2ZY2A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
521
structure length
521
Chain Sequence
SPFELKDELIKVASGKANRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTVGVGGLAKLDGIEGRFERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLTVSEQIVRQYIVREMAGGAVPPESVDLFAVEGGTAAMAYIFESLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQRPDLLILTDDVYGTFADEFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNVTCRLYGEAFSQWAVQQSSTGDMLFRVADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRRLADELYEQYKALGKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Lyase
molecule keywords L-aspartate 4-carboxylyase
total genus 154
structure length 521
sequence length 521
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy2A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy2A01
4AH3A 4ATPA 1FG7A 4BA4A 1IJIA 3LV2A 4Q6RA 4J5UA 3QN6A 2R2NA 4WXGA 2GB3A 2Z1ZA 1AKAA 3KGWA 1W23A 4ATQA 3PJ0A 5EIGA 1IVRA 1OHVA 4F5GA 2W7HA 1E5FA 1WYVA 4LW2A 1PFFA 1ARSA 4DQ6A 3ZZJA 3PDBA 1ASBA 1UU2A 4A0GA 4CBSA 1DGDA 1C0NA 2BI5A 3E2FA 3MKJA 1V72A 4F5FA 1M0OA 3UE8A 1M0NA 1VJOA 5DB5A 1LKCA 4RJYA 1C7NA 3NYUA 3B1DA 2WK8A 4E77A 2CTZA 2DKBA 5FT5A 4MQPA 3WY7A 3MAFA 1X29A 4E1OA 5K8BA 1QZ9A 1GEXA 2HORA 2YKUA 1O4SA 3NDNA 2C81A 2AY5A 1TPLA 2BWOA 5D5SA 1YIZA 2ZYJA 3AEOA 5HXXA 4JEVA 3HLMA 2YOBA 3HQTA 2X5FA 4LW4A 2D5YA 4Y0HA 5DX5A 2YCPA 4OT8A 4M2MA 2VMRA 3UAKA 4A0RA 2HUIA 3PDBB 4N0WA 2Z1YA 5M4DA 1S08A 1Z3ZA 1LC5A 1O62A 2Z20A 1RV3A 3JWAA 1ASNA 1QIRA 1SFFA 4ZLVA 1DJUA 1KKPA 1VP4A 3DODA 4M2JA 2YCNA 3A8UX 1RVUA 1TASA 2HOYA 3II0A 1QITA 4GDYA 2VI9A 3LVJA 4BQ0A 1XI9A 4ZWVA 1E5EA 2QA3A 4KXKA 4ADBA 4ZDLA 1ZC9A 5HHYA 3TCMA 1IX8A 2EGYA 1BS0A 1IX7A 4AO9A 2AY7A 2CJHA 1BJ4A 2VIAA 3MC6C 3WX9A 2BWPA 2EH6A 1CL2A 3MAFB 2EZ2A 2BI9A 3G7QA 3RCHB 3KE3A 4XQ2A 2AY8A 1AIAA 4ADEA 4R5FA 2RFVA 2AY1A 4LNJA 3WKRA 1W7NA 1DGEA 2GSAA 2ORDA 2W8JA 4P7YA 4ZWMA 2CFBA 2YKYA 8AATA 1C9CA 2VI8A 4DBCA 2R5EA 1J04A 2Z9XA 4WXFA 5J8QA 3RCHA 4WBTA 3EZ1A 1YNUA 2HP1A 2V0YA 1V2FA 2VGSA 3AEJA 4MQQA 4W91A 5G4JA 3MEBA 4JEXA 4LNMA 2YKXA 2F8JA 1BQAA 3DZZA 3NU7A 3MBBA 3FQ8A 1YJSA 4ITGA 2JJFA 4W5KA 1AAMA 3BN1A 2AY9A 1GC2A 1TOEA 4HF8A 5EAVA 4WYCA 3Q8NA 4IXZA 2D7YA 4FFCA 1P3WA 1CS1A 4K2MA 3NUIA 4JF1A 2BYLA 3BS8A 3NUBA 2FN6A 3ACZA 2HOZA 3CQ4A 4A6TA 4RKCA 2BKWA 3IHJA 3R4TA 5M49A 1J32A 9AATA 1M0PA 1S06A 4WYDA 4K2IA 3P1TA 4GRXA 4OC9A 4FL0A 4A72A 4MKKA 3EI9A 1B5OA 3ZZKA 2PO3A 4W1VA 3ASAA 1ZOBA 2VGUA 2HZPA 4A0FA 2W8TA 1M0QA 1IUGA 1TOJA 3DR7A 3EI7A 1V2DA 2VYCA 3TQXA 2ZJGA 3QM2A 1WKHA 5EUNA 2FNIA 1W7MA 4EU1A 4OCAA 1LK9A 1KL2A 1LC7A 2WKAA 1JS6A 4GE4A 1CQ6A 1MDXA 3WGCA 1TARA 1ASLA 2AY4A 5E5IA 4KAMA 3JW9A 2V1PA 3BC8A 2QB3A 2FM1A 4WP0A 1OXOA 3LVLB 4AZJA 1EJIA 4IYOB 5M46A 1MDOA 3ZRQA 4JEYA 3OP7A 2Z9VA 1AHEA 1D7RA 2VMWA 4WD2A 3AENB 2DR1A 2FQ6A 2Z9WA 2PB0A 1RVYA 2VGTA 4F5KA 4MSOA 2JG2A 3GZDA 1AHFA 1ASDA 1OATA 2W8VA 4UHNA 4Q76A 4F5HA 1B5PA 1AJRA 1ASGA 1B9IA 3EI6A 4CXQA 1PG8A 1KMKA 4H51A 2W7JA 4IXSA 5E4ZA 5EUEA 4F4EA 1ORDA 2NMPA 3D6KA 2TPLA 2O0RA 3DC1A 3BB8A 4PIWA 1QJ5A 4CXRA 1WYVB 2W7IA 3ISLA 4BHDA 7AATA 1M32A 1MLYA 3FTBA 4ISYA 5EUDA 1AIBA 2EZ1A 3CQ5A 1ARIA 1OXPA 2CH2A 1CQ7A 3AATA 4O6ZA 4HVKA 4CBRA 2R5CA 4EB7A 2XH1A 3DRDA 4GSAA 3R9AA 4ZASA 3LVMA 1I48A 5C6UA 3AELA 4GE7A 3FQ7A 1LS3A 2CJGA 2VIBA 2OATA 3QBOA 4LC3A 1IX6A 1AHGA 5M4BA 1MAPA 1SZSA 2JGTA 1TOGA 2ZUKA 3GR9A 1Y4IA 3FDDA 3MC6A 1SVVA 1ZODA 1BJWA 2HUUA 5AX8A 1AY5A 4K2BA 4XJLA 1AICA 4ZAHA 3N5MA 1ELQA 4EB5A 3P6KA 2ZY2A 5EAAA 1G4XA 4OYTA 4WLJA 4XK1A 4ADDA 3E9KA 1G7XA 4Y0IA 3CAIA 1N31A 4RKDA 2VMZA 1CQ8A 4W1WA 3FVUA 3LY1A 1MGVA 1YJYA 3FQAA 1GD9A 1O61A 2W8UA 3FSLA 4I8AA 3AEJC 3HMUA 2DOUA 1JG8A 3K7YA 3ELPA 4QGRA 2AY2A 2CANA 2JJEA 3WLXA 1AX4A 1G7WA 4LNLA 1CJ0A 1KKJA 2E54A 2HUFA 4A6UA 5F9SA 2YCTA 1AMRA 4XAUA 4E3QA 3DYDA 3FKDA 4JEWA 4PFFA 3FVXA 4UOYA 1BW0A 4WYGA 3AV7A 1GC0A 2ZY3A 4UHOA 1AHYA 2W7KA 1ASMA 3N75A 4ZSWA 5G09A 3UWCA 3KGXA 2YKVA 3PAAA 1ECXA 4WYAA 3WKSA 3HL2A 1AY8A 2D61A 4OMAA 1GEWA 3G8MA 4U2HA 2D63A 1ASAA 4TMRA 1UKJA 1DKAA 4F5IA 2ZY4A 2ZY5A 3RBFA 2AY3A 2BHXA 3ELEA 4JF0A 1ELUA 2OGAA 3RQ1A 3QI6A 3TATA 2W8WA 4PVFA 3I5TA 4AO4A 3WZFA 3BCAA 3FCRA 3GSBA 2VMVA 3NX3A 2EO5A 2O1BA 1MAQA 1IBJA 3JWBA 3ASBA 1S09A 1BJOA 2R0TA 4F5JA 1RV4A 2VMYA 2O7CA 2ZSLA 1GEYA 3MADA 4PFNA 2HOXA 4MKJA 1H0CA 2Z9UA 3EI8A 1W3UA 2FYFA 3BCBA 1FG3A 4GEBA 1KMJA 2GMUA 2VMOA 1UU1A 3ZRPA 2QB2A 1OHWA 1GDEA 3K28A 4DGTA 1I43A 4KYOA 1CZEA 1X28A 1AHXA 4NOGA 3BWNC 1LC8A 1WYUB 2JJHA 1EQBA 2VMTA 3QGUA 3VOMA 1S07A 1W7LA 4EMYA 2YHKA 5JAYA 2AY6A 1QGNA 3NNKA 5FT6A 2E7IA 4UQVA 3GZDC 2OGEA 1BJNA 5BJ3A 2CY8A 1H1CA 4XJOA 3GZCA 1CZCA 5G2QA 4WB0B 3AOWA 2VMXA 4WYFA 1YJZA 5G4IA 1DJEA 1QJ3A 1V2EA 1T3IA 3VAXA 3I4JA 2CSTA 2WK9A 3N0LA 4XJPA 1OHYA 4A6RA 1ARGA 1I41A 2BI3A 2R5CB 3QHXA 3DXWA 3NU8A 3H7FA 2YRIA 3DR4A 3E2ZB 3FFRA 2W7EA 5G2PA 5IWQA 3AEMC 5E3KA 1LW4A 3L8AA 1BT4A 3ECDA 3DXVA 4Q75A 2VGZA 3AEPA 3L44A 1D7SA 1AJSB 3COGA 5HDMA 3FRKA 3OKSA 3GETA 1SZUA 3JTXA 4R2NA 3RUYA 1DFOA 2BIEA 3EIAA 1D7VA 4WXBA 5I92A 2D66A 2D7ZA 1MDZA 3NYSA 3B1EA 3E6GA 4A00A 1D2FA 3BV0A 3NTJA 2ZC0A 1I29A 2VMQA 2VMUA 3AENA 2VLHA 5F8VA 3NRAA 1AMQA 1ARTA 1FC4A 2QBTA 3QPGA 2HP2A 1X2AA 5BJ4A 1WYUA 4WYEA 4U1TA 4F5LA 4MQRA 3FVSA 1G4VA 4AZKA 1IAYA 5EIGB 4B98A 4AOAA 3EZSA 1SZKA 1U08A 3EIBA 4R8DA 2D64A 2ZP7A 3NYTA 1TATA 1M7YA 1N2TA 1M4NA 2AATA 4Q31A 1AJSA 1C7GA 3AEMA 4TN4A 1AKBA 1BQDA 2VLFA 3FDBA 1C7OA 2W7GA 3ZRRA 4ITXA 1AAWA 3E2ZA 1B9HA 2EPJA 4EFFA 3FFHA 4W1XA 5FT4A 4A0HA 1AY4A 2C44A 1SF2A 2C7TA 2VMPA 2PB2A 4R5ZA 5DJ9A 2Z61A 5FT8A 5D95A 1WSTA 4WB0A 2W7LA 1JS3A 2W7FA 2BYJA 2ZSMA 3M5UA 2CINA 2GMSA 3PPLA 4GE9A 4UHMA 2E7UA 3A9ZA 3LVKA 2FNUA 5DJ1A 2VGWA 1EG5A 1B4XA 1S0AA 1WYTB 2BIAA 2W7MA 3B1CA 3EI5A 1ASFA 4ZDOA 3CQ6A 3PD6A 1N8PA 2VGVA 2VMNA 4F5MA 3CBFA 2BWNA 1CL1A 1AMAA 1LW5A 1ARHA 1YAAA 1VEFA 2G6WA 1ASCA 1TOIA 1MLZA 3GBXA 3E77A 3ATHA 3F9TA 1B8GA 3F6TA 1YIYA 4M2KA 1ASEA 2CB1A 3RI6A 2BIGA 2OQXA 2X5DA 1O69A 4IXOA 3B46A 1D7UA 2QLRA 3DU4A 3LG0A 1WKGA 4CVQA 3AOVA 1Z7DA 2DKJA 3PDXA 4IYOA 4IX8A 1AMSA 1TOKA 2BI2A 3VK4A 1KL1A 4BMKA 3GJUA 4RAEA 2W7DA 3RBLA 1BJOB 4BA5A 4ZM4A 3TFTA 4ZSYA 3E2YA 4IW7A 4MY5A 1BKGA 2WK7A 2Q7WA 1DJ9A 3KKIA 2XBNA 2C0RA 1AKCA 3PIUA 5EQCA 1QISA 3PD6B 2GQNA 3PA9A 2QMAA 3F0HA 3VK3A 3A9XA 1IAXA 2E7JA 1WYTA 3A9YA 1SPAA 1C4KA 4P3MA 4ZDPA 1YOOA 1UU0A 2CJDA 3HDOA 1DTYA 3A2BA 5EFSA 3WGBA 2JJGA 4L0OA 4OTLA 1GC4A 2CH1A 4IY7A 4JEZA 2YRRA 3VK2A 4B9BA 4XJMA 3PGYA 1GBNA 3B8XA 4ZM3A 2VMSA 4XEWA 4W8IA 3K40A 2BI1A 3EUCA 3LWSA 3T32A 4WLHA 4E3RA 5G0AA 3USFA 4Y0DA 3TFUA 1X0MA 5TF5A 1M6SA 1GC3A 1JF9A 1GCKA 2X8UA 4ADCA 3BWOA 2D65A 3MAUA 3BCXA 3BWNA
chains in the Genus database with same CATH superfamily
4AH3A 4ATPA 1FG7A 4BA4A 5DNMC 1IJIA 3LV2A 3W97B 4Q6RA 2GB3A 3KGWA 1W23A 3UT9D 2RVQD 2AROD 1E5FA 4LW2A 1ARSA 3N7NA 2RVQC 3WKJB 3AZKC 1V72A 5E5AD 3W96D 4NFTA 3AZIC 1M18A 5B33D 2NQBD 1C7NA 3X1TD 1P3PA 2F8NB 2YKUA 1O4SA 1AOIC 3NDNA 2C81A 5B33B 5KDMB 1TPLA 5D5SA 1YIZA 2ZYJA 3AEOA 5HXXA 4Y0HA 1P3MA 5BS7A 4R8PB 2VMRA 4Z5TA 2HUIA 3WAAD 1Z3ZA 3LZ1B 1LC5A 5B1LD 3JWAA 1QIRA 1SFFA 4YS3A 4UPKA 1PMMA 4ZLVA 1DJUA 1RVUA 4WU9B 3II0A 1QITA 4GDYA 2VI9A 4J8XB 2NZDA 4ZBJB 2Y2MA 5CPID 5GSUC 4ZWVA 4KXKA 4ZDLA 5CHLB 5DNMB 4LD9C 5DNND 4KUDC 3LELA 2VIAA 2EH6A 2BI9A 3RCHB 3LZ0A 2QSRA 2AY1A 2RFVA 2ORDA 4ZWMA 2CFBA 8AATA 2KFPA 1C9CA 4EO5B 2VI8A 2R5EA 4WXFA 4W91A 5G4JA 4LNMA 2F8JA 1BQAA 3NQJB 3MBBA 3FQ8A 4W5KA 2JJFA 1TZYA 2G5HC 1GC2A 5B24B 3REHB 2PYOA 5AY8A 3MGSD 4JF1A 2BYLA 4NE6A 2HOZA 3CQ4A 3R4TA 1JFIB 3P1TA 3RELD 1P3OB 3EI9A 2PO3A 2VGUA 3NQUB 1IUGA 3VP6A 5GT0D 3AZJD 1V2DA 3N4RA 5BNXA 3QM2A 3KXBB 1MDXA 3WGCA 3AZLB 5E5IA 3JW9A 1OXOA 3A6NC 4IYOB 5CP6D 4JEYA 2VMWA 3UTBA 1P3AA 3X1SC 3WKJC 2FQ6A 2YFVA 2VGTA 5B31D 4F5KA 3UTAB 4J8UB 2W8VA 4F5HA 4Q76A 1B9IA 1S32C 5E4ZA 1QJ5A 4CXRA 1WYVB 1P3AB 4R8PA 2L5AA 4G92B 3AATA 2R5CA 4GSAA 3REHD 3LVMA 5GXQB 3AZKD 5GT3C 3QBOA 5M4BA 5G49B 3HBXA 3GR9A 1KAFA 3B6FA 4QLCD 3MC6A 3MVDD 1P3OD 5AX8A 1AY5A 2HUEB 4ZAHA 2F8ND 4OYTA 1G7XA 1P3OC 2VMZA 3AZNC 3FVUA 3FQAA 3K7YA 3ELPA 3W98C 2AY2A 2CANA 3AV1A 3REHC 4ZUXA 2HUFA 1KKJA 4KUDD 1HQ3A 4JEWA 5AV5C 4UOYA 2ZY3A 4ZSWA 1AHYA 3N75A 3REJB 1ASMA 1KX5A 2DGMA 4U2HA 3G8MA 4JF0A 2CV5D 3KXBD 4JJNC 3I5TA 4AO4A 3WZFA 3LZ1C 2EO5A 1IBJA 3C1CD 2HIOD 1U35A 1GEYA 3REIC 1M1AA 1AOIB 3BCBA 3KUYD 3A1IA 2GMUA 5GXQC 2QB2A 2J8PA 1OHWA 4Z5TC 2BG1A 5CPKD 4NOGA 2JJHA 1U35B 5AV9D 2YHKA 2UWXA 4UQVA 3AFAB 3WKJD 4XJOA 1CZCA 2VMXA 3AZMA 4H9RB 5G4IA 1QJ3A 3I4JA 4XJPA 4A6RA 4YM6B 1ARGA 5AV9C 3DXWA 3NU8A 3H7FA 2YRIA 4KHAB 3AZGD 2W7EA 5E3KA 3EPKA 3L8AA 3ECDA 4LD9A 4LD9B 1P3PB 3LELC 2OKKA 4QLCB 4XUJB 1P3FB 3AZFC 1DFOA 5B0ZD 4WXBA 4Z66D 5I92A 3WAAB 5GT3D 3NYSA 1P3PD 4J8XD 3BV0A 4K05A 3C1BC 2CV5B 2VLHA 