1ARHA

Aspartate aminotransferase, y225r/r386a mutant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFARQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGAVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Changing the reaction specificity of a pyridoxal-5'-phosphate-dependent enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (aminotransferase)
total genus 142
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1995-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1arhA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1arhA01
4MGRA 4HF8A 2GSAA 4JEVA 5LHAA 2BI9A 3A8UX 4W1XA 2BKWA 3TFUA 5BJ4A 3BWNA 4FL0A 4OBVA 1YNUA 3FVXA 5HDMA 3B1CA 1W3UA 2AEUA 2HZPA 2O7CA 1ARTA 5FT4A 2VMUA 2AY7A 1CL1A 4ZSWA 2F8JA 2VMSA 3D6KA 4OBUA 4F5MA 1Z3ZA 3USFA 1M6SA 4MKKA 4RM1A 2E7UA 5IWQA 2VGWA 3BS8A 2GQNA 4F5IA 1EQBA 4M2MA 3RCHA 1JS3A 1H1CA 2PB0A 3UAKA 2HOZA 4CBSA 4JE5A 3N5MA 2OKJA 4RLGA 1ASDA 3B1EA 1N31A 2OKKA 4OC9A 2YCPA 3BCBA 4OT8A 1PMOA 4J8LA 1LW5A 1RV3A 2CH1A 1AIBA 3AEJA 5FT5A 3ECDA 3Q8NA 1IX6A 3LVLB 3AENB 3HMUA 4E1OA 3GZCA 3ISLA 2AEVA 1V2FA 2AY4A 3WGCA 4N0BA 3ASAA 3E6GA 1D7RA 2EZ2A 4GEBA 2PO3A 2ZY2A 1WYTA 1AMQA 3BC8A 3ZRPA 3TATA 5EUEA 1IAXA 1GEYA 1G7WA 1IX7A 3AOVA 4W91A 4F5LA 2OATA 2VMPA 3KGXA 2Z20A 2W7MA 2W7FA 1SZSA 2BI2A 4WXGA 3G8MA 3FFHA 5EIGA 1U08A 1BJNA 3I5TA 4JEXA 3F9TA 3E2YA 4ATQA 1X0MA 2YKVA 2W8VA 3BCXA 3M5UA 3R9AA 1IVRA 4RAEA 1YOOA 4AZJA 3VP6A 1IJIA 4WYFA 4MQRA 4ZAHA 4P7YA 1IAYA 3N75A 2W8JA 2YRRA 3W1IA 1OHWA 3JW9A 2VI8A 4UHNA 1MDZA 2JG2A 3AEJC 3WLXA 1GEXA 5TF5A 2ZSMA 3GJUA 2VGTA 4XK1A 2AY3A 5FT8A 3VK3A 3B1DA 3DXVA 2W7DA 3K7YA 3PIUA 1M7YA 2ZY4A 4HVKA 3E2ZA 3BB8A 2JJHA 3H14A 4Y0IA 4E3RA 3L8AA 3AEPA 4IYOB 4R2NA 3AV7A 1OHYA 2E7IA 3E2FA 3CQ4A 1AJRA 4BQ0A 3W1HA 1JG8A 3QHXA 2ZUKA 3UE8A 1E5FA 1E5EA 2EGYA 4W1VA 2E7JA 1O4SA 1H0CA 3MAFA 3GZDA 1AIAA 2QB3A 2RFVA 2Z1ZA 2JGTA 2W7IA 1AKCA 2YKYA 1BS0A 4A6TA 4EMYA 2CANA 2JISA 2FYFA 5DB5A 4WXBA 2AATA 1GCKA 2GB3A 3WCOA 1J04A 1QZ9A 2Z1YA 1C9CA 3PA9A 3ZZJA 1C0NA 3JTXA 1AICA 2QMAA 3GSBA 3AEOA 3BWOA 4RKCA 2WK8A 1UU0A 2R5CB 2D5YA 1LK9A 2HUIA 3NUBA 4N0WA 4XAUA 5K8BA 5D95A 4MQPA 3LVJA 3MEBA 4JF0A 5FT6A 1D7UA 3PPLA 1XEYA 2X3LA 3HBXA 4RJYA 5M4BA 2BWPA 4A0HA 2DR1A 4ATPA 1FG7A 3GWPA 3VAXA 3E77A 3QGUA 3W1JA 3FRKA 4CXRA 1ZC9A 1BKGA 2C0RA 4XJLA 4ZM3A 5I92A 1TPLA 3NNKA 4FFCA 4A0GA 1C7OA 3TCMA 3FDDA 1IX8A 5EQCA 3MC6A 5AX8A 3DODA 1IUGA 1M0QA 1TOJA 1N8PA 3LY1A 1S06A 4F5KA 1AHXA 1C7NA 1QIRA 4NOGA 2E54A 2R2NA 4XQ2A 1IBJA 1PMMA 3WX9A 2VMTA 2OQXA 3NYSA 2X5FA 3KGWA 2VIAA 3EI5A 1ORDA 2VMRA 2YOBA 4TMRA 1W7MA 1D2FA 1YJZA 4WXFA 4ADBA 3HL2A 1T3IA 4XEWA 4JF1A 1B9IA 3FVUA 3FVSA 4ITXA 1W7NA 2VGSA 1TASA 2AY1A 2WK9A 1X28A 2FQ6A 3EI8A 2YRIA 3PGYA 2BYLA 2JJEA 4RJ0A 2VGZA 4GSAA 4IXZA 5EAVA 1M32A 2DKJA 3FQAA 2VGVA 4ADEA 3WY7A 1AHEA 1TOIA 2OGEA 3LWSA 4E3QA 2W7EA 1AY8A 3B8XA 3K28A 5G4JA 3ZRRA 4A6UA 4LW4A 1WYVB 2DKBA 1SPAA 2VMXA 1YAAA 1BQDA 5DJ1A 4GE4A 4U1TA 1CZCA 1M0NA 2BI1A 1QJ3A 4WYEA 1BW0A 1WYTB 4XJPA 4EB7A 1LC7A 1S0AA 4F5JA 4ZSYA 5M46A 3EI9A 4CVQA 1OXPA 2HP2A 4UHOA 4PIWA 1Z7DA 4WLJA 1LKCA 3BWNC 5LH9A 1CZEA 1ELUA 1BJOB 3BN1A 1ARHA 3FZ8A 2CH2A 3NU8A 4A0FA 3P1TA 4KYOA 3RBLA 1QJ5A 2G6WA 1W23A 1AJSB 4Y0HA 1AMSA 3DXWA 4ADDA 2VMWA 1V72A 2ORDA 3F6TA 3MAUA 1N2TA 4ZWVA 2ZY3A 2PB2A 3OP7A 3QM2A 4GE9A 3LVMA 4F5HA 4BA4A 1PFFA 5EUDA 3FDBA 1FG3A 1WSTA 1LW4A 3A9XA 3VK2A 1KMJA 2D66A 2NMPA 1C4KA 1PG8A 5G2PA 2W7KA 4GDYA 4LC3A 3PDBB 1KKJA 1OXOA 1LC5A 2D65A 3AENA 1RVUA 3LVKA 1S07A 3GETA 1KMKA 1MLZA 2CTZA 3AEMA 3HQTA 3IHJA 1UKJA 1AKBA 3HVYA 3HT4A 2BWNA 2Z61A 2FN6A 4MKJA 4WB0B 1GD9A 5J8QA 1VP4A 4W8IA 1Y4IA 4A72A 2BI3A 1BJ4A 2W7LA 3FD0A 2C44A 1C7GA 4AO9A 2C7TA 2QLRA 4JEZA 1O62A 2VMYA 2WKAA 3DZZA 4QGRA 1UU1A 2C81A 2HUUA 2AY6A 4RIZA 4AOAA 2R0TA 4Q6RA 4AH3A 3WGBA 3JWBA 1CJ0A 2VMZA 3CAIA 4F5GA 3FQ7A 3PD6B 4OTLA 2HOYA 1B9HA 4A6RA 1TOKA 4H51A 2Z67A 2CY8A 1GC2A 5EUNA 1RV4A 4ADCA 2CJGA 4ZDPA 2BI5A 2EPJA 3RUYA 1ASFA 2V1PA 4ZM4A 1WYUB 1DJ9A 1GEWA 2VMQA 5HHYA 2YKXA 2CINA 4L0OA 2BIEA 4IYOA 3FZ6A 3AATA 3KE3A 1AMAA 3EI6A 1J32A 3A9ZA 1TOEA 3CQ6A 4K2BA 4RKDA 1AAMA 4K2IA 2HUFA 5G09A 5E5IA 2VI9A 4MY5A 3ACZA 3MBBA 3ELEA 4WD2A 2D7ZA 3ASBA 1WKGA 3NTJA 2AY8A 2ZJGA 2BHXA 4LNLA 4DQ6A 4WYDA 3GZDC 1ASGA 2W7HA 4ZDOA 3HDOA 4JEYA 1I48A 2ZC0A 3P6KA 3ZRQA 2QBTA 4EFFA 1S09A 3WKRA 4UHMA 1WKHA 2CJDA 3DR4A 5G2QA 2BYJA 2XH1A 4Q76A 3I16A 2DGKA 4AZKA 2Z9VA 3DR7A 4JE5D 3IF2A 4ZDLA 2DOUA 1I29A 3A9YA 2R5CA 2Z9WA 2ZYJA 4UQVA 4EU1A 2W8WA 4IXSA 1DKAA 4R5FA 3B46A 2VLHA 2JJFA 1P3WA 3AELA 3DU4A 1B5OA 4ZASA 2QA3A 3DRDA 2AY5A 1GDEA 2D61A 1G7XA 3NYUA 2JJGA 3RCHB 1DGDA 4WYCA 4WLHA 4Y0DA 1V2EA 3EZ1A 4B9BA 2VMVA 3NDNA 2VYCA 3TQXA 1BJWA 4LNJA 4TN4A 4W1WA 2VMOA 2VIBA 3WCNA 4IX8A 1GC3A 3II0A 3MC6C 1AX4A 3FKDA 4BHDA 4OMAA 1YIZA 1SZKA 1OHVA 4WP0A 4I8AA 3RI6A 4CBRA 2YCNA 4ISYA 2W7GA 2YKUA 4TV7A 4XJMA 1TOGA 1KKPA 2VMNA 1ASAA 1MAPA 3QN6A 3ATHA 1AY4A 1SFFA 1B5PA 7AATA 3HLMA 1SZUA 2HP1A 4OYTA 1EG5A 1VJOA 5EIGB 1ECXA 2O1BA 1JF9A 3JZLA 3NU7A 5HXXA 3CQ5A 5BJ3A 4J5UA 1ASMA 4F4EA 4CXQA 4ZWMA 1ASCA 3NX3A 3GR9A 3VOMA 1S08A 2HOXA 2R5EA 3QPGA 3FTBA 2FNIA 3WKSA 8AATA 1M0PA 1AAWA 1CL2A 2YHKA 3AOWA 3PJ0A 5E3KA 3NRAA 5EFSA 3UWCA 4W5KA 2QB2A 3BV0A 1AHGA 3TFTA 1AHYA 1DTYA 1WYVA 4LNMA 3FFRA 3GBXA 1G4XA 5G0AA 4KAMA 3VK4A 5DX5A 2ZY5A 4OCAA 1MDOA 4P3MA 5G4IA 1SF2A 1UU2A 3E2ZB 4DGTA 1DJUA 1LS3A 4O6ZA 1QGNA 1CS1A 5E4ZA 1BJOA 9AATA 1O69A 1ARIA 3H7FA 1BQAA 1YIYA 3DYDA 2D63A 3OKSA 3QBOA 2VLFA 3JWAA 2D64A 1X29A 2BIAA 3ZZKA 3KKIA 1AJSA 1ARSA 1ZODA 1B4XA 3MAFB 1V2DA 1FC4A 4U2HA 4DBCA 1ASBA 1ASEA 1ASNA 2CJHA 2X8UA 4R5ZA 2YCTA 1I43A 2TPLA 1OATA 4A00A 1VEFA 4AO4A 1D7SA 3MADA 1G4VA 3MKJA 3F0HA 1MDXA 4RITA 3PDXA 1YJSA 2EO5A 2GMSA 4IY7A 4WYGA 4KXKA 1CQ6A 1O61A 2X5DA 4JEWA 3JU7A 4BMKA 1AY5A 3EZSA 4ZLVA 4K2MA 1X2AA 4F5FA 3BCAA 3RQ1A 1KL2A 1MLYA 2OGAA 2VGUA 1CQ7A 3PDBA 3L44A 4LW2A 1EJIA 2ZP7A 3WZFA 1SVVA 2BWOA 3G0TA 5F8VA 2FNUA 2EH6A 3FSLA 3PAAA 4GE7A 1AMRA 1JS6A 3AEMC 2Q7WA 3K40A 2DGLA 1CQ8A 3QI6A 4M2JA 4Q75A 1MGVA 5DJ9A 4WB0A 1ARGA 4WYAA 5M49A 3COGA 1M0OA 3R4TA 1XI9A 4EB5A 2AY9A 2V0YA 3FCRA 1BT4A 3I4JA 3EIAA 1ELQA 4WBTA 2O0RA 3EIBA 1DFOA 4MQQA 3N0LA 2AY2A 3ELPA 3FZ7A 1QITA 3DC1A 3PD6A 1LC8A 3G7QA 4B98A 1ASLA 3EUCA 2XBNA 5D5SA 4XJOA 4ITGA 1RVYA 1I41A 5C6UA 2D7YA 4M2KA 4GRXA 3A2BA 4PVFA 1GC0A 1KL1A 1QISA 2ZSLA 1TARA 1DJEA 1W7LA 4IW7A 2CFBA 2CB1A 3FQ8A 1B8GA 3EI7A 5M4DA 2W7JA 3LV2A 2Z9XA 2BIGA 1D7VA 2HORA 3LG0A 1TATA 4BA5A 2W8UA 1WYUA 1M4NA 2EZ1A 1ZOBA 3NUIA 2CSTA 2DGMA 5JAYA 2GMUA 2FM1A 3E9KA 1GC4A 5EAAA 5F9SA 1GBNA 4R8DA 2WK7A 2W8TA 2Z9UA 1AKAA 4E77A 3CBFA 4MSOA 4PFNA 4A0RA 3RBFA 4IXOA 1MAQA 1YJYA 1AHFA 4Q31A 3T32A 4UOYA 1DGEA 4PFFA 3NYTA
