A;  3VK3 A;  5F9S A;  3JTX A;  1BT4 A;  2E7I A;  1UKJ A;  2VMT A;  3NX3 A;  1O69 A;  5FT5 A;  1ZOD A;  1GC3 A;  2BIE A;  4WB0 A;  1TOG A;  3B8X A;  3CQ4 A;  1IX8 A;  4XAU A;  2VI9 A;  4XJL A;  2VGZ A;  2W8T A;  3R9A A;  4BHD A;  4J5U A;  5EQC A;  2W8V A;  3WGC A;  3QI6 A;  1YJY A;  2DGK A;  3HDO A;  4E1O A;  2W7L A;  2DGL A;  3GR9 A;  3L8A A;  1WYT B;  1B4X A;  4GRX A;  2ZC0 A;  3DYD A;  5LH9 A;  4JEX A;  1YOO A;  1LC8 A;  4A0H A;  3EIB A;  3FVU A;  4OYT A;  4UOY A;  5LHA A;  5G0A A;  1CQ7 A;  2ZSM A;  1W7M A;  4F5L A;  1JF9 A;  4EB7 A;  2E7U A;  2AAT A;  4MKK A;  3TQX A;  1ZOB A;  5G2P A;  1AAM A;  1KKJ A;  1JS3 A;  3ASA A;  1IAY A;  5EIG A;  1AIB A;  3NYT A;  4MGR A;  1WYU A;  3GET A;  1SVV A;  2FQ6 A;  3HL2 A;  3QM2 A;  2W7M A;  1N2T A;  2W8J A;  4TN4 A;  3USF A;  2EH6 A;  1AIA A;  3GJU A;  2D65 A;  3MBB A;  5M49 A;  4IYO A;  2Z9U A;  4MQP A;  4RIZ A;  4R8D A;  5E3K A;  3WGB A;  3ZZJ A;  3GBX A;  1FG3 A;  4CXR A;  4XEW A;  1DJE A;  4AH3 A;  1LC5 A;  3EI7 A;  3BB8 A;  4EMY A;  4A72 A;  1E5E A;  1O4S A;  3AOV A;  4WYD A;  1BS0 A;  3BV0 A;  1S0A A;  3ASB A;  1O61 A;  4K2B A;  4UHN A;  2QLR A;  3LVL B;  1DKA A;  3WLX A;  1SPA A;  3AEN A;  1DGE A;  3DZZ A;  4AZK A;  3KGW A;  1CZE A;  1ARH A;  1XEY A;  4I8A A;  3CAI A;  4CXQ A;  2OAT A;  1MDZ A;  3MKJ A;  4ZSY A;  3QPG A;  2BYJ A;  3AEJ C;  3II0 A;  3RBL A;  2R5C A;  1OAT A;  3ATH A;  1GC4 A;  2HP2 A;  1V2E A;  1KMK A;  1WYV A;  2VGT A;  2GB3 A;  4R5F A;  4U1T A;  4W1V A;  4BQ0 A;  4W5K A;  1PMO A;  5HHY A;  3HLM A;  1M0Q A;  1E5F A;  3GZD A;  4F4E A;  3D6K A;  3Q8N A;  4WLJ A;  4IY7 A;  2AY4 A;  4PFF A;  2CJD A;  2QBT A;  1ASD A;  1UU1 A;  4ZWM A;  4WB0 B;  2C7T A;  3WCO A;  4LNJ A;  1XI9 A;  4XQ2 A;  4ZAH A;  2AY5 A;  4MSO A;  2VMQ A;  1SF2 A;  2YHK A;  1U08 A;  3RQ1 A;  1I41 A;  4WBT A;  3DOD A;  4KXK A;  3F0H A;  3LWS A;  4WYC A;  2JGT A;  2G6W A;  3PDB A;  1AAW A;  2JG2 A;  3CQ5 A;  3ISL A;  3AEM A;  3RBF A;  2GSA A;  1PFF A;  3T32 A;  2YKX A;  3A2B A;  3JW9 A;  2HOZ A;  1AHF A;  1CZC A;  1GC0 A;  2VMR A;  1KMJ A;  5I92 A;  1JG8 A;  4Y0I A;  2AEU A;  5EIG B;  3KKI A;  4RLG A;  1IX6 A;  1WYU B;  2JIS A;  4CVQ A;  1D7U A;  2BI5 A;  3FVX A;  3MAU A;  3LG0 A;  1GDE A;  3N0L A;  3COG A;  4GSA A;  2XH1 A;  5F8V A;  1GBN A;  3NUI A;  2O1B A;  2DR1 A;  1OHY A;  2D7Z A;  2FNI A;  3JWB A;  3MAD A;  4IYO B;  3H7F A;  3FQ8 A;  4F5G A;  1AKA A;  2EPJ A;  2W7F A;  3FQ7 A;  4WYF A;  2D64 A;  2C0R A;  1Y4I A;  4W91 A;  4GE7 A;  1M0O A;  9AAT A;  1AMQ A;  4AOA A;  1G4V A;  3NYS A;  4WXG A;  1SFF A;  1MAQ A;  1VP4 A;  3FDB A;  4ITG A;  3WX9 A;  2XBN A;  3H14 A;  1BJN A;  5TF5 A;  2CIN A;  4WYA A;  2C44 A;  2OGE A;  2QB3 A;  3AEN B;  2RFV A;  3EIA A;  5G2Q A;  4WP0 A;  2VGU A;  1Z3Z A;  1AMA A;  2BI2 A;  1IX7 A;  2JJG A;  1C7N A;  3CBF A;  3FSL A;  4LNM A;  3W1J A;  2NMP A;  2W7D A;  5D5S A;  4A0G A;  1QJ3 A;  1QIR A;  2R5C B;  1BQD A;  1TAS A;  4ADE A;  4ADD A;  3FFH A;  1SZS A;  3ACZ A;  3LY1 A;  1WYV B;  3MAF A;  3RUY A;  3UAK A;  2YRR A;  2VLF A;  1LC7 A;  3KGX A;  4O6Z A;  4Q6R A;  3AEP A;  3EI6 A;  2ZSL A;  2VGV A;  4Y0D A;  4GEB A;  3DRD A;  2VIA A;  3CQ6 A;  3BWN A;  3DU4 A;  2CTZ A;  1BJO A;  1J32 A;  7AAT A;  1QZ9 A;  3ZRQ A;  4XJM A;  3LVK A;  2CST A;  2WKA A;  2Z1Z A;  3GZC A;  3HBX A;  2FNU A;  2OKK A;  