2HP2A 1WYUA 4F5LA 4G91C 3FVSA 4B98A 4XUJC 5EIGB 3EZSA 3AZGC 5DNNC 1ID3D 3W97A 5AY8C 1M4NA 1N2TA 3A1KA 4TN4A 3AEMA 5G49A 2JSSA 2W7GA 5F99A 4ITXA 3E2ZA 2EPJA 4EFFA 3FFHA 1AY4A 4RITA 1SF2A 1KX3B 4G91B 1ZLAA 2PB2A 4R5ZA 4XZQC 2Z61A 5D95A 4GE9A 2VGWA 1S0AA 1WYTB 3AZKB 3EI5A 2VGVA 2BWNA 3LELD 1AMAA 4HGAC 2G6WA 3W96A 1TOIA 3GBXA 5B32G 4J8UA 3RI6A 4CSRB 1O69A 2QLRA 3LG0A 3AN2D 3PDXA 4IYOA 4IX8A 4H9OA 2BI2A 3HT4A 3GJUA 3RBLA 5E5AA 4ZSYA 1PMOA 3RELB 3AV2B 3PD6B 2GQNA 2QMAA 3LZ0B 3X1TA 3HVYA 1WWIA 1C4KA 3MGPC 1GC4A 2CH1A 4B9BA 2DF4C 3REJC 1GBNA 4RLGA 4ZM3A 3RELA 2F8NG 3K40A 2BI1A 4WLHA 5G0AA 3TFUA 1P3PC 2Y2HA 1GC3A 1M6SA 3KSYA 3BWNA 1W2EA 3QN6A 3B0DC 2R2NA 2YFWA 5AY8B 1IVRA 1OHVA 4F5GA 1P3KC 4DQ6A 3MGRA 3X1VD 4A0GA 1P3LA 5FUGA 3AZNA 1M0NA 5KDMA 3AN2C 3W98A 4RJYA 3B1DA 4E77A 3MGQD 2CTZA 2DKBA 5AV5B 3REIB 5K8BA 1H3OB 1KX5C 1KX3D 2AY5A 2BWOA 3MGSA 4JEVA 2YOBA 3HQTA 4LW4A 4NE5A 2YCPA 3KWQB 2Z1YA 3NQUA 2Z20A 1M19A 1ASNA 4WV4B 4KUDB 4H9OB 2PYOD 3AFAC 1KKPA 1VP4A 2YCNA 1U35C 1TASA 2HOYA 2NQBC 3LVJA 3AZEB 1XI9A 2QA3A 4ADBA 2PYOB 3V9RA 3LJAC 1ZC9A 3TCMA 1IX8A 4X23D 1AOID 4AO9A 1EQZC 1S32D 1B67A 3UT9B 3WX9A 2BWPA 3AZHB 1CL2A 3KE3A 2LY8A 4ADEA 4LNJA 3X1SD 1DGEA 4P7YA 1WWSA 1S32B 2AEVA 3AYWB 3WA9A 3RCHA 4WBTA 2HP1A 3X1SB 2YKXA 3NU7A 1YJSA 4ITGA 1AAMA 4HF8A 2DQNC 3LJAD 3REKA 5E5AB 4FFCA 3NUIA 3BS8A 4A6TA 1M0PA 1S06A 4GRXA 4OC9A 4FL0A 4MKKA 2HIOA 1U35D 1B5OA 3C1BA 3ASAA 3W96B 4A0FA 2W8TA 1P3FA 4XUJA 1TOJA 3UTAC 3EI7A 3AZKA 2ZJGA 4RM1A 5EUNA 1P3MB 2FNIA 5B31G 3REID 3WTPE 4OCAA 1LK9A 1KL2A 5F99C 1TARA 2F8NA 4KGCD 3BC8A 5B2IA 3AV1B 5AVCD 4WU9C 4AZJA 5AV8D 1ZLAC 3ZRQA 3KXBC 4JJND 3B6GC 1D7RA 1P3GB 2PB0A 1P34B 1RVYA 1P3MC 2JG2A 3GZDA 4UHNA 3FZ7A 3AV1D 1AJRA 3WCNA 3EI6A 1M19B 4H51A 2W7JA 1ORDA 2TPLA 3BB8A 3AZHC 3WTPB 1P3GA 3ISLA 1P3KD 1AIBA 4H9SA 2EZ1A 3AV1C 3CQ5A 2CH2A 4HVKA 4ZUXC 4J8WB 3C1CC 3R9AA 5E5AC 5AV5A 2WB6A 3AELA 3FQ7A 1LS3A 3MNND 1F66A 3A6ND 2Y2JA 1ZODA 2HUUA 3LZ0C 1ELQA 1G4XA 5F99D 4WLJA 1M1AD 3E9KA 3CAIA 1N31A 1HQ3B 3EPJA 4RKDA 4DQYB 4J8VA 1YJYA 5AV8C 1ZLAD 2W8UA 5CPKA 4QGRA 3WLXA 1AX4A 5B33C 1G7WA 4LNLA 1CJ0A 2E54A 4A6UA 5B1LB 3AZLA 4DRAA 3G0TA 3DYDA 4WYGA 1BW0A 3UWCA 3KGXA 5AV6B 1KX4C 3MGRC 4CAYA 3WKSA 5BNXB 3AZIB 1AY8A 1GEWA 4Z66A 1N1JB 4J8UD 2D63A 4TMRA 4F5IA 3RBFA 1ELUA 5B32B 3RQ1A 3QI6A 3AN2A 4X23B 2FJ7B 4E45A 3FCRA 1P3BD 2O1BA 5B1LC 5B0YA 3B6GD 3ASBA 2R0TA 5B0ZA 2XD1A 5CPKB 2HOXA 4J8WD 3EI8A 3H0RC 2Z9UA 1W3UA 1KX5B 1FG3A 4GEBA 2VMOA 1I43A 4ZUXB 4J8WC 4ZBJC 1AHXA 1W7LA 4WZSB 2AY6A 1QGNA 3NNKA 5B24D 5FT6A 2E7IA 3N4XA 1H1CA 3LZ1D 3AV2C 1DJEA 3KWQA 1V2EA 1OHYA 1TAFB 2BI3A 3DR4A 3AEMC 3AZIA 5B1MB 5B1MA 3AEPA 5BT1C 3L44A 1AJSB 5HDMA 3WTPA 3FD0A 3B0BA 1P3MD 4R2NA 3EIAA 2JCHA 1P3BC 2D7ZA 2JISA 2ZC0A 1I29A 4H9QB 4WNNA 2Y2IA 3MGRB 3W99A 2FJ7D 1AMQA 2QBTA 5BJ4A 1G4VA 4UUZA 1IAYA 1P34D 1SZKA 5CPIB 5GT0C 1U08A 3AZJC 4J8UC 2AROB 2YFVB 2AATA 1M19D 4WU8D 1BQDA 3FDBA 3P5JB 4KHAA 2FFFB 2Y2GA 2HIOC 2OKJA 1B9HA 4W1XA 1M18B 2C44A 5DJ9A 4J8XC 1WSTA 4WB0A 2ZSMA 2W7FA 3PPLA 2E7UA 3A9ZA 3LVKA 1EG5A 3X1TB 3AZND 3PD6A 4F5MA 4CAYB 5B40C 1MLZA 3REKB 3WCOA 3ATHA 1B8GA 3F6TA 1YIYA 2NZDB 2CB1A 3MGQA 2OQXA 4IXOA 3B46A 4CVQA 3AOVA 4YM6D 3O62B 1BKGA 4J8VB 3KKIA 2XBNA 2C0RA 5CP6B 3W1JA 3PA9A 2DGLA 1IAXA 1P3LC 2E7JA 1SPAA 4ZDPA 1F1EA 1DTYA 5EFSA 3WGBA 2YRRA 4H9SC 1KX3A 3VH6A 4XJMA 5GT3B 3B8XA 3T32A 3USFA 4Y0DA 1JF9A 2X8UA 1P3FD 3BWOA 3MAUA 5AV8B 3MGSC 2Z1ZA 1AKAA 1P3AD 4ATQA 5EIGA 5B31A 2W7HA 1ASBA 5B2JB 3UTBC 1DGDA 3X1SA 1C0NA 3MKJA 4F5FA 5AV8A 3UE8A 4YS3B 3MNNB 3A6NB 1BH9B 1S32A 3NYUA 4MQPA 1X29A 1QZ9A 2HORA 3LJAA 3W98B 1EQZA 3HLMA 3VH5A 3WA9D 2X5FA 3KUYC 2D5YA 5DX5A 3MVDA 2F8NK 3PDBB 3AZEA 3C1BD 4XZQA 3B6FC 3MNNA 2YFWB 3REKD 3AV2D 3DODA 5B0ZC 2BYKA 4Z2MH 3A8UX 4M2JA 1BH8A 4WU8C 3WAAC 4BQ0A 1E5EA 5BO0A 5BNVA 2EGYA 1KX5D 2AY7A 5AVCA 2CJHA 3X1UC 1TAFA 1B6WA 3MAFB 1HQ3C 2EZ2A 5CPIC 2Y2LA 4YM6C 1AIAA 2AY8A 2AEUA 1W7NA 2W8JA 4KGCA 4DBCA 3AFAD 3MGPA 1J04A 2Z9XA 5J8QA 3EZ1A 3AEJA 1V2FA 1R4VA 3MEBA 4JEXA 4JJNA 1JFIA 3DZZA 3REJA 2AY9A 1TOEA 5EAVA 3Q8NA 4IXZA 2D7YA 1KX4D 2FN6A 1P3BA 4RKCA 3B6GA 2BKWA 1J32A 9AATA 4WYDA 3MGQB 4A72A 2BYMA 1P3KA 3ZZKA 3AZGB 4W1VA 1ZOBA 3TU4C 4M6BA 2HZPA 5B32A 3AZMD 1P3GC 3TQXA 5AVBC 4J8VD 5AV6A 5AVCB 4EU1A 5DNMA 1LC7A 2X3LA 4GE4A 1CQ6A 2AY4A 3AZFB 1ASLA 1P3IC 4WP0A 3KWQD 3LVLB 1AHEA 4WD2A 2DR1A 2Z9WA 4MSOA 4EO5C 2Y2OA 3AYWC 1OATA 1B5PA 4UUZB 4CXQA 1PG8A 1KMKA 4IXSA 4F4EA 5EUEA 5B40A 1M19C 4BHDA 1M32A 1ID3A 1MLYA 3MGQC 5EUDA 3UT9C 1M18D 2NQBA 1ARIA 1OXPA 4CBRA 3LJAB 4EB7A 3DRDA 5BS7C 1I48A 3R45B 4GE7A 4H9RA 2VIBA 2OATA 4LC3A 1MAPA 3AN2B 2JGTA 1Y4IA 1BH9A 4Z2MG 1SVVA 5JRGA 4W1WA 5GSUA 4H9NB 3LY1A 1MGVA 1GD9A 4I8AA 5JA4A 2JJEA 3AZID 5B24A 1AMRA 4XAUA 2XD5A 3FVXA 3AV7A 1GC0A 4UHOA 5G09A 2W7KA 5BT1D 4JJNB 3PAAA 2YKVA 1ECXA 4WYAA 3HL2A 4OMAA 1ASAA 3LZ0D 4KGCB 1DKAA 2ZY4A 3ELEA 2BHXA 2IO5C 3TATA 3BCAA 2VMVA 3KWQC 2FJ7A 3WTPD 1S09A 1BJOA 4F5JA 1RV4A 2VMYA 3MADA 4PFNA 1TZYD 4MKJA 1H0CA 1KMJA 2W8SA 3VH6W 3MVDC 3B0CW 5B2IC 5AY8D 1CZEA 4WU9A 1X28A 3AZEC 3H0LC 3BWNC 1LC8A 1WYUB 1EQBA 2VMTA 4RIZA 3WA9B 3QGUA 3MNNC 1S07A 5JAYA 4EMYA 3GZDC 5BJ3A 2CY8A 3N4SA 1Z2CB 5G2QA 3W98D 4WB0B 4Z5TB 3AOWA 1YJZA 3VAXA 3MVDB 1T3IA 2CSTA 3AZHA 2R5CB 3QHXA 2JE5A 4E44A 3FZ6A 2VGZA 1P3AC 3COGA 3FRKA 3AZJB 3GETA 2F8NH 4YM6A 2BIEA 1D7VA 3C1BB 4KGCC 2G5IC 5B2JA 5F8VA 1EQZD 3NRAA 1FC4A 5JRGB 1M18C 1X2AA 4MQRA 4AZKA 5AVBD 4J8VC 3UTAD 3EIBA 4R8DA 2ZP7A 3NYTA 1M7YA 4Q31A 1AJSA 1C7GA 2AROC 2DGKA 2VLFA 5C3IC 3R45A 5FT4A 4HGAB 4A0HA 5FT8A 2W7LA 2NQBB 1P3OA 2CINA 4Z66C 4UHMA 2FNUA 4YS3C 2CV5C 1B4XA 2BIAA 1ASFA 3B6GB 5GXQD 4ZDOA 2VMNA 1KX3C 3CBFA 1ARHA 1YAAA 3E77A 3O62A 3EPLA 3F9TA 5C3IB 5B0YC 1P3IA 4WJ3C 4QLCC 1ASEA 2BIGA 2X5DA 1D7UA 1WKGA 4ZUXD 4BMKA 4KUDA 1TOKA 3VK4A 1HQ3D 4ZM4A 3TFTA 3REKC 3E2YA 3REJD 4H9NA 5GSUB 1DJ9A 5EQCA 3F0HA 3VK3A 3AZED 4XUJD 4P3MA 1UU0A 3X1UB 4L0OA 4OTLA 4JEZA 3VK2A 4Z66B 1H3OA 3AV2A 1ULYA 3REIA 2VMSA 4W8IA 1P3FC 5CP6C 4E3RA 1X0MA 1P3KB 2BYMB 4ADCA 5B32D 1T3UA 2D65A 2Y2KA 4R5FA 2BYKB 5B1MC 4J5UA 4WXGA 1ID3B 3PJ0A 1WYVA 1PFFA 4X23C 3ZZJA 3PDBA 1UU2A 3AZMC 4DRBA 5JRGC 4CBSA 2HUEC 3KUYB 2BI5A 3E2FA 1M0OA 3VH5T 1VJOA 5DB5A 1LKCA 3KFUG 2WK8A 5FT5A 3WY7A 3MAFA 5CPJD 4E1OA 3AZFA 5B40D 1GEXA 4OBVA 3LELB 1F66D 4LD9D 3A6NA 3MGSB 2FKIA 3X1UA 3MGPD 5BO0B 2VQRA 4OT8A 4M2MA 3UAKA 4A0RA 4N0WA 3W1IA 5M4DA 1S08A 4J8XA 1O62A 1RV3A 5B31B 2F2AC 3W97C 1P3LB 4CSRA 4XZQB 1P3BB 1P3IB 3AZLD 5B2IB 5CPKC 5HHYA 5JRGD 1TZYB 5GSUD 4H63Q 1BS0A 5B0ZB 1IX7A 5AVBB 5B33A 2A1VA 1BJ4A 4G92C 3MC6C 3G7QA 4XQ2A 3WKRA 5DNMD 2GSAA 5B32C 3W96C 2YKYA 5B0YD 1YNUA 2V0YA 2VGSA 4MQQA 5AV6C 1KX4B 4Z5TD 2NZDC 3BN1A 5BNVB 5B1LA 4WYCA 4YS3D 1P3WA 1CS1A 4K2MA 3NUBA 3ACZA 3IHJA 5M49A 3GWPA 3TU4D 4K2IA 5B2JC 3H0MC 3AYWA 2G7JA 3LZ1A 1M0QA 4H9PB 3TU4B 3W1HA 3JZLA 3DR7A 2VYCA 1WKHA 3UT9A 1W7MA 1Q9CA 2AROA 1F66B 2WKAA 1JS6A 5B1MD 5GT0B 4KAMA 3C1CB 2V1PA 2QB3A 3V9RB 2FM1A 2PYOC 4WU8B 5F99B 3AL0C 1EJIA 5M46A 3W99B 1MDOA 3OP7A 2Z9VA 3AENB 4WNNB 3WTPC 1AHFA 1ASDA 4NE3A 3X1VB 3MGRD 3X1VA 3W99D 1ASGA 1P3LD 2NMPA 3EPHA 3D6KA 2O0RA 3O62C 3DC1A 4PIWA 1P34A 2W7IA 5CPJC 7AATA 4AWLC 3FTBA 3W99C 4ISYA 4WU8A 1CQ7A 4O6ZA 3WAAA 5B24C 2XH1A 5GT0A 4ZASA 5C6UA 1PZRA 3AZJA 2CJGA 1IX6A 1AHGA 1SZSA 2ZUKA 1TOGA 3FDDA 1BJWA 4AWLB 4K2BA 2NZDD 1AICA 4XJLA 5AV9B 3N5MA 5CPJB 4EB5A 5CPIA 3P6KA 2ZY2A 5EAAA 3AZNB 1BFMA 4XK1A 3AZMB 4Y0IA 2FJ7C 5CP6A 1CQ8A 5DNNA 1O61A 3VH6T 3FSLA 4WU9D 3AEJC 3HMUA 2DOUA 1JG8A 3B0DB 4H9QA 2EYQA 5JA4B 5F9SA 2YCTA 4E3QA 3FKDA 4PFFA 4R8PD 4X23A 1AOIA 2D61A 3AZHD 1UKJA 1N1JA 2ZY5A 3B6FB 2AY3A 2OGAA 2W8WA 4PVFA 5B2JD 1A7WA 3GSBA 3NX3A 3B6FD 1MAQA 3JWBA 5AVBA 2O7CA 2ZSLA 3REHA 2Y2QA 3B0CT 2FYFA 5DNNB 2RIQA 1UU1A 3ZRPA 5B40B 3K28A 1GDEA 4DGTA 4KYOA 2Y2PA 3MGPB 3X1TC 3UTAA 3VOMA 5KTBA 4RJ0A 5B31C 3UTBB 2OGEA 1BJNA 3GZCA 3IP4C 4WYFA 3RELC 2WK9A 3N0LA 1I41A 3UTBD 3O62D 1ID3C 3E2ZB 3FFRA 5G2PA 5IWQA 1LW4A 1BT4A 3KXBA 3DXVA 4Q75A 3VH5W 1M1AC 1TZYC 1D7SA 2ZM5A 5B2ID 3OKSA 5GXQA 1SZUA 3JTXA 3RUYA 1BH8B 2D66A 1MDZA 3B1EA 3E6GA 4A00A 1D2FA 4XZQD 3NTJA 1P3ID 2VMQA 2VMUA 3KUYA 3AZFD 2CV5A 5FUGB 3AENA 1KU5A 1ARTA 3QPGA 4WYEA 4U1TA 3C1CA 4AOAA 1P3GD 5AV9A 2D64A 4QLCA 1TATA 3NQJA 1F66C 1AKBA 3ZRRA 1C7OA 1AAWA 5AV5D 5B0YB 2C7TA 3FZ8A 2VMPA 2IO5B 1JS3A 3M5UA 2BYJA 5AVCC 2GMSA 3WKJA 1HTAA 5DJ1A 2W7MA 3AFAA 3B1CA 3CQ6A 1N8PA 1XEYA 3I16A 1CL1A 1LW5A 1VEFA 1ASCA 2CWEA 3AZLC 3AZGA 4R8PC 4M2KA 1KX4A 3H9XA 3DU4A 1M1AB 1Z7DA 2DKJA 1AMSA 1KL1A 4RAEA 2W7DA 4BA5A 1BJOB 3X1UD 4IW7A 4J8LA 4MY5A 2WK7A 5GT3A 2Q7WA 3PIUA 3X1VC 1AKCA 1QISA 3EG5B 3A9XA 1WYTA 3A9YA 1P34C 1YOOA 3HDOA 2CJDA 5CPJA 3WA9C 1EQZB 3A2BA 2JJGA 4IY7A 1ZLAB 4H9PA 3TU4A 3PGYA 5AV6D 4XEWA 3EUCA 3LWSA 3W97D 3AYWD 2Y2NA 5TF5A 4OBUA 2HIOB 1GCKA 4J8WA 3BCXA 4ADDA