chains in the Genus database with same CATH superfamily
4MGRA 4HF8A 2GSAA 4JEVA 5LHAA 2BI9A 3A8UX 4W1XA 2BKWA 3TFUA 5BJ4A 3BWNA 4FL0A 4OBVA 1YNUA 3FVXA 5HDMA 3B1CA 1W3UA 2AEUA 2HZPA 2O7CA 1ARTA 5FT4A 2VMUA 2AY7A 1CL1A 4ZSWA 2F8JA 2VMSA 3D6KA 4OBUA 4F5MA 1Z3ZA 3USFA 1M6SA 4MKKA 4RM1A 2E7UA 5IWQA 2VGWA 3BS8A 2GQNA 4F5IA 1EQBA 2G7JA 4M2MA 3RCHA 2A1VA 1JS3A 1H1CA 2PB0A 3UAKA 2HOZA 4CBSA 4JE5A 3N5MA 2OKJA 4RLGA 1ASDA 3B1EA 1N31A 2OKKA 4OC9A 2YCPA 3BCBA 4OT8A 1PMOA 4J8LA 1LW5A 1RV3A 2CH1A 1AIBA 3AEJA 5FT5A 3ECDA 3Q8NA 1IX6A 3LVLB 3AENB 3HMUA 4E1OA 3GZCA 3ISLA 2AEVA 1V2FA 2AY4A 3WGCA 4N0BA 3ASAA 3E6GA 1D7RA 2EZ2A 4GEBA 2PO3A 2ZY2A 1WYTA 1AMQA 3BC8A 3ZRPA 3TATA 5EUEA 1IAXA 1GEYA 1G7WA 1IX7A 3AOVA 4W91A 4F5LA 2OATA 2VMPA 3KGXA 2Z20A 2W7MA 2W7FA 5KTBA 1SZSA 2BI2A 4WXGA 3G8MA 3FFHA 5EIGA 1U08A 1BJNA 3I5TA 4JEXA 3F9TA 3E2YA 4ATQA 1X0MA 2YKVA 2W8VA 3BCXA 3M5UA 3R9AA 1IVRA 4RAEA 1YOOA 4AZJA 3VP6A 1IJIA 4WYFA 4MQRA 4ZAHA 4P7YA 1IAYA 3N75A 2W8JA 2YRRA 3W1IA 1OHWA 3JW9A 2VI8A 4UHNA 1MDZA 2JG2A 3AEJC 3WLXA 1GEXA 5TF5A 2ZSMA 3GJUA 2VGTA 4XK1A 2AY3A 5FT8A 3VK3A 3B1DA 3DXVA 2W7DA 3K7YA 3PIUA 2EYQA 1M7YA 2ZY4A 4HVKA 3E2ZA 3BB8A 2JJHA 3H14A 4Y0IA 4E3RA 3L8AA 3AEPA 4IYOB 4R2NA 3AV7A 1OHYA 2E7IA 3E2FA 3CQ4A 1AJRA 4BQ0A 3W1HA 1JG8A 3QHXA 2ZUKA 3UE8A 1E5FA 1E5EA 2EGYA 4W1VA 2E7JA 1O4SA 1H0CA 3MAFA 3GZDA 1AIAA 2QB3A 2RFVA 2Z1ZA 2JGTA 2W7IA 1AKCA 2YKYA 1BS0A 4A6TA 4EMYA 2CANA 2JISA 2FYFA 2FKIA 5DB5A 4WXBA 2AATA 1GCKA 2GB3A 3WCOA 1J04A 1QZ9A 2Z1YA 1C9CA 3PA9A 3ZZJA 1C0NA 3JTXA 1AICA 2QMAA 3GSBA 3AEOA 3BWOA 4RKCA 2WK8A 1UU0A 2R5CB 2D5YA 1LK9A 2HUIA 3NUBA 4N0WA 4XAUA 5K8BA 5D95A 4MQPA 3LVJA 3MEBA 4JF0A 5FT6A 1D7UA 3PPLA 1XEYA 2X3LA 3HBXA 4RJYA 5M4BA 2BWPA 4A0HA 2DR1A 4ATPA 1FG7A 3GWPA 3VAXA 3E77A 3QGUA 3W1JA 3FRKA 4CXRA 1ZC9A 2QSRA 1BKGA 2C0RA 4XJLA 4ZM3A 5I92A 1TPLA 3NNKA 4FFCA 4A0GA 1C7OA 3TCMA 3FDDA 1IX8A 5EQCA 3MC6A 5AX8A 3DODA 1IUGA 1M0QA 1TOJA 1N8PA 3LY1A 1S06A 4F5KA 1AHXA 1C7NA 1QIRA 4NOGA 2E54A 2R2NA 4XQ2A 1IBJA 1PMMA 3WX9A 2VMTA 2OQXA 3NYSA 2X5FA 3KGWA 2VIAA 3EI5A 1ORDA 2VMRA 2YOBA 4TMRA 1W7MA 1D2FA 1YJZA 4WXFA 4ADBA 3HL2A 1T3IA 4XEWA 4JF1A 1B9IA 3FVUA 3FVSA 4ITXA 1W7NA 2VGSA 1TASA 2AY1A 2WK9A 1X28A 2FQ6A 3EI8A 2YRIA 3PGYA 2BYLA 2JJEA 4RJ0A 2VGZA 4GSAA 4IXZA 5EAVA 1M32A 2DKJA 3FQAA 2VGVA 4ADEA 3WY7A 1AHEA 1TOIA 2OGEA 3LWSA 4E3QA 2W7EA 1AY8A 3B8XA 3K28A 2WB6A 5G4JA 3ZRRA 4A6UA 4LW4A 1WYVB 2DKBA 1SPAA 2VMXA 1YAAA 1BQDA 5DJ1A 4GE4A 4U1TA 1CZCA 1M0NA 2BI1A 1QJ3A 4WYEA 1BW0A 1WYTB 4XJPA 4EB7A 1LC7A 1S0AA 4F5JA 4ZSYA 5M46A 3EI9A 4CVQA 1OXPA 2HP2A 4UHOA 4PIWA 1Z7DA 4WLJA 1LKCA 3BWNC 5LH9A 1CZEA 1ELUA 1BJOB 3BN1A 2KFPA 1ARHA 3FZ8A 2CH2A 3NU8A 4A0FA 3P1TA 4KYOA 3RBLA 1QJ5A 2G6WA 1W23A 1AJSB 4Y0HA 1AMSA 3DXWA 4ADDA 2VMWA 1V72A 2ORDA 3F6TA 3MAUA 1N2TA 4ZWVA 2ZY3A 2PB2A 3OP7A 3QM2A 4GE9A 3LVMA 4F5HA 4BA4A 1PFFA 5EUDA 3FDBA 1FG3A 1WSTA 1LW4A 3A9XA 3VK2A 1KMJA 2D66A 2NMPA 1C4KA 1PG8A 5G2PA 2W7KA 4GDYA 4LC3A 3PDBB 1KKJA 1OXOA 1LC5A 2D65A 3AENA 1RVUA 3LVKA 1S07A 3GETA 1KMKA 1MLZA 2CTZA 3AEMA 3HQTA 3IHJA 1UKJA 1AKBA 3HVYA 3HT4A 2BWNA 2Z61A 2FN6A 4MKJA 4WB0B 1GD9A 5J8QA 1VP4A 4W8IA 1Y4IA 4A72A 2BI3A 1BJ4A 2W7LA 3FD0A 3N4XA 2C44A 1C7GA 4AO9A 2C7TA 2QLRA 4JEZA 1O62A 2VMYA 2WKAA 3DZZA 4QGRA 1UU1A 2C81A 2HUUA 2AY6A 4RIZA 4AOAA 2R0TA 4Q6RA 4AH3A 3WGBA 3JWBA 1CJ0A 2VMZA 3CAIA 4F5GA 3FQ7A 3PD6B 4OTLA 2HOYA 1B9HA 4A6RA 1TOKA 4H51A 2Z67A 2CY8A 1GC2A 5EUNA 1RV4A 4ADCA 2CJGA 4ZDPA 1KAFA 2BI5A 2EPJA 3RUYA 1ASFA 2V1PA 4ZM4A 1WYUB 1DJ9A 1GEWA 2VMQA 5HHYA 2YKXA 2CINA 4L0OA 2BIEA 4IYOA 3FZ6A 3AATA 3KE3A 1AMAA 3EI6A 1J32A 3A9ZA 1TOEA 3CQ6A 4K2BA 4RKDA 1AAMA 3N7NA 4K2IA 2HUFA 5G09A 5E5IA 2VI9A 4MY5A 3ACZA 3MBBA 3ELEA 4WD2A 2D7ZA 3ASBA 1WKGA 3NTJA 2AY8A 2ZJGA 2BHXA 4LNLA 4DQ6A 4WYDA 3GZDC 1ASGA 2W7HA 4ZDOA 3HDOA 4JEYA 1I48A 2ZC0A 3P6KA 3ZRQA 2QBTA 4EFFA 1S09A 3WKRA 4UHMA 1WKHA 2CJDA 3DR4A 5G2QA 2BYJA 2XH1A 4Q76A 3I16A 2DGKA 4AZKA 3N4RA 2Z9VA 3DR7A 4JE5D 3IF2A 4ZDLA 2DOUA 1I29A 3A9YA 2R5CA 2Z9WA 2ZYJA 4UQVA 4EU1A 2W8WA 4IXSA 1DKAA 4R5FA 3B46A 2VLHA 2JJFA 1P3WA 3AELA 3DU4A 1B5OA 4ZASA 2QA3A 3DRDA 2AY5A 1GDEA 2D61A 1G7XA 3NYUA 2JJGA 3RCHB 1DGDA 4WYCA 4WLHA 4Y0DA 1V2EA 3EZ1A 4B9BA 2VMVA 3NDNA 2VYCA 3TQXA 1BJWA 4LNJA 4TN4A 4W1WA 2VMOA 2VIBA 3WCNA 4IX8A 1GC3A 3II0A 3MC6C 1AX4A 3FKDA 4BHDA 4OMAA 1YIZA 1SZKA 1OHVA 4WP0A 4I8AA 3RI6A 4CBRA 2YCNA 4ISYA 2W7GA 2YKUA 4TV7A 4XJMA 1TOGA 1KKPA 2VMNA 1ASAA 1MAPA 3QN6A 3ATHA 1AY4A 1SFFA 1B5PA 7AATA 3HLMA 1SZUA 2HP1A 4OYTA 1EG5A 1VJOA 5EIGB 1ECXA 2O1BA 1JF9A 3JZLA 3NU7A 5HXXA 3CQ5A 5BJ3A 4J5UA 1ASMA 4F4EA 4CXQA 4ZWMA 3N4SA 1ASCA 3NX3A 3GR9A 3VOMA 1S08A 2HOXA 2R5EA 3QPGA 3FTBA 2FNIA 3WKSA 8AATA 1M0PA 1AAWA 1CL2A 2YHKA 4K05A 3AOWA 3PJ0A 5E3KA 3NRAA 5EFSA 3UWCA 4W5KA 2QB2A 3BV0A 1AHGA 3TFTA 1AHYA 1DTYA 1WYVA 4LNMA 3FFRA 3GBXA 1G4XA 5G0AA 4KAMA 3VK4A 5DX5A 2ZY5A 4OCAA 1MDOA 4P3MA 5G4IA 1SF2A 1UU2A 3E2ZB 4DGTA 1DJUA 1LS3A 4O6ZA 1QGNA 1CS1A 5E4ZA 1BJOA 9AATA 1O69A 1ARIA 3H7FA 1BQAA 1YIYA 3DYDA 2D63A 3OKSA 3QBOA 2VLFA 3JWAA 2D64A 1X29A 2BIAA 3ZZKA 3KKIA 1AJSA 1ARSA 1ZODA 1B4XA 3MAFB 1V2DA 