1QGN A;  4FFC A;  3TAT A;  4CBS A;  4BA5 A;  2Z9W A;  1MGV A;  2R5E A;  2F8J A;  3VAX A;  1RVY A;  3IHJ A;  4CBR A;  1ASE A;  1N31 A;  2CH1 A;  2O7C A;  4XJP A;  1P3W A;  3LVJ A;  1G4X A;  3HQT A;  1G7X A;  1V72 A;  2DKB A;  1M4N A;  4M2J A;  1W23 A;  3JU7 A;  1S06 A;  3FD0 A;  5E5I A;  2D63 A;  1SZK A;  1TAT A;  4GE9 A;  1LW4 A;  1YIZ A;  1M6S A;  2ZUK A;  2AY1 A;  2EZ1 A;  3RCH A;  4MKJ A;  3WKS A;  3MC6 A;  3P6K A;  1G7W A;  2QMA A;  1ASN A;  4F5H A;  2HUI A;  1GC2 A;  2Z9X A;  4WXF A;  2BI9 A;  1IUG A;  5G4J A;  1EQB A;  1I29 A;  4AO9 A;  4NOG A;  4GE4 A;  4ATP A;  1UU2 A;  5C6U A;  2C81 A;  3ECD A;  3N75 A;  4MQR A;  2WK9 A;  2BHX A;  1ASB A;  3ZRR A;  4LW2 A;  3G8M A;  2OGA A;  3EUC A;  1OXO A;  3PGY A;  1YIY A;  2AY7 A;  2X8U A;  3E77 A;  3R4T A;  2W7E A;  4RKD A;  3FTB A;  1O62 A;  3PIU A;  2VIB A;  1ARS A;  2ZY3 A;  1WST A;  3ZZK A;  4E3R A;  3WCN A;  1B5P A;  1EJI A;  3DR4 A;  4OMA A;  4A6T A;  3BCB A;  1DJ9 A;  4PFN A;  4ZDO A;  2O0R A;  4ATQ A;  1PMM A;  3VK4 A;  2D66 A;  1B5O A;  1JS6 A;  3A9Y A;  4ZLV A;  5D95 A;  2ZY4 A;  3PJ0 A;  3LVM A;  3L44 A;  2FM1 A;  1UU0 A;  1H1C A;  4A6R A;  3MAF B;  2ORD A;  4K2I A;  3K7Y A;  1T3I A;  4JEW A;  4TV7 A;  2WK7 A;  2CY8 A;  1AY8 A;  3TCM A;  3BN1 A;  1B9H A;  3I5T A;  1BJ4 A;  4JE5 A;  4KAM A;  3E2Z A;  4ISY A;  1BJO B;  4F5I A;  5EUD A;  1ASM A;  2EZ2 A;  1C7G A;  2GMS A;  2VLH A;  2YCT A;  2EGY A;  3KE3 A;  1KL2 A;  2YRI A;  4OBU A;  4GDY A;  2Z1Y A;  1KL1 A;  1V2D A;  4W8I A;  5M4D A;  2Q7W A;  3AEO A;  3MEB A;  1AJS A;  3BWO A;  4JEZ A;  2W7J A;  4N0B A;  3P1T A;  3NRA A;  1BW0 A;  1ASG A;  2BYL A;  3OKS A;  3PAA A;  5E4Z A;  3BCA A;  2VGW A;  1TOJ A;  2R2N A;  1MDX A;  4F5J A;  3E6G A;  4RAE A;  1WKH A;  1ARI A;  2ZYJ A;  5M46 A;  3FRK A;  2DKJ A;  2Z20 A;  3EI9 A;  3RCH B;  4IXS A;  2V0Y A;  4ITX A;  1M0P A;  4AO4 A;  1GCK A;  2JJH A;  4K2M A;  5M4B A;  2PB2 A;  3PA9 A;  4OT8 A;  4M2K A;  1LK9 A;  1LS3 A;  1IBJ A;  4ZM3 A;  2AY2 A;  4JEY A;  3BWN C;  4HF8 A;  5DB5 A;  2JJE A;  5DJ9 A;  3E9K A;  1Z7D A;  1GD9 A;  1GEY A;  2VYC A;  3GSB A;  4XJO A;  1X2A A;  4MQQ A;  2X5D A;  2PB0 A;  3A9X A;  3F9T A;  2VMW A;  3N5M A;  2BIG A;  2VI8 A;  4N0W A;  1PG8 A;  2VMP A;  4ZM4 A;  2VMU A;  1ELQ A;  2FN6 A;  4P7Y A;  4WLH A;  4WYG A;  3GWP A;  5FT6 A;  5BJ3 A;  2CH2 A;  4BMK A;  8AAT A;  4RM1 A;  5BJ4 A;  1TPL A;  1IJI A;  2FYF A;  3ELE A;  3FZ7 A;  4IW7 A;  5EUE A;  1ZC9 A;  4P3M A;  1MLY A;  2W7G A;  4B9B A;  4EU1 A;  2VMN A;  2GQN A;  2YCP A;  5EFS A;  1RV3 A;  3FZ8 A;  3K40 A;  2YKV A;  5HDM A;  3EI8 A;  2W7I A;  4A0R A;  1ASL A;  4DQ6 A;  2HZP A;  3WKR A;  1WKG A;  2VMX A;  1ARG A;  3NUB A;  1J04 A;  1AX4 A;  1AIC A;  3I4J A;  4AZJ A;  3DXV A;  2R0T A;  3HVY A;  4UHM A;  2BI3 A;  1AY5 A;  3BS8 A;  1CQ6 A;  2QB2 A;  2CAN A;  1BJW A;  4IX8 A;  2AY6 A;  1D7V A;  2OQX A;  4RJY A;  4EFF A;  3EZ1 A;  3W1I A;  2CFB A;  1D2F A;  2X5F A;  3E2Z B;  1OHV A;  3I16 A;  4Q76 A;  4OTL A;  4OBV A;  4BA4 A;  2D61 A;  4E3Q A;  1AMS A;  1BQA A;  1YJS A;  3EZS A;  3WY7 A;  1SZU A;  2ZY5 A;  4FL0 A;  3FDD A;  5EUN A;  2YKU A;  1AHY A;  1I48 A;  1DGD A;  3FKD A;  3PDB B;  3AAT A;  1AJS B;  1TOI A;  2WK8 A;  2ZY2 A;  1MLZ A;  1W7N A;  4RIT A;  4ADC A;  2ZJG A;  2OKJ A;  3A8U X;  4PVF A;  1TOE A;  2CJH A;  3AV7 A;  3GZD