chains in the Genus database with same CATH topology
4AH3A 4ATPA 1FG7A 4BA4A 5DNMC 1IJIA 3LV2A 3W97B 4Q6RA 2GB3A 3KGWA 1W23A 3UT9D 2RVQD 2AROD 1E5FA 4LW2A 1ARSA 3N7NA 2RVQC 3WKJB 3AZKC 1V72A 5E5AD 3W96D 4NFTA 3AZIC 1M18A 5B33D 2NQBD 1C7NA 3X1TD 1P3PA 2F8NB 2YKUA 1O4SA 1AOIC 3NDNA 2C81A 5B33B 5KDMB 1TPLA 5D5SA 1YIZA 2ZYJA 3AEOA 5HXXA 4Y0HA 1P3MA 5BS7A 4R8PB 2VMRA 4Z5TA 2HUIA 3WAAD 1Z3ZA 3LZ1B 1LC5A 5B1LD 3JWAA 1QIRA 1SFFA 4YS3A 4UPKA 1PMMA 4ZLVA 1DJUA 1RVUA 4WU9B 3II0A 1QITA 4GDYA 2VI9A 4J8XB 2NZDA 4ZBJB 2Y2MA 5CPID 5GSUC 4ZWVA 4KXKA 4ZDLA 5CHLB 5DNMB 4LD9C 5DNND 4KUDC 3LELA 2VIAA 2EH6A 2BI9A 3RCHB 3LZ0A 2QSRA 2AY1A 2RFVA 2ORDA 4ZWMA 2CFBA 8AATA 2KFPA 1C9CA 4EO5B 2VI8A 2R5EA 4WXFA 4W91A 5G4JA 4LNMA 2F8JA 1BQAA 3NQJB 3MBBA 3FQ8A 4W5KA 2JJFA 1TZYA 2G5HC 1GC2A 5B24B 3REHB 2PYOA 5AY8A 3MGSD 4JF1A 2BYLA 4NE6A 2HOZA 3CQ4A 3R4TA 1JFIB 3P1TA 3RELD 1P3OB 3EI9A 2PO3A 2VGUA 3NQUB 1IUGA 3VP6A 5GT0D 3AZJD 1V2DA 3N4RA 5BNXA 3QM2A 3KXBB 1MDXA 3WGCA 3AZLB 5E5IA 3JW9A 1OXOA 3A6NC 4IYOB 5CP6D 4JEYA 2VMWA 3UTBA 1P3AA 3X1SC 3WKJC 2FQ6A 2YFVA 2VGTA 5B31D 4F5KA 3UTAB 4J8UB 2W8VA 4F5HA 4Q76A 1B9IA 1S32C 5E4ZA 1QJ5A 4CXRA 1WYVB 1P3AB 4R8PA 2L5AA 4G92B 3AATA 2R5CA 4GSAA 3REHD 3LVMA 5GXQB 3AZKD 5GT3C 3QBOA 5M4BA 5G49B 3HBXA 3GR9A 3B6FA 4QLCD 3MC6A 3MVDD 1P3OD 5AX8A 1AY5A 2HUEB 4ZAHA 2F8ND 4OYTA 1G7XA 1P3OC 2VMZA 3AZNC 3FVUA 3FQAA 3K7YA 3ELPA 3W98C 2AY2A 2CANA 3AV1A 3REHC 4ZUXA 2HUFA 1KKJA 4KUDD 1HQ3A 4JEWA 5AV5C 4UOYA 2ZY3A 4ZSWA 1AHYA 3N75A 3REJB 1ASMA 1KX5A 2DGMA 4U2HA 3G8MA 4JF0A 2CV5D 3KXBD 4JJNC 3I5TA 4AO4A 3WZFA 3LZ1C 2EO5A 1IBJA 3C1CD 2HIOD 1U35A 1GEYA 3REIC 1M1AA 1AOIB 3BCBA 3KUYD 3A1IA 2GMUA 5GXQC 2QB2A 2J8PA 1OHWA 4Z5TC 2BG1A 5CPKD 4NOGA 2JJHA 1U35B 5AV9D 2YHKA 2UWXA 4UQVA 3AFAB 3WKJD 4XJOA 1CZCA 2VMXA 3AZMA 4H9RB 5G4IA 1QJ3A 3I4JA 4XJPA 4A6RA 4YM6B 1ARGA 5AV9C 3DXWA 3NU8A 3H7FA 2YRIA 4KHAB 3AZGD 2W7EA 5E3KA 3EPKA 3L8AA 3ECDA 4LD9A 4LD9B 1P3PB 3LELC 2OKKA 4QLCB 4XUJB 1P3FB 3AZFC 1DFOA 5B0ZD 4WXBA 4Z66D 5I92A 3WAAB 5GT3D 3NYSA 1P3PD 4J8XD 3BV0A 4K05A 3C1BC 2CV5B 2VLHA 2HP2A 1WYUA 4F5LA 4G91C 3FVSA 4B98A 4XUJC 5EIGB 3EZSA 3AZGC 5DNNC 1ID3D 3W97A 5AY8C 1M4NA 1N2TA 3A1KA 4TN4A 3AEMA 5G49A 2JSSA 2W7GA 5F99A 4ITXA 3E2ZA 2EPJA 4EFFA 3FFHA 1AY4A 4RITA 1SF2A 1KX3B 4G91B 1ZLAA 2PB2A 4R5ZA 4XZQC 2Z61A 5D95A 4GE9A 2VGWA 1S0AA 1WYTB 3AZKB 3EI5A 2VGVA 2BWNA 3LELD 1AMAA 4HGAC 2G6WA 3W96A 1TOIA 3GBXA 5B32G 4J8UA 3RI6A 4CSRB 1O69A 2QLRA 3LG0A 3AN2D 3PDXA 4IYOA 4IX8A 4H9OA 2BI2A 3HT4A 3GJUA 3RBLA 5E5AA 4ZSYA 1PMOA 3RELB 3AV2B 3PD6B 2GQNA 2QMAA 3LZ0B 3X1TA 3HVYA 1WWIA 1C4KA 3MGPC 1GC4A 2CH1A 4B9BA 2DF4C 3REJC 1GBNA 4RLGA 4ZM3A 3RELA 2F8NG 3K40A 2BI1A 4WLHA 5G0AA 3TFUA 1P3PC 2Y2HA 1GC3A 1M6SA 3KSYA 3BWNA 1W2EA 3QN6A 3B0DC 2R2NA 2YFWA 5AY8B 1IVRA 1OHVA 4F5GA 1P3KC 4DQ6A 3MGRA 3X1VD 4A0GA 1P3LA 5FUGA 3AZNA 1M0NA 5KDMA 3AN2C 3W98A 4RJYA 3B1DA 4E77A 3MGQD 2CTZA 2DKBA 5AV5B 3REIB 5K8BA 1H3OB 1KX5C 1KX3D 2AY5A 2BWOA 3MGSA 4JEVA 2YOBA 3HQTA 4LW4A 4NE5A 2YCPA 3KWQB 2Z1YA 3NQUA 2Z20A 1M19A 1ASNA 4WV4B 4KUDB 4H9OB 2PYOD 3AFAC 1KKPA 1VP4A 2YCNA 1U35C 1TASA 2HOYA 2NQBC 3LVJA 3AZEB 1XI9A 2QA3A 4ADBA 2PYOB 3V9RA 3LJAC 1ZC9A 3TCMA 1IX8A 4X23D 1AOID 4AO9A 1EQZC 1S32D 1B67A 3UT9B 3WX9A 2BWPA 3AZHB 1CL2A 3KE3A 2LY8A 4ADEA 4LNJA 3X1SD 1DGEA 4P7YA 1WWSA 1S32B 2AEVA 3AYWB 3WA9A 3RCHA 4WBTA 2HP1A 3X1SB 2YKXA 3NU7A 1YJSA 4ITGA 1AAMA 4HF8A 2DQNC 3LJAD 3REKA 5E5AB 4FFCA 3NUIA 3BS8A 4A6TA 1M0PA 1S06A 4GRXA 4OC9A 4FL0A 4MKKA 2HIOA 1U35D 1B5OA 3C1BA 3ASAA 3W96B 4A0FA 2W8TA 1P3FA 4XUJA 1TOJA 3UTAC 3EI7A 3AZKA 2ZJGA 4RM1A 5EUNA 1P3MB 2FNIA 5B31G 3REID 3WTPE 4OCAA 1LK9A 1KL2A 5F99C 1TARA 2F8NA 4KGCD 3BC8A 5B2IA 3AV1B 5AVCD 4WU9C 4AZJA 5AV8D 1ZLAC 3ZRQA 3KXBC 4JJND 3B6GC 1D7RA 1P3GB 2PB0A 1P34B 1RVYA 1P3MC 2JG2A 3GZDA 4UHNA 3FZ7A 3AV1D 1AJRA 3WCNA 3EI6A 1M19B 4H51A 2W7JA 1ORDA 2TPLA 3BB8A 3AZHC 3WTPB 1P3GA 3ISLA 1P3KD 1AIBA 4H9SA 2EZ1A 3AV1C 3CQ5A 2CH2A 4HVKA 4ZUXC 4J8WB 3C1CC 3R9AA 5E5AC 5AV5A 2WB6A 3AELA 3FQ7A 1LS3A 3MNND 1F66A 3A6ND 2Y2JA 1ZODA 2HUUA 3LZ0C 1ELQA 1G4XA 5F99D 4WLJA 1M1AD 3E9KA 3CAIA 1N31A 1HQ3B 3EPJA 4RKDA 4DQYB 4J8VA 1YJYA 5AV8C 1ZLAD 2W8UA 5CPKA 4QGRA 3WLXA 1AX4A 5B33C 1G7WA 4LNLA 1CJ0A 2E54A 4A6UA 5B1LB 3AZLA 4DRAA 3G0TA 3DYDA 4WYGA 1BW0A 3UWCA 3KGXA 5AV6B 1KX4C 3MGRC 4CAYA 3WKSA 5BNXB 3AZIB 1AY8A 1GEWA 4Z66A 1N1JB 4J8UD 2D63A 4TMRA 4F5IA 3RBFA 1ELUA 5B32B 3RQ1A 3QI6A 3AN2A 4X23B 2FJ7B 4E45A 3FCRA 1P3BD 2O1BA 5B1LC 5B0YA 3B6GD 3ASBA 2R0TA 5B0ZA 2XD1A 5CPKB 2HOXA 4J8WD 3EI8A 3H0RC 2Z9UA 1W3UA 1KX5B 1FG3A 4GEBA 2VMOA 1I43A 4ZUXB 4J8WC 4ZBJC 1AHXA 1W7LA 4WZSB 2AY6A 1QGNA 3NNKA 5B24D 5FT6A 2E7IA 3N4XA 1H1CA 3LZ1D 3AV2C 1DJEA 3KWQA 1V2EA 1OHYA 1TAFB 2BI3A 3DR4A 3AEMC 3AZIA 5B1MB 5B1MA 3AEPA 5BT1C 3L44A 1AJSB 5HDMA 3WTPA 3FD0A 3B0BA 1P3MD 4R2NA 3EIAA 2JCHA 1P3BC 2D7ZA 2JISA 2ZC0A 1I29A 4H9QB 4WNNA 2Y2IA 3MGRB 3W99A 2FJ7D 1AMQA 2QBTA 5BJ4A 1G4VA 4UUZA 1IAYA 1P34D 1SZKA 5CPIB 5GT0C 1U08A 3AZJC 4J8UC 2AROB 2YFVB 2AATA 1M19D 4WU8D 1BQDA 3FDBA 3P5JB 4KHAA 2FFFB 2Y2GA 2HIOC 2OKJA 1B9HA 4W1XA 1M18B 2C44A 5DJ9A 4J8XC 1WSTA 4WB0A 2ZSMA 2W7FA 3PPLA 2E7UA 3A9ZA 3LVKA 1EG5A 3X1TB 3AZND 3PD6A 4F5MA 4CAYB 5B40C 1MLZA 3REKB 3WCOA 3ATHA 1B8GA 3F6TA 1YIYA 2NZDB 2CB1A 3MGQA 2OQXA 4IXOA 3B46A 4CVQA 3AOVA 4YM6D 3O62B 1BKGA 4J8VB 3KKIA 2XBNA 2C0RA 5CP6B 3W1JA 3PA9A 2DGLA 1IAXA 1P3LC 2E7JA 1SPAA 4ZDPA 1F1EA 1DTYA 5EFSA 3WGBA 2YRRA 4H9SC 1KX3A 3VH6A 4XJMA 5GT3B 3B8XA 3T32A 3USFA 4Y0DA 1JF9A 2X8UA 1P3FD 3BWOA 3MAUA 5AV8B 3MGSC 2Z1ZA 1AKAA 1P3AD 4ATQA 5EIGA 5B31A 2W7HA 1ASBA 5B2JB 3UTBC 1DGDA 3X1SA 1C0NA 3MKJA 4F5FA 5AV8A 3UE8A 4YS3B 3MNNB 3A6NB 1BH9B 1S32A 3NYUA 4MQPA 1X29A 1QZ9A 2HORA 3LJAA 3W98B 1EQZA 3HLMA 3VH5A 3WA9D 2X5FA 3KUYC 2D5YA 5DX5A 3MVDA 2F8NK 3PDBB 3AZEA 3C1BD 4XZQA 3B6FC 3MNNA 2YFWB 3REKD 3AV2D 3DODA 5B0ZC 2BYKA 4Z2MH 3A8UX 4M2JA 1BH8A 4WU8C 3WAAC 4BQ0A 1E5EA 5BO0A 5BNVA 2EGYA 1KX5D 2AY7A 5AVCA 2CJHA 3X1UC 1TAFA 1B6WA 3MAFB 1HQ3C 2EZ2A 5CPIC 2Y2LA 4YM6C 1AIAA 2AY8A 2AEUA 1W7NA 2W8JA 4KGCA 4DBCA 3AFAD 3MGPA 1J04A 2Z9XA 5J8QA 3EZ1A 3AEJA 1V2FA 1R4VA 3MEBA 4JEXA 4JJNA 1JFIA 3DZZA 3REJA 2AY9A 1TOEA 5EAVA 3Q8NA 4IXZA 2D7YA 1KX4D 2FN6A 1P3BA 4RKCA 3B6GA 2BKWA 1J32A 9AATA 4WYDA 3MGQB 4A72A 2BYMA 1P3KA 3ZZKA 3AZGB 4W1VA 1ZOBA 3TU4C 4M6BA 2HZPA 5B32A 3AZMD 1P3GC 3TQXA 5AVBC 4J8VD 5AV6A 5AVCB 4EU1A 5DNMA 1LC7A 2X3LA 4GE4A 1CQ6A 2AY4A 3AZFB 1ASLA 1P3IC 4WP0A 3KWQD 3LVLB 1AHEA 4WD2A 2DR1A 2Z9WA 4MSOA 4EO5C 2Y2OA 3AYWC 1OATA 1B5PA 4UUZB 4CXQA 1PG8A 1KMKA 4IXSA 4F4EA 5EUEA 5B40A 1M19C 4BHDA 1M32A 1ID3A 1MLYA 3MGQC 5EUDA 3UT9C 1M18D 2NQBA 1ARIA 1OXPA 4CBRA 3LJAB 4EB7A 3DRDA 5BS7C 1I48A 3R45B 4GE7A 4H9RA 2VIBA 2OATA 4LC3A 1MAPA 3AN2B 2JGTA 1Y4IA 1BH9A 4Z2MG 1SVVA 5JRGA 4W1WA 5GSUA 4H9NB 3LY1A 1MGVA 1GD9A 4I8AA 5JA4A 2JJEA 3AZID 5B24A 1AMRA 4XAUA 2XD5A 3FVXA 3AV7A 1GC0A 4UHOA 5G09A 2W7KA 5BT1D 4JJNB 3PAAA 2YKVA 1ECXA 4WYAA 3HL2A 4OMAA 1ASAA 3LZ0D 4KGCB 1DKAA 2ZY4A 3ELEA 2BHXA 2IO5C 3TATA 3BCAA 2VMVA 3KWQC 2FJ7A 3WTPD 1S09A 1BJOA 4F5JA 1RV4A 2VMYA 3MADA 4PFNA 1TZYD 4MKJA 1H0CA 1KMJA 2W8SA 3VH6W 3MVDC 3B0CW 5B2IC 5AY8D 1CZEA 4WU9A 1X28A 3AZEC 3H0LC 3BWNC 1LC8A 1WYUB 1EQBA 2VMTA 4RIZA 3WA9B 3QGUA 3MNNC 1S07A 5JAYA 4EMYA 3GZDC 5BJ3A 2CY8A 3N4SA 1Z2CB 5G2QA 3W98D 4WB0B 4Z5TB 3AOWA 1YJZA 3VAXA 3MVDB 1T3IA 2CSTA 3AZHA 2R5CB 3QHXA 2JE5A 4E44A 3FZ6A 2VGZA 1P3AC 3COGA 3FRKA 3AZJB 3GETA 2F8NH 4YM6A 2BIEA 1D7VA 3C1BB 4KGCC 2G5IC 5B2JA 5F8VA 1EQZD 3NRAA 1FC4A 5JRGB 1M18C 1X2AA 4MQRA 4AZKA 5AVBD 4J8VC 3UTAD 3EIBA 4R8DA 2ZP7A 3NYTA 1M7YA 4Q31A 1AJSA 1C7GA 2AROC 2DGKA 2VLFA 5C3IC 3R45A 5FT4A 4HGAB 4A0HA 5FT8A 2W7LA 2NQBB 1P3OA 2CINA 4Z66C 4UHMA 2FNUA 4YS3C 2CV5C 1B4XA 2BIAA 1ASFA 3B6GB 5GXQD 4ZDOA 2VMNA 1KX3C 3CBFA 1ARHA 1YAAA 3E77A 3O62A 3EPLA 3F9TA 5C3IB 5B0YC 1P3IA 4WJ3C 4QLCC 1ASEA 2BIGA 2X5DA 1D7UA 1WKGA 4ZUXD 4BMKA 4KUDA 1TOKA 3VK4A 1HQ3D 4ZM4A 3TFTA 3REKC 3E2YA 3REJD 4H9NA 5GSUB 1DJ9A 5EQCA 3F0HA 3VK3A 3AZED 4XUJD 4P3MA 1UU0A 3X1UB 4L0OA 4OTLA 4JEZA 3VK2A 4Z66B 1H3OA 3AV2A 1ULYA 3REIA 2VMSA 4W8IA 1P3FC 5CP6C 4E3RA 1X0MA 1P3KB 2BYMB 4ADCA 5B32D 1T3UA 2D65A 2Y2KA 4R5FA 2BYKB 5B1MC 4J5UA 4WXGA 1ID3B 3PJ0A 1WYVA 1PFFA 4X23C 3ZZJA 3PDBA 1UU2A 3AZMC 4DRBA 5JRGC 4CBSA 2HUEC 3KUYB 2BI5A 3E2FA 1M0OA 3VH5T 1VJOA 5DB5A 1LKCA 3KFUG 2WK8A 5FT5A 3WY7A 3MAFA 5CPJD 4E1OA 3AZFA 5B40D 1GEXA 4OBVA 3LELB 1F66D 4LD9D 3A6NA 3MGSB 2FKIA 3X1UA 3MGPD 5BO0B 2VQRA 4OT8A 4M2MA 3UAKA 4A0RA 4N0WA 3W1IA 5M4DA 1S08A 4J8XA 1O62A 1RV3A 5B31B 2F2AC 3W97C 1P3LB 4CSRA 4XZQB 1P3BB 1P3IB 3AZLD 5B2IB 5CPKC 5HHYA 5JRGD 1TZYB 5GSUD 4H63Q 1BS0A 5B0ZB 1IX7A 5AVBB 5B33A 2A1VA 1BJ4A 4G92C 3MC6C 