1FC4A 4U2HA 4DBCA 1ASBA 1ASEA 4H63Q 1ASNA 2CJHA 2X8UA 4R5ZA 2YCTA 1I43A 2TPLA 1OATA 4A00A 1VEFA 4AO4A 1D7SA 3MADA 1G4VA 3MKJA 3F0HA 1MDXA 4RITA 3PDXA 1YJSA 2EO5A 2GMSA 4IY7A 4WYGA 4KXKA 1CQ6A 1O61A 2X5DA 4JEWA 3JU7A 4BMKA 1AY5A 3EZSA 4ZLVA 4K2MA 1X2AA 4F5FA 3BCAA 3RQ1A 1KL2A 1MLYA 2OGAA 2VGUA 1CQ7A 3PDBA 3L44A 4LW2A 1EJIA 2ZP7A 3WZFA 1SVVA 2BWOA 3G0TA 5F8VA 2FNUA 2EH6A 3FSLA 3PAAA 4GE7A 1AMRA 1JS6A 3AEMC 2Q7WA 3K40A 2DGLA 1CQ8A 3QI6A 4M2JA 4Q75A 1MGVA 5DJ9A 4WB0A 1ARGA 4WYAA 5M49A 3COGA 1M0OA 3R4TA 1XI9A 4EB5A 2AY9A 2V0YA 3FCRA 1BT4A 3I4JA 3EIAA 1ELQA 4WBTA 2O0RA 3EIBA 1DFOA 4MQQA 3N0LA 2AY2A 3ELPA 3FZ7A 1QITA 3DC1A 3PD6A 1LC8A 3G7QA 4B98A 1ASLA 3EUCA 2XBNA 5D5SA 4XJOA 4ITGA 1RVYA 1I41A 5C6UA 2D7YA 4M2KA 4GRXA 3A2BA 4PVFA 1GC0A 1KL1A 1QISA 2ZSLA 1TARA 1DJEA 1W7LA 4IW7A 2CFBA 2CB1A 3FQ8A 1B8GA 3EI7A 5M4DA 2W7JA 3LV2A 2Z9XA 2BIGA 1D7VA 2HORA 3LG0A 1TATA 4BA5A 2W8UA 1WYUA 1M4NA 2EZ1A 1ZOBA 3NUIA 2CSTA 2DGMA 5JAYA 2GMUA 2FM1A 3E9KA 1GC4A 5EAAA 5F9SA 1GBNA 4R8DA 2WK7A 2W8TA 2Z9UA 1AKAA 4E77A 3CBFA 4MSOA 4PFNA 3H9XA 4A0RA 3RBFA 4IXOA 1MAQA 1YJYA 1AHFA 4Q31A 3T32A 4UOYA 1DGEA 4PFFA 3NYTA
chains in the Genus database with same CATH topology
4MGRA 4HF8A 2GSAA 4JEVA 5LHAA 2BI9A 3A8UX 4W1XA 2BKWA 3TFUA 5BJ4A 3BWNA 4FL0A 4OBVA 1YNUA 3FVXA 5HDMA 3B1CA 1W3UA 2AEUA 2HZPA 2O7CA 1ARTA 5FT4A 2VMUA 2AY7A 1CL1A 4ZSWA 2F8JA 2VMSA 3D6KA 4OBUA 4F5MA 1Z3ZA 3USFA 1M6SA 4MKKA 4RM1A 2E7UA 5IWQA 2VGWA 3BS8A 2GQNA 4F5IA 1EQBA 2G7JA 4M2MA 3RCHA 2A1VA 1JS3A 1H1CA 2PB0A 3UAKA 2HOZA 4CBSA 4JE5A 3N5MA 2OKJA 4RLGA 1ASDA 3B1EA 1N31A 2OKKA 4OC9A 2YCPA 3BCBA 4OT8A 1PMOA 4J8LA 1LW5A 1RV3A 2CH1A 1AIBA 3AEJA 5FT5A 3ECDA 3Q8NA 1IX6A 3LVLB 3AENB 3HMUA 4E1OA 3GZCA 3ISLA 2AEVA 1V2FA 2AY4A 3WGCA 4N0BA 3ASAA 3E6GA 1D7RA 2EZ2A 4GEBA 2PO3A 2ZY2A 1WYTA 1AMQA 3BC8A 3ZRPA 3TATA 5EUEA 1IAXA 1GEYA 1G7WA 1IX7A 3AOVA 4W91A 4F5LA 2OATA 2VMPA 3KGXA 2Z20A 2W7MA 2W7FA 5KTBA 1SZSA 2BI2A 4WXGA 3G8MA 3FFHA 5EIGA 1U08A 1BJNA 3I5TA 4JEXA 3F9TA 3E2YA 4ATQA 1X0MA 2YKVA 2W8VA 3BCXA 3M5UA 3R9AA 1IVRA 4RAEA 1YOOA 4AZJA 3VP6A 1IJIA 4WYFA 4MQRA 4ZAHA 4P7YA 1IAYA 3N75A 2W8JA 2YRRA 3W1IA 1OHWA 3JW9A 2VI8A 4UHNA 1MDZA 2JG2A 3AEJC 3WLXA 1GEXA 5TF5A 2ZSMA 3GJUA 2VGTA 4XK1A 2AY3A 5FT8A 3VK3A 3B1DA 3DXVA 2W7DA 3K7YA 3PIUA 2EYQA 1M7YA 2ZY4A 4HVKA 3E2ZA 3BB8A 2JJHA 3H14A 4Y0IA 4E3RA 3L8AA 3AEPA 4IYOB 4R2NA 3AV7A 1OHYA 2E7IA 3E2FA 3CQ4A 1AJRA 4BQ0A 3W1HA 1JG8A 3QHXA 2ZUKA 3UE8A 1E5FA 1E5EA 2EGYA 4W1VA 2E7JA 1O4SA 1H0CA 3MAFA 3GZDA 1AIAA 2QB3A 2RFVA 2Z1ZA 2JGTA 2W7IA 1AKCA 2YKYA 1BS0A 4A6TA 4EMYA 2CANA 2JISA 2FYFA 2FKIA 5DB5A 4WXBA 2AATA 1GCKA 2GB3A 3WCOA 1J04A 1QZ9A 2Z1YA 1C9CA 3PA9A 3ZZJA 1C0NA 3JTXA 1AICA 2QMAA 3GSBA 3AEOA 3BWOA 4RKCA 2WK8A 1UU0A 2R5CB 2D5YA 1LK9A 2HUIA 3NUBA 4N0WA 4XAUA 5K8BA 5D95A 4MQPA 3LVJA 3MEBA 4JF0A 5FT6A 1D7UA 3PPLA 1XEYA 2X3LA 3HBXA 4RJYA 5M4BA 2BWPA 4A0HA 2DR1A 4ATPA 1FG7A 3GWPA 3VAXA 3E77A 3QGUA 3W1JA 3FRKA 4CXRA 1ZC9A 2QSRA 1BKGA 2C0RA 4XJLA 4ZM3A 5I92A 1TPLA 3NNKA 4FFCA 4A0GA 1C7OA 3TCMA 3FDDA 1IX8A 5EQCA 3MC6A 5AX8A 3DODA 1IUGA 1M0QA 1TOJA 1N8PA 3LY1A 1S06A 4F5KA 1AHXA 1C7NA 1QIRA 4NOGA 2E54A 2R2NA 4XQ2A 1IBJA 1PMMA 3WX9A 2VMTA 2OQXA 3NYSA 2X5FA 3KGWA 2VIAA 3EI5A 1ORDA 2VMRA 2YOBA 4TMRA 1W7MA 1D2FA 1YJZA 4WXFA 4ADBA 3HL2A 1T3IA 4XEWA 4JF1A 1B9IA 3FVUA 3FVSA 4ITXA 1W7NA 2VGSA 1TASA 2AY1A 2WK9A 1X28A 2FQ6A 3EI8A 2YRIA 3PGYA 2BYLA 2JJEA 4RJ0A 2VGZA 4GSAA 4IXZA 5EAVA 1M32A 2DKJA 3FQAA 2VGVA 4ADEA 3WY7A 1AHEA 1TOIA 2OGEA 3LWSA 4E3QA 2W7EA 1AY8A 3B8XA 3K28A 2WB6A 5G4JA 3ZRRA 4A6UA 4LW4A 1WYVB 2DKBA 1SPAA 2VMXA 1YAAA 1BQDA 5DJ1A 4GE4A 4U1TA 1CZCA 1M0NA 2BI1A 1QJ3A 4WYEA 1BW0A 1WYTB 4XJPA 4EB7A 1LC7A 1S0AA 4F5JA 4ZSYA 5M46A 3EI9A 4CVQA 1OXPA 2HP2A 4UHOA 4PIWA 1Z7DA 4WLJA 1LKCA 3BWNC 5LH9A 1CZEA 1ELUA 1BJOB 3BN1A 2KFPA 1ARHA 3FZ8A 2CH2A 3NU8A 4A0FA 3P1TA 4KYOA 3RBLA 1QJ5A 2G6WA 1W23A 1AJSB 4Y0HA 1AMSA 3DXWA 4ADDA 2VMWA 1V72A 2ORDA 3F6TA 3MAUA 1N2TA 4ZWVA 2ZY3A 2PB2A 3OP7A 3QM2A 4GE9A 3LVMA 4F5HA 4BA4A 1PFFA 5EUDA 3FDBA 1FG3A 1WSTA 1LW4A 3A9XA 3VK2A 1KMJA 2D66A 2NMPA 1C4KA 1PG8A 5G2PA 2W7KA 4GDYA 4LC3A 3PDBB 1KKJA 1OXOA 1LC5A 2D65A 3AENA 1RVUA 3LVKA 1S07A 3GETA 1KMKA 1MLZA 2CTZA 3AEMA 3HQTA 3IHJA 1UKJA 1AKBA 3HVYA 3HT4A 2BWNA 2Z61A 2FN6A 4MKJA 4WB0B 1GD9A 5J8QA 1VP4A 4W8IA 1Y4IA 4A72A 2BI3A 1BJ4A 2W7LA 3FD0A 3N4XA 2C44A 1C7GA 4AO9A 2C7TA 2QLRA 4JEZA 1O62A 2VMYA 2WKAA 3DZZA 4QGRA 1UU1A 2C81A 2HUUA 2AY6A 4RIZA 4AOAA 2R0TA 4Q6RA 4AH3A 3WGBA 3JWBA 1CJ0A 2VMZA 3CAIA 4F5GA 3FQ7A 3PD6B 4OTLA 2HOYA 1B9HA 4A6RA 1TOKA 4H51A 2Z67A 2CY8A 1GC2A 5EUNA 1RV4A 4ADCA 2CJGA 4ZDPA 2BI5A 2EPJA 3RUYA 1ASFA 2V1PA 4ZM4A 1WYUB 1DJ9A 1GEWA 2VMQA 5HHYA 2YKXA 2CINA 4L0OA 2BIEA 4IYOA 3FZ6A 3AATA 3KE3A 1AMAA 3EI6A 1J32A 3A9ZA 1TOEA 3CQ6A 4K2BA 4RKDA 1AAMA 3N7NA 4K2IA 2HUFA 5G09A 5E5IA 2VI9A 4MY5A 3ACZA 3MBBA 3ELEA 4WD2A 2D7ZA 3ASBA 1WKGA 3NTJA 2AY8A 2ZJGA 2BHXA 4LNLA 4DQ6A 4WYDA 3GZDC 1ASGA 2W7HA 4ZDOA 3HDOA 4JEYA 1I48A 2ZC0A 3P6KA 3ZRQA 2QBTA 4EFFA 1S09A 3WKRA 4UHMA 1WKHA 2CJDA 3DR4A 5G2QA 2BYJA 2XH1A 4Q76A 3I16A 2DGKA 4AZKA 3N4RA 2Z9VA 3DR7A 4JE5D 3IF2A 4ZDLA 2DOUA 1I29A 3A9YA 2R5CA 2Z9WA 2ZYJA 4UQVA 4EU1A 2W8WA 4IXSA 1DKAA 4R5FA 3B46A 2VLHA 2JJFA 1P3WA 3AELA 3DU4A 1B5OA 4ZASA 2QA3A 3DRDA 2AY5A 1GDEA 2D61A 1G7XA 3NYUA 2JJGA 3RCHB 1DGDA 4WYCA 4WLHA 4Y0DA 1V2EA 3EZ1A 4B9BA 2VMVA 3NDNA 2VYCA 3TQXA 1BJWA 4LNJA 4TN4A 4W1WA 2VMOA 2VIBA 3WCNA 4IX8A 1GC3A 3II0A 3MC6C 1AX4A 3FKDA 4BHDA 4OMAA 1YIZA 1SZKA 1OHVA 4WP0A 4I8AA 3RI6A 4CBRA 2YCNA 4ISYA 2W7GA 2YKUA 4TV7A 4XJMA 1TOGA 1KKPA 2VMNA 1ASAA 1MAPA 3QN6A 3ATHA 1AY4A 1SFFA 1B5PA 7AATA 3HLMA 1SZUA 2HP1A 4OYTA 1EG5A 1VJOA 5EIGB 1ECXA 2O1BA 1JF9A 3JZLA 3NU7A 5HXXA 3CQ5A 5BJ3A 4J5UA 1ASMA 4F4EA 4CXQA 4ZWMA 3N4SA 1ASCA 3NX3A 3GR9A 3VOMA 1S08A 2HOXA 2R5EA 3QPGA 3FTBA 2FNIA 3WKSA 8AATA 1M0PA 1AAWA 1CL2A 2YHKA 4K05A 3AOWA 3PJ0A 5E3KA 3NRAA 5EFSA 