C;  4OC9 A;  2BWP A;  1MAP A;  4PIW A;  4WYE A;  3UWC A;  4UHO A;  1S07 A;  4A0F A;  4F5M A;  4JE5 D;  1LW5 A;  4IXO A;  4JF1 A;  5EAA A;  2VMO A;  2D7Y A;  1DTY A;  2JJF A;  2HP1 A;  3NU8 A;  1IAX A;  3ZRP A;  3A9Z A;  2VMV A;  1IVR A;  1RVU A;  4J8L A;  1ASF A;  4R5Z A;  4TMR A;  4EB5 A;  4A6U A;  1VEF A;  4JF0 A;  2YOB A;  5HXX A;  1C9C A;  5DX5 A;  1KKP A;  3OP7 A;  3PDX A;  1VJO A;  3AEM C;  3FCR A;  1ECX A;  1DFO A;  2AY3 A;  4W1W A;  1OHW A;  1YAA A;  4IXZ A;  4HVK A;  4U2H A;  1W7L A;  1QIT A;  1YJZ A;  2E54 A;  3NU7 A;  2HUF A;  4DGT A;  1B9I A;  1FG7 A;  2CJG A;  2BWN A;  4KYO A;  1AHX A;  3TFU A;  3QHX A;  1I43 A;  1CS1 A;  4WD2 A;  1GEX A;  1OXP A;  3NYU A;  2BI1 A;  1ORD A;  2E7J A;  1M32 A;  1MDO A;  2PO3 A;  1D7S A;  1CL2 A;  3E2F A;  1X28 A;  4OCA A;  4DBC A;  4L0O A;  3NNK A;  3PD6 A;  5JAY A;  1X29 A;  3FFR A;  3BCX A;  2X3L A;  3RI6 A;  1N8P A;  2W8W A;  3B1E A;  2VMY A;  3FQA A;  3K28 A;  4LW4 A;  4ZDL A;  5AX8 A;  2YCN A;  2Z67 A;  3G0T A;  2GMU A;  3DC1 A;  2YKY A;  3QBO A;  1C0N A;  1ART A;  3VK2 A;  4W1X A;  2VGS A;  2D5Y A;  1C7O A;  3E2Y A;  4MY5 A;  1QIS A;  2HOX A;  2Z61 A;  5K8B A;  2ZP7 A;  3B1C A;  4Q75 A;  4LC3 A;  1WYT A;  2W7K A;  1DJU A;  1YNU A;  2V1P A;  3WZF A;  1V2F A;  3B46 A;  3EI5 A;  3QN6 A;  3BC8 A;  1S08 A;  5DJ1 A;  4H51 A;  3VP6 A;  3HT4 A;  2HOY A;  4JEV A;  4LNL A;  2VMS A;  2DOU A;  1TAR A;  4R2N A;  3M5U A;  2AY9 A;  5G09 A;  2W7H A;  3IF2 A;  1W3U A;  1X0M A;  1AHE A; 
#chains in the Genus database with same CATH topology
 4F5F A;  2AEV A;  5FT8 A;  4RJ0 A;  1FC4 A;  1M0N A;  4M2M A;  1ASC A;  1AY4 A;  4E77 A;  3JWA A;  3AEJ A;  4ZWV A;  4Q31 A;  3AEL A;  1C4K A;  2EO5 A;  2Z9V A;  1CJ0 A;  2W8U A;  3DXW A;  3VOM A;  4A00 A;  3FVS A;  4ZSW A;  1GEW A;  3B1D A;  4RKC A;  2BIA A;  3NDN A;  1D7R A;  2BWO A;  3AOW A;  1S09 A;  1TOK A;  5EAV A;  2VMZ A;  4F5K A;  2TPL A;  4QGR A;  3W1H A;  4B98 A;  4UQV A;  3QGU A;  4WXB A;  1BKG A;  5G4I A;  1B8G A;  3HMU A;  1ASA A;  3MC6 C;  2HUU A;  4XK1 A;  2CB1 A;  3JZL A;  4ADB A;  3UE8 A;  3LV2 A;  3TFT A;  1M7Y A;  1RV4 A;  2HOR A;  4ZAS A;  1H0C A;  5FT4 A;  5J8Q A;  1AMR A;  1AHG A;  2AY8 A;  2QA3 A;  3PPL A;  1ELU A;  1QJ5 A;  2DGM A;  1LKC A;  1CQ8 A;  1AJR A;  3G7Q A;  4Y0H A;  1AKB A;  3ELP A;  3NTJ A;  3F6T A;  1EG5 A;  3DR7 A;  1AKC A;  2BKW A;  3FZ6 A;  3PD6 B;  4ZDP A;  2FKI A;  1CL1 A;  5IWQ A;  3VK3 A;  5F9S A;  3JTX A;  1BT4 A;  2E7I A;  1UKJ A;  2VMT A;  3NX3 A;  1O69 A;  5FT5 A;  1ZOD A;  1GC3 A;  2BIE A;  4WB0 A;  1TOG A;  3B8X A;  3CQ4 A;  1IX8 A;  4XAU A;  2VI9 A;  4XJL A;  2VGZ A;  2W8T A;  3R9A A;  4BHD A;  4J5U A;  5EQC A;  2W8V A;  3WGC A;  3QI6 A;  1YJY A;  2DGK A;  3HDO A;  4E1O A;  2W7L A;  2DGL A;  3GR9 A;  3L8A A;  1WYT B;  1B4X A;  4GRX A;  2ZC0 A;  3DYD A;  5LH9 A;  4JEX A;  1YOO A;  1LC8 A;  4A0H A;  3EIB A;  3FVU A;  4OYT A;  4UOY A;  5LHA A;  5G0A A;  1CQ7 A;  2ZSM A;  1W7M A;  4F5L A;  1JF9 A;  4EB7 A;  2E7U A;  2AAT A;  4MKK A;  3TQX A;  1ZOB A;  5G2P A;  1AAM A;  2A1V A;  1KKJ A;  1JS3 A;  3ASA A;  1IAY A;  5EIG A;  1AIB A;  3NYT A;  4MGR A;  1WYU A;  3GET A;  1SVV A;  2FQ6 A;  3HL2 A;  3QM2 A;  2W7M A;  1N2T A;  2W8J A;  4TN4 A;  3USF A;  2EH6 A;  1AIA A;  3GJU A;  2D65 A;  3MBB A;  5M49 A;  4IYO A;  2Z9U A;  4MQP A;  4RIZ A;  