3G7QA 4XQ2A 3WKRA 5DNMD 2GSAA 5B32C 3W96C 2YKYA 5B0YD 1YNUA 2V0YA 2VGSA 4MQQA 5AV6C 1KX4B 4Z5TD 2NZDC 3BN1A 5BNVB 5B1LA 4WYCA 4YS3D 1P3WA 1CS1A 4K2MA 3NUBA 3ACZA 3IHJA 5M49A 3GWPA 3TU4D 4K2IA 5B2JC 3H0MC 3AYWA 2G7JA 3LZ1A 1M0QA 4H9PB 3TU4B 3W1HA 3JZLA 3DR7A 2VYCA 1WKHA 3UT9A 1W7MA 1Q9CA 2AROA 1F66B 2WKAA 1JS6A 5B1MD 5GT0B 4KAMA 3C1CB 2V1PA 2QB3A 3V9RB 2FM1A 2PYOC 4WU8B 5F99B 3AL0C 1EJIA 5M46A 3W99B 1MDOA 3OP7A 2Z9VA 3AENB 4WNNB 3WTPC 1AHFA 1ASDA 4NE3A 3X1VB 3MGRD 3X1VA 3W99D 1ASGA 1P3LD 2NMPA 3EPHA 3D6KA 2O0RA 3O62C 3DC1A 4PIWA 1P34A 2W7IA 5CPJC 7AATA 4AWLC 3FTBA 3W99C 4ISYA 4WU8A 1CQ7A 4O6ZA 3WAAA 5B24C 2XH1A 5GT0A 4ZASA 5C6UA 1PZRA 3AZJA 2CJGA 1IX6A 1AHGA 1SZSA 2ZUKA 1TOGA 3FDDA 1BJWA 4AWLB 4K2BA 2NZDD 1AICA 4XJLA 5AV9B 3N5MA 5CPJB 4EB5A 5CPIA 3P6KA 2ZY2A 5EAAA 3AZNB 1BFMA 4XK1A 3AZMB 4Y0IA 2FJ7C 5CP6A 1CQ8A 5DNNA 1O61A 3VH6T 3FSLA 4WU9D 3AEJC 3HMUA 2DOUA 1JG8A 3B0DB 4H9QA 2EYQA 5JA4B 5F9SA 2YCTA 4E3QA 3FKDA 4PFFA 4R8PD 4X23A 1AOIA 2D61A 3AZHD 1UKJA 1N1JA 2ZY5A 3B6FB 2AY3A 2OGAA 2W8WA 4PVFA 5B2JD 1A7WA 3GSBA 3NX3A 3B6FD 1MAQA 3JWBA 5AVBA 2O7CA 2ZSLA 3REHA 2Y2QA 3B0CT 2FYFA 5DNNB 2RIQA 1UU1A 3ZRPA 5B40B 3K28A 1GDEA 4DGTA 4KYOA 2Y2PA 3MGPB 3X1TC 3UTAA 3VOMA 5KTBA 4RJ0A 5B31C 3UTBB 2OGEA 1BJNA 3GZCA 3IP4C 4WYFA 3RELC 2WK9A 3N0LA 1I41A 3UTBD 3O62D 1ID3C 3E2ZB 3FFRA 5G2PA 5IWQA 1LW4A 1BT4A 3KXBA 3DXVA 4Q75A 3VH5W 1M1AC 1TZYC 1D7SA 2ZM5A 5B2ID 3OKSA 5GXQA 1SZUA 3JTXA 3RUYA 1BH8B 2D66A 1MDZA 3B1EA 3E6GA 4A00A 1D2FA 4XZQD 3NTJA 1P3ID 2VMQA 2VMUA 3KUYA 3AZFD 2CV5A 5FUGB 3AENA 1KU5A 1ARTA 3QPGA 4WYEA 4U1TA 3C1CA 4AOAA 1P3GD 5AV9A 2D64A 4QLCA 1TATA 3NQJA 1F66C 1AKBA 3ZRRA 1C7OA 1AAWA 5AV5D 5B0YB 2C7TA 3FZ8A 2VMPA 2IO5B 1JS3A 3M5UA 2BYJA 5AVCC 2GMSA 3WKJA 1HTAA 5DJ1A 2W7MA 3AFAA 3B1CA 3CQ6A 1N8PA 1XEYA 3I16A 1CL1A 1LW5A 1VEFA 1ASCA 2CWEA 3AZLC 3AZGA 4R8PC 4M2KA 1KX4A 3H9XA 3DU4A 1M1AB 1Z7DA 2DKJA 1AMSA 1KL1A 4RAEA 2W7DA 4BA5A 1BJOB 3X1UD 4IW7A 4J8LA 4MY5A 2WK7A 5GT3A 2Q7WA 3PIUA 3X1VC 1AKCA 1QISA 3EG5B 3A9XA 1WYTA 3A9YA 1P34C 1YOOA 3HDOA 2CJDA 5CPJA 3WA9C 1EQZB 3A2BA 2JJGA 4IY7A 1ZLAB 4H9PA 3TU4A 3PGYA 5AV6D 4XEWA 3EUCA 3LWSA 3W97D 3AYWD 2Y2NA 5TF5A 4OBUA 2HIOB 1GCKA 4J8WA 3BCXA 4ADDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AH3 A;  4ATP A;  1FG7 A;  4BA4 A;  1IJI A;  3LV2 A;  4Q6R A;  4J5U A;  3QN6 A;  2R2N A;  4WXG A;  2GB3 A;  2Z1Z A;  1AKA A;  3KGW A;  1W23 A;  4ATQ A;  3PJ0 A;  5EIG A;  1IVR A;  1OHV A;  4F5G A;  2W7H A;  1E5F A;  1WYV A;  4LW2 A;  1PFF A;  1ARS A;  4DQ6 A;  3ZZJ A;  3PDB A;  1ASB A;  1UU2 A;  4A0G A;  4CBS A;  1DGD A;  1C0N A;  2BI5 A;  3E2F A;  3MKJ A;  1V72 A;  4F5F A;  1M0O A;  3UE8 A;  1M0N A;  1VJO A;  5DB5 A;  1LKC A;  4RJY A;  1C7N A;  3NYU A;  3B1D A;  2WK8 A;  4E77 A;  2CTZ A;  2DKB A;  5FT5 A;  4MQP A;  3WY7 A;  3MAF A;  1X29 A;  4E1O A;  5K8B A;  1QZ9 A;  1GEX A;  2HOR A;  2YKU A;  1O4S A;  3NDN A;  2C81 A;  2AY5 A;  1TPL A;  2BWO A;  5D5S A;  1YIZ A;  2ZYJ A;  3AEO A;  5HXX A;  4JEV A;  3HLM A;  2YOB A;  3HQT A;  2X5F A;  4LW4 A;  2D5Y A;  4Y0H A;  5DX5 A;  2YCP A;  4OT8 A;  4M2M A;  2VMR A;  3UAK A;  4A0R A;  2HUI A;  3PDB B;  4N0W A;  2Z1Y A;  5M4D A;  1S08 A;  1Z3Z A;  1LC5 A;  1O62 A;  2Z20 A;  1RV3 A;  3JWA A;  1ASN A;  1QIR A;  1SFF A;  4ZLV A;  1DJU A;  1KKP A;  1VP4 A;  3DOD A;  4M2J A;  2YCN A;  3A8U X;  1RVU A;  1TAS A;  2HOY A;  3II0 A;  1QIT A;  4GDY A;  2VI9 A;  3LVJ A;  4BQ0 A;  1XI9 A;  4ZWV A;  1E5E A;  2QA3 A;  4KXK A;  4ADB A;  4ZDL A;  1ZC9 A;  5HHY A;  3TCM A;  1IX8 A;  2EGY A;  1BS0 A;  1IX7 A;  4AO9 A;  2AY7 A;  2CJH A;  1BJ4 A;  2VIA A;  3MC6 C;  3WX9 A;  2BWP A;  2EH6 A;  1CL2 A;  3MAF B;  2EZ2 A;  2BI9 A;  3G7Q A;  3RCH B;  3KE3 A;  4XQ2 A;  2AY8 A;  1AIA A;  4ADE A;  4R5F A;  2RFV A;  2AY1 A;  4LNJ A;  3WKR A;  1W7N A;  1DGE A;  2GSA A;  2ORD A;  2W8J A;  4P7Y A;  4ZWM A;  2CFB A;  2YKY A;  8AAT A;  1C9C A;  2VI8 A;  4DBC A;  2R5E A;  1J04 A;  2Z9X A;  4WXF A;  5J8Q A;  3RCH A;  4WBT A;  3EZ1 A;  1YNU A;  2HP1 A;  2V0Y A;  1V2F A;  2VGS A;  3AEJ A;  4MQQ A;  4W91 A;  5G4J A;  3MEB A;  4JEX A;  4LNM A;  2YKX A;  2F8J A;  1BQA A;  3DZZ A;  3NU7 A;  3MBB A;  3FQ8 A;  1YJS A;  4ITG A;  2JJF A;  4W5K A;  1AAM A;  3BN1 A;  2AY9 A;  1GC2 A;  1TOE A;  4HF8 A;  5EAV A;  4WYC A;  3Q8N A;  4IXZ A;  2D7Y A;  4FFC A;  1P3W A;  1CS1 A;  4K2M A;  3NUI A;  4JF1 A;  2BYL A;  3BS8 A;  3NUB A;  2FN6 A;  3ACZ A;  2HOZ A;  3CQ4 A;  4A6T A;  4RKC A;  2BKW A;  3IHJ A;  3R4T A;  5M49 A;  1J32 A;  9AAT A;  1M0P A;  1S06 A;  4WYD A;  4K2I A;  3P1T A;  4GRX A;  4OC9 A;  4FL0 A;  4A72 A;  4MKK A;  3EI9 A;  1B5O A;  3ZZK A;  2PO3 A;  4W1V A;  3ASA A;  1ZOB A;  2VGU A;  2HZP A;  4A0F A;  2W8T A;  1M0Q A;  1IUG A;  1TOJ A;  3DR7 A;  3EI7 A;  1V2D A;  2VYC A;  3TQX A;  2ZJG A;  3QM2 A;  1WKH A;  5EUN A;  2FNI A;  1W7M A;  4EU1 A;  4OCA A;  1LK9 A;  1KL2 A;  1LC7 A;  2WKA A;  1JS6 A;  4GE4 A;  1CQ6 A;  1MDX A;  3WGC A;  1TAR A;  1ASL A;  2AY4 A;  5E5I A;  4KAM A;  3JW9 A;  2V1P A;  3BC8 A;  2QB3 A;  2FM1 A;  4WP0 A;  1OXO A;  3LVL B;  4AZJ A;  1EJI A;  4IYO B;  5M46 A;  1MDO A;  3ZRQ A;  4JEY A;  3OP7 A;  2Z9V A;  1AHE A;  1D7R A;  2VMW A;  4WD2 A;  3AEN B;  2DR1 A;  2FQ6 A;  2Z9W A;  2PB0 A;  1RVY A;  2VGT A;  4F5K A;  4MSO A;  2JG2 A;  3GZD A;  1AHF A;  1ASD A;  1OAT A;  2W8V A;  4UHN A;  4Q76 A;  4F5H A;  1B5P A;  1AJR A;  1ASG A;  1B9I A;  3EI6 A;  4CXQ A;  1PG8 A;  1KMK A;  4H51 A;  2W7J A;  4IXS A;  5E4Z A;  5EUE A;  4F4E A;  1ORD A;  2NMP A;  3D6K A;  2TPL A;  2O0R A;  3DC1 A;  3BB8 A;  4PIW A;  1QJ5 A;  4CXR A;  1WYV B;  2W7I A;  3ISL A;  4BHD A;  7AAT A;  1M32 A;  1MLY A;  3FTB A;  4ISY A;  5EUD A;  1AIB A;  2EZ1 A;  3CQ5 A;  1ARI A;  1OXP A;  2CH2 A;  1CQ7 A;  3AAT A;  4O6Z A;  4HVK A;  4CBR A;  2R5C A;  4EB7 A;  2XH1 A;  3DRD A;  4GSA A;  3R9A A;  4ZAS A;  3LVM A;  1I48 A;  5C6U A;  3AEL A;  4GE7 A;  3FQ7 A;  1LS3 A;  2CJG A;  2VIB A;  2OAT A;  3QBO A;  4LC3 A;  1IX6 A;  1AHG A;  5M4B A;  1MAP A;  1SZS A;  2JGT A;  1TOG A;  2ZUK A;  3GR9 A;  1Y4I A;  3FDD A;  3MC6 A;  1SVV A;  1ZOD A;  1BJW A;  2HUU A;  5AX8 A;  1AY5 A;  4K2B A;  4XJL A;  1AIC A;  4ZAH A;  3N5M A;  1ELQ A;  4EB5 A;  3P6K A;  2ZY2 A;  5EAA A;  1G4X A;  4OYT A;  4WLJ A;  4XK1 A;  4ADD A;  3E9K A;  1G7X A;  4Y0I A;  3CAI A;  1N31 A;  4RKD A;  2VMZ A;  1CQ8 A;  4W1W A;  3FVU A;  3LY1 A;  1MGV A;  1YJY A;  3FQA A;  1GD9 A;  1O61 A;  2W8U A;  3FSL A;  4I8A A;  3AEJ C;  3HMU A;  2DOU A;  1JG8 A;  3K7Y A;  3ELP A;  4QGR A;  2AY2 A;  2CAN A;  2JJE A;  3WLX A;  1AX4 A;  1G7W A;  4LNL A;  1CJ0 A;  1KKJ A;  2E54 A;  2HUF A;  4A6U A;  5F9S A;  2YCT A;  1AMR A;  4XAU A;  4E3Q A;  3DYD A;  3FKD A;  4JEW A;  4PFF A;  3FVX A;  4UOY A;  1BW0 A;  4WYG A;  3AV7 A;  1GC0 A;  2ZY3 A;  4UHO A;  1AHY A;  2W7K A;  1ASM A;  3N75 A;  4ZSW A;  5G09 A;  3UWC A;  3KGX A;  2YKV A;  3PAA A;  1ECX A;  4WYA A;  3WKS A;  3HL2 A;  1AY8 A;  2D61 A;  4OMA A;  1GEW A;  3G8M A;  4U2H A;  2D63 A;  1ASA A;  4TMR A;  1UKJ A;  1DKA A;  4F5I A;  2ZY4 A;  2ZY5 A;  3RBF A;  2AY3 A;  2BHX A;  3ELE A;  4JF0 A;  1ELU A;  2OGA A;  3RQ1 A;  3QI6 A;  3TAT A;  2W8W A;  4PVF A;  3I5T A;  4AO4 A;  3WZF A;  3BCA A;  3FCR A;  3GSB A;  2VMV A;  3NX3 A;  2EO5 A;  2O1B A;  1MAQ A;  1IBJ A;  3JWB A;  3ASB A;  1S09 A;  1BJO A;  2R0T A;  4F5J A;  1RV4 A;  2VMY A;  2O7C A;  2ZSL A;  1GEY A;  3MAD A;  4PFN A;  2HOX A;  4MKJ A;  1H0C A;  2Z9U A;  3EI8 A;  1W3U A;  2FYF A;  3BCB A;  1FG3 A;  4GEB A;  1KMJ A;  2GMU A;  2VMO A;  1UU1 A;  3ZRP A;  2QB2 A;  1OHW A;  1GDE A;  3K28 A;  4DGT A;  1I43 A;  4KYO A;  1CZE A;  1X28 A;  1AHX A;  4NOG A;  3BWN C;  1LC8 A;  1WYU B;  2JJH A;  1EQB A;  2VMT A;  3QGU A;  3VOM A;  1S07 A;  1W7L A;  4EMY A;  2YHK A;  5JAY A;  2AY6 A;  1QGN A;  3NNK A;  5FT6 A;  2E7I A;  4UQV A;  3GZD C;  2OGE A;  1BJN A;  5BJ3 A;  2CY8 A;  1H1C A;  4XJO A;  3GZC A;  1CZC A;  5G2Q A;  4WB0 B;  3AOW A;  2VMX A;  4WYF A;  1YJZ A;  5G4I A;  1DJE A;  1QJ3 A;  1V2E A;  1T3I A;  3VAX A;  3I4J A;  2CST A;  2WK9 A;  3N0L A;  4XJP A;  1OHY A;  4A6R A;  1ARG A;  1I41 A;  2BI3 A;  2R5C B;  3QHX A;  3DXW A;  3NU8 A;  3H7F A;  2YRI A;  3DR4 A;  3E2Z B;  3FFR A;  2W7E A;  5G2P A;  5IWQ A;  3AEM C;  5E3K A;  1LW4 A;  3L8A A;  1BT4 A;  3ECD A;  3DXV A;  4Q75 A;  2VGZ A;  3AEP A;  3L44 A;  1D7S A;  1AJS B;  3COG A;  5HDM A;  3FRK A;  3OKS A;  3GET A;  1SZU A;  3JTX A;  4R2N A;  3RUY A;  1DFO A;  2BIE A;  3EIA A;  1D7V A;  4WXB A;  5I92 A;  2D66 A;  2D7Z A;  1MDZ A;  3NYS A;  3B1E A;  3E6G A;  4A00 A;  1D2F A;  3BV0 A;  3NTJ A;  2ZC0 A;  1I29 A;  2VMQ A;  2VMU A;  3AEN A;  2VLH A;  5F8V A;  