3UWCA 4W5KA 2QB2A 3BV0A 1AHGA 3TFTA 1AHYA 1DTYA 1WYVA 4LNMA 3FFRA 3GBXA 1G4XA 5G0AA 4KAMA 3VK4A 5DX5A 2ZY5A 4OCAA 1MDOA 4P3MA 5G4IA 1SF2A 1UU2A 3E2ZB 4DGTA 1DJUA 1LS3A 4O6ZA 1QGNA 1CS1A 5E4ZA 1BJOA 9AATA 1O69A 1ARIA 3H7FA 1BQAA 1YIYA 3DYDA 2D63A 3OKSA 3QBOA 2VLFA 3JWAA 2D64A 1X29A 2BIAA 3ZZKA 3KKIA 1AJSA 1ARSA 1ZODA 1B4XA 3MAFB 1V2DA 1FC4A 4U2HA 4DBCA 1ASBA 1ASEA 4H63Q 1ASNA 2CJHA 2X8UA 4R5ZA 2YCTA 1I43A 2TPLA 1OATA 4A00A 1VEFA 4AO4A 1D7SA 3MADA 1G4VA 3MKJA 3F0HA 1MDXA 4RITA 3PDXA 1YJSA 2EO5A 2GMSA 4IY7A 4WYGA 4KXKA 1CQ6A 1O61A 2X5DA 4JEWA 3JU7A 4BMKA 1AY5A 3EZSA 4ZLVA 4K2MA 1X2AA 4F5FA 3BCAA 3RQ1A 1KL2A 1MLYA 2OGAA 2VGUA 1CQ7A 3PDBA 3L44A 4LW2A 1EJIA 2ZP7A 3WZFA 1SVVA 2BWOA 3G0TA 5F8VA 2FNUA 2EH6A 3FSLA 3PAAA 4GE7A 1AMRA 1JS6A 3AEMC 2Q7WA 3K40A 2DGLA 1CQ8A 3QI6A 4M2JA 4Q75A 1MGVA 5DJ9A 4WB0A 1ARGA 4WYAA 5M49A 3COGA 1M0OA 3R4TA 1XI9A 4EB5A 2AY9A 2V0YA 3FCRA 1BT4A 3I4JA 3EIAA 1ELQA 4WBTA 2O0RA 3EIBA 1DFOA 4MQQA 3N0LA 2AY2A 3ELPA 3FZ7A 1QITA 3DC1A 3PD6A 1LC8A 3G7QA 4B98A 1ASLA 3EUCA 2XBNA 5D5SA 4XJOA 4ITGA 1RVYA 1I41A 5C6UA 2D7YA 4M2KA 4GRXA 3A2BA 4PVFA 1GC0A 1KL1A 1QISA 2ZSLA 1TARA 1DJEA 1W7LA 4IW7A 2CFBA 2CB1A 3FQ8A 1B8GA 3EI7A 5M4DA 2W7JA 3LV2A 2Z9XA 2BIGA 1D7VA 2HORA 3LG0A 1TATA 4BA5A 2W8UA 1WYUA 1M4NA 2EZ1A 1ZOBA 3NUIA 2CSTA 2DGMA 5JAYA 2GMUA 2FM1A 3E9KA 1GC4A 5EAAA 5F9SA 1GBNA 4R8DA 2WK7A 2W8TA 2Z9UA 1AKAA 4E77A 3CBFA 4MSOA 4PFNA 3H9XA 4A0RA 3RBFA 4IXOA 1MAQA 1YJYA 1AHFA 4Q31A 3T32A 4UOYA 1DGEA 4PFFA 3NYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGR A;  4HF8 A;  2GSA A;  4JEV A;  5LHA A;  2BI9 A;  3A8U X;  4W1X A;  2BKW A;  3TFU A;  5BJ4 A;  3BWN A;  4FL0 A;  4OBV A;  1YNU A;  3FVX A;  5HDM A;  3B1C A;  1W3U A;  2AEU A;  2HZP A;  2O7C A;  1ART A;  5FT4 A;  2VMU A;  2AY7 A;  1CL1 A;  4ZSW A;  2F8J A;  2VMS A;  3D6K A;  4OBU A;  4F5M A;  1Z3Z A;  3USF A;  1M6S A;  4MKK A;  4RM1 A;  2E7U A;  5IWQ A;  2VGW A;  3BS8 A;  2GQN A;  4F5I A;  1EQB A;  4M2M A;  3RCH A;  1JS3 A;  1H1C A;  2PB0 A;  3UAK A;  2HOZ A;  4CBS A;  4JE5 A;  3N5M A;  2OKJ A;  4RLG A;  1ASD A;  3B1E A;  1N31 A;  2OKK A;  4OC9 A;  2YCP A;  3BCB A;  4OT8 A;  1PMO A;  4J8L A;  1LW5 A;  1RV3 A;  2CH1 A;  1AIB A;  3AEJ A;  5FT5 A;  3ECD A;  3Q8N A;  1IX6 A;  3LVL B;  3AEN B;  3HMU A;  4E1O A;  3GZC A;  3ISL A;  2AEV A;  1V2F A;  2AY4 A;  3WGC A;  4N0B A;  3ASA A;  3E6G A;  1D7R A;  2EZ2 A;  4GEB A;  2PO3 A;  2ZY2 A;  1WYT A;  1AMQ A;  3BC8 A;  3ZRP A;  3TAT A;  5EUE A;  1IAX A;  1GEY A;  1G7W A;  1IX7 A;  3AOV A;  4W91 A;  4F5L A;  2OAT A;  2VMP A;  3KGX A;  2Z20 A;  2W7M A;  2W7F A;  1SZS A;  2BI2 A;  4WXG A;  3G8M A;  3FFH A;  5EIG A;  1U08 A;  1BJN A;  3I5T A;  4JEX A;  3F9T A;  3E2Y A;  4ATQ A;  1X0M A;  2YKV A;  2W8V A;  3BCX A;  3M5U A;  3R9A A;  1IVR A;  4RAE A;  1YOO A;  4AZJ A;  3VP6 A;  1IJI A;  4WYF A;  4MQR A;  4ZAH A;  4P7Y A;  1IAY A;  3N75 A;  2W8J A;  2YRR A;  3W1I A;  1OHW A;  3JW9 A;  2VI8 A;  4UHN A;  1MDZ A;  2JG2 A;  3AEJ C;  3WLX A;  1GEX A;  5TF5 A;  2ZSM A;  3GJU A;  2VGT A;  4XK1 A;  2AY3 A;  5FT8 A;  3VK3 A;  3B1D A;  3DXV A;  2W7D A;  3K7Y A;  3PIU A;  1M7Y A;  2ZY4 A;  4HVK A;  3E2Z A;  3BB8 A;  2JJH A;  3H14 A;  4Y0I A;  4E3R A;  3L8A A;  3AEP A;  4IYO B;  4R2N A;  3AV7 A;  1OHY A;  2E7I A;  3E2F A;  3CQ4 A;  1AJR A;  4BQ0 A;  3W1H A;  1JG8 A;  3QHX A;  2ZUK A;  3UE8 A;  1E5F A;  1E5E A;  2EGY A;  4W1V A;  2E7J A;  1O4S A;  1H0C A;  3MAF A;  3GZD A;  1AIA A;  2QB3 A;  2RFV A;  2Z1Z A;  2JGT A;  2W7I A;  1AKC A;  2YKY A;  1BS0 A;  4A6T A;  4EMY A;  2CAN A;  2JIS A;  2FYF A;  5DB5 A;  4WXB A;  2AAT A;  1GCK A;  2GB3 A;  3WCO A;  1J04 A;  1QZ9 A;  2Z1Y A;  1C9C A;  3PA9 A;  3ZZJ A;  1C0N A;  3JTX A;  1AIC A;  2QMA A;  3GSB A;  3AEO A;  3BWO A;  4RKC A;  2WK8 A;  1UU0 A;  2R5C B;  2D5Y A;  1LK9 A;  2HUI A;  3NUB A;  4N0W A;  4XAU A;  5K8B A;  5D95 A;  4MQP A;  3LVJ A;  3MEB A;  4JF0 A;  5FT6 A;  1D7U A;  3PPL A;  1XEY A;  2X3L A;  3HBX A;  4RJY A;  5M4B A;  2BWP A;  4A0H A;  2DR1 A;  4ATP A;  1FG7 A;  3GWP A;  3VAX A;  3E77 A;  3QGU A;  3W1J A;  3FRK A;  4CXR A;  1ZC9 A;  1BKG A;  2C0R A;  4XJL A;  4ZM3 A;  5I92 A;  1TPL A;  3NNK A;  4FFC A;  4A0G A;  1C7O A;  3TCM A;  3FDD A;  1IX8 A;  5EQC A;  3MC6 A;  5AX8 A;  3DOD A;  1IUG A;  1M0Q A;  1TOJ A;  1N8P A;  3LY1 A;  1S06 A;  4F5K A;  1AHX A;  1C7N A;  1QIR A;  4NOG A;  2E54 A;  2R2N A;  4XQ2 A;  1IBJ A;  1PMM A;  3WX9 A;  2VMT A;  2OQX A;  3NYS A;  2X5F A;  3KGW A;  2VIA A;  3EI5 A;  1ORD A;  2VMR A;  2YOB A;  4TMR A;  1W7M A;  1D2F A;  1YJZ A;  4WXF A;  4ADB A;  3HL2 A;  1T3I A;  4XEW A;  4JF1 A;  1B9I A;  3FVU A;  3FVS A;  4ITX A;  1W7N A;  2VGS A;  1TAS A;  2AY1 A;  2WK9 A;  1X28 A;  2FQ6 A;  3EI8 A;  2YRI A;  3PGY A;  2BYL A;  2JJE A;  4RJ0 A;  2VGZ A;  4GSA A;  4IXZ A;  5EAV A;  1M32 A;  2DKJ A;  3FQA A;  2VGV A;  4ADE A;  3WY7 A;  1AHE A;  1TOI A;  2OGE A;  3LWS A;  4E3Q A;  2W7E A;  1AY8 A;  3B8X A;  3K28 A;  5G4J A;  3ZRR A;  4A6U A;  4LW4 A;  1WYV B;  2DKB A;  1SPA A;  2VMX A;  1YAA A;  1BQD A;  5DJ1 A;  4GE4 A;  4U1T A;  1CZC A;  1M0N A;  2BI1 A;  1QJ3 A;  4WYE A;  1BW0 A;  1WYT B;  4XJP A;  4EB7 A;  1LC7 A;  1S0A A;  4F5J A;  4ZSY A;  5M46 A;  3EI9 A;  4CVQ A;  1OXP A;  2HP2 A;  4UHO A;  4PIW A;  1Z7D A;  4WLJ A;  1LKC A;  3BWN C;  5LH9 A;  1CZE A;  1ELU A;  1BJO B;  3BN1 A;  1ARH A;  3FZ8 A;  2CH2 A;  3NU8 A;  4A0F A;  3P1T A;  4KYO A;  3RBL A;  1QJ5 A;  2G6W A;  1W23 A;  1AJS B;  4Y0H A;  1AMS A;  3DXW A;  4ADD A;  2VMW A;  1V72 A;  2ORD A;  3F6T A;  3MAU A;  1N2T A;  4ZWV A;  2ZY3 A;  2PB2 A;  3OP7 A;  3QM2 A;  4GE9 A;  3LVM A;  4F5H A;  4BA4 A;  1PFF A;  5EUD A;  3FDB A;  1FG3 A;  1WST A;  1LW4 A;  3A9X A;  3VK2 A;  1KMJ A;  2D66 A;  2NMP A;  1C4K A;  1PG8 A;  5G2P A;  2W7K A;  4GDY A;  4LC3 A;  3PDB B;  1KKJ A;  1OXO A;  1LC5 A;  