2ZY2A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
521
structure length
521
Chain Sequence
SPFELKDELIKVASGKANRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTVGVGGLAKLDGIEGRFERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLTVSEQIVRQYIVREMAGGAVPPESVDLFAVEGGTAAMAYIFESLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQRPDLLILTDDVYGTFADEFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNVTCRLYGEAFSQWAVQQSSTGDMLFRVADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRRLADELYEQYKALGKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-aspartate 4-carboxylyase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Lyase
total genus 154
structure length 521
sequence length 521
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy2A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy2A01
1IX8A 1DJEA 1YIYA 4LNLA 1D7RA 3RCHB 1DJUA 1CL2A 3DODA 3MAFA 4K2MA 4LNJA 4OTLA 1AHYA 1GC2A 5BJ4A 3LVJA 1ASNA 3AOVA 5E4ZA 4M2MA 1TASA 2OATA 3AEPA 4L0OA 1J32A 4UOYA 3PD6B 4GE9A 3B1DA 4LW4A 1U08A 2BIAA 4W1VA 3G8MA 3L8AA 3K7YA 2BIGA 3EZSA 1GDEA 1ZODA 1AIAA 1I48A 2GB3A 2ORDA 3IHJA 1BJOB 1AMAA 1GEWA 1B4XA 1WYUB 2BKWA 3BCXA 3NU8A 3QI6A 4ZLVA 2BWPA 4XJLA 2BI9A 3MAUA 4JEWA 2F8JA 2VMNA 3MEBA 1CQ8A 2W8TA 3WLXA 4GEBA 3DRDA 4EFFA 1W7MA 5I92A 4ZM4A 5G2QA 2PB2A 1XI9A 4F4EA 1Z3ZA 2Z61A 1BT4A 1RV3A 4AZKA 4EMYA 3QGUA 4U2HA 2D63A 1TOIA 2CTZA 4F5JA 2QB2A 4H51A 4LC3A 1CQ6A 4WBTA 3HQTA 3NYSA 3ZRQA 2EZ1A 1O62A 1AHXA 5E5IA 2FQ6A 2VMPA 3GSBA 1ASGA 3KE3A 2O0RA 4UHNA 2VMOA 1DTYA 4W5KA 1S06A 3VK2A 4KAMA 4WYEA 2DR1A 5AX8A 1C4KA 2QA3A 4XAUA 2GMUA 2D64A 1AKCA 3BCBA 1BW0A 1YAAA 2VMUA 1S0AA 4MQQA 1B5OA 1ASLA 1VEFA 1GEYA 3E77A 1TPLA 3ZZKA 2Q7WA 3N5MA 2CJHA 4XJOA 1IJIA 3RCHA 