3NRA A;  1AMQ A;  1ART A;  1FC4 A;  2QBT A;  3QPG A;  2HP2 A;  1X2A A;  5BJ4 A;  1WYU A;  4WYE A;  4U1T A;  4F5L A;  4MQR A;  3FVS A;  1G4V A;  4AZK A;  1IAY A;  5EIG B;  4B98 A;  4AOA A;  3EZS A;  1SZK A;  1U08 A;  3EIB A;  4R8D A;  2D64 A;  2ZP7 A;  3NYT A;  1TAT A;  1M7Y A;  1N2T A;  1M4N A;  2AAT A;  4Q31 A;  1AJS A;  1C7G A;  3AEM A;  4TN4 A;  1AKB A;  1BQD A;  2VLF A;  3FDB A;  1C7O A;  2W7G A;  3ZRR A;  4ITX A;  1AAW A;  3E2Z A;  1B9H A;  2EPJ A;  4EFF A;  3FFH A;  4W1X A;  5FT4 A;  4A0H A;  1AY4 A;  2C44 A;  1SF2 A;  2C7T A;  2VMP A;  2PB2 A;  4R5Z A;  5DJ9 A;  2Z61 A;  5FT8 A;  5D95 A;  1WST A;  4WB0 A;  2W7L A;  1JS3 A;  2W7F A;  2BYJ A;  2ZSM A;  3M5U A;  2CIN A;  2GMS A;  3PPL A;  4GE9 A;  4UHM A;  2E7U A;  3A9Z A;  3LVK A;  2FNU A;  5DJ1 A;  2VGW A;  1EG5 A;  1B4X A;  1S0A A;  1WYT B;  2BIA A;  2W7M A;  3B1C A;  3EI5 A;  1ASF A;  4ZDO A;  3CQ6 A;  3PD6 A;  1N8P A;  2VGV A;  2VMN A;  4F5M A;  3CBF A;  2BWN A;  1CL1 A;  1AMA A;  1LW5 A;  1ARH A;  1YAA A;  1VEF A;  2G6W A;  1ASC A;  1TOI A;  1MLZ A;  3GBX A;  3E77 A;  3ATH A;  3F9T A;  1B8G A;  3F6T A;  1YIY A;  4M2K A;  1ASE A;  2CB1 A;  3RI6 A;  2BIG A;  2OQX A;  2X5D A;  1O69 A;  4IXO A;  3B46 A;  1D7U A;  2QLR A;  3DU4 A;  3LG0 A;  1WKG A;  4CVQ A;  3AOV A;  1Z7D A;  2DKJ A;  3PDX A;  4IYO A;  4IX8 A;  1AMS A;  1TOK A;  2BI2 A;  3VK4 A;  1KL1 A;  4BMK A;  3GJU A;  4RAE A;  2W7D A;  3RBL A;  1BJO B;  4BA5 A;  4ZM4 A;  3TFT A;  4ZSY A;  3E2Y A;  4IW7 A;  4MY5 A;  1BKG A;  2WK7 A;  2Q7W A;  1DJ9 A;  3KKI A;  2XBN A;  2C0R A;  1AKC A;  3PIU A;  5EQC A;  1QIS A;  3PD6 B;  2GQN A;  3PA9 A;  2QMA A;  3F0H A;  3VK3 A;  3A9X A;  1IAX A;  2E7J A;  1WYT A;  3A9Y A;  1SPA A;  1C4K A;  4P3M A;  4ZDP A;  1YOO A;  1UU0 A;  2CJD A;  3HDO A;  1DTY A;  3A2B A;  5EFS A;  3WGB A;  2JJG A;  4L0O A;  4OTL A;  1GC4 A;  2CH1 A;  4IY7 A;  4JEZ A;  2YRR A;  3VK2 A;  4B9B A;  4XJM A;  3PGY A;  1GBN A;  3B8X A;  4ZM3 A;  2VMS A;  4XEW A;  4W8I A;  3K40 A;  2BI1 A;  3EUC A;  3LWS A;  3T32 A;  4WLH A;  4E3R A;  5G0A A;  3USF A;  4Y0D A;  3TFU A;  1X0M A;  5TF5 A;  1M6S A;  1GC3 A;  1JF9 A;  1GCK A;  2X8U A;  4ADC A;  3BWO A;  2D65 A;  3MAU A;  3BCX A;  3BWN A; 
#chains in the Genus database with same CATH topology
 4AH3 A;  4ATP A;  1FG7 A;  4BA4 A;  5DNM C;  1IJI A;  3LV2 A;  3W97 B;  4Q6R A;  2GB3 A;  3KGW A;  1W23 A;  3UT9 D;  2RVQ D;  2ARO D;  1E5F A;  4LW2 A;  1ARS A;  3N7N A;  2RVQ C;  3WKJ B;  3AZK C;  1V72 A;  5E5A D;  3W96 D;  4NFT A;  3AZI C;  1M18 A;  5B33 D;  2NQB D;  1C7N A;  3X1T D;  1P3P A;  2F8N B;  2YKU A;  1O4S A;  1AOI C;  3NDN A;  2C81 A;  5B33 B;  5KDM B;  1TPL A;  5D5S A;  1YIZ A;  2ZYJ A;  3AEO A;  5HXX A;  4Y0H A;  1P3M A;  5BS7 A;  4R8P B;  2VMR A;  4Z5T A;  2HUI A;  3WAA D;  1Z3Z A;  3LZ1 B;  1LC5 A;  5B1L D;  3JWA A;  1QIR A;  1SFF A;  4YS3 A;  4UPK A;  1PMM A;  4ZLV A;  1DJU A;  1RVU A;  4WU9 B;  3II0 A;  1QIT A;  4GDY A;  2VI9 A;  4J8X B;  2NZD A;  4ZBJ B;  2Y2M A;  5CPI D;  5GSU C;  4ZWV A;  4KXK A;  4ZDL A;  5CHL B;  5DNM B;  4LD9 C;  5DNN D;  4KUD C;  3LEL A;  2VIA A;  2EH6 A;  2BI9 A;  3RCH B;  3LZ0 A;  2QSR A;  2AY1 A;  2RFV A;  2ORD A;  4ZWM A;  2CFB A;  8AAT A;  2KFP A;  1C9C A;  4EO5 B;  2VI8 A;  2R5E A;  4WXF A;  4W91 A;  5G4J A;  4LNM A;  2F8J A;  1BQA A;  3NQJ B;  3MBB A;  3FQ8 A;  4W5K A;  2JJF A;  1TZY A;  2G5H C;  1GC2 A;  5B24 B;  3REH B;  2PYO A;  5AY8 A;  3MGS D;  4JF1 A;  2BYL A;  4NE6 A;  2HOZ A;  3CQ4 A;  3R4T A;  1JFI B;  3P1T A;  3REL D;  1P3O B;  3EI9 A;  2PO3 A;  2VGU A;  3NQU B;  1IUG A;  3VP6 A;  5GT0 D;  3AZJ D;  1V2D A;  3N4R A;  5BNX A;  3QM2 A;  3KXB B;  1MDX A;  3WGC A;  3AZL B;  5E5I A;  3JW9 A;  1OXO A;  3A6N C;  4IYO B;  5CP6 D;  4JEY A;  2VMW A;  3UTB A;  1P3A A;  3X1S C;  3WKJ C;  2FQ6 A;  2YFV A;  2VGT A;  5B31 D;  4F5K A;  3UTA B;  4J8U B;  2W8V A;  4F5H A;  4Q76 A;  1B9I A;  1S32 C;  5E4Z A;  1QJ5 A;  4CXR A;  1WYV B;  1P3A B;  4R8P A;  2L5A A;  4G92 B;  3AAT A;  2R5C A;  4GSA A;  3REH D;  3LVM A;  5GXQ B;  3AZK D;  5GT3 C;  3QBO A;  5M4B A;  5G49 B;  3HBX A;  3GR9 A;  1KAF A;  3B6F A;  4QLC D;  3MC6 A;  3MVD D;  1P3O D;  5AX8 A;  1AY5 A;  2HUE B;  4ZAH A;  2F8N D;  4OYT A;  1G7X A;  1P3O C;  2VMZ A;  3AZN C;  3FVU A;  3FQA A;  3K7Y A;  3ELP A;  3W98 C;  2AY2 A;  2CAN A;  3AV1 A;  3REH C;  4ZUX A;  2HUF A;  1KKJ A;  4KUD D;  1HQ3 A;  4JEW A;  5AV5 C;  4UOY A;  2ZY3 A;  4ZSW A;  1AHY A;  3N75 A;  3REJ B;  1ASM A;  1KX5 A;  2DGM A;  4U2H A;  3G8M A;  4JF0 A;  2CV5 D;  3KXB D;  4JJN C;  3I5T A;  4AO4 A;  3WZF A;  3LZ1 C;  2EO5 A;  1IBJ A;  3C1C D;  2HIO D;  1U35 A;  1GEY A;  3REI C;  1M1A A;  1AOI B;  3BCB A;  3KUY D;  3A1I A;  2GMU A;  5GXQ C;  2QB2 A;  2J8P A;  1OHW A;  4Z5T C;  2BG1 A;  5CPK D;  4NOG A;  2JJH A;  1U35 B;  5AV9 D;  2YHK A;  2UWX A;  4UQV A;  3AFA B;  3WKJ D;  4XJO A;  1CZC A;  2VMX A;  3AZM A;  4H9R B;  5G4I A;  1QJ3 A;  3I4J A;  4XJP A;  4A6R A;  4YM6 B;  1ARG A;  5AV9 C;  3DXW A;  3NU8 A;  3H7F A;  2YRI A;  4KHA B;  3AZG D;  2W7E A;  5E3K A;  3EPK A;  3L8A A;  3ECD A;  4LD9 A;  4LD9 B;  1P3P B;  3LEL C;  2OKK A;  4QLC B;  4XUJ B;  1P3F B;  3AZF C;  1DFO A;  5B0Z D;  4WXB A;  4Z66 D;  5I92 A;  3WAA B;  5GT3 D;  3NYS A;  1P3P D;  4J8X D;  3BV0 A;  4K05 A;  3C1B C;  2CV5 B;  2VLH A;  2HP2 A;  1WYU A;  4F5L A;  4G91 C;  3FVS A;  4B98 A;  4XUJ C;  5EIG B;  3EZS A;  3AZG C;  5DNN C;  1ID3 D;  3W97 A;  5AY8 C;  1M4N A;  1N2T A;  3A1K A;  4TN4 A;  3AEM A;  5G49 A;  2JSS A;  2W7G A;  5F99 A;  4ITX A;  3E2Z A;  2EPJ A;  4EFF A;  3FFH A;  1AY4 A;  4RIT A;  1SF2 A;  1KX3 B;  4G91 B;  1ZLA A;  2PB2 A;  4R5Z A;  4XZQ C;  2Z61 A;  5D95 A;  4GE9 A;  2VGW A;  1S0A A;  1WYT B;  3AZK B;  3EI5 A;  2VGV A;  2BWN A;  3LEL D;  1AMA A;  4HGA C;  2G6W A;  3W96 A;  1TOI A;  3GBX A;  5B32 G;  4J8U A;  3RI6 A;  4CSR B;  1O69 A;  2QLR A;  3LG0 A;  3AN2 D;  3PDX A;  4IYO A;  4IX8 A;  4H9O A;  2BI2 A;  3HT4 A;  3GJU A;  3RBL A;  5E5A A;  4ZSY A;  1PMO A;  3REL B;  3AV2 B;  3PD6 B;  2GQN A;  2QMA A;  3LZ0 B;  3X1T A;  3HVY A;  1WWI A;  1C4K A;  3MGP C;  1GC4 A;  2CH1 A;  4B9B A;  2DF4 C;  3REJ C;  1GBN A;  4RLG A;  4ZM3 A;  3REL A;  2F8N G;  3K40 A;  2BI1 A;  4WLH A;  5G0A A;  3TFU A;  1P3P C;  2Y2H A;  1GC3 A;  1M6S A;  3KSY A;  3BWN A;  1W2E A;  3QN6 A;  3B0D C;  2R2N A;  2YFW A;  5AY8 B;  1IVR A;  1OHV A;  4F5G A;  1P3K C;  4DQ6 A;  3MGR A;  3X1V D;  4A0G A;  1P3L A;  5FUG A;  3AZN A;  1M0N A;  5KDM A;  3AN2 C;  3W98 A;  4RJY A;  3B1D A;  4E77 A;  3MGQ D;  2CTZ A;  2DKB A;  5AV5 B;  3REI B;  5K8B A;  1H3O B;  1KX5 C;  1KX3 D;  2AY5 A;  2BWO A;  3MGS A;  4JEV A;  2YOB A;  3HQT A;  4LW4 A;  4NE5 A;  2YCP A;  3KWQ B;  2Z1Y A;  3NQU A;  2Z20 A;  1M19 A;  1ASN A;  4WV4 B;  4KUD B;  4H9O B;  2PYO D;  3AFA C;  1KKP A;  1VP4 A;  2YCN A;  1U35 C;  1TAS A;  2HOY A;  2NQB C;  3LVJ A;  3AZE B;  1XI9 A;  2QA3 A;  4ADB A;  2PYO B;  3V9R A;  3LJA C;  1ZC9 A;  3TCM A;  1IX8 A;  4X23 D;  1AOI D;  4AO9 A;  1EQZ C;  1S32 D;  1B67 A;  3UT9 B;  3WX9 A;  2BWP A;  3AZH B;  1CL2 A;  3KE3 A;  2LY8 A;  4ADE A;  4LNJ A;  3X1S D;  1DGE A;  4P7Y A;  1WWS A;  1S32 B;  2AEV A;  3AYW B;  3WA9 A;  3RCH A;  4WBT A;  2HP1 A;  3X1S B;  2YKX A;  3NU7 A;  1YJS A;  4ITG A;  1AAM A;  4HF8 A;  2DQN C;  3LJA D;  3REK A;  5E5A B;  4FFC A;  3NUI A;  3BS8 A;  4A6T A;  1M0P A;  1S06 A;  4GRX A;  4OC9 A;  4FL0 A;  4MKK A;  2HIO A;  1U35 D;  1B5O A;  3C1B A;  3ASA A;  3W96 B;  4A0F A;  2W8T A;  1P3F A;  4XUJ A;  1TOJ A;  3UTA C;  3EI7 A;  3AZK A;  2ZJG A;  4RM1 A;  5EUN A;  1P3M B;  2FNI A;  5B31 G;  3REI D;  3WTP E;  4OCA A;  1LK9 A;  1KL2 A;  5F99 C;  1TAR A;  2F8N A;  4KGC D;  3BC8 A;  5B2I A;  3AV1 B;  5AVC D;  4WU9 C;  4AZJ A;  5AV8 D;  1ZLA C;  3ZRQ A;  3KXB C;  4JJN D;  3B6G C;  1D7R A;  1P3G B;  2PB0 A;  1P34 B;  1RVY A;  1P3M C;  2JG2 A;  3GZD A;  4UHN A;  3FZ7 A;  3AV1 D;  1AJR A;  3WCN A;  3EI6 A;  1M19 B;  4H51 A;  2W7J A;  1ORD A;  2TPL A;  3BB8 A;  3AZH C;  3WTP B;  1P3G A;  3ISL A;  1P3K D;  1AIB A;  4H9S A;  2EZ1 A;  3AV1 C;  3CQ5 A;  2CH2 A;  4HVK A;  4ZUX C;  4J8W B;  3C1C C;  3R9A A;  5E5A C;  5AV5 A;  2WB6 A;  3AEL A;  3FQ7 A;  1LS3 A;  3MNN D;  1F66 A;  3A6N D;  2Y2J A;  1ZOD A;  2HUU A;  3LZ0 C;  1ELQ A;  1G4X A;  5F99 D;  4WLJ A;  1M1A D;  3E9K A;  3CAI A;  1N31 A;  1HQ3 B;  3EPJ A;  4RKD A;  4DQY B;  4J8V A;  1YJY A;  5AV8 C;  1ZLA D;  2W8U A;  5CPK A;  4QGR A;  3WLX A;  1AX4 A;  5B33 C;  1G7W A;  4LNL A;  1CJ0 A;  2E54 A;  4A6U A;  5B1L B;  3AZL A;  4DRA A;  3G0T A;  3DYD A;  4WYG A;  1BW0 A;  3UWC A;  3KGX A;  5AV6 B;  1KX4 C;  3MGR C;  4CAY A;  3WKS A;  5BNX B;  3AZI B;  1AY8 A;  1GEW A;  4Z66 A;  1N1J B;  4J8U D;  2D63 A;  4TMR A;  4F5I A;  3RBF A;  1ELU A;  5B32 B;  3RQ1 A;  3QI6 A;  3AN2 A;  4X23 B;  2FJ7 B;  4E45 A;  3FCR A;  1P3B D;  2O1B A;  5B1L C;  5B0Y A;  3B6G D;  3ASB A;  2R0T A;  5B0Z A;  2XD1 A;  5CPK B;  2HOX A;  4J8W D;  3EI8 A;  3H0R C;  2Z9U A;  1W3U A;  1KX5 B;  1FG3 A;  4GEB A;  2VMO A;  1I43 A;  4ZUX B;  4J8W C;  4ZBJ C;  1AHX A;  1W7L A;  4WZS B;  2AY6 A;  1QGN A;  3NNK A;  5B24 D;  5FT6 A;  2E7I A;  3N4X A;  1H1C A;  3LZ1 D;  3AV2 C;  1DJE A;  3KWQ A;  1V2E A;  1OHY A;  1TAF B;  2BI3 A;  3DR4 A;  3AEM C;  3AZI A;  5B1M B;  5B1M A;  3AEP A;  5BT1 C;  3L44 A;  1AJS B;  5HDM A;  3WTP A;  3FD0 A;  3B0B A;  1P3M D;  4R2N A;  3EIA A;  2JCH A;  1P3B C;  2D7Z A;  2JIS A;  2ZC0 A;  1I29 A;  4H9Q B;  4WNN A;  2Y2I A;  3MGR B;  3W99 A;  2FJ7 D;  1AMQ A;  2QBT A;  5BJ4 A;  1G4V A;  4UUZ A;  1IAY A;  1P34 D;  1SZK A;  5CPI B;  5GT0 C;  1U08 A;  3AZJ C;  4J8U C;  2ARO B;  2YFV B;  2AAT A;  1M19 D;  4WU8 D;  1BQD A;  3FDB A;  3P5J B;  4KHA A;  2FFF B;  2Y2G A;  2HIO C;  2OKJ A;  1B9H A;  4W1X A;  1M18 B;  2C44 A;  5DJ9 A;  4J8X C;  1WST A;  4WB0 A;  2ZSM A;  2W7F A;  3PPL A;  2E7U A;  3A9Z A;  3LVK A;  1EG5 A;  3X1T B;  3AZN D;  3PD6 A;  4F5M A;  4CAY B;  5B40 C;  1MLZ A;  3REK B;  3WCO A;  3ATH A;  1B8G A;  3F6T A;  1YIY A;  2NZD B;  2CB1 A;  3MGQ A;  2OQX A;  4IXO A;  3B46 A;  4CVQ A;  3AOV A;  4YM6 D;  3O62 B;  1BKG A;  4J8V B;  3KKI A;  2XBN A;  2C0R A;  5CP6 B;  3W1J A;  3PA9 A;  2DGL A;  1IAX A;  1P3L C;  2E7J A;  1SPA A;  4ZDP A;  1F1E A;  1DTY A;  5EFS A;  3WGB A;  2YRR A;  4H9S C;  1KX3 A;  3VH6 A;  4XJM A;  5GT3 B;  3B8X A;  3T32 A;  3USF A;  4Y0D A;  1JF9 A;  2X8U A;  1P3F D;  3BWO A;  3MAU A;  5AV8 B;  3MGS C;  2Z1Z A;  1AKA A;  1P3A D;  4ATQ A;  5EIG A;  5B31 A;  2W7H A;  1ASB A;  5B2J B;  3UTB C;  1DGD A;  3X1S A;  1C0N A;  3MKJ A;  4F5F A;  5AV8 A;  3UE8 A;  4YS3 B;  3MNN B;  3A6N B;  1BH9 B;  1S32 A;  3NYU A;  4MQP A;  1X29 A;  1QZ9 A;  2HOR A;  3LJA A;  3W98 B;  1EQZ A;  3HLM A;  3VH5 A;  3WA9 D;  2X5F A;  3KUY C;  2D5Y A;  5DX5 A;  3MVD A;  2F8N K;  3PDB B;  3AZE A;  3C1B D;  4XZQ A;  3B6F C;  3MNN A;  2YFW B;  3REK D;  3AV2 D;  3DOD A;  5B0Z C;  2BYK A;  4Z2M H;  3A8U X;  4M2J A;  1BH8 A;  4WU8 C;  3WAA C;  4BQ0 A;  1E5E A;  5BO0 A;  5BNV A;  2EGY A;  1KX5 D;  2AY7 A;  5AVC A;  2CJH A;  3X1U C;  1TAF A;  1B6W A;  3MAF B;  1HQ3 C;  2EZ2 A;  5CPI C;  2Y2L A;  4YM6 C;  1AIA A;  2AY8 A;  2AEU A;  1W7N A;  2W8J A;  4KGC A;  4DBC A;  3AFA D;  3MGP A;  1J04 A;  2Z9X A;  5J8Q A;  3EZ1 A;  3AEJ A;  1V2F A;  1R4V A;  3MEB A;  4JEX A;  4JJN A;  1JFI A;  3DZZ A;  3REJ A;  2AY9 A;  1TOE A;  5EAV A;  3Q8N A;  4IXZ A;  2D7Y A;  1KX4 D;  2FN6 A;  1P3B A;  4RKC A;  3B6G A;  2BKW A;  1J32 A;  9AAT A;  4WYD A;  3MGQ B;  4A72 A;  2BYM A;  1P3K A;  3ZZK A;  3AZG B;  4W1V A;  1ZOB A;  3TU4 C;  4M6B A;  2HZP A;  5B32 A;  3AZM D;  1P3G C;  3TQX A;  5AVB C;  4J8V D;  5AV6 A;  5AVC B;  4EU1 A;  5DNM A;  1LC7 A;  2X3L A;  4GE4 A;  1CQ6 A;  2AY4 A;  3AZF B;  1ASL A;  1P3I C;  4WP0 A;  3KWQ D;  3LVL B;  1AHE A;  4WD2 A;  2DR1 A;  2Z9W A;  4MSO A;  4EO5 C;  2Y2O A;  3AYW C;  1OAT A;  1B5P A;  4UUZ B;  4CXQ A;  1PG8 A;  1KMK A;  4IXS A;  4F4E A;  5EUE A;  5B40 A;  1M19 C;  4BHD A;  1M32 A;  1ID3 A;  1MLY A;  3MGQ C;  5EUD A;  3UT9 C;  1M18 D;  2NQB A;  1ARI A;  1OXP A;  4CBR A;  3LJA B;  4EB7 A;  3DRD A;  5BS7 C;  1I48 A;  3R45 B;  4GE7 A;  4H9R A;  2VIB A;  2OAT A;  4LC3 A;  1MAP A;  3AN2 B;  2JGT A;  1Y4I A;  1BH9 A;  4Z2M G;  1SVV A;  5JRG A;  4W1W A;  5GSU A;  4H9N B;  3LY1 A;  1MGV A;  1GD9 A;  4I8A A;  5JA4 A;  2JJE A;  3AZI D;  5B24 A;  1AMR A;  4XAU A;  2XD5 A;  3FVX A;  3AV7 A;  1GC0 A;  4UHO A;  5G09 A;  2W7K A;  5BT1 D;  4JJN B;  3PAA A;  2YKV A;  1ECX A;  4WYA A;  3HL2 A;  4OMA A;  1ASA A;  3LZ0 D;  4KGC B;  1DKA A;  2ZY4 A;  3ELE A;  2BHX A;  2IO5 C;  3TAT A;  3BCA A;  2VMV A;  3KWQ C;  2FJ7 A;  3WTP D;  1S09 A;  1BJO A;  4F5J A;  1RV4 A;  2VMY A;  3MAD A;  4PFN A;  1TZY D;  4MKJ A;  1H0C A;  1KMJ A;  2W8S A;  3VH6 W;  3MVD C;  3B0C W;  5B2I C;  5AY8 D;  1CZE A;  4WU9 A;  1X28 A;  3AZE C;  3H0L C;  3BWN C;  1LC8 A;  1WYU B;  1EQB A;  2VMT A;  4RIZ A;  3WA9 B;  3QGU A;  3MNN C;  1S07 A;  5JAY A;  4EMY A;  3GZD C;  5BJ3 A;  2CY8 A;  3N4S A;  1Z2C B;  5G2Q A;  3W98 D;  4WB0 B;  4Z5T B;  3AOW A;  1YJZ A;  3VAX A;  3MVD B;  1T3I A;  2CST A;  3AZH A;  2R5C B;  3QHX A;  2JE5 A;  4E44 A;  3FZ6 A;  2VGZ A;  1P3A C;  3COG A;  3FRK A;  3AZJ B;  3GET A;  2F8N H;  4YM6 A;  2BIE A;  1D7V A;  3C1B B;  4KGC C;  2G5I C;  5B2J A;  5F8V A;  1EQZ D;  3NRA A;  1FC4 A;  5JRG B;  1M18 C;  1X2A A;  4MQR A;  4AZK A;  5AVB D;  4J8V C;  3UTA D;  3EIB A;  4R8D A;  2ZP7 A;  3NYT A;  1M7Y A;  4Q31 A;  1AJS A;  1C7G A;  2ARO C;  2DGK A;  2VLF A;  5C3I C;  3R45 A;  5FT4 A;  4HGA B;  4A0H A;  5FT8 A;  2W7L A;  2NQB B;  1P3O A;  2CIN A;  4Z66 C;  4UHM A;  2FNU A;  4YS3 C;  2CV5 C;  1B4X A;  2BIA A;  1ASF A;  3B6G B;  5GXQ D;  4ZDO A;  2VMN A;  1KX3 C;  3CBF A;  1ARH A;  1YAA A;  3E77 A;  3O62 A;  3EPL A;  3F9T A;  5C3I B;  5B0Y C;  1P3I A;  4WJ3 C;  4QLC C;  1ASE A;  2BIG A;  2X5D A;  1D7U A;  1WKG A;  4ZUX D;  4BMK A;  4KUD A;  1TOK A;  3VK4 A;  1HQ3 D;  4ZM4 A;  3TFT A;  3REK C;  3E2Y A;  3REJ D;  4H9N A;  5GSU B;  1DJ9 A;  5EQC A;  3F0H A;  3VK3 A;  3AZE D;  4XUJ D;  4P3M A;  1UU0 A;  3X1U B;  4L0O A;  4OTL A;  4JEZ A;  3VK2 A;  4Z66 B;  1H3O A;  3AV2 A;  1ULY A;  3REI A;  2VMS A;  4W8I A;  1P3F C;  5CP6 C;  4E3R A;  1X0M A;  1P3K B;  2BYM B;  4ADC A;  5B32 D;  1T3U A;  2D65 A;  2Y2K A;  4R5F A;  2BYK B;  5B1M C;  4J5U A;  4WXG A;  1ID3 B;  3PJ0 A;  1WYV A;  1PFF A;  4X23 C;  3ZZJ A;  3PDB A;  1UU2 A;  3AZM C;  4DRB A;  5JRG C;  4CBS A;  2HUE C;  3KUY B;  2BI5 A;  3E2F A;  1M0O A;  3VH5 T;  1VJO A;  5DB5 A;  1LKC A;  3KFU G;  2WK8 A;  5FT5 A;  3WY7 A;  3MAF A;  5CPJ D;  4E1O A;  3AZF A;  5B40 D;  1GEX A;  4OBV A;  3LEL B;  1F66 D;  4LD9 D;  3A6N A;  3MGS B;  2FKI A;  3X1U A;  3MGP D;  5BO0 B;  2VQR A;  4OT8 A;  4M2M A;  3UAK A;  4A0R A;  4N0W A;  3W1I A;  5M4D A;  1S08 A;  4J8X A;  1O62 A;  1RV3 A;  5B31 B;  2F2A C;  3W97 C;  1P3L B;  4CSR A;  4XZQ B;  1P3B B;  1P3I B;  3AZL D;  5B2I B;  5CPK C;  5HHY A;  5JRG D;  1TZY B;  5GSU D;  4H63 Q;  1BS0 A;  5B0Z B;  1IX7 A;  5AVB B;  5B33 A;  2A1V A;  1BJ4 A;  4G92 C;  3MC6 C;  3G7Q A;  4XQ2 A;  3WKR A;  5DNM D;  2GSA A;  5B32 C;  3W96 C;  2YKY A;  5B0Y D;  1YNU A;  2V0Y A;  2VGS A;  4MQQ A;  5AV6 C;  1KX4 B;  4Z5T D;  2NZD C;  3BN1 A;  5BNV B;  5B1L A;  4WYC A;  4YS3 D;  1P3W A;  1CS1 A;  4K2M A;  3NUB A;  3ACZ A;  3IHJ A;  5M49 A;  3GWP A;  3TU4 D;  4K2I A;  5B2J C;  3H0M C;  3AYW A;  2G7J A;  3LZ1 A;  1M0Q A;  4H9P B;  3TU4 B;  3W1H A;  3JZL A;  3DR7 A;  2VYC A;  1WKH A;  3UT9 A;  1W7M A;  1Q9C A;  2ARO A;  1F66 B;  2WKA A;  1JS6 A;  5B1M D;  5GT0 B;  4KAM A;  3C1C B;  2V1P A;  2QB3 A;  3V9R B;  2FM1 A;  2PYO C;  4WU8 B;  5F99 B;  3AL0 C;  1EJI A;  5M46 A;  3W99 B;  1MDO A;  3OP7 A;  2Z9V A;  3AEN B;  4WNN B;  3WTP C;  1AHF A;  1ASD A;  4NE3 A;  3X1V B;  3MGR D;  3X1V A;  3W99 D;  1ASG A;  1P3L D;  2NMP A;  3EPH A;  3D6K A;  2O0R A;  3O62 C;  3DC1 A;  4PIW A;  1P34 A;  2W7I A;  5CPJ C;  7AAT A;  4AWL C;  3FTB A;  3W99 C;  4ISY A;  4WU8 A;  1CQ7 A;  4O6Z A;  3WAA A;  5B24 C;  2XH1 A;  5GT0 A;  4ZAS A;  5C6U A;  1PZR A;  3AZJ A;  2CJG A;  1IX6 A;  1AHG A;  1SZS A;  2ZUK A;  1TOG A;  3FDD A;  1BJW A;  4AWL B;  4K2B A;  2NZD D;  1AIC A;  4XJL A;  5AV9 B;  3N5M A;  5CPJ B;  4EB5 A;  5CPI A;  3P6K A;  2ZY2 A;  5EAA A;  3AZN B;  1BFM A;  4XK1 A;  3AZM B;  4Y0I A;  2FJ7 C;  5CP6 A;  1CQ8 A;  5DNN A;  1O61 A;  3VH6 T;  3FSL A;  4WU9 D;  3AEJ C;  3HMU A;  2DOU A;  1JG8 A;  3B0D B;  4H9Q A;  2EYQ A;  5JA4 B;  5F9S A;  2YCT A;  4E3Q A;  3FKD A;  4PFF A;  4R8P D;  4X23 A;  1AOI A;  2D61 A;  3AZH D;  1UKJ A;  1N1J A;  2ZY5 A;  3B6F B;  2AY3 A;  2OGA A;  2W8W A;  4PVF A;  5B2J D;  1A7W A;  3GSB A;  3NX3 A;  3B6F D;  1MAQ A;  3JWB A;  5AVB A;  2O7C A;  2ZSL A;  3REH A;  2Y2Q A;  3B0C T;  2FYF A;  5DNN B;  2RIQ A;  1UU1 A;  3ZRP A;  5B40 B;  3K28 A;  1GDE A;  4DGT A;  4KYO A;  2Y2P A;  3MGP B;  3X1T C;  3UTA A;  3VOM A;  5KTB A;  4RJ0 A;  5B31 C;  3UTB B;  2OGE A;  1BJN A;  3GZC A;  3IP4 C;  4WYF A;  3REL C;  2WK9 A;  3N0L A;  1I41 A;  3UTB D;  3O62 D;  1ID3 C;  3E2Z B;  3FFR A;  5G2P A;  5IWQ A;  1LW4 A;  1BT4 A;  3KXB A;  3DXV A;  4Q75 A;  3VH5 W;  1M1A C;  1TZY C;  1D7S A;  2ZM5 A;  5B2I D;  3OKS A;  5GXQ A;  1SZU A;  3JTX A;  3RUY A;  1BH8 B;  2D66 A;  1MDZ A;  3B1E A;  3E6G A;  4A00 A;  1D2F A;  4XZQ D;  3NTJ A;  1P3I D;  2VMQ A;  2VMU A;  3KUY A;  3AZF D;  2CV5 A;  5FUG B;  3AEN A;  1KU5 A;  1ART A;  3QPG A;  4WYE A;  4U1T A;  3C1C A;  4AOA A;  1P3G D;  5AV9 A;  2D64 A;  4QLC A;  1TAT A;  3NQJ A;  1F66 C;  1AKB A;  3ZRR A;  1C7O A;  1AAW A;  5AV5 D;  5B0Y B;  2C7T A;  3FZ8 A;  2VMP A;  2IO5 B;  1JS3 A;  3M5U A;  2BYJ A;  5AVC C;  2GMS A;  3WKJ A;  1HTA A;  5DJ1 A;  2W7M A;  3AFA A;  3B1C A;  3CQ6 A;  1N8P A;  1XEY A;  3I16 A;  1CL1 A;  1LW5 A;  1VEF A;  1ASC A;  2CWE A;  3AZL C;  3AZG A;  4R8P C;  4M2K A;  1KX4 A;  3H9X A;  3DU4 A;  1M1A B;  1Z7D A;  2DKJ A;  1AMS A;  1KL1 A;  4RAE A;  2W7D A;  4BA5 A;  1BJO B;  3X1U D;  4IW7 A;  4J8L A;  4MY5 A;  2WK7 A;  5GT3 A;  2Q7W A;  3PIU A;  3X1V C;  1AKC A;  1QIS A;  3EG5 B;  3A9X A;  1WYT A;  3A9Y A;  1P34 C;  1YOO A;  3HDO A;  2CJD A;  5CPJ A;  3WA9 C;  1EQZ B;  3A2B A;  2JJG A;  4IY7 A;  1ZLA B;  4H9P A;  3TU4 A;  3PGY A;  5AV6 D;  4XEW A;  3EUC A;  3LWS A;  3W97 D;  3AYW D;  2Y2N A;  5TF5 A;  4OBU A;  2HIO B;  1GCK A;  4J8W A;  3BCX A;  4ADD A; 