2D65 A;  3AEN A;  1RVU A;  3LVK A;  1S07 A;  3GET A;  1KMK A;  1MLZ A;  2CTZ A;  3AEM A;  3HQT A;  3IHJ A;  1UKJ A;  1AKB A;  3HVY A;  3HT4 A;  2BWN A;  2Z61 A;  2FN6 A;  4MKJ A;  4WB0 B;  1GD9 A;  5J8Q A;  1VP4 A;  4W8I A;  1Y4I A;  4A72 A;  2BI3 A;  1BJ4 A;  2W7L A;  3FD0 A;  2C44 A;  1C7G A;  4AO9 A;  2C7T A;  2QLR A;  4JEZ A;  1O62 A;  2VMY A;  2WKA A;  3DZZ A;  4QGR A;  1UU1 A;  2C81 A;  2HUU A;  2AY6 A;  4RIZ A;  4AOA A;  2R0T A;  4Q6R A;  4AH3 A;  3WGB A;  3JWB A;  1CJ0 A;  2VMZ A;  3CAI A;  4F5G A;  3FQ7 A;  3PD6 B;  4OTL A;  2HOY A;  1B9H A;  4A6R A;  1TOK A;  4H51 A;  2Z67 A;  2CY8 A;  1GC2 A;  5EUN A;  1RV4 A;  4ADC A;  2CJG A;  4ZDP A;  2BI5 A;  2EPJ A;  3RUY A;  1ASF A;  2V1P A;  4ZM4 A;  1WYU B;  1DJ9 A;  1GEW A;  2VMQ A;  5HHY A;  2YKX A;  2CIN A;  4L0O A;  2BIE A;  4IYO A;  3FZ6 A;  3AAT A;  3KE3 A;  1AMA A;  3EI6 A;  1J32 A;  3A9Z A;  1TOE A;  3CQ6 A;  4K2B A;  4RKD A;  1AAM A;  4K2I A;  2HUF A;  5G09 A;  5E5I A;  2VI9 A;  4MY5 A;  3ACZ A;  3MBB A;  3ELE A;  4WD2 A;  2D7Z A;  3ASB A;  1WKG A;  3NTJ A;  2AY8 A;  2ZJG A;  2BHX A;  4LNL A;  4DQ6 A;  4WYD A;  3GZD C;  1ASG A;  2W7H A;  4ZDO A;  3HDO A;  4JEY A;  1I48 A;  2ZC0 A;  3P6K A;  3ZRQ A;  2QBT A;  4EFF A;  1S09 A;  3WKR A;  4UHM A;  1WKH A;  2CJD A;  3DR4 A;  5G2Q A;  2BYJ A;  2XH1 A;  4Q76 A;  3I16 A;  2DGK A;  4AZK A;  2Z9V A;  3DR7 A;  4JE5 D;  3IF2 A;  4ZDL A;  2DOU A;  1I29 A;  3A9Y A;  2R5C A;  2Z9W A;  2ZYJ A;  4UQV A;  4EU1 A;  2W8W A;  4IXS A;  1DKA A;  4R5F A;  3B46 A;  2VLH A;  2JJF A;  1P3W A;  3AEL A;  3DU4 A;  1B5O A;  4ZAS A;  2QA3 A;  3DRD A;  2AY5 A;  1GDE A;  2D61 A;  1G7X A;  3NYU A;  2JJG A;  3RCH B;  1DGD A;  4WYC A;  4WLH A;  4Y0D A;  1V2E A;  3EZ1 A;  4B9B A;  2VMV A;  3NDN A;  2VYC A;  3TQX A;  1BJW A;  4LNJ A;  4TN4 A;  4W1W A;  2VMO A;  2VIB A;  3WCN A;  4IX8 A;  1GC3 A;  3II0 A;  3MC6 C;  1AX4 A;  3FKD A;  4BHD A;  4OMA A;  1YIZ A;  1SZK A;  1OHV A;  4WP0 A;  4I8A A;  3RI6 A;  4CBR A;  2YCN A;  4ISY A;  2W7G A;  2YKU A;  4TV7 A;  4XJM A;  1TOG A;  1KKP A;  2VMN A;  1ASA A;  1MAP A;  3QN6 A;  3ATH A;  1AY4 A;  1SFF A;  1B5P A;  7AAT A;  3HLM A;  1SZU A;  2HP1 A;  4OYT A;  1EG5 A;  1VJO A;  5EIG B;  1ECX A;  2O1B A;  1JF9 A;  3JZL A;  3NU7 A;  5HXX A;  3CQ5 A;  5BJ3 A;  4J5U A;  1ASM A;  4F4E A;  4CXQ A;  4ZWM A;  1ASC A;  3NX3 A;  3GR9 A;  3VOM A;  1S08 A;  2HOX A;  2R5E A;  3QPG A;  3FTB A;  2FNI A;  3WKS A;  8AAT A;  1M0P A;  1AAW A;  1CL2 A;  2YHK A;  3AOW A;  3PJ0 A;  5E3K A;  3NRA A;  5EFS A;  3UWC A;  4W5K A;  2QB2 A;  3BV0 A;  1AHG A;  3TFT A;  1AHY A;  1DTY A;  1WYV A;  4LNM A;  3FFR A;  3GBX A;  1G4X A;  5G0A A;  4KAM A;  3VK4 A;  5DX5 A;  2ZY5 A;  4OCA A;  1MDO A;  4P3M A;  5G4I A;  1SF2 A;  1UU2 A;  3E2Z B;  4DGT A;  1DJU A;  1LS3 A;  4O6Z A;  1QGN A;  1CS1 A;  5E4Z A;  1BJO A;  9AAT A;  1O69 A;  1ARI A;  3H7F A;  1BQA A;  1YIY A;  3DYD A;  2D63 A;  3OKS A;  3QBO A;  2VLF A;  3JWA A;  2D64 A;  1X29 A;  2BIA A;  3ZZK A;  3KKI A;  1AJS A;  1ARS A;  1ZOD A;  1B4X A;  3MAF B;  1V2D A;  1FC4 A;  4U2H A;  4DBC A;  1ASB A;  1ASE A;  1ASN A;  2CJH A;  2X8U A;  4R5Z A;  2YCT A;  1I43 A;  2TPL A;  1OAT A;  4A00 A;  1VEF A;  4AO4 A;  1D7S A;  3MAD A;  1G4V A;  3MKJ A;  3F0H A;  1MDX A;  4RIT A;  3PDX A;  1YJS A;  2EO5 A;  2GMS A;  4IY7 A;  4WYG A;  4KXK A;  1CQ6 A;  1O61 A;  2X5D A;  4JEW A;  3JU7 A;  4BMK A;  1AY5 A;  3EZS A;  4ZLV A;  4K2M A;  1X2A A;  4F5F A;  3BCA A;  3RQ1 A;  1KL2 A;  1MLY A;  2OGA A;  2VGU A;  1CQ7 A;  3PDB A;  3L44 A;  4LW2 A;  1EJI A;  2ZP7 A;  3WZF A;  1SVV A;  2BWO A;  3G0T A;  5F8V A;  2FNU A;  2EH6 A;  3FSL A;  3PAA A;  4GE7 A;  1AMR A;  1JS6 A;  3AEM C;  2Q7W A;  3K40 A;  2DGL A;  1CQ8 A;  3QI6 A;  4M2J A;  4Q75 A;  1MGV A;  5DJ9 A;  4WB0 A;  1ARG A;  4WYA A;  5M49 A;  3COG A;  1M0O A;  3R4T A;  1XI9 A;  4EB5 A;  2AY9 A;  2V0Y A;  3FCR A;  1BT4 A;  3I4J A;  3EIA A;  1ELQ A;  4WBT A;  2O0R A;  3EIB A;  1DFO A;  4MQQ A;  3N0L A;  2AY2 A;  3ELP A;  3FZ7 A;  1QIT A;  3DC1 A;  3PD6 A;  1LC8 A;  3G7Q A;  4B98 A;  1ASL A;  3EUC A;  2XBN A;  5D5S A;  4XJO A;  4ITG A;  1RVY A;  1I41 A;  5C6U A;  2D7Y A;  4M2K A;  4GRX A;  3A2B A;  4PVF A;  1GC0 A;  1KL1 A;  1QIS A;  2ZSL A;  1TAR A;  1DJE A;  1W7L A;  4IW7 A;  2CFB A;  2CB1 A;  3FQ8 A;  1B8G A;  3EI7 A;  5M4D A;  2W7J A;  3LV2 A;  2Z9X A;  2BIG A;  1D7V A;  2HOR A;  3LG0 A;  1TAT A;  4BA5 A;  2W8U A;  1WYU A;  1M4N A;  2EZ1 A;  1ZOB A;  3NUI A;  2CST A;  2DGM A;  5JAY A;  2GMU A;  2FM1 A;  3E9K A;  1GC4 A;  5EAA A;  5F9S A;  1GBN A;  4R8D A;  2WK7 A;  2W8T A;  2Z9U A;  1AKA A;  4E77 A;  3CBF A;  4MSO A;  4PFN A;  4A0R A;  3RBF A;  4IXO A;  1MAQ A;  1YJY A;  1AHF A;  4Q31 A;  3T32 A;  4UOY A;  1DGE A;  4PFF A;  3NYT A; 
#chains in the Genus database with same CATH topology
 4MGR A;  4HF8 A;  2GSA A;  4JEV A;  5LHA A;  2BI9 A;  3A8U X;  4W1X A;  2BKW A;  3TFU A;  5BJ4 A;  3BWN A;  4FL0 A;  4OBV A;  1YNU A;  3FVX A;  5HDM A;  3B1C A;  1W3U A;  2AEU A;  2HZP A;  2O7C A;  1ART A;  5FT4 A;  2VMU A;  2AY7 A;  1CL1 A;  4ZSW A;  2F8J A;  2VMS A;  3D6K A;  4OBU A;  4F5M A;  1Z3Z A;  3USF A;  1M6S A;  4MKK A;  4RM1 A;  2E7U A;  5IWQ A;  2VGW A;  3BS8 A;  2GQN A;  4F5I A;  1EQB A;  2G7J A;  4M2M A;  3RCH A;  2A1V A;  1JS3 A;  1H1C A;  2PB0 A;  3UAK A;  2HOZ A;  4CBS A;  4JE5 A;  3N5M A;  2OKJ A;  4RLG A;  1ASD A;  3B1E A;  1N31 A;  2OKK A;  4OC9 A;  2YCP A;  3BCB A;  4OT8 A;  1PMO A;  4J8L A;  1LW5 A;  1RV3 A;  2CH1 A;  1AIB A;  3AEJ A;  5FT5 A;  3ECD A;  3Q8N A;  1IX6 A;  3LVL B;  3AEN B;  3HMU A;  4E1O A;  3GZC A;  3ISL A;  2AEV A;  1V2F A;  2AY4 A;  3WGC A;  4N0B A;  3ASA A;  3E6G A;  1D7R A;  2EZ2 A;  4GEB A;  2PO3 A;  2ZY2 A;  1WYT A;  1AMQ A;  3BC8 A;  3ZRP A;  3TAT A;  5EUE A;  1IAX A;  1GEY A;  1G7W A;  1IX7 A;  3AOV A;  4W91 