1SPAA 3Q8NA 4WYAA 2VIAA 1LKCA 2JGTA 3PPLA 3N75A 1N31A 2BWOA 3F6TA 3EI8A 5EFSA 1Z7DA 2HUFA 3GJUA 2JJEA 1ELUA 4XJPA 2ZY5A 2ZYJA 3PD6A 4N0WA 4FFCA 5EUNA 3GBXA 5HDMA 4ZDPA 1M7YA 2D66A 1BJOA 1WYUA 1AJRA 2E7JA 2FN6A 3GR9A 3JWAA 3QM2A 2HUUA 1V2DA 3II0A 1AY5A 2Z9UA 3K40A 3PDBB 2V0YA 3WZFA 4EB5A 1QGNA 4CXRA 3FDBA 4MQRA 1WSTA 2CSTA 3USFA 1V2EA 4RKDA 1BJNA 1EQBA 2FYFA 1JG8A 2X5FA 2W7IA 1C7OA 4HVKA 1ARTA 1IAXA 1V72A 3BWOA 1ASEA 4ATQA 4PIWA 2AY7A 3HLMA 5FT6A 1IAYA 1JS3A 5EAVA 1IX6A 1X28A 4WYGA 3VOMA 2C0RA 2VYCA 4GE4A 3K28A 2ZSLA 3P6KA 4ITXA 2BIEA 4MY5A 2W7FA 1EG5A 4WLJA 4ZDOA 5DJ1A 2VGUA 1QISA 4IY7A 4E1OA 4R2NA 2FNIA 2Z20A 5DB5A 2HP1A 2YCTA 2C7TA 1B9IA 4Y0DA 2GQNA 5J8QA 1GBNA 1ARSA 1B8GA 2CFBA 2QBTA 3B1CA 3GZDC 2HOXA 1OHWA 2W7JA 5HXXA 3G7QA 1AJSB 3RI6A 4U1TA 3EIBA 5D5SA 4J5UA 1T3IA 2GSAA 3AEOA 3RQ1A 3ELPA 3M5UA 3NTJA 4UHMA 1D7SA 2JG2A 2Z1YA 3WY7A 3NYTA 2D7YA 2VMZA 2VGSA 3R9AA 2CH1A 5JAYA 1ASBA 1W23A 3EZ1A 3D6KA 2E54A 1G7WA 3QPGA 2D7ZA 5K8BA 1AMQA 4NOGA 4B98A 2BI5A 3MBBA 3DC1A 4EU1A 1UKJA 4A0GA 2W8VA 2W8WA 3NDNA 2VMVA 3MC6C 3PDXA 4B9BA 1CZEA 1SZSA 2C81A 2XH1A 4PFFA 3FRKA 5F8VA 3E6GA 2BI1A 4JEZA 4F5IA 3HL2A 1I29A 2VMTA 1DGDA 1MDOA 1AAWA 2ZY2A 3AEMC 2R5CB 1IUGA 3E2ZB 3VK4A 4XQ2A 5M49A 3PDBA 4AO9A 2V1PA 1YNUA 3DYDA 5EIGB 2X5DA 2W7LA 3RBFA 3WGCA 2BI2A 2FM1A 2HOZA 1ORDA 3ECDA 4LNMA 4W8IA 4JF1A 2JJGA 4A72A 4WYFA 2BI3A 1TATA 3NNKA 3BWNA 2CINA 2VLFA 3DZZA 4F5GA 2Z9VA 4R5FA 5G0AA 4ADCA 4W91A 2ZY4A 4WYDA 1AHFA 2OQXA 2HUIA 4Y0HA 4ITGA 4ZDLA 1QJ5A 1TOKA 5D95A 4CBSA 1O61A 2R2NA 3H7FA 3PJ0A 4BA4A 4JEYA 4M2JA 5DX5A 1QJ3A 3LVLB 4WXGA 5EQCA 2EGYA 1QIRA 3EI7A 3RUYA 3NUBA 2W7GA 1RVUA 2AY3A 4JEVA 1B9HA 4F5LA 1J04A 1M6SA 2CY8A 3TCMA 2DKBA 4WLHA 4XEWA 3CBFA 1AJSA 9AATA 2VIBA 