4R8D A;  5E3K A;  3WGB A;  3ZZJ A;  3GBX A;  1FG3 A;  4CXR A;  4XEW A;  1DJE A;  4AH3 A;  1LC5 A;  3EI7 A;  3BB8 A;  4EMY A;  4A72 A;  1E5E A;  1O4S A;  3AOV A;  4WYD A;  1BS0 A;  3BV0 A;  1S0A A;  3ASB A;  1O61 A;  4K2B A;  4UHN A;  2QLR A;  3LVL B;  1DKA A;  3WLX A;  1SPA A;  3AEN A;  1DGE A;  3DZZ A;  4AZK A;  3KGW A;  1CZE A;  1ARH A;  1XEY A;  4I8A A;  3CAI A;  4CXQ A;  2OAT A;  1MDZ A;  3MKJ A;  4ZSY A;  3QPG A;  2BYJ A;  3AEJ C;  3II0 A;  3RBL A;  2R5C A;  1OAT A;  3ATH A;  1GC4 A;  2HP2 A;  1V2E A;  1KMK A;  1WYV A;  2VGT A;  2GB3 A;  4R5F A;  4U1T A;  4W1V A;  4BQ0 A;  4W5K A;  1PMO A;  5HHY A;  3HLM A;  1M0Q A;  1E5F A;  2KFP A;  3GZD A;  4F4E A;  3D6K A;  3Q8N A;  4WLJ A;  4K05 A;  4IY7 A;  2AY4 A;  4PFF A;  2CJD A;  2QBT A;  1ASD A;  1UU1 A;  4ZWM A;  4WB0 B;  2C7T A;  3WCO A;  4LNJ A;  1XI9 A;  4XQ2 A;  4ZAH A;  2AY5 A;  4MSO A;  2VMQ A;  1SF2 A;  2YHK A;  1U08 A;  3RQ1 A;  1I41 A;  4WBT A;  3DOD A;  4KXK A;  3F0H A;  4H63 Q;  3LWS A;  4WYC A;  2JGT A;  2G6W A;  3PDB A;  1AAW A;  2JG2 A;  3CQ5 A;  3ISL A;  3AEM A;  3N7N A;  3RBF A;  2GSA A;  1PFF A;  3T32 A;  2YKX A;  3A2B A;  3JW9 A;  2HOZ A;  1AHF A;  1CZC A;  1GC0 A;  2VMR A;  1KMJ A;  5I92 A;  1JG8 A;  4Y0I A;  2AEU A;  5EIG B;  3KKI A;  4RLG A;  1IX6 A;  1WYU B;  2JIS A;  4CVQ A;  1D7U A;  2BI5 A;  3FVX A;  3MAU A;  3LG0 A;  1GDE A;  3N0L A;  3COG A;  4GSA A;  2XH1 A;  5F8V A;  1GBN A;  3NUI A;  2O1B A;  2DR1 A;  1OHY A;  2D7Z A;  2FNI A;  3JWB A;  3MAD A;  4IYO B;  3H7F A;  3FQ8 A;  4F5G A;  1AKA A;  2EPJ A;  2W7F A;  3FQ7 A;  4WYF A;  2D64 A;  2C0R A;  1Y4I A;  4W91 A;  4GE7 A;  1M0O A;  9AAT A;  1AMQ A;  4AOA A;  1G4V A;  3NYS A;  4WXG A;  1SFF A;  1MAQ A;  1VP4 A;  3FDB A;  4ITG A;  3WX9 A;  2XBN A;  3H14 A;  1BJN A;  5TF5 A;  2CIN A;  4WYA A;  2C44 A;  2OGE A;  2QB3 A;  3AEN B;  2RFV A;  3EIA A;  5G2Q A;  4WP0 A;  2VGU A;  1Z3Z A;  1AMA A;  2BI2 A;  1IX7 A;  2JJG A;  1C7N A;  3CBF A;  3FSL A;  4LNM A;  3W1J A;  2NMP A;  2W7D A;  5D5S A;  4A0G A;  1QJ3 A;  1QIR A;  2R5C B;  1BQD A;  1TAS A;  4ADE A;  4ADD A;  3FFH A;  1SZS A;  3ACZ A;  3LY1 A;  1WYV B;  3MAF A;  3RUY A;  3UAK A;  2YRR A;  2VLF A;  1LC7 A;  3KGX A;  4O6Z A;  4Q6R A;  3AEP A;  3EI6 A;  2ZSL A;  2VGV A;  4Y0D A;  4GEB A;  3DRD A;  2VIA A;  3CQ6 A;  3BWN A;  3DU4 A;  2CTZ A;  1BJO A;  1J32 A;  7AAT A;  1QZ9 A;  3ZRQ A;  4XJM A;  3LVK A;  2CST A;  2WKA A;  2Z1Z A;  3GZC A;  3HBX A;  2FNU A;  2OKK A;  1QGN A;  4FFC A;  3TAT A;  4CBS A;  4BA5 A;  2Z9W A;  1MGV A;  2R5E A;  2F8J A;  3VAX A;  1RVY A;  3IHJ A;  4CBR A;  1ASE A;  1N31 A;  2CH1 A;  2O7C A;  4XJP A;  1P3W A;  3LVJ A;  1G4X A;  3HQT A;  1G7X A;  1V72 A;  2DKB A;  1M4N A;  4M2J A;  1W23 A;  3JU7 A;  1S06 A;  3FD0 A;  5E5I A;  2D63 A;  1SZK A;  1TAT A;  4GE9 A;  1LW4 A;  1YIZ A;  1M6S A;  2ZUK A;  2AY1 A;  2EZ1 A;  3RCH A;  4MKJ A;  3WKS A;  3MC6 A;  3P6K A;  1G7W A;  2QMA A;  1ASN A;  4F5H A;  2HUI A;  1GC2 A;  2Z9X A;  4WXF A;  2BI9 A;  1IUG A;  5G4J A;  1EQB A;  1I29 A;  4AO9 A;  4NOG A;  4GE4 A;  4ATP A;  1UU2 A;  5C6U A;  2C81 A;  3ECD A;  3N75 A;  5KTB A;  3N4X A;  4MQR A;  2WK9 A;  2BHX A;  1ASB A;  3ZRR A;  4LW2 A;  3G8M A;  2OGA A;  3EUC A;  2EYQ A;  1OXO A;  3PGY A;  2QSR A;  1YIY A;  2AY7 A;  2X8U A;  3E77 A;  3R4T A;  2W7E A;  4RKD A;  3FTB A;  1O62 