A;  4F5L A;  2OAT A;  2VMP A;  3KGX A;  2Z20 A;  2W7M A;  2W7F A;  5KTB A;  1SZS A;  2BI2 A;  4WXG A;  3G8M A;  3FFH A;  5EIG A;  1U08 A;  1BJN A;  3I5T A;  4JEX A;  3F9T A;  3E2Y A;  4ATQ A;  1X0M A;  2YKV A;  2W8V A;  3BCX A;  3M5U A;  3R9A A;  1IVR A;  4RAE A;  1YOO A;  4AZJ A;  3VP6 A;  1IJI A;  4WYF A;  4MQR A;  4ZAH A;  4P7Y A;  1IAY A;  3N75 A;  2W8J A;  2YRR A;  3W1I A;  1OHW A;  3JW9 A;  2VI8 A;  4UHN A;  1MDZ A;  2JG2 A;  3AEJ C;  3WLX A;  1GEX A;  5TF5 A;  2ZSM A;  3GJU A;  2VGT A;  4XK1 A;  2AY3 A;  5FT8 A;  3VK3 A;  3B1D A;  3DXV A;  2W7D A;  3K7Y A;  3PIU A;  2EYQ A;  1M7Y A;  2ZY4 A;  4HVK A;  3E2Z A;  3BB8 A;  2JJH A;  3H14 A;  4Y0I A;  4E3R A;  3L8A A;  3AEP A;  4IYO B;  4R2N A;  3AV7 A;  1OHY A;  2E7I A;  3E2F A;  3CQ4 A;  1AJR A;  4BQ0 A;  3W1H A;  1JG8 A;  3QHX A;  2ZUK A;  3UE8 A;  1E5F A;  1E5E A;  2EGY A;  4W1V A;  2E7J A;  1O4S A;  1H0C A;  3MAF A;  3GZD A;  1AIA A;  2QB3 A;  2RFV A;  2Z1Z A;  2JGT A;  2W7I A;  1AKC A;  2YKY A;  1BS0 A;  4A6T A;  4EMY A;  2CAN A;  2JIS A;  2FYF A;  2FKI A;  5DB5 A;  4WXB A;  2AAT A;  1GCK A;  2GB3 A;  3WCO A;  1J04 A;  1QZ9 A;  2Z1Y A;  1C9C A;  3PA9 A;  3ZZJ A;  1C0N A;  3JTX A;  1AIC A;  2QMA A;  3GSB A;  3AEO A;  3BWO A;  4RKC A;  2WK8 A;  1UU0 A;  2R5C B;  2D5Y A;  1LK9 A;  2HUI A;  3NUB A;  4N0W A;  4XAU A;  5K8B A;  5D95 A;  4MQP A;  3LVJ A;  3MEB A;  4JF0 A;  5FT6 A;  1D7U A;  3PPL A;  1XEY A;  2X3L A;  3HBX A;  4RJY A;  5M4B A;  2BWP A;  4A0H A;  2DR1 A;  4ATP A;  1FG7 A;  3GWP A;  3VAX A;  3E77 A;  3QGU A;  3W1J A;  3FRK A;  4CXR A;  1ZC9 A;  2QSR A;  1BKG A;  2C0R A;  4XJL A;  4ZM3 A;  5I92 A;  1TPL A;  3NNK A;  4FFC A;  4A0G A;  1C7O A;  3TCM A;  3FDD A;  1IX8 A;  5EQC A;  3MC6 A;  5AX8 A;  3DOD A;  1IUG A;  1M0Q A;  1TOJ A;  1N8P A;  3LY1 A;  1S06 A;  4F5K A;  1AHX A;  1C7N A;  1QIR A;  4NOG A;  2E54 A;  2R2N A;  4XQ2 A;  1IBJ A;  1PMM A;  3WX9 A;  2VMT A;  2OQX A;  3NYS A;  2X5F A;  3KGW A;  2VIA A;  3EI5 A;  1ORD A;  2VMR A;  2YOB A;  4TMR A;  1W7M A;  1D2F A;  1YJZ A;  4WXF A;  4ADB A;  3HL2 A;  1T3I A;  4XEW A;  4JF1 A;  1B9I A;  3FVU A;  3FVS A;  4ITX A;  1W7N A;  2VGS A;  1TAS A;  2AY1 A;  2WK9 A;  1X28 A;  2FQ6 A;  3EI8 A;  2YRI A;  3PGY A;  2BYL A;  2JJE A;  4RJ0 A;  2VGZ A;  4GSA A;  4IXZ A;  5EAV A;  1M32 A;  2DKJ A;  3FQA A;  2VGV A;  4ADE A;  3WY7 A;  1AHE A;  1TOI A;  2OGE A;  3LWS A;  4E3Q A;  2W7E A;  1AY8 A;  3B8X A;  3K28 A;  2WB6 A;  5G4J A;  3ZRR A;  4A6U A;  4LW4 A;  1WYV B;  2DKB A;  1SPA A;  2VMX A;  1YAA A;  1BQD A;  5DJ1 A;  4GE4 A;  4U1T A;  1CZC A;  1M0N A;  2BI1 A;  1QJ3 A;  4WYE A;  1BW0 A;  1WYT B;  4XJP A;  4EB7 A;  1LC7 A;  1S0A A;  4F5J A;  4ZSY A;  5M46 A;  3EI9 A;  4CVQ A;  1OXP A;  2HP2 A;  4UHO A;  4PIW A;  1Z7D A;  4WLJ A;  1LKC A;  3BWN C;  5LH9 A;  1CZE A;  1ELU A;  1BJO B;  3BN1 A;  2KFP A;  1ARH A;  3FZ8 A;  2CH2 A;  3NU8 A;  4A0F A;  3P1T A;  4KYO A;  3RBL A;  1QJ5 A;  2G6W A;  1W23 A;  1AJS B;  4Y0H A;  1AMS A;  3DXW A;  4ADD A;  2VMW A;  1V72 A;  2ORD A;  3F6T A;  3MAU A;  1N2T A;  4ZWV A;  2ZY3 A;  2PB2 A;  3OP7 A;  3QM2 A;  4GE9 A;  3LVM A;  4F5H A;  4BA4 A;  1PFF A;  5EUD A;  3FDB A;  1FG3 A;  1WST A;  1LW4 A;  3A9X A;  3VK2 A;  1KMJ A;  2D66 A;  2NMP A;  1C4K A;  1PG8 A;  5G2P A;  2W7K A;  4GDY A;  4LC3 A;  3PDB B;  1KKJ A;  1OXO A;  1LC5 A;  2D65 A;  3AEN A;  1RVU A;  3LVK A;  1S07 A;  3GET A;  1KMK A;  1MLZ A;  2CTZ A;  3AEM A;  3HQT A;  3IHJ A;  1UKJ A;  1AKB A;  3HVY A;  3HT4 A;  2BWN A;  2Z61 A;  2FN6 A;  4MKJ A;  4WB0 B;  1GD9 A;  5J8Q A;  1VP4 A;  4W8I A;  1Y4I A;  4A72 A;  2BI3 A;  1BJ4 A;  2W7L A;  3FD0 A;  3N4X A;  2C44 A;  1C7G A;  4AO9 A;  2C7T A;  2QLR A;  4JEZ A;  1O62 A;  2VMY A;  2WKA A;  3DZZ A;  4QGR A;  1UU1 A;  2C81 A;  2HUU A;  2AY6 A;  4RIZ A;  4AOA A;  2R0T A;  4Q6R A;  4AH3 A;  3WGB A;  3JWB A;  1CJ0 A;  2VMZ A;  3CAI A;  4F5G A;  3FQ7 A;  3PD6 B;  4OTL A;  2HOY A;  1B9H A;  4A6R A;  1TOK A;  4H51 A;  2Z67 A;  2CY8 A;  1GC2 A;  5EUN A;  1RV4 A;  4ADC A;  2CJG A;  4ZDP A;  1KAF A;  2BI5 A;  2EPJ A;  3RUY A;  1ASF A;  2V1P A;  4ZM4 A;  1WYU B;  1DJ9 A;  1GEW A;  2VMQ A;  5HHY A;  2YKX A;  2CIN A;  4L0O A;  2BIE A;  4IYO A;  3FZ6 A;  3AAT A;  3KE3 A;  1AMA A;  3EI6 A;  1J32 A;  3A9Z A;  1TOE A;  3CQ6 A;  4K2B A;  4RKD A;  1AAM A;  3N7N A;  4K2I A;  2HUF A;  5G09 A;  5E5I A;  2VI9 A;  4MY5 A;  3ACZ A;  3MBB A;  3ELE A;  4WD2 A;  2D7Z A;  3ASB A;  1WKG A;  3NTJ A;  2AY8 A;  2ZJG A;  2BHX A;  4LNL A;  4DQ6 A;  4WYD A;  3GZD C;  1ASG A;  2W7H A;  4ZDO A;  3HDO A;  4JEY A;  1I48 A;  2ZC0 A;  3P6K A;  3ZRQ A;  2QBT A;  4EFF A;  1S09 A;  3WKR A;  4UHM A;  1WKH A;  2CJD A;  3DR4 A;  5G2Q A;  2BYJ A;  2XH1 A;  4Q76 A;  3I16 A;  2DGK A;  4AZK A;  3N4R A;  2Z9V A;  3DR7 A;  4JE5 D;  3IF2 A;  4ZDL A;  2DOU A;  1I29 A;  3A9Y A;  2R5C A;  2Z9W A;  2ZYJ A;  4UQV A;  4EU1 A;  2W8W A;  4IXS A;  1DKA A;  4R5F A;  3B46 A;  2VLH A;  2JJF A;  1P3W A;  3AEL A;  3DU4 A;  1B5O A;  4ZAS A;  2QA3 A;  3DRD A;  2AY5 A;  1GDE A;  2D61 A;  1G7X A;  3NYU A;  2JJG A;  3RCH B;  1DGD A;  4WYC A;  4WLH A;  4Y0D A;  1V2E A;  3EZ1 A;  4B9B A;  2VMV A;  3NDN A;  2VYC A;  3TQX A;  1BJW A;  4LNJ A;  4TN4 A;  4W1W A;  2VMO A;  2VIB A;  3WCN A;  4IX8 A;  1GC3 A;  3II0 A;  3MC6 C;  1AX4 A;  3FKD A;  4BHD A;  4OMA A;  1YIZ A;  1SZK A;  1OHV A;  4WP0 A;  4I8A A;  3RI6 A;  4CBR A;  2YCN A;  4ISY A;  2W7G A;  2YKU A;  4TV7 A;  4XJM A;  1TOG A;  1KKP A;  2VMN A;  1ASA A;  1MAP A;  3QN6 A;  3ATH A;  1AY4 A;  1SFF A;  1B5P A;  7AAT A;  3HLM A;  1SZU A;  2HP1 A;  4OYT A;  1EG5 A;  1VJO A;  5EIG B;  1ECX A;  2O1B A;  1JF9 A;  3JZL A;  3NU7 A;  5HXX A;  3CQ5 A;  5BJ3 A;  4J5U A;  1ASM A;  4F4E A;  4CXQ A;  4ZWM A;  3N4S A;  1ASC A;  3NX3 A;  3GR9 A;  3VOM A;  1S08 A;  2HOX A;  2R5E A;  3QPG A;  3FTB A;  