3L44A 3FSLA 1FC4A 1P3WA 3FVSA 3AEJA 1KMJA 1SVVA 2WK7A 2QMAA 1E5EA 3FKDA 4BMKA 1AIBA 3AATA 2YHKA 3BS8A 2OGAA 4GE7A 4K2BA 3ZRPA 1TOJA 1AMSA 3EI5A 4LW2A 4UQVA 3AELA 3B8XA 1I41A 3NX3A 1ARGA 4R8DA 2YCNA 2AATA 3F0HA 4MKJA 2E7IA 3QBOA 1MLZA 3CQ4A 1AICA 3I5TA 3UWCA 4TMRA 1AHGA 4BQ0A 4IXSA 2R5CA 3E2ZA 1W7LA 4F5FA 1M0NA 4PVFA 1VJOA 5EIGA 1D7UA 2ZJGA 3KKIA 2GMSA 4BHDA 4W1WA 4Q76A 2JJHA 1B5PA 3CQ5A 4AO4A 4WP0A 4OMAA 5E3KA 1IX7A 1MDZA 1ASFA 1GD9A 1WKGA 3HMUA 3BC8A 1PG8A 4A0FA 3FDDA 5M4BA 1GC4A 1GC3A 1YJZA 2Z9XA 4A6UA 3T32A 3TFUA 2CJDA 4AH3A 2YKVA 7AATA 3DU4A 4P3MA 2VLHA 1DKAA 3DXWA 3WX9A 1M0PA 5FT4A 1OHVA 3MC6A 5G4JA 3LVMA 5FT8A 1YOOA 1M32A 1LC8A 3PGYA 4ZWVA 1OATA 2AY4A 2HORA 2G6WA 2VGWA 2W8JA 3MADA 2DOUA 4OC9A 3I4JA 3AV7A 4F5HA 4Y0IA 2BWNA 4ISYA 1JS6A 3JW9A 1GCKA 4MKKA 3AEMA 1KL1A 4F5KA 4ZWMA 2ZY3A 4WB0B 1RV4A 3FFHA 4E3RA 3TATA 1S07A 2Z1ZA 3JWBA 3LG0A 5TF5A 3NU7A 4ZM3A 5G09A 4ADDA 1CL1A 3A9ZA 4WYCA 2CB1A 2HZPA 2VGZA 3EUCA 1O69A 4ZAHA 2E7UA 1DGEA 2FNUA 2W7KA 4O6ZA 4A6RA 3CAIA 2HOYA 4QGRA 3LWSA 1WYVB 4A0HA 4EB7A 1IBJA 1Y4IA 3A8UX 1TARA 5EAAA 3DR7A 5F9SA 4ZSWA 3E2FA 2AY6A 1UU1A 2YKUA 3QHXA 1WYTB 2AY8A 2BYLA 4KYOA 1G4VA 4IX8A 1AHEA 1KKJA 4A00A 3UE8A 1UU2A 4JF0A 3TFTA 2ZSMA 4TN4A 4RJYA 1ZC9A 5G4IA 3LY1A 3LVKA 3PIUA 4GSAA 4F5MA 1JF9A 2CH2A 1S08A 2D61A 3ASAA 1D2FA 4KXKA 3BCAA 4Q31A 8AATA 2AY2A 2EZ2A 3ACZA 3FCRA 1MLYA 3DXVA 4R5ZA 3AOWA 1V2FA 3F9TA 3A9XA 4WXBA 4HF8A 4IXZA 1S09A 1AY8A 2QB3A 1OHYA 3UAKA 1FG3A 4P7YA 4DGTA 1YIZA 4ATPA 2YRIA 1H0CA 2W7DA 4RAEA 2TPLA 1DFOA 3AENB 4Q75A 5IWQA 1GC0A 1KL2A 1WKHA 2D5YA 3KGXA 3NUIA 1LS3A 1SFFA 2YKXA 4A0RA 1CJ0A 1MDXA 2O1BA 1ELQA 4ADEA 3FQ7A 1BQAA 1VP4A 1OXOA 3KGWA 3NYUA 1N8PA 1W3UA 2OGEA 5EUEA 2AY1A 1DJ9A 4WD2A 2VMYA 1AY4A 1I43A 