#chains in the Genus database with same CATH homology
 4AH3 A;  4ATP A;  1FG7 A;  4BA4 A;  5DNM C;  1IJI A;  3LV2 A;  3W97 B;  4Q6R A;  2GB3 A;  3KGW A;  1W23 A;  3UT9 D;  2RVQ D;  2ARO D;  1E5F A;  4LW2 A;  1ARS A;  3N7N A;  2RVQ C;  3WKJ B;  3AZK C;  1V72 A;  5E5A D;  3W96 D;  4NFT A;  3AZI C;  1M18 A;  5B33 D;  2NQB D;  1C7N A;  3X1T D;  1P3P A;  2F8N B;  2YKU A;  1O4S A;  1AOI C;  3NDN A;  2C81 A;  5B33 B;  5KDM B;  1TPL A;  5D5S A;  1YIZ A;  2ZYJ A;  3AEO A;  5HXX A;  4Y0H A;  1P3M A;  5BS7 A;  4R8P B;  2VMR A;  4Z5T A;  2HUI A;  3WAA D;  1Z3Z A;  3LZ1 B;  1LC5 A;  5B1L D;  3JWA A;  1QIR A;  1SFF A;  4YS3 A;  4UPK A;  1PMM A;  4ZLV A;  1DJU A;  1RVU A;  4WU9 B;  3II0 A;  1QIT A;  4GDY A;  2VI9 A;  4J8X B;  2NZD A;  4ZBJ B;  2Y2M A;  5CPI D;  5GSU C;  4ZWV A;  4KXK A;  4ZDL A;  5CHL B;  5DNM B;  4LD9 C;  5DNN D;  4KUD C;  3LEL A;  2VIA A;  2EH6 A;  2BI9 A;  3RCH B;  3LZ0 A;  2QSR A;  2AY1 A;  2RFV A;  2ORD A;  4ZWM A;  2CFB A;  8AAT A;  2KFP A;  1C9C A;  4EO5 B;  2VI8 A;  2R5E A;  4WXF A;  4W91 A;  5G4J A;  4LNM A;  2F8J A;  1BQA A;  3NQJ B;  3MBB A;  3FQ8 A;  4W5K A;  2JJF A;  1TZY A;  2G5H C;  1GC2 A;  5B24 B;  3REH B;  2PYO A;  5AY8 A;  3MGS D;  4JF1 A;  2BYL A;  4NE6 A;  2HOZ A;  3CQ4 A;  3R4T A;  1JFI B;  3P1T A;  3REL D;  1P3O B;  3EI9 A;  2PO3 A;  2VGU A;  3NQU B;  1IUG A;  3VP6 A;  5GT0 D;  3AZJ D;  1V2D A;  3N4R A;  5BNX A;  3QM2 A;  3KXB B;  1MDX A;  3WGC A;  3AZL B;  5E5I A;  3JW9 A;  1OXO A;  3A6N C;  4IYO B;  5CP6 D;  4JEY A;  2VMW A;  3UTB A;  1P3A A;  3X1S C;  3WKJ C;  2FQ6 A;  2YFV A;  2VGT A;  5B31 D;  4F5K A;  3UTA B;  4J8U B;  2W8V A;  4F5H A;  4Q76 A;  1B9I A;  1S32 C;  5E4Z A;  1QJ5 A;  4CXR A;  1WYV B;  1P3A B;  4R8P A;  2L5A A;  4G92 B;  3AAT A;  2R5C A;  4GSA A;  3REH D;  3LVM A;  5GXQ B;  3AZK D;  5GT3 C;  3QBO A;  5M4B A;  5G49 B;  3HBX A;  3GR9 A;  3B6F A;  4QLC D;  3MC6 A;  3MVD D;  1P3O D;  5AX8 A;  1AY5 A;  2HUE B;  4ZAH A;  2F8N D;  4OYT A;  1G7X A;  1P3O C;  2VMZ A;  3AZN C;  3FVU A;  3FQA A;  3K7Y A;  3ELP A;  3W98 C;  2AY2 A;  2CAN A;  3AV1 A;  3REH C;  4ZUX A;  2HUF A;  1KKJ A;  4KUD D;  1HQ3 A;  4JEW A;  5AV5 C;  4UOY A;  2ZY3 A;  4ZSW A;  1AHY A;  3N75 A;  3REJ B;  1ASM A;  1KX5 A;  2DGM A;  4U2H A;  3G8M A;  4JF0 A;  2CV5 D;  3KXB D;  4JJN C;  3I5T A;  4AO4 A;  3WZF A;  3LZ1 C;  2EO5 A;  1IBJ A;  3C1C D;  2HIO D;  1U35 A;  1GEY A;  3REI C;  1M1A A;  1AOI B;  3BCB A;  3KUY D;  3A1I A;  2GMU A;  5GXQ C;  2QB2 A;  2J8P A;  1OHW A;  4Z5T C;  2BG1 A;  5CPK D;  4NOG A;  2JJH A;  1U35 B;  5AV9 D;  2YHK A;  2UWX A;  4UQV A;  3AFA B;  3WKJ D;  4XJO A;  1CZC A;  2VMX A;  3AZM A;  4H9R B;  5G4I A;  1QJ3 A;  3I4J A;  4XJP A;  4A6R A;  4YM6 B;  1ARG A;  5AV9 C;  3DXW A;  3NU8 A;  3H7F A;  2YRI A;  4KHA B;  3AZG D;  2W7E A;  5E3K A;  3EPK A;  3L8A A;  3ECD A;  4LD9 A;  4LD9 B;  1P3P B;  3LEL C;  2OKK A;  4QLC B;  4XUJ B;  1P3F B;  3AZF C;  1DFO A;  5B0Z D;  4WXB A;  4Z66 D;  5I92 A;  3WAA B;  5GT3 D;  3NYS A;  1P3P D;  4J8X D;  3BV0 A;  4K05 A;  3C1B C;  2CV5 B;  2VLH A;  2HP2 A;  1WYU A;  4F5L A;  4G91 C;  3FVS A;  4B98 A;  4XUJ C;  5EIG B;  3EZS A;  3AZG C;  5DNN C;  1ID3 D;  3W97 A;  5AY8 C;  1M4N A;  1N2T A;  3A1K A;  4TN4 A;  3AEM A;  5G49 A;  2JSS A;  2W7G A;  5F99 A;  4ITX A;  3E2Z A;  2EPJ A;  4EFF A;  3FFH A;  1AY4 A;  4RIT A;  1SF2 A;  1KX3 B;  4G91 B;  1ZLA A;  2PB2 A;  4R5Z A;  4XZQ C;  2Z61 A;  5D95 A;  4GE9 A;  2VGW A;  1S0A A;  1WYT B;  3AZK B;  3EI5 A;  2VGV A;  2BWN A;  3LEL D;  1AMA A;  4HGA C;  2G6W A;  3W96 A;  1TOI A;  3GBX A;  5B32 G;  4J8U A;  3RI6 A;  4CSR B;  1O69 A;  2QLR A;  3LG0 A;  3AN2 D;  3PDX A;  4IYO A;  4IX8 A;  4H9O A;  2BI2 A;  3HT4 A;  3GJU A;  3RBL A;  5E5A A;  4ZSY A;  1PMO A;  3REL B;  3AV2 B;  3PD6 B;  2GQN A;  2QMA A;  3LZ0 B;  3X1T A;  3HVY A;  1WWI A;  1C4K A;  3MGP C;  1GC4 A;  2CH1 A;  4B9B A;  2DF4 C;  3REJ C;  1GBN A;  4RLG A;  4ZM3 A;  3REL A;  2F8N G;  3K40 A;  2BI1 A;  4WLH A;  5G0A A;  3TFU A;  1P3P C;  2Y2H A;  1GC3 A;  1M6S A;  3KSY A;  3BWN A;  1W2E A;  3QN6 A;  3B0D C;  2R2N A;  2YFW A;  5AY8 B;  1IVR A;  1OHV A;  4F5G A;  1P3K C;  4DQ6 A;  3MGR A;  3X1V D;  4A0G A;  1P3L A;  5FUG A;  3AZN A;  1M0N A;  5KDM A;  3AN2 C;  3W98 A;  4RJY A;  3B1D A;  4E77 A;  3MGQ D;  2CTZ A;  2DKB A;  5AV5 B;  3REI B;  5K8B A;  1H3O B;  1KX5 C;  1KX3 D;  2AY5 A;  2BWO A;  3MGS A;  4JEV A;  2YOB A;  3HQT A;  4LW4 A;  4NE5 A;  2YCP A;  3KWQ B;  2Z1Y A;  3NQU A;  2Z20 A;  1M19 A;  1ASN A;  4WV4 B;  4KUD B;  4H9O B;  2PYO D;  3AFA C;  1KKP A;  1VP4 A;  2YCN A;  1U35 C;  1TAS A;  2HOY A;  2NQB C;  3LVJ A;  3AZE B;  1XI9 A;  2QA3 A;  4ADB A;  2PYO B;  3V9R A;  3LJA C;  1ZC9 A;  3TCM A;  1IX8 A;  4X23 D;  1AOI D;  4AO9 A;  1EQZ C;  1S32 D;  1B67 A;  3UT9 B;  3WX9 A;  2BWP A;  3AZH B;  1CL2 A;  3KE3 A;  2LY8 A;  4ADE A;  4LNJ A;  3X1S D;  1DGE A;  4P7Y A;  1WWS A;  1S32 B;  2AEV A;  3AYW B;  3WA9 A;  3RCH A;  4WBT A;  2HP1 A;  3X1S B;  2YKX A;  3NU7 A;  1YJS A;  4ITG A;  1AAM A;  4HF8 A;  2DQN C;  3LJA D;  3REK A;  5E5A B;  4FFC A;  3NUI A;  3BS8 A;  4A6T A;  1M0P A;  1S06 A;  4GRX A;  4OC9 A;  4FL0 A;  4MKK A;  2HIO A;  1U35 D;  1B5O A;  3C1B A;  3ASA A;  3W96 B;  4A0F A;  2W8T A;  1P3F A;  4XUJ A;  1TOJ A;  3UTA C;  3EI7 A;  3AZK A;  2ZJG A;  4RM1 A;  5EUN A;  1P3M B;  2FNI A;  5B31 G;  3REI D;  3WTP E;  4OCA A;  1LK9 A;  1KL2 A;  5F99 C;  1TAR A;  2F8N A;  4KGC D;  3BC8 A;  5B2I A;  3AV1 B;  5AVC D;  4WU9 C;  4AZJ A;  5AV8 D;  1ZLA C;  3ZRQ A;  3KXB C;  4JJN D;  3B6G C;  1D7R A;  1P3G B;  2PB0 A;  1P34 B;  1RVY A;  1P3M C;  2JG2 A;  3GZD A;  4UHN A;  3FZ7 A;  3AV1 D;  1AJR A;  3WCN A;  3EI6 A;  1M19 B;  4H51 A;  2W7J A;  1ORD A;  2TPL A;  3BB8 A;  3AZH C;  3WTP B;  1P3G A;  3ISL A;  1P3K D;  1AIB A;  4H9S A;  2EZ1 A;  3AV1 C;  3CQ5 A;  2CH2 A;  4HVK A;  4ZUX C;  4J8W B;  3C1C C;  3R9A A;  5E5A C;  5AV5 A;  2WB6 A;  3AEL A;  3FQ7 A;  1LS3 A;  3MNN D;  1F66 A;  3A6N D;  2Y2J A;  1ZOD A;  2HUU A;  3LZ0 C;  1ELQ A;  1G4X A;  5F99 D;  4WLJ A;  1M1A D;  3E9K A;  3CAI A;  1N31 A;  1HQ3 B;  3EPJ A;  4RKD A;  4DQY B;  4J8V A;  1YJY A;  5AV8 C;  1ZLA D;  2W8U A;  5CPK A;  4QGR A;  3WLX A;  1AX4 A;  5B33 C;  1G7W A;  4LNL A;  1CJ0 A;  2E54 A;  4A6U A;  5B1L B;  3AZL A;  4DRA A;  3G0T A;  3DYD A;  4WYG A;  1BW0 A;  3UWC A;  3KGX A;  5AV6 B;  1KX4 C;  3MGR C;  4CAY A;  3WKS A;  5BNX B;  3AZI B;  1AY8 A;  1GEW A;  4Z66 A;  1N1J B;  4J8U D;  2D63 A;  4TMR A;  4F5I A;  3RBF A;  1ELU A;  5B32 B;  3RQ1 A;  3QI6 A;  3AN2 A;  4X23 B;  2FJ7 B;  4E45 A;  3FCR A;  1P3B D;  2O1B A;  5B1L C;  5B0Y A;  3B6G D;  3ASB A;  2R0T A;  5B0Z A;  2XD1 A;  5CPK B;  2HOX A;  4J8W D;  3EI8 A;  3H0R C;  2Z9U A;  1W3U A;  1KX5 B;  1FG3 A;  4GEB A;  2VMO A;  1I43 A;  4ZUX B;  4J8W C;  4ZBJ C;  1AHX A;  1W7L A;  4WZS B;  2AY6 A;  1QGN A;  3NNK A;  5B24 D;  5FT6 A;  2E7I A;  3N4X A;  1H1C A;  3LZ1 D;  3AV2 C;  1DJE A;  3KWQ A;  1V2E A;  1OHY A;  1TAF B;  2BI3 A;  3DR4 A;  3AEM C;  3AZI A;  5B1M B;  5B1M A;  3AEP A;  5BT1 C;  3L44 A;  1AJS B;  5HDM A;  3WTP A;  3FD0 A;  3B0B A;  1P3M D;  4R2N A;  3EIA A;  2JCH A;  1P3B C;  2D7Z A;  2JIS A;  2ZC0 A;  1I29 A;  4H9Q B;  4WNN A;  2Y2I A;  3MGR B;  3W99 A;  2FJ7 D;  1AMQ A;  2QBT A;  5BJ4 A;  1G4V A;  4UUZ A;  1IAY A;  1P34 D;  1SZK A;  5CPI B;  5GT0 C;  1U08 A;  3AZJ C;  4J8U C;  2ARO B;  2YFV B;  2AAT A;  1M19 D;  4WU8 D;  1BQD A;  3FDB A;  3P5J B;  4KHA A;  2FFF B;  2Y2G A;  2HIO C;  2OKJ A;  1B9H A;  4W1X A;  1M18 B;  2C44 A;  5DJ9 A;  4J8X C;  1WST A;  4WB0 A;  2ZSM A;  2W7F A;  3PPL A;  2E7U A;  3A9Z A;  3LVK A;  1EG5 A;  3X1T B;  3AZN D;  3PD6 A;  4F5M A;  4CAY B;  5B40 C;  1MLZ A;  3REK B;  3WCO A;  3ATH A;  1B8G A;  3F6T A;  1YIY A;  2NZD B;  2CB1 A;  3MGQ A;  2OQX A;  4IXO A;  3B46 A;  4CVQ A;  3AOV A;  4YM6 D;  3O62 B;  1BKG A;  4J8V B;  3KKI A;  2XBN A;  2C0R A;  5CP6 B;  3W1J A;  3PA9 A;  2DGL A;  1IAX A;  1P3L C;  2E7J A;  1SPA A;  4ZDP A;  1F1E A;  1DTY A;  5EFS A;  3WGB A;  2YRR A;  4H9S C;  1KX3 A;  3VH6 A;  4XJM A;  5GT3 B;  3B8X A;  3T32 A;  3USF A;  4Y0D A;  1JF9 A;  2X8U A;  1P3F D;  3BWO A;  3MAU A;  5AV8 B;  3MGS C;  2Z1Z A;  1AKA A;  1P3A D;  4ATQ A;  5EIG A;  5B31 A;  2W7H A;  1ASB A;  5B2J B;  3UTB C;  1DGD A;  3X1S A;  1C0N A;  3MKJ A;  4F5F A;  5AV8 A;  3UE8 A;  4YS3 B;  3MNN B;  3A6N B;  1BH9 B;  1S32 A;  3NYU A;  4MQP A;  1X29 A;  1QZ9 A;  2HOR A;  3LJA A;  3W98 B;  1EQZ A;  3HLM A;  3VH5 A;  3WA9 D;  2X5F A;  3KUY C;  2D5Y A;  5DX5 A;  3MVD A;  2F8N K;  3PDB B;  3AZE A;  3C1B D;  4XZQ A;  3B6F C;  3MNN A;  2YFW B;  3REK D;  3AV2 D;  3DOD A;  5B0Z C;  2BYK A;  4Z2M H;  3A8U X;  4M2J A;  1BH8 A;  4WU8 C;  3WAA C;  4BQ0 A;  1E5E A;  5BO0 A;  5BNV A;  2EGY A;  1KX5 D;  2AY7 A;  5AVC A;  2CJH A;  3X1U C;  1TAF A;  1B6W A;  3MAF B;  1HQ3 C;  2EZ2 A;  5CPI C;  2Y2L A;  4YM6 C;  1AIA A;  2AY8 A;  2AEU A;  1W7N A;  2W8J A;  4KGC A;  4DBC A;  3AFA D;  3MGP A;  1J04 A;  2Z9X A;  5J8Q A;  3EZ1 A;  3AEJ A;  1V2F A;  1R4V A;  3MEB A;  4JEX A;  4JJN A;  1JFI A;  3DZZ A;  3REJ A;  2AY9 A;  1TOE A;  5EAV A;  3Q8N A;  4IXZ A;  2D7Y A;  1KX4 D;  2FN6 A;  1P3B A;  4RKC A;  3B6G A;  2BKW A;  1J32 A;  9AAT A;  4WYD A;  3MGQ B;  4A72 A;  2BYM A;  1P3K A;  3ZZK A;  3AZG B;  4W1V A;  1ZOB A;  3TU4 C;  4M6B A;  2HZP A;  5B32 A;  3AZM D;  1P3G C;  3TQX A;  5AVB C;  4J8V D;  5AV6 A;  5AVC B;  4EU1 A;  5DNM A;  1LC7 A;  2X3L A;  4GE4 A;  1CQ6 A;  2AY4 A;  3AZF B;  1ASL A;  1P3I C;  4WP0 A;  3KWQ D;  3LVL B;  1AHE A;  4WD2 A;  2DR1 A;  2Z9W A;  4MSO A;  4EO5 C;  2Y2O A;  3AYW C;  1OAT A;  1B5P A;  4UUZ B;  4CXQ A;  1PG8 A;  1KMK A;  4IXS A;  4F4E A;  5EUE A;  5B40 A;  1M19 C;  4BHD A;  1M32 A;  1ID3 A;  1MLY A;  3MGQ C;  5EUD A;  3UT9 C;  1M18 D;  2NQB A;  1ARI A;  1OXP A;  4CBR A;  3LJA B;  4EB7 A;  3DRD A;  5BS7 C;  1I48 A;  3R45 B;  4GE7 A;  4H9R A;  2VIB A;  2OAT A;  4LC3 A;  1MAP A;  3AN2 B;  2JGT A;  1Y4I A;  1BH9 A;  4Z2M G;  1SVV A;  5JRG A;  4W1W A;  5GSU A;  4H9N B;  3LY1 A;  1MGV A;  1GD9 A;  4I8A A;  5JA4 A;  2JJE A;  3AZI D;  5B24 A;  1AMR A;  4XAU A;  2XD5 A;  3FVX A;  3AV7 A;  1GC0 A;  4UHO A;  5G09 A;  2W7K A;  5BT1 D;  4JJN B;  3PAA A;  2YKV A;  1ECX A;  4WYA A;  3HL2 A;  4OMA A;  1ASA A;  3LZ0 D;  4KGC B;  1DKA A;  2ZY4 A;  3ELE A;  2BHX A;  2IO5 C;  3TAT A;  3BCA A;  2VMV A;  3KWQ C;  2FJ7 A;  3WTP D;  1S09 A;  1BJO A;  4F5J A;  1RV4 A;  2VMY A;  3MAD A;  4PFN A;  1TZY D;  4MKJ A;  1H0C A;  1KMJ A;  2W8S A;  3VH6 W;  3MVD C;  3B0C W;  5B2I C;  5AY8 D;  1CZE A;  4WU9 A;  1X28 A;  3AZE C;  3H0L C;  3BWN C;  1LC8 A;  1WYU B;  1EQB A;  2VMT A;  4RIZ A;  3WA9 B;  3QGU A;  3MNN C;  1S07 A;  5JAY A;  4EMY A;  3GZD C;  5BJ3 A;  2CY8 A;  3N4S A;  1Z2C B;  5G2Q A;  3W98 D;  4WB0 B;  4Z5T B;  3AOW A;  1YJZ A;  3VAX A;  3MVD B;  1T3I A;  2CST A;  3AZH A;  2R5C B;  3QHX A;  2JE5 A;  4E44 A;  3FZ6 A;  2VGZ A;  1P3A C;  3COG A;  3FRK A;  3AZJ B;  3GET A;  2F8N H;  4YM6 A;  2BIE A;  1D7V A;  3C1B B;  4KGC C;  2G5I C;  5B2J A;  5F8V A;  1EQZ D;  3NRA A;  1FC4 A;  5JRG B;  1M18 C;  1X2A A;  4MQR A;  4AZK A;  5AVB D;  4J8V C;  3UTA D;  3EIB A;  4R8D A;  2ZP7 A;  3NYT A;  1M7Y A;  4Q31 A;  1AJS A;  1C7G A;  2ARO C;  2DGK A;  2VLF A;  5C3I C;  3R45 A;  5FT4 A;  4HGA B;  4A0H A;  5FT8 A;  2W7L A;  2NQB B;  1P3O A;  2CIN A;  4Z66 C;  4UHM A;  2FNU A;  4YS3 C;  2CV5 C;  1B4X A;  2BIA A;  1ASF A;  3B6G B;  5GXQ D;  4ZDO A;  2VMN A;  1KX3 C;  3CBF A;  1ARH A;  1YAA A;  3E77 A;  3O62 A;  3EPL A;  3F9T A;  5C3I B;  5B0Y C;  1P3I A;  4WJ3 C;  4QLC C;  1ASE A;  2BIG A;  2X5D A;  1D7U A;  1WKG A;  4ZUX D;  4BMK A;  4KUD A;  1TOK A;  3VK4 A;  1HQ3 D;  4ZM4 A;  3TFT A;  3REK C;  3E2Y A;  3REJ D;  4H9N A;  5GSU B;  1DJ9 A;  5EQC A;  3F0H A;  3VK3 A;  3AZE D;  4XUJ D;  4P3M A;  1UU0 A;  3X1U B;  4L0O A;  4OTL A;  4JEZ A;  3VK2 A;  4Z66 B;  1H3O A;  3AV2 A;  1ULY A;  3REI A;  2VMS A;  4W8I A;  1P3F C;  5CP6 C;  4E3R A;  1X0M A;  1P3K B;  2BYM B;  4ADC A;  5B32 D;  1T3U A;  2D65 A;  2Y2K A;  4R5F A;  2BYK B;  5B1M C;  4J5U A;  4WXG A;  1ID3 B;  3PJ0 A;  1WYV A;  1PFF A;  4X23 C;  3ZZJ A;  3PDB A;  1UU2 A;  3AZM C;  4DRB A;  5JRG C;  4CBS A;  2HUE C;  3KUY B;  2BI5 A;  3E2F A;  1M0O A;  3VH5 T;  1VJO A;  5DB5 A;  1LKC A;  3KFU G;  2WK8 A;  5FT5 A;  3WY7 A;  3MAF A;  5CPJ D;  4E1O A;  3AZF A;  5B40 D;  1GEX A;  4OBV A;  3LEL B;  1F66 D;  4LD9 D;  3A6N A;  3MGS B;  2FKI A;  3X1U A;  3MGP D;  5BO0 B;  2VQR A;  4OT8 A;  4M2M A;  3UAK A;  4A0R A;  4N0W A;  3W1I A;  5M4D A;  1S08 A;  4J8X A;  1O62 A;  1RV3 A;  5B31 B;  2F2A C;  3W97 C;  1P3L B;  4CSR A;  4XZQ B;  1P3B B;  1P3I B;  3AZL D;  5B2I B;  5CPK C;  5HHY A;  5JRG D;  1TZY B;  5GSU D;  4H63 Q;  1BS0 A;  5B0Z B;  1IX7 A;  5AVB B;  5B33 A;  2A1V A;  1BJ4 A;  4G92 C;  3MC6 C;  3G7Q A;  4XQ2 A;  3WKR A;  5DNM D;  2GSA A;  5B32 C;  3W96 C;  2YKY A;  5B0Y D;  1YNU A;  2V0Y A;  2VGS A;  4MQQ A;  5AV6 C;  1KX4 B;  4Z5T D;  2NZD C;  3BN1 A;  5BNV B;  5B1L A;  4WYC A;  4YS3 D;  1P3W A;  1CS1 A;  4K2M A;  3NUB A;  3ACZ A;  3IHJ A;  5M49 A;  3GWP A;  3TU4 D;  4K2I A;  5B2J C;  3H0M C;  3AYW A;  2G7J A;  3LZ1 A;  1M0Q A;  4H9P B;  3TU4 B;  3W1H A;  3JZL A;  3DR7 A;  2VYC A;  1WKH A;  3UT9 A;  1W7M A;  1Q9C A;  2ARO A;  1F66 B;  2WKA A;  1JS6 A;  5B1M D;  5GT0 B;  4KAM A;  3C1C B;  2V1P A;  2QB3 A;  3V9R B;  2FM1 A;  2PYO C;  4WU8 B;  5F99 B;  3AL0 C;  1EJI A;  5M46 A;  3W99 B;  1MDO A;  3OP7 A;  2Z9V A;  3AEN B;  4WNN B;  3WTP C;  1AHF A;  1ASD A;  4NE3 A;  3X1V B;  3MGR D;  3X1V A;  3W99 D;  1ASG A;  1P3L D;  2NMP A;  3EPH A;  3D6K A;  2O0R A;  3O62 C;  3DC1 A;  4PIW A;  1P34 A;  2W7I A;  5CPJ C;  7AAT A;  4AWL C;  3FTB A;  3W99 C;  4ISY A;  4WU8 A;  1CQ7 A;  4O6Z A;  3WAA A;  5B24 C;  2XH1 A;  5GT0 A;  4ZAS A;  5C6U A;  1PZR A;  3AZJ A;  2CJG A;  1IX6 A;  1AHG A;  1SZS A;  2ZUK A;  1TOG A;  3FDD A;  1BJW A;  4AWL B;  4K2B A;  2NZD D;  1AIC A;  4XJL A;  5AV9 B;  3N5M A;  5CPJ B;  4EB5 A;  5CPI A;  3P6K A;  2ZY2 A;  5EAA A;  3AZN B;  1BFM A;  4XK1 A;  3AZM B;  4Y0I A;  2FJ7 C;  5CP6 A;  1CQ8 A;  5DNN A;  1O61 A;  3VH6 T;  3FSL A;  4WU9 D;  3AEJ C;  3HMU A;  2DOU A;  1JG8 A;  3B0D B;  4H9Q A;  2EYQ A;  5JA4 B;  5F9S A;  2YCT A;  4E3Q A;  3FKD A;  4PFF A;  4R8P D;  4X23 A;  1AOI A;  2D61 A;  3AZH D;  1UKJ A;  1N1J A;  2ZY5 A;  3B6F B;  2AY3 A;  2OGA A;  2W8W A;  4PVF A;  5B2J D;  1A7W A;  3GSB A;  3NX3 A;  3B6F D;  1MAQ A;  3JWB A;  5AVB A;  2O7C A;  2ZSL A;  3REH A;  2Y2Q A;  3B0C T;  2FYF A;  5DNN B;  2RIQ A;  1UU1 A;  3ZRP A;  5B40 B;  3K28 A;  1GDE A;  4DGT A;  4KYO A;  2Y2P A;  3MGP B;  3X1T C;  3UTA A;  3VOM A;  5KTB A;  4RJ0 A;  5B31 C;  3UTB B;  2OGE A;  1BJN A;  3GZC A;  3IP4 C;  4WYF A;  3REL C;  2WK9 A;  3N0L A;  1I41 A;  3UTB D;  3O62 D;  1ID3 C;  3E2Z B;  3FFR A;  5G2P A;  5IWQ A;  1LW4 A;  1BT4 A;  3KXB A;  3DXV A;  4Q75 A;  3VH5 W;  1M1A C;  1TZY C;  1D7S A;  2ZM5 A;  5B2I D;  3OKS A;  5GXQ A;  1SZU A;  3JTX A;  3RUY A;  1BH8 B;  2D66 A;  1MDZ A;  3B1E A;  3E6G A;  4A00 A;  1D2F A;  4XZQ D;  3NTJ A;  1P3I D;  2VMQ A;  2VMU A;  3KUY A;  3AZF D;  2CV5 A;  5FUG B;  3AEN A;  1KU5 A;  1ART A;  3QPG A;  4WYE A;  4U1T A;  3C1C A;  4AOA A;  1P3G D;  5AV9 A;  2D64 A;  4QLC A;  1TAT A;  3NQJ A;  1F66 C;  1AKB A;  3ZRR A;  1C7O A;  1AAW A;  5AV5 D;  5B0Y B;  2C7T A;  3FZ8 A;  2VMP A;  2IO5 B;  1JS3 A;  3M5U A;  2BYJ A;  5AVC C;  2GMS A;  3WKJ A;  1HTA A;  5DJ1 A;  2W7M A;  3AFA A;  3B1C A;  3CQ6 A;  1N8P A;  1XEY A;  3I16 A;  1CL1 A;  1LW5 A;  1VEF A;  1ASC A;  2CWE A;  3AZL C;  3AZG A;  4R8P C;  4M2K A;  1KX4 A;  3H9X A;  3DU4 A;  1M1A B;  1Z7D A;  2DKJ A;  1AMS A;  1KL1 A;  4RAE A;  2W7D A;  4BA5 A;  1BJO B;  3X1U D;  4IW7 A;  4J8L A;  4MY5 A;  2WK7 A;  5GT3 A;  2Q7W A;  3PIU A;  3X1V C;  1AKC A;  1QIS A;  3EG5 B;  3A9X A;  1WYT A;  3A9Y A;  1P34 C;  1YOO A;  3HDO A;  2CJD A;  5CPJ A;  3WA9 C;  1EQZ B;  3A2B A;  2JJG A;  4IY7 A;  1ZLA B;  4H9P A;  3TU4 A;  3PGY A;  5AV6 D;  4XEW A;  3EUC A;  3LWS A;  3W97 D;  3AYW D;  2Y2N A;  5TF5 A;  4OBU A;  2HIO B;  1GCK A;  4J8W A;  3BCX A;  4ADD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...