2FNI A;  3WKS A;  8AAT A;  1M0P A;  1AAW A;  1CL2 A;  2YHK A;  4K05 A;  3AOW A;  3PJ0 A;  5E3K A;  3NRA A;  5EFS A;  3UWC A;  4W5K A;  2QB2 A;  3BV0 A;  1AHG A;  3TFT A;  1AHY A;  1DTY A;  1WYV A;  4LNM A;  3FFR A;  3GBX A;  1G4X A;  5G0A A;  4KAM A;  3VK4 A;  5DX5 A;  2ZY5 A;  4OCA A;  1MDO A;  4P3M A;  5G4I A;  1SF2 A;  1UU2 A;  3E2Z B;  4DGT A;  1DJU A;  1LS3 A;  4O6Z A;  1QGN A;  1CS1 A;  5E4Z A;  1BJO A;  9AAT A;  1O69 A;  1ARI A;  3H7F A;  1BQA A;  1YIY A;  3DYD A;  2D63 A;  3OKS A;  3QBO A;  2VLF A;  3JWA A;  2D64 A;  1X29 A;  2BIA A;  3ZZK A;  3KKI A;  1AJS A;  1ARS A;  1ZOD A;  1B4X A;  3MAF B;  1V2D A;  1FC4 A;  4U2H A;  4DBC A;  1ASB A;  1ASE A;  4H63 Q;  1ASN A;  2CJH A;  2X8U A;  4R5Z A;  2YCT A;  1I43 A;  2TPL A;  1OAT A;  4A00 A;  1VEF A;  4AO4 A;  1D7S A;  3MAD A;  1G4V A;  3MKJ A;  3F0H A;  1MDX A;  4RIT A;  3PDX A;  1YJS A;  2EO5 A;  2GMS A;  4IY7 A;  4WYG A;  4KXK A;  1CQ6 A;  1O61 A;  2X5D A;  4JEW A;  3JU7 A;  4BMK A;  1AY5 A;  3EZS A;  4ZLV A;  4K2M A;  1X2A A;  4F5F A;  3BCA A;  3RQ1 A;  1KL2 A;  1MLY A;  2OGA A;  2VGU A;  1CQ7 A;  3PDB A;  3L44 A;  4LW2 A;  1EJI A;  2ZP7 A;  3WZF A;  1SVV A;  2BWO A;  3G0T A;  5F8V A;  2FNU A;  2EH6 A;  3FSL A;  3PAA A;  4GE7 A;  1AMR A;  1JS6 A;  3AEM C;  2Q7W A;  3K40 A;  2DGL A;  1CQ8 A;  3QI6 A;  4M2J A;  4Q75 A;  1MGV A;  5DJ9 A;  4WB0 A;  1ARG A;  4WYA A;  5M49 A;  3COG A;  1M0O A;  3R4T A;  1XI9 A;  4EB5 A;  2AY9 A;  2V0Y A;  3FCR A;  1BT4 A;  3I4J A;  3EIA A;  1ELQ A;  4WBT A;  2O0R A;  3EIB A;  1DFO A;  4MQQ A;  3N0L A;  2AY2 A;  3ELP A;  3FZ7 A;  1QIT A;  3DC1 A;  3PD6 A;  1LC8 A;  3G7Q A;  4B98 A;  1ASL A;  3EUC A;  2XBN A;  5D5S A;  4XJO A;  4ITG A;  1RVY A;  1I41 A;  5C6U A;  2D7Y A;  4M2K A;  4GRX A;  3A2B A;  4PVF A;  1GC0 A;  1KL1 A;  1QIS A;  2ZSL A;  1TAR A;  1DJE A;  1W7L A;  4IW7 A;  2CFB A;  2CB1 A;  3FQ8 A;  1B8G A;  3EI7 A;  5M4D A;  2W7J A;  3LV2 A;  2Z9X A;  2BIG A;  1D7V A;  2HOR A;  3LG0 A;  1TAT A;  4BA5 A;  2W8U A;  1WYU A;  1M4N A;  2EZ1 A;  1ZOB A;  3NUI A;  2CST A;  2DGM A;  5JAY A;  2GMU A;  2FM1 A;  3E9K A;  1GC4 A;  5EAA A;  5F9S A;  1GBN A;  4R8D A;  2WK7 A;  2W8T A;  2Z9U A;  1AKA A;  4E77 A;  3CBF A;  4MSO A;  4PFN A;  3H9X A;  4A0R A;  3RBF A;  4IXO A;  1MAQ A;  1YJY A;  1AHF A;  4Q31 A;  3T32 A;  4UOY A;  1DGE A;  4PFF A;  3NYT A; 
#chains in the Genus database with same CATH homology
 4MGR A;  4HF8 A;  2GSA A;  4JEV A;  5LHA A;  2BI9 A;  3A8U X;  4W1X A;  2BKW A;  3TFU A;  5BJ4 A;  3BWN A;  4FL0 A;  4OBV A;  1YNU A;  3FVX A;  5HDM A;  3B1C A;  1W3U A;  2AEU A;  2HZP A;  2O7C A;  1ART A;  5FT4 A;  2VMU A;  2AY7 A;  1CL1 A;  4ZSW A;  2F8J A;  2VMS A;  3D6K A;  4OBU A;  4F5M A;  1Z3Z A;  3USF A;  1M6S A;  4MKK A;  4RM1 A;  2E7U A;  5IWQ A;  2VGW A;  3BS8 A;  2GQN A;  4F5I A;  1EQB A;  2G7J A;  4M2M A;  3RCH A;  2A1V A;  1JS3 A;  1H1C A;  2PB0 A;  3UAK A;  2HOZ A;  4CBS A;  4JE5 A;  3N5M A;  2OKJ A;  4RLG A;  1ASD A;  3B1E A;  1N31 A;  2OKK A;  4OC9 A;  2YCP A;  3BCB A;  4OT8 A;  1PMO A;  4J8L A;  1LW5 A;  1RV3 A;  2CH1 A;  1AIB A;  3AEJ A;  5FT5 A;  3ECD A;  3Q8N A;  1IX6 A;  3LVL B;  3AEN B;  3HMU A;  4E1O A;  3GZC A;  3ISL A;  2AEV A;  1V2F A;  2AY4 A;  3WGC A;  4N0B A;  3ASA A;  3E6G A;  1D7R A;  2EZ2 A;  4GEB A;  2PO3 A;  2ZY2 A;  1WYT A;  1AMQ A;  3BC8 A;  3ZRP A;  3TAT A;  5EUE A;  1IAX A;  1GEY A;  1G7W A;  1IX7 A;  3AOV A;  4W91 A;  4F5L A;  2OAT A;  2VMP A;  3KGX A;  2Z20 A;  2W7M A;  2W7F A;  5KTB A;  1SZS A;  2BI2 A;  4WXG A;  3G8M A;  3FFH A;  5EIG A;  1U08 A;  1BJN A;  3I5T A;  4JEX A;  3F9T A;  3E2Y A;  4ATQ A;  1X0M A;  2YKV A;  2W8V A;  3BCX A;  3M5U A;  3R9A A;  1IVR A;  4RAE A;  1YOO A;  4AZJ A;  3VP6 A;  1IJI A;  4WYF A;  4MQR A;  4ZAH A;  4P7Y A;  1IAY A;  3N75 A;  2W8J A;  2YRR A;  3W1I A;  1OHW A;  3JW9 A;  2VI8 A;  4UHN A;  1MDZ A;  2JG2 A;  3AEJ C;  3WLX A;  1GEX A;  5TF5 A;  2ZSM A;  3GJU A;  2VGT A;  4XK1 A;  2AY3 A;  5FT8 A;  3VK3 A;  3B1D A;  3DXV A;  2W7D A;  3K7Y A;  3PIU A;  2EYQ A;  1M7Y A;  2ZY4 A;  4HVK A;  3E2Z A;  3BB8 A;  2JJH A;  3H14 A;  4Y0I A;  4E3R A;  3L8A A;  3AEP A;  4IYO B;  4R2N A;  3AV7 A;  1OHY A;  2E7I A;  3E2F A;  3CQ4 A;  1AJR A;  4BQ0 A;  3W1H A;  1JG8 A;  3QHX A;  2ZUK A;  3UE8 A;  1E5F A;  1E5E A;  2EGY A;  4W1V A;  2E7J A;  1O4S A;  1H0C A;  3MAF A;  3GZD A;  1AIA A;  2QB3 A;  2RFV A;  2Z1Z A;  2JGT A;  2W7I A;  1AKC A;  2YKY A;  1BS0 A;  4A6T A;  4EMY A;  2CAN A;  2JIS A;  2FYF A;  2FKI A;  5DB5 A;  4WXB A;  2AAT A;  1GCK A;  2GB3 A;  3WCO A;  1J04 A;  1QZ9 A;  2Z1Y A;  1C9C A;  3PA9 A;  3ZZJ A;  1C0N A;  3JTX A;  1AIC A;  2QMA A;  3GSB A;  3AEO A;  3BWO A;  4RKC A;  2WK8 A;  1UU0 A;  2R5C B;  2D5Y A;  1LK9 A;  2HUI A;  3NUB A;  4N0W A;  4XAU A;  5K8B A;  5D95 A;  4MQP A;  3LVJ A;  3MEB A;  4JF0 A;  5FT6 A;  1D7U A;  3PPL A;  1XEY A;  2X3L A;  3HBX A;  4RJY A;  5M4B A;  2BWP A;  4A0H A;  2DR1 A;  4ATP A;  1FG7 A;  3GWP A;  3VAX A;  3E77 A;  3QGU A;  3W1J A;  3FRK A;  4CXR A;  1ZC9 A;  2QSR A;  1BKG A;  2C0R A;  4XJL A;  4ZM3 A;  5I92 A;  1TPL A;  3NNK A;  4FFC A;  4A0G A;  1C7O A;  3TCM A;  3FDD A;  1IX8 A;  5EQC A;  3MC6 A;  5AX8 A;  3DOD A;  1IUG A;  1M0Q A;  1TOJ A;  1N8P A;  3LY1 A;  1S06 A;  4F5K A;  1AHX A;  1C7N A;  1QIR A;  4NOG A;  2E54 A;  2R2N A;  4XQ2 A;  1IBJ A;  1PMM A;  3WX9 A;  2VMT A;  2OQX A;  3NYS A;  2X5F A;  3KGW A;  2VIA A;  3EI5 A;  1ORD A;  2VMR A;  2YOB A;  4TMR A;  1W7M A;  1D2F A;  1YJZ A;  4WXF A;  4ADB A;  3HL2 A;  1T3I A;  4XEW A;  4JF1 A;  1B9I A;  3FVU A;  3FVS A;  4ITX A;  1W7N A;  2VGS A;  1TAS A;  2AY1 A;  2WK9 A;  1X28 A;  2FQ6 A;  3EI8 A;  2YRI A;  3PGY A;  2BYL A;  2JJE A;  4RJ0 A;  2VGZ A;  4GSA A;  4IXZ A;  5EAV A;  1M32 A;  2DKJ A;  3FQA A;  2VGV A;  4ADE A;  3WY7 A;  1AHE A;  1TOI A;  2OGE A;  3LWS A;  4E3Q A;  2W7E A;  1AY8 A;  3B8X A;  3K28 A;  2WB6 A;  5G4J A;  3ZRR A;  4A6U A;  4LW4 A;  1WYV B;  2DKB A;  1SPA A;  2VMX A;  1YAA A;  1BQD A;  5DJ1 A;  4GE4 A;  4U1T A;  1CZC A;  1M0N A;  2BI1 A;  1QJ3 A;  4WYE A;  1BW0 A;  1WYT B;  4XJP A;  4EB7 A;  1LC7 A;  1S0A A;  4F5J A;  4ZSY A;  5M46 A;  3EI9 A;  4CVQ A;  1OXP A;  2HP2 A;  4UHO A;  4PIW A;  1Z7D A;  4WLJ A;  1LKC A;  3BWN C;  5LH9 A;  1CZE A;  1ELU A;  1BJO B;  3BN1 A;  2KFP A;  1ARH A;  3FZ8 A;  2CH2 A;  3NU8 A;  4A0F A;  3P1T A;  4KYO A;  3RBL A;  1QJ5 A;  2G6W A;  1W23 A;  1AJS B;  4Y0H A;  1AMS A;  3DXW A;  4ADD A;  2VMW A;  1V72 A;  2ORD A;  3F6T A;  3MAU A;  1N2T A;  4ZWV A;  2ZY3 A;  2PB2 A;  3OP7 A;  3QM2 A;  4GE9 A;  3LVM A;  4F5H A;  4BA4 A;  1PFF A;  5EUD A;  3FDB A;  1FG3 A;  1WST A;  1LW4 A;  3A9X A;  3VK2 A;  1KMJ A;  2D66 A;  2NMP A;  1C4K A;  1PG8 A;  5G2P A;  2W7K A;  4GDY A;  4LC3 A;  3PDB B;  1KKJ A;  1OXO A;  1LC5 A;  2D65 A;  3AEN A;  1RVU A;  3LVK A;  1S07 A;  3GET A;  1KMK A;  1MLZ A;  2CTZ A;  3AEM A;  3HQT A;  3IHJ A;  1UKJ A;  1AKB A;  3HVY A;  3HT4 A;  2BWN A;  2Z61 A;  2FN6 A;  4MKJ A;  4WB0 B;  1GD9 A;  5J8Q A;  1VP4 A;  4W8I A;  1Y4I A;  4A72 A;  2BI3 A;  1BJ4 A;  2W7L A;  3FD0 A;  3N4X A;  2C44 A;  1C7G A;  4AO9 A;  2C7T A;  2QLR A;  4JEZ A;  1O62 A;  2VMY A;  2WKA A;  3DZZ A;  4QGR A;  1UU1 A;  2C81 A;  2HUU A;  2AY6 A;  4RIZ A;  4AOA A;  2R0T A;  4Q6R A;  4AH3 A;  3WGB A;  3JWB A;  1CJ0 A;  2VMZ A;  3CAI A;  4F5G A;  3FQ7 A;  3PD6 B;  4OTL A;  2HOY A;  1B9H A;  4A6R A;  1TOK A;  4H51 A;  2Z67 A;  2CY8 A;  1GC2 A;  5EUN A;  1RV4 A;  4ADC A;  2CJG A;  4ZDP A;  2BI5 A;  2EPJ A;  3RUY A;  1ASF A;  2V1P A;  4ZM4 A;  1WYU B;  1DJ9 A;  1GEW A;  2VMQ A;  5HHY A;  2YKX A;  2CIN A;  4L0O A;  2BIE A;  4IYO A;  3FZ6 A;  3AAT A;  3KE3 A;  1AMA A;  3EI6 A;  1J32 A;  3A9Z A;  1TOE A;  3CQ6 A;  4K2B A;  4RKD A;  1AAM A;  3N7N A;  4K2I A;  2HUF A;  5G09 A;  5E5I A;  2VI9 A;  4MY5 A;  3ACZ A;  3MBB A;  3ELE A;  4WD2 A;  2D7Z A;  3ASB A;  1WKG A;  3NTJ A;  2AY8 A;  2ZJG A;  2BHX A;  4LNL A;  4DQ6 A;  4WYD A;  3GZD C;  1ASG A;  2W7H A;  4ZDO A;  3HDO A;  4JEY A;  1I48 A;  2ZC0 A;  3P6K A;  3ZRQ A;  2QBT A;  4EFF A;  1S09 A;  3WKR A;  4UHM A;  1WKH A;  2CJD A;  3DR4 A;  5G2Q A;  2BYJ A;  2XH1 A;  4Q76 A;  3I16 A;  2DGK A;  4AZK A;  3N4R A;  2Z9V A;  3DR7 A;  4JE5 D;  3IF2 A;  4ZDL A;  2DOU A;  1I29 A;  3A9Y A;  2R5C A;  2Z9W A;  2ZYJ A;  4UQV A;  4EU1 A;  2W8W A;  4IXS A;  1DKA A;  4R5F A;  3B46 A;  2VLH A;  2JJF A;  1P3W A;  3AEL A;  3DU4 A;  1B5O A;  4ZAS A;  2QA3 A;  3DRD A;  2AY5 A;  1GDE A;  2D61 A;  1G7X A;  3NYU A;  2JJG A;  3RCH B;  1DGD A;  4WYC A;  4WLH A;  4Y0D A;  1V2E A;  3EZ1 A;  4B9B A;  2VMV A;  3NDN A;  2VYC A;  3TQX A;  1BJW A;  4LNJ A;  4TN4 A;  4W1W A;  2VMO A;  2VIB A;  3WCN A;  4IX8 A;  1GC3 A;  3II0 A;  3MC6 C;  1AX4 A;  3FKD A;  4BHD A;  4OMA A;  1YIZ A;  1SZK A;  1OHV A;  4WP0 A;  4I8A A;  3RI6 A;  4CBR A;  2YCN A;  4ISY A;  2W7G A;  2YKU A;  4TV7 A;  4XJM A;  1TOG A;  1KKP A;  2VMN A;  1ASA A;  1MAP A;  3QN6 A;  3ATH A;  1AY4 A;  1SFF A;  1B5P A;  7AAT A;  3HLM A;  1SZU A;  2HP1 A;  4OYT A;  1EG5 A;  1VJO A;  5EIG B;  1ECX A;  2O1B A;  1JF9 A;  3JZL A;  3NU7 A;  5HXX A;  3CQ5 A;  5BJ3 A;  4J5U A;  1ASM A;  4F4E A;  4CXQ A;  4ZWM A;  3N4S A;  1ASC A;  3NX3 A;  3GR9 A;  3VOM A;  1S08 A;  2HOX A;  2R5E A;  3QPG A;  3FTB A;  2FNI A;  3WKS A;  8AAT A;  1M0P A;  1AAW A;  1CL2 A;  2YHK A;  4K05 A;  3AOW A;  3PJ0 A;  5E3K A;  3NRA A;  5EFS A;  3UWC A;  4W5K A;  2QB2 A;  3BV0 A;  1AHG A;  3TFT A;  1AHY A;  1DTY A;  1WYV A;  4LNM A;  3FFR A;  3GBX A;  1G4X A;  5G0A A;  4KAM A;  3VK4 A;  5DX5 A;  2ZY5 A;  4OCA A;  1MDO A;  4P3M A;  5G4I A;  1SF2 A;  1UU2 A;  3E2Z B;  4DGT A;  1DJU A;  1LS3 A;  4O6Z A;  1QGN A;  1CS1 A;  5E4Z A;  1BJO A;  9AAT A;  1O69 A;  1ARI A;  3H7F A;  1BQA A;  1YIY A;  3DYD A;  2D63 A;  3OKS A;  3QBO A;  2VLF A;  3JWA A;  2D64 A;  1X29 A;  2BIA A;  3ZZK A;  3KKI A;  1AJS A;  1ARS A;  1ZOD A;  1B4X A;  3MAF B;  1V2D A;  1FC4 A;  4U2H A;  4DBC A;  1ASB A;  1ASE A;  4H63 Q;  1ASN A;  2CJH A;  2X8U A;  4R5Z A;  2YCT A;  1I43 A;  2TPL A;  1OAT A;  4A00 A;  1VEF A;  4AO4 A;  1D7S A;  3MAD A;  1G4V A;  3MKJ A;  3F0H A;  1MDX A;  4RIT A;  3PDX A;  1YJS A;  2EO5 A;  2GMS A;  4IY7 A;  4WYG A;  4KXK A;  1CQ6 A;  1O61 A;  2X5D A;  4JEW A;  3JU7 A;  4BMK A;  1AY5 A;  3EZS A;  4ZLV A;  4K2M A;  1X2A A;  4F5F A;  3BCA A;  3RQ1 A;  1KL2 A;  1MLY A;  2OGA A;  2VGU A;  1CQ7 A;  3PDB A;  3L44 A;  4LW2 A;  1EJI A;  2ZP7 A;  3WZF A;  1SVV A;  2BWO A;  3G0T A;  5F8V A;  2FNU A;  2EH6 A;  3FSL A;  3PAA A;  4GE7 A;  1AMR A;  1JS6 A;  3AEM C;  2Q7W A;  3K40 A;  2DGL A;  1CQ8 A;  3QI6 A;  4M2J A;  4Q75 A;  1MGV A;  5DJ9 A;  4WB0 A;  1ARG A;  4WYA A;  5M49 A;  3COG A;  1M0O A;  3R4T A;  1XI9 A;  4EB5 A;  2AY9 A;  2V0Y A;  3FCR A;  1BT4 A;  3I4J A;  3EIA A;  1ELQ A;  4WBT A;  2O0R A;  3EIB A;  1DFO A;  4MQQ A;  3N0L A;  2AY2 A;  3ELP A;  3FZ7 A;  1QIT A;  3DC1 A;  3PD6 A;  1LC8 A;  3G7Q A;  4B98 A;  1ASL A;  3EUC A;  2XBN A;  5D5S A;  4XJO A;  4ITG A;  1RVY A;  1I41 A;  5C6U A;  2D7Y A;  4M2K A;  4GRX A;  3A2B A;  4PVF A;  1GC0 A;  1KL1 A;  1QIS A;  2ZSL A;  1TAR A;  1DJE A;  1W7L A;  4IW7 A;  2CFB A;  2CB1 A;  3FQ8 A;  1B8G A;  3EI7 A;  5M4D A;  2W7J A;  3LV2 A;  2Z9X A;  2BIG A;  1D7V A;  2HOR A;  3LG0 A;  1TAT A;  4BA5 A;  2W8U A;  1WYU A;  1M4N A;  2EZ1 A;  1ZOB A;  3NUI A;  2CST A;  2DGM A;  5JAY A;  2GMU A;  2FM1 A;  3E9K A;  1GC4 A;  5EAA A;  5F9S A;  1GBN A;  4R8D A;  2WK7 A;  2W8T A;  2Z9U A;  1AKA A;  4E77 A;  3CBF A;  4MSO A;  4PFN A;  3H9X A;  4A0R A;  3RBF A;  4IXO A;  1MAQ A;  1YJY A;  1AHF A;  4Q31 A;  3T32 A;  4UOY A;  1DGE A;  4PFF A;  3NYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...