1ARIA 1E5FA 1LW5A 4IYOB 4WB0A 3EI9A 1C9CA 4E77A 2Z9WA 4AOAA 1ASAA 1SZKA 2XBNA 1SZUA 1M0OA 3FFRA 5DJ9A 3B1EA 4IW7A 1KKPA 3CQ6A 3COGA 1BS0A 3LV2A 1D7VA 1SF2A 1W7NA 3OP7A 2YOBA 3MKJA 1C7GA 4IXOA 1CQ7A 2CJGA 2VMWA 1MAPA 2BYJA 1TOEA 1YJYA 3E2YA 2CANA 4ZSYA 2WK8A 4FL0A 1C0NA 4W1XA 2O7CA 2C44A 1BQDA 1WYVA 2QLRA 3FQAA 3GETA 4Q6RA 1BKGA 2PB0A 1LC5A 3BWNC 1G7XA 1CZCA 3WKSA 3PAAA 4DQ6A 3OKSA 3E9KA 5G2PA 1FG7A 3R4TA 1MGVA 1X29A 1WYTA 3FQ8A 2VMQA 2NMPA 2WKAA 1O4SA 3BV0A 3MAFB 3BN1A 5M46A 2RFVA 1QITA 1AX4A 3HDOA 1X2AA 1UU0A 4RKCA 1RVYA 1ZOBA 2R5EA 3GZDA 3RBLA 2VI9A 2W7HA 4PFNA 4OCAA 3VAXA 1BJ4A 1CS1A 5C6UA 3GZCA 1ARHA 1TOGA 1IVRA 2D65A 3A9YA 3B46A 4OYTA 4CVQA 3ZRRA 2W8UA 1LK9A 2ZC0A 1N2TA 1YJSA 3P1TA 4A6TA 3TQXA 4WXFA 2YRRA 2VMSA 4BA5A 1G4XA 2EPJA 4CXQA 3AENA 3AEJC 3ZZJA 1KMKA 2JJFA 1M0QA 3PA9A 2YCPA 5HHYA 4M2KA 3BB8A 2VGTA 1C7NA 5FT5A 1H1CA 4MSOA 4E3QA 3ATHA 3FVUA 3FVXA 1LW4A 2AY5A 1M4NA 2W7MA 3ELEA 1MAQA 3A2BA 3WKRA 1AKBA 1ASDA 3NRAA 4I8AA 2ZUKA 3ASBA 3EI6A 1X0MA 3VK3A 2WK9A 1OXPA 4GRXA 1AMRA 2VGVA 4IYOA 4JEXA 2R0TA 2YKYA 2AY9A 4OT8A 1QZ9A 5EUDA 1BJWA 2DKJA 2HP2A 3ISLA 2X8UA 2EH6A 4CBRA 2ZP7A 1ASCA 1EJIA 1AAMA 4AZJA 1PFFA 1LC7A 2VI8A 2VMRA 4UHOA 1GEXA 3EIAA 4MQPA 4XK1A 3JTXA 4ZASA 4K2IA 5BJ3A 2EO5A 2W7EA 1ASMA 1AKAA 4GDYA 3N0LA 3DR4A 3QN6A 4XJMA 2PO3A 3FTBA 4ADBA 2BHXA 3WGBA 4DBCA 5M4DA 1ECXA 2VMXA
chains in the Genus database with same CATH superfamily
1DJUA 3DODA 5AVBB 5E5AA 1GC2A 1B6WA 5BJ4A 2KFPA 4WJ3C 5BS7C 4UPKA 1ASNA 5C3IB 2DF4C 5B31A 1TASA 3PD6B 3B1DA 1U08A 3H9XA 4XUJA 3EZSA 2FFFB 2GB3A 3AZHB 4XJLA 2BI9A 4YM6C 2VMNA 3FD0A 2W8TA 5CHLB 4EFFA 4DQYB 3B0CW 4ZM4A 5BO0A 2XD1A 2PB2A 1BT4A 3QGUA 1P3MD 1O62A 2FQ6A 2BG1A 5B1LA 3AZFB 3C1BB 2O0RA 2VMOA 4UHNA 1KX4D 