A;  3PIU A;  2VIB A;  1ARS A;  2ZY3 A;  1WST A;  3ZZK A;  4E3R A;  3WCN A;  1B5P A;  1EJI A;  3DR4 A;  4OMA A;  4A6T A;  3BCB A;  1DJ9 A;  4PFN A;  4ZDO A;  2O0R A;  4ATQ A;  1PMM A;  3VK4 A;  2D66 A;  1B5O A;  1JS6 A;  3A9Y A;  4ZLV A;  5D95 A;  2ZY4 A;  3PJ0 A;  3LVM A;  3L44 A;  2FM1 A;  1UU0 A;  1H1C A;  4A6R A;  3MAF B;  2ORD A;  4K2I A;  3K7Y A;  1T3I A;  4JEW A;  4TV7 A;  2WK7 A;  2CY8 A;  1AY8 A;  3TCM A;  3BN1 A;  1B9H A;  3I5T A;  1BJ4 A;  4JE5 A;  4KAM A;  3E2Z A;  4ISY A;  1BJO B;  4F5I A;  5EUD A;  1ASM A;  2EZ2 A;  1C7G A;  2GMS A;  2VLH A;  2YCT A;  2EGY A;  3KE3 A;  1KL2 A;  2YRI A;  4OBU A;  4GDY A;  2Z1Y A;  1KL1 A;  1V2D A;  4W8I A;  5M4D A;  2Q7W A;  3AEO A;  3MEB A;  1AJS A;  3BWO A;  4JEZ A;  2W7J A;  4N0B A;  3P1T A;  3NRA A;  1BW0 A;  1ASG A;  2BYL A;  3OKS A;  3PAA A;  5E4Z A;  3BCA A;  2VGW A;  1TOJ A;  2R2N A;  1MDX A;  4F5J A;  3E6G A;  4RAE A;  1WKH A;  1ARI A;  2ZYJ A;  5M46 A;  3FRK A;  2DKJ A;  2Z20 A;  3EI9 A;  3RCH B;  4IXS A;  2V0Y A;  4ITX A;  1M0P A;  4AO4 A;  1GCK A;  2JJH A;  4K2M A;  5M4B A;  2PB2 A;  3PA9 A;  4OT8 A;  4M2K A;  1LK9 A;  1LS3 A;  1IBJ A;  4ZM3 A;  2AY2 A;  4JEY A;  3BWN C;  4HF8 A;  5DB5 A;  2JJE A;  5DJ9 A;  3E9K A;  1Z7D A;  1GD9 A;  1GEY A;  2VYC A;  3GSB A;  4XJO A;  1X2A A;  4MQQ A;  2G7J A;  2X5D A;  2PB0 A;  3A9X A;  3F9T A;  2VMW A;  3N5M A;  2BIG A;  2VI8 A;  4N0W A;  1PG8 A;  2VMP A;  4ZM4 A;  2VMU A;  1ELQ A;  2FN6 A;  4P7Y A;  4WLH A;  4WYG A;  3GWP A;  5FT6 A;  5BJ3 A;  2CH2 A;  4BMK A;  8AAT A;  3H9X A;  4RM1 A;  5BJ4 A;  1TPL A;  1IJI A;  2FYF A;  3ELE A;  3FZ7 A;  4IW7 A;  5EUE A;  1ZC9 A;  4P3M A;  1MLY A;  2W7G A;  4B9B A;  4EU1 A;  2VMN A;  2GQN A;  2YCP A;  5EFS A;  1RV3 A;  3FZ8 A;  3K40 A;  2YKV A;  5HDM A;  3EI8 A;  2W7I A;  4A0R A;  1ASL A;  4DQ6 A;  2HZP A;  3WKR A;  1WKG A;  2VMX A;  1ARG A;  3NUB A;  1J04 A;  1AX4 A;  1AIC A;  3I4J A;  4AZJ A;  3DXV A;  2R0T A;  3HVY A;  4UHM A;  2BI3 A;  1AY5 A;  3BS8 A;  1CQ6 A;  2QB2 A;  2CAN A;  1BJW A;  4IX8 A;  2AY6 A;  1D7V A;  2OQX A;  4RJY A;  4EFF A;  3EZ1 A;  3W1I A;  2CFB A;  1D2F A;  2X5F A;  3E2Z B;  1OHV A;  3I16 A;  4Q76 A;  4OTL A;  4OBV A;  4BA4 A;  2D61 A;  4E3Q A;  1AMS A;  1BQA A;  1YJS A;  1KAF A;  3EZS A;  3WY7 A;  1SZU A;  2ZY5 A;  4FL0 A;  3FDD A;  5EUN A;  2YKU A;  1AHY A;  1I48 A;  1DGD A;  3FKD A;  3PDB B;  3AAT A;  1AJS B;  1TOI A;  2WK8 A;  2ZY2 A;  1MLZ A;  1W7N A;  4RIT A;  4ADC A;  2ZJG A;  2OKJ A;  3A8U X;  4PVF A;  1TOE A;  2CJH A;  3AV7 A;  3GZD C;  4OC9 A;  2BWP A;  1MAP A;  4PIW A;  4WYE A;  3UWC A;  4UHO A;  1S07 A;  4A0F A;  4F5M A;  4JE5 D;  1LW5 A;  4IXO A;  4JF1 A;  5EAA A;  2VMO A;  2D7Y A;  1DTY A;  2JJF A;  2HP1 A;  3NU8 A;  1IAX A;  3ZRP A;  3A9Z A;  2VMV A;  3N4S A;  1IVR A;  1RVU A;  4J8L A;  1ASF A;  4R5Z A;  4TMR A;  4EB5 A;  4A6U A;  1VEF A;  4JF0 A;  2YOB A;  5HXX A;  1C9C A;  5DX5 A;  1KKP A;  3OP7 A;  3PDX A;  1VJO A;  3AEM C;  3FCR A;  1ECX A;  1DFO A;  2AY3 A;  4W1W A;  1OHW A;  1YAA A;  4IXZ A;  4HVK A;  4U2H A;  1W7L A;  1QIT A;  1YJZ A;  2E54 A;  3NU7 A;  2HUF A;  4DGT A;  1B9I A;  1FG7 A;  2CJG A;  2BWN A;  4KYO A;  1AHX A;  3TFU A;  3QHX A;  1I43 A;  1CS1 A;  4WD2 A;  1GEX A;  1OXP A;  3NYU A;  2BI1 A;  1ORD A;  2E7J A;  1M32 A;  1MDO A;  2PO3 A;  1D7S A;  1CL2 A;  3E2F A;  1X28 A;  4OCA A;  4DBC A;  4L0O A;  3NNK A;  3PD6 A;  5JAY A;  1X29 A;  3FFR A;  3BCX A;  2X3L A;  3RI6 A;  1N8P A;  2W8W A;  3B1E A;  2VMY A;  3FQA A;  3K28 A;  4LW4 A;  4ZDL A;  5AX8 A;  2YCN A;  2Z67 A;  3G0T A;  2GMU A;  3DC1 A;  2YKY A;  3QBO A;  1C0N A;  1ART A;  3VK2 A;  4W1X A;  2VGS A;  2D5Y A;  1C7O A;  3E2Y A;  4MY5 A;  1QIS A;  2HOX A;  2Z61 A;  5K8B A;  2ZP7 A;  3B1C A;  4Q75 A;  4LC3 A;  1WYT A;  2W7K A;  2WB6 A;  1DJU A;  1YNU A;  2V1P A;  3WZF A;  1V2F A;  3B46 A;  3EI5 A;  3QN6 A;  3BC8 A;  1S08 A;  5DJ1 A;  4H51 A;  3VP6 A;  3HT4 A;  2HOY A;  4JEV A;  4LNL A;  2VMS A;  2DOU A;  1TAR A;  4R2N A;  3N4R A;  3M5U A;  2AY9 A;  5G09 A;  2W7H A;  3IF2 A;  1W3U A;  1X0M A;  1AHE A; 
#chains in the Genus database with same CATH homology
 4F5F A;  2AEV A;  5FT8 A;  4RJ0 A;  1FC4 A;  1M0N A;  4M2M A;  1ASC A;  1AY4 A;  4E77 A;  3JWA A;  3AEJ A;  4ZWV A;  4Q31 A;  3AEL A;  1C4K A;  2EO5 A;  2Z9V A;  1CJ0 A;  2W8U A;  3DXW A;  3VOM A;  4A00 A;  3FVS A;  4ZSW A;  1GEW A;  3B1D A;  4RKC A;  2BIA A;  3NDN A;  1D7R A;  2BWO A;  3AOW A;  1S09 A;  1TOK A;  5EAV A;  2VMZ A;  4F5K A;  2TPL A;  4QGR A;  3W1H A;  4B98 A;  4UQV A;  3QGU A;  4WXB A;  1BKG A;  5G4I A;  1B8G A;  3HMU A;  1ASA A;  3MC6 C;  2HUU A;  4XK1 A;  2CB1 A;  3JZL A;  4ADB A;  3UE8 A;  3LV2 A;  3TFT A;  1M7Y A;  1RV4 A;  2HOR A;  4ZAS A;  1H0C A;  5FT4 A;  5J8Q A;  1AMR A;  1AHG A;  2AY8 A;  2QA3 A;  3PPL A;  1ELU A;  1QJ5 A;  2DGM A;  1LKC A;  1CQ8 A;  1AJR A;  3G7Q A;  4Y0H A;  1AKB A;  3ELP A;  3NTJ A;  3F6T A;  1EG5 A;  3DR7 A;  1AKC A;  2BKW A;  3FZ6 A;  3PD6 B;  4ZDP A;  2FKI A;  1CL1 A;  5IWQ A;  3VK3 A;  5F9S A;  3JTX A;  1BT4 A;  2E7I A;  1UKJ A;  2VMT A;  3NX3 A;  1O69 A;  5FT5 A;  1ZOD A;  1GC3 A;  2BIE A;  4WB0 A;  1TOG A;  3B8X A;  3CQ4 A;  1IX8 A;  4XAU A;  2VI9 A;  4XJL A;  2VGZ A;  2W8T A;  3R9A A;  4BHD A;  4J5U A;  5EQC A;  2W8V A;  3WGC A;  3QI6 A;  1YJY A;  2DGK A;  3HDO A;  4E1O A;  2W7L A;  2DGL A;  3GR9 A;  3L8A A;  1WYT B;  1B4X A;  4GRX A;  2ZC0 A;  3DYD A;  5LH9 A;  4JEX A;  1YOO A;  1LC8 A;  4A0H A;  3EIB A;  3FVU A;  4OYT A;  4UOY A;  5LHA A;  5G0A A;  1CQ7 A;  2ZSM A;  1W7M A;  4F5L A;  1JF9 A;  4EB7 A;  2E7U A;  2AAT A;  4MKK A;  3TQX A;  1ZOB A;  5G2P A;  1AAM A;  2A1V A;  1KKJ A;  1JS3 A;  3ASA A;  1IAY A;  5EIG A;  1AIB A;  3NYT A;  4MGR A;  1WYU A;  3GET A;  1SVV A;  2FQ6 A;  3HL2 A;  3QM2 A;  2W7M A;  1N2T A;  2W8J A;  4TN4 A;  3USF A;  2EH6 A;  1AIA A;  3GJU A;  2D65 A;  3MBB A;  5M49 A;  4IYO A;  2Z9U A;  4MQP A;  4RIZ A;  4R8D A;  5E3K A;  3WGB A;  3ZZJ A;  3GBX A;  1FG3 A;  4CXR A;  4XEW A;  1DJE A;  4AH3 A;  1LC5 A;  3EI7 A;  3BB8 A;  4EMY A;  4A72 A;  1E5E A;  1O4S A;  3AOV A;  4WYD A;  1BS0 A;  3BV0 A;  1S0A A;  3ASB A;  1O61 A;  4K2B A;  4UHN A;  2QLR A;  3LVL B;  1DKA A;  3WLX A;  1SPA A;  3AEN A;  1DGE A;  3DZZ A;  4AZK A;  3KGW A;  1CZE A;  1ARH A;  1XEY A;  4I8A A;  3CAI A;  4CXQ A;  2OAT A;  1MDZ A;  3MKJ A;  4ZSY A;  3QPG A;  2BYJ A;  3AEJ C;  3II0 A;  3RBL A;  2R5C A;  1OAT A;  3ATH A;  1GC4 A;  2HP2 A;  1V2E A;  1KMK A;  1WYV A;  2VGT A;  2GB3 A;  4R5F A;  4U1T A;  4W1V A;  4BQ0 A;  4W5K A;  1PMO A;  5HHY A;  3HLM A;  1M0Q A;  1E5F A;  2KFP A;  3GZD A;  4F4E A;  3D6K A;  3Q8N A;  4WLJ A;  4K05 A;  4IY7 A;  2AY4 A;  4PFF A;  2CJD A;  2QBT A;  1ASD A;  1UU1 A;  4ZWM A;  4WB0 B;  2C7T A;  3WCO A;  4LNJ A;  1XI9 A;  4XQ2 A;  4ZAH A;  2AY5 A;  4MSO A;  2VMQ A;  1SF2 A;  2YHK A;  1U08 A;  3RQ1 A;  1I41 A;  4WBT A;  3DOD A;  4KXK A;  3F0H A;  4H63 Q;  3LWS A;  4WYC A;  2JGT A;  2G6W A;  3PDB A;  1AAW A;  2JG2 A;  3CQ5 A;  3ISL A;  3AEM A;  3N7N A;  3RBF A;  2GSA A;  1PFF A;  3T32 A;  2YKX A;  3A2B A;  3JW9 A;  2HOZ A;  1AHF A;  1CZC A;  1GC0 A;  2VMR A;  1KMJ A;  5I92 A;  1JG8 A;  4Y0I A;  2AEU A;  5EIG B;  3KKI A;  4RLG A;  1IX6 A;  1WYU B;  2JIS A;  4CVQ A;  1D7U A;  2BI5 A;  3FVX A;  3MAU A;  3LG0 A;  1GDE A;  3N0L A;  3COG A;  4GSA A;  2XH1 A;  5F8V A;  1GBN A;  3NUI A;  2O1B A;  2DR1 A;  1OHY A;  2D7Z A;  2FNI A;  3JWB A;  3MAD A;  4IYO B;  3H7F A;  3FQ8 A;  4F5G A;  1AKA A;  2EPJ A;  2W7F A;  3FQ7 A;  4WYF A;  2D64 A;  2C0R A;  1Y4I A;  4W91 A;  4GE7 A;  1M0O A;  9AAT A;  1AMQ A;  4AOA A;  1G4V A;  3NYS A;  4WXG A;  1SFF A;  1MAQ A;  1VP4 A;  3FDB A;  4ITG A;  3WX9 A;  2XBN A;  3H14 A;  1BJN A;  5TF5 A;  2CIN A;  4WYA A;  2C44 A;  2OGE A;  2QB3 A;  3AEN B;  2RFV A;  3EIA A;  5G2Q A;  4WP0 A;  2VGU A;  1Z3Z A;  1AMA A;  2BI2 A;  1IX7 A;  2JJG A;  1C7N A;  3CBF A;  3FSL A;  4LNM A;  3W1J A;  2NMP A;  2W7D A;  5D5S A;  4A0G A;  1QJ3 A;  1QIR A;  2R5C B;  1BQD A;  1TAS A;  4ADE A;  4ADD A;  3FFH A;  1SZS A;  3ACZ A;  3LY1 A;  1WYV B;  3MAF A;  3RUY A;  3UAK A;  2YRR A;  2VLF A;  1LC7 A;  3KGX A;  4O6Z A;  4Q6R A;  3AEP A;  3EI6 A;  2ZSL A;  2VGV A;  4Y0D A;  4GEB A;  3DRD A;  2VIA A;  3CQ6 A;  3BWN A;  3DU4 A;  2CTZ A;  1BJO A;  1J32 A;  7AAT A;  1QZ9 A;  3ZRQ A;  4XJM A;  3LVK A;  2CST A;  2WKA A;  2Z1Z A;  3GZC A;  3HBX A;  2FNU A;  2OKK A;  1QGN A;  4FFC A;  3TAT A;  4CBS A;  4BA5 A;  2Z9W A;  1MGV A;  2R5E A;  2F8J A;  3VAX A;  1RVY A;  3IHJ A;  4CBR A;  1ASE A;  1N31 A;  2CH1 A;  2O7C A;  4XJP A;  1P3W A;  3LVJ A;  1G4X A;  3HQT A;  1G7X A;  1V72 A;  2DKB A;  1M4N A;  4M2J A;  1W23 A;  3JU7 A;  1S06 A;  3FD0 A;  5E5I A;  2D63 A;  1SZK A;  1TAT A;  4GE9 A;  1LW4 A;  1YIZ A;  1M6S A;  2ZUK A;  2AY1 A;  2EZ1 A;  3RCH A;  4MKJ A;  3WKS A;  3MC6 A;  3P6K A;  1G7W A;  2QMA A;  1ASN A;  4F5H A;  2HUI A;  1GC2 A;  2Z9X A;  4WXF A;  2BI9 A;  1IUG A;  5G4J A;  1EQB A;  1I29 A;  4AO9 A;  4NOG A;  4GE4 A;  4ATP A;  1UU2 A;  5C6U A;  2C81 A;  3ECD A;  3N75 A;  5KTB A;  3N4X A;  4MQR A;  2WK9 A;  2BHX A;  1ASB A;  3ZRR A;  4LW2 A;  3G8M A;  2OGA A;  3EUC A;  2EYQ A;  1OXO A;  3PGY A;  2QSR A;  1YIY A;  2AY7 A;  2X8U A;  3E77 A;  3R4T A;  2W7E A;  4RKD A;  3FTB A;  1O62 A;  3PIU A;  2VIB A;  1ARS A;  2ZY3 A;  1WST A;  3ZZK A;  4E3R A;  3WCN A;  1B5P A;  1EJI A;  3DR4 A;  4OMA A;  4A6T A;  3BCB A;  1DJ9 A;  4PFN A;  4ZDO A;  2O0R A;  4ATQ A;  1PMM A;  3VK4 A;  2D66 A;  1B5O A;  1JS6 A;  3A9Y A;  4ZLV A;  5D95 A;  2ZY4 A;  3PJ0 A;  3LVM A;  3L44 A;  2FM1 A;  1UU0 A;  1H1C A;  4A6R A;  3MAF B;  2ORD A;  4K2I A;  3K7Y A;  1T3I A;  4JEW A;  4TV7 A;  2WK7 A;  2CY8 A;  1AY8 A;  3TCM A;  3BN1 A;  1B9H A;  3I5T A;  1BJ4 A;  4JE5 A;  4KAM A;  3E2Z A;  4ISY A;  1BJO B;  4F5I A;  5EUD A;  1ASM A;  2EZ2 A;  1C7G A;  2GMS A;  2VLH A;  2YCT A;  2EGY A;  3KE3 A;  1KL2 A;  2YRI A;  4OBU A;  4GDY A;  2Z1Y A;  1KL1 A;  1V2D A;  4W8I A;  5M4D A;  2Q7W A;  3AEO A;  3MEB A;  1AJS A;  3BWO A;  4JEZ A;  2W7J A;  4N0B A;  3P1T A;  3NRA A;  1BW0 A;  1ASG A;  2BYL A;  3OKS A;  3PAA A;  5E4Z A;  3BCA A;  2VGW A;  1TOJ A;  2R2N A;  1MDX A;  4F5J A;  3E6G A;  4RAE A;  1WKH A;  1ARI A;  2ZYJ A;  5M46 A;  3FRK A;  2DKJ A;  2Z20 A;  3EI9 A;  3RCH B;  4IXS A;  2V0Y A;  4ITX A;  1M0P A;  4AO4 A;  1GCK A;  2JJH A;  4K2M A;  5M4B A;  2PB2 A;  3PA9 A;  4OT8 A;  4M2K A;  1LK9 A;  1LS3 A;  1IBJ A;  4ZM3 A;  2AY2 A;  4JEY A;  3BWN C;  4HF8 A;  5DB5 A;  2JJE A;  5DJ9 A;  3E9K A;  1Z7D A;  1GD9 A;  1GEY A;  2VYC A;  3GSB A;  4XJO A;  1X2A A;  4MQQ A;  2G7J A;  2X5D A;  2PB0 A;  3A9X A;  3F9T A;  2VMW A;  3N5M A;  2BIG A;  2VI8 A;  4N0W A;  1PG8 A;  2VMP A;  4ZM4 A;  2VMU A;  1ELQ A;  2FN6 A;  4P7Y A;  4WLH A;  4WYG A;  3GWP A;  5FT6 A;  5BJ3 A;  2CH2 A;  4BMK A;  8AAT A;  3H9X A;  4RM1 A;  5BJ4 A;  1TPL A;  1IJI A;  2FYF A;  3ELE A;  3FZ7 A;  4IW7 A;  5EUE A;  1ZC9 A;  4P3M A;  1MLY A;  2W7G A;  4B9B A;  4EU1 A;  2VMN A;  2GQN A;  2YCP A;  5EFS A;  1RV3 A;  3FZ8 A;  3K40 A;  2YKV A;  5HDM A;  3EI8 A;  2W7I A;  4A0R A;  1ASL A;  4DQ6 A;  2HZP A;  3WKR A;  1WKG A;  2VMX A;  1ARG A;  3NUB A;  1J04 A;  1AX4 A;  1AIC A;  3I4J A;  4AZJ A;  3DXV A;  2R0T A;  3HVY A;  4UHM A;  2BI3 A;  1AY5 A;  3BS8 A;  1CQ6 A;  2QB2 A;  2CAN A;  1BJW A;  4IX8 A;  2AY6 A;  1D7V A;  2OQX A;  4RJY A;  4EFF A;  3EZ1 A;  3W1I A;  2CFB A;  1D2F A;  2X5F A;  3E2Z B;  1OHV A;  3I16 A;  4Q76 A;  4OTL A;  4OBV A;  4BA4 A;  2D61 A;  4E3Q A;  1AMS A;  1BQA A;  1YJS A;  3EZS A;  3WY7 A;  1SZU A;  2ZY5 A;  4FL0 A;  3FDD A;  5EUN A;  2YKU A;  1AHY A;  1I48 A;  1DGD A;  3FKD A;  3PDB B;  3AAT A;  1AJS B;  1TOI A;  2WK8 A;  2ZY2 A;  1MLZ A;  1W7N A;  4RIT A;  4ADC A;  2ZJG A;  2OKJ A;  3A8U X;  4PVF A;  1TOE A;  2CJH A;  3AV7 A;  3GZD C;  4OC9 A;  2BWP A;  1MAP A;  4PIW A;  4WYE A;  3UWC A;  4UHO A;  1S07 A;  4A0F A;  4F5M A;  4JE5 D;  1LW5 A;  4IXO A;  4JF1 A;  5EAA A;  2VMO A;  2D7Y A;  1DTY A;  2JJF A;  2HP1 A;  3NU8 A;  1IAX A;  3ZRP A;  3A9Z A;  2VMV A;  3N4S A;  1IVR A;  1RVU A;  4J8L A;  1ASF A;  4R5Z A;  4TMR A;  4EB5 A;  4A6U A;  1VEF A;  4JF0 A;  2YOB A;  5HXX A;  1C9C A;  5DX5 A;  1KKP A;  3OP7 A;  3PDX A;  1VJO A;  3AEM C;  3FCR A;  1ECX A;  1DFO A;  2AY3 A;  4W1W A;  1OHW A;  1YAA A;  4IXZ A;  4HVK A;  4U2H A;  1W7L A;  1QIT A;  1YJZ A;  2E54 A;  3NU7 A;  2HUF A;  4DGT A;  1B9I A;  1FG7 A;  2CJG A;  2BWN A;  4KYO A;  1AHX A;  3TFU A;  3QHX A;  1I43 A;  1CS1 A;  4WD2 A;  1GEX A;  1OXP A;  3NYU A;  2BI1 A;  1ORD A;  2E7J A;  1M32 A;  1MDO A;  2PO3 A;  1D7S A;  1CL2 A;  3E2F A;  1X28 A;  4OCA A;  4DBC A;  4L0O A;  3NNK A;  3PD6 A;  5JAY A;  1X29 A;  3FFR A;  3BCX A;  2X3L A;  3RI6 A;  1N8P A;  2W8W A;  3B1E A;  2VMY A;  3FQA A;  3K28 A;  4LW4 A;  4ZDL A;  5AX8 A;  2YCN A;  2Z67 A;  3G0T A;  2GMU A;  3DC1 A;  2YKY A;  3QBO A;  1C0N A;  1ART A;  3VK2 A;  4W1X A;  2VGS A;  2D5Y A;  1C7O A;  3E2Y A;  4MY5 A;  1QIS A;  2HOX A;  2Z61 A;  5K8B A;  2ZP7 A;  3B1C A;  4Q75 A;  4LC3 A;  1WYT A;  2W7K A;  2WB6 A;  1DJU A;  1YNU A;  2V1P A;  3WZF A;  1V2F A;  3B46 A;  3EI5 A;  3QN6 A;  3BC8 A;  1S08 A;  5DJ1 A;  4H51 A;  3VP6 A;  3HT4 A;  2HOY A;  4JEV A;  4LNL A;  2VMS A;  2DOU A;  1TAR A;  4R2N A;  3N4R A;  3M5U A;  2AY9 A;  5G09 A;  2W7H A;  3IF2 A;  1W3U A;  1X0M A;  1AHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...