2Y2JA 3KWQD 1S06A 3VK2A 1C4KA 4KGCC 1P3AD 1P3GD 1ASLA 3LJAB 3E77A 4ZUXA 1TPLA 3AN2C 4WYAA 5GSUC 3N75A 4E45A 3REIC 3F6TA 2HUFA 3GJUA 2HUEB 3VH5T 4N0WA 3AZLC 3W96C 4ZDPA 3REKD 1M7YA 1P3LD 3A1IA 5GT3A 3PDBB 3K40A 2Z9UA 4EB5A 2V0YA 3AZMC 3MGQA 2CSTA 1BJNA 1EQBA 1P3OA 2X5FA 2Y2HA 5AV5C 4RIZA 3B6FB 1P3FD 3BWOA 4KUDC 3AV2B 5EAVA 1IX6A 1X28A 4WYGA 1HQ3C 1U35D 1F66D 2W7FA 3X1SA 4H9NA 3MGPB 4H9SC 2YCTA 2C7TA 2GQNA 3A6NC 1GBNA 1ARSA 5JRGC 1OHWA 1AJSB 3EPJA 3EIBA 5D5SA 3ELPA 1P34A 3NTJA 3R9AA 5JAYA 3D6KA 1KX5B 3QPGA 5K8BA 5BNXB 3NDNA 2VMVA 5B33C 1SZSA 5F8VA 4G92C 2VMTA 1DGDA 1MDOA 5GXQA 3LELC 3V9RA 3DYDA 2BI2A 2FM1A 1ORDA 3W98A 4A72A 1ID3A 3NNKA 4H9RA 5CPIB 2CINA 3DZZA 5GT0C 5G0AA 4ADCA 1AHFA 3AZFD 3C1BD 2OQXA 4Y0HA 2BYKA 4ITGA 1TOKA 1ULYA 1O61A 3WKJC 5B1MC 4J8VA 1N1JB 3LVLB 1QIRA 2W7GA 5AY8C 3MGRD 2NQBA 3WAAA 2DKBA 5AV6C 2F8ND 1P3WA 3AEJA 1AIBA 3AATA 4NE3A 3NQUB 5B0YC 3X1UD 2G5HC 3C1CC 4JJND 3FZ8A 4R8DA 5B32A 4Z5TB 1M18B 3QBOA 2JSSA 1KU5A 3B6FD 1AHGA 4IXSA 3AV2D 1VJOA 4BHDA 1D7UA 2ZJGA 4AO4A 1B5PA 3AZGC 1S32B 2BYMB 1IX7A 1ASFA 3MGPD 1WKGA 1P3IC 3AZJD 3HMUA 4A0FA 1TAFB 3N4SA 1GC3A 1YJZA 2Z9XA 2NZDA 4A6UA 3AN2B 3MGSC 2CJDA 4AH3A 5KDMB 4J8LA 4X23C 3A1KA 5GSUB 4P3MA 2VLHA 3REIB 3DXWA 3B0CT 3UTAC 1M0PA 5FT4A 1OHVA 5G4JA 4WU9D 1LC8A 3AZLB 1OATA 3MADA 4F5HA 5G49B 1KX5D 1JS6A 1GCKA 3VH6W 3AZMB 1S07A 2Z1ZA 2X3LA 5TF5A 4ZM3A 4ADDA 3A9ZA 3W97C 4ZAHA 2E7UA 3TU4C 1M19A 2W7KA 3EPKA 4O6ZA 4LD9B 2HOYA 3R45B 4J8XA 3MNNB 1WYVB 4A0HA 3EPLA 5EAAA 2AY8A 5CPID 4WZSB 5CP6A 1EQZB 4GSAA 1JF9A 2CH2A 5JRGB 1D2FA 5AV8B 4H9QA 2EZ2A 3FCRA 3A9XA 4WXBA 4IXZA 1S09A 3O62C 3X1TA 1YIZA 2AROC 3AZEA 2W7DA 2G5IC 4RAEA 1KX4C 1GC0A 1KL2A 1WKHA 2D5YA 3KGXA 3UTBA 1CJ0A 2O1BA 1ELQA 4YM6D 4G92B 1AOIA 4EO5C 2CV5B 2Z9WA 1SZKA 1SZUA 3X1SB 4IW7A 1KKPA 3OP7A 4Z5TD 4J8UA 3MKJA 4H9PB 3FZ7A 3MVDB 4XZQC 1CQ7A 2BYJA 3E2YA 5DNMC 5F99B 2CANA 4ZSYA 1P3LC 2WK8A 1P3PC 1PMMA 1P3KB 1BKGA 1LC5A 3BWNC 3WKSA 1S32D 1FG7A 1MGVA 3WKJB 4UUZB 2VMQA 5B1MB 4J8WB 2RFVA 1QITA 5M46A 1P3FC 3X1VB 3AN2D 4E44A 1ZOBA 3WTPB 4H9OB 1U35C 5GSUD 1F66C 1BJ4A 1CS1A 3REID 5AV6B 2Y2NA 3A9YA 4CVQA 3ZRRA 1LK9A 1YJSA 4A6TA 3TQXA 4WXFA 3UT9A 2VMSA 3AZLD 2EPJA 1KX3A 3RELA 2YCPA 5B0YB 3BB8A 4YS3B 5AVBC 3C1CB 3FVUA 3AZMD 2AY5A 2JISA 1MAQA 5B31G 3NRAA 1X0MA 5AV5D 2JE5A 1QZ9A 4LD9D 1HQ3D 3MNND 3AZHC 1AAMA 3EIAA 4XK1A 3JTXA 1ZLAC 2EO5A 2W7EA 3A6ND 1EQZD 4GDYA 3QN6A 3DR4A 3AZIA 2PO3A 3VH5W 4X23B 5JRGD 2BHXA 3WGBA 5AV9A 1ECXA 5AV8D 3MGRA 5CPJB 1YIYA 4LNLA 3MAFA 1CL2A 4K2MA 1Q9CA 2F8NA 5AVCC 1P3BB 2PYOB 3L8AA 3K7YA 1GDEA 1ZODA 3IHJA 3X1UA 1WYUB 1B4XA 2BKWA 1BH8B 3LZ0C 3MAUA 4JJNA 3W97B 4JEWA 3LJAC 3LELD 3TU4B 4RJ0A 1CQ8A 4GEBA 3DRDA 1W7MA 2CV5D 2AEUA 5G2QA 4NE6A 2HUEC 2Z61A 3MVDD 4EMYA 4U2HA 1TOIA 3B6GC 2QB2A 4LC3A 5F99D 5CPKA 3HQTA 4WBTA 1P3KD 5E5IA 2VMPA 5DNNC 3WKJD 2AEVA 4KAMA 5B1MD 2DR1A 4J8WD 3O62B 3X1VD 5B40B 3AV2C 2AROB 1BW0A 2VMUA 4MQQA 4WU9A 5B2JB 3WTPD 2CJHA 4WU8C 3RCHA 5AV6D 3Q8NA 2JGTA 3PPLA 3MGPC 2BWOA 3EI8A 1ELUA 4J8XB 4FFCA 5B0YD 4EO5B 3AZNA 3C1CD 1BJOA 4HGAB 2FJ7C 2E7JA 2FN6A 4WNNB 3WZFA 1QGNA 4XZQB 4CXRA 2F8NH 1WSTA 3USFA 5CP6B 2DGKA 5DNMB 1JG8A 1P3PB 1KX5C 1C7OA 1V72A 5B0ZC 2AY7A 1B67A 3VOMA 4CAYB 4GE4A 2ZSLA 4KHAB 3P6KA 4MY5A 4WLJA 4ZDOA 3AZEB 2VGUA 2Z20A 5DB5A 3MGSD 3KXBA 4X23D 5CPJD 3KUYC 3GZDC 2W7JA 3G7QA 5CPIC 1WWSA 3RQ1A 3REJC 4CSRB 1P3BD 1D7SA 2JG2A 2VMZA 2PYOD 3EZ1A 2E54A 4J8UB 3DC1A 1UKJA 2W8VA 3W97D 3TU4D 4K05A 3W1JA 4JEZA 1I29A 2Y2OA 2R5CB 3VK4A 4AO9A 3REHB 1YNUA 3RBFA 4JF1A 2Y2GA 4WYFA 1ZLAB 4KGCA 5B32G 4F5GA 1M1AA 4R5FA 5FUGB 2HUIA 2F2AC 4Z5TC 3AYWB 1M18C 3O62D 5B40D 4H63Q 4BA4A 2AROD 4JEYA 5AVCB 4M2JA 5E5AC 5EQCA 3RUYA 3EI7A 5B2JD 1RVUA 3W96A 1S32C 5JA4B 5B24B 4F5LA 2CY8A 3TCMA 4WLHA 4XEWA 3CBFA 5B31C 3LZ0B 3W99B 1SVVA 3W1HA 2QMAA 4Z66A 1E5EA 4BMKA 2OGAA 4KUDA 1I41A 3NX3A 1HQ3A 4XZQD 1H3OA 3KSYA 3B6GB 5DNMD 1P3PD 4H9SA 3E2ZA 4QLCB 5DNNB 5EIGA 3KKIA 4OMAA 5E3KA 1MDZA 1TZYA 1PG8A 4LD9C 3FDDA 5M4BA 1GC4A 3MNNC 4WU8B 3TFUA 4R8PA 1XEYA 3WX9A 5B33A 3PGYA 1M32A 1EQZC 3H0RC 2VGWA 5B2IB 4OC9A 2DOUA 3NQJB 3I4JA 3AV7A 5AVBD 3LELA 4OBUA 5AV8C 2FJ7B 2ZY3A 3FFHA 4E3RA 5G09A 4WYCA 2CB1A 3EUCA 3AZHD 3LZ1B 5B0ZB 5GT0A 3REHD 4QGRA 3I16A 2L5AA 1IBJA 3AFAB 2HIOB 3HVYA 5F9SA 2AY6A 1UU1A 1ZLAD 3N4XA 3AV1B 2CV5C 4AWLB 1JFIA 1UU2A 4JF0A 3TFTA 2ZSMA 3X1SC 4RJYA 2W8SA 5AY8A 3LY1A 3KUYB 3AYWD 3MVDC 2D61A 4KXKA 3GWPA 2YFVB 4Q31A 3DXVA 5F99C 3AZNB 3F9TA 5AVCD 3REJB 1P3KC 3UAKA 5B24D 1DFOA 3AENB 1P34C 1LS3A 1W2EA 1MDXA 3LZ0D 4J8WC 3W99D 3LJAD 3X1VC 1N8PA 3WTPC 1LW5A 1E5FA 4IYOB 4WB0A 4AOAA 5DJ9A 3AZGA 1BS0A 1SF2A 1W7NA 3B6GD 2YOBA 4IXOA 2VMWA 2F8NK 1P3IA 1TOEA 4YS3C 3W98C 5DNND 4FL0A 4W1XA 3AZKA 1BQDA 4Q6RA 2A1VA 3WA9B 5G2PA 3R4TA 2YFWA 1WYTA 3FQ8A 3UTAA 3BV0A 5E5AB 1AX4A 4WU8D 2R5EA 2VI9A 2W7HA 5B31B 4OCAA 4DRBA 3VAXA 1TOGA 1IVRA 4XUJB 3B46A 2NQBC 4BA5A 5B2ID 3AEJC 3PA9A 1M0QA 4M2KA 2FJ7D 5CPJC 1H1CA 4MSOA 2F8NG 1M4NA 5BO0B 3ELEA 3A2BA 1ASDA 2J8PA 3ASBA 4GRXA 1P3BC 1M1AB 2VGVA 4JEXA 5B32C 2PYOC 2AY9A 5B0ZD 2DKJA 1ASCA 1EJIA 5B1LB 1PFFA 3AFAD 2HIOD 2VI8A 3IP4C 1P3MA 4UHOA 1PZRA 5BJ3A 2CWEA 1ASMA 3KUYD 3FTBA 1KX4A 4ZUXB 2NZDC 3KWQA 1DJEA 3W1IA 4OTLA 1P3AA 3REJD 3LVJA 1P3GA 4M2MA 1J32A 4UOYA 4GE9A 4LW4A 5BNVA 1AIAA 1I48A 2G7JA 2ORDA 1GEWA 3QI6A 5GT3B 5B40C 3BCXA 2WB6A 2F8JA 5B2JC 3MEBA 3MGQB 3REKA 3WLXA 1P3LA 1P3OB 1M19C 1Z3ZA 1RV3A 4J8XC 4F5JA 4H51A 1CQ6A 1P3FA 4H9NB 3ZRQA 4HGAC 1AHXA 3GSBA 1M18D 3WA9D 1U35A 1F66A 5CP6C 4W5KA 4WYEA 2QA3A 4XAUA 5E5AD 2GMUA 2D64A 1AKCA 1BH9A 1YAAA 1S0AA 1P34B 1B5OA 3ZZKA 5B31D 3N5MA 4XJOA 2VIAA 3AZEC 4XUJD 1LKCA 5EFSA 1Z7DA 3UTBC 2JJEA 3PD6A 5EUNA 5HDMA 5GXQB 1AJRA 3JWAA 3GR9A 3II0A 3V9RB 1AOIC 4MQRA 1V2EA 4RKDA 3W98B 2W7IA 4J8UC 4HVKA 1ID3B 4H9RB 4PIWA 5FT6A 1IAYA 5B1LD 2VYCA 3K28A 2BYKB 4ITXA 2BIEA 1EG5A 1QISA 4E1OA 4R2NA 3REHC 4J8VB 3AZFA 3C1BA 4ZUXD 5J8QA 1B8GA 2NQBB 3HT4A 3WAAB 2RIQA 3RI6A 4U1TA 4J5UA 1T3IA 3AEOA 3WY7A 2VGSA 3UT9C 3AYWC 1ASBA 1W23A 1G7WA 3H0MC 3B0DC 2D7ZA 2BI5A 3MBBA 2W8WA 3MC6C 3PDXA 4B9BA 1CZEA 2C81A 2XH1A 4PFFA 3FRKA 5B32B 4Z2MH 3MGQD 3E6GA 2BI1A 4F5IA 2Y2IA 5B24C 3HL2A 1AAWA 3AEMC 3G0TA 5M49A 3PDBA 3W99C 2X5DA 3WGCA 2HOZA 4W8IA 3B6FA 1TATA 3X1SD 3AV2A 2VLFA 2EYQA 2Z9VA 2DGMA 2NZDB 4ZDLA 2IO5B 3AZIC 2RVQC 3MGPA 5D95A 4CBSA 3AZJA 4QLCC 2R2NA 3PJ0A 5DX5A 1QJ3A 4WXGA 1P34D 3NUBA 1B9HA 1J04A 1AJSA 2VIBA 3FSLA 3FVSA 1KMJA 2WK7A 5BT1C 1KX5A 2Y2LA 2YHKA 2QSRA 4GE7A 1M19B 3EI5A 5BNXA 4UQVA 1ARGA 2AATA 3F0HA 4MKJA 4YS3D 5B2IC 2E7IA 3W98D 3CQ4A 1ID3D 1W7LA 1M0NA 4G91B 5CPKC 2VQRA 4Q76A 2ZM5A 5CPIA 4H9QB 3LZ1C 3AL0C 2DQNC 4J8VD 3X1TB 3AFAC 4M6BA 2HIOC 2NQBD 3WAAD 5BS7A 3AV1C 1N1JA 3UTBB 4AWLC 1YOOA 2AY4A 2G6WA 2W8JA 3JW9A 2UWXA 4MKKA 1KL1A 4F5KA 4ZWMA 1RV4A 1AOIB 3AZNC 4YM6A 3JWBA 3LG0A 5B32D 2VGZA 1A7WA 3NQUA 1DGEA 4A6RA 1T3UA 4Z5TA 3A8UX 1BH9B 1TARA 3DR7A 4ZSWA 2YKUA 4KYOA 1KKJA 4A00A 1ZC9A 2NZDD 5G4IA 1S32A 3LVKA 2BYMA 3PIUA 3KXBC 3BCAA 8AATA 1MLYA 4R5ZA 1TAFA 1V2FA 3HBXA 3AN2A 1OHYA 3UT9B 4DGTA 4ATPA 2OKKA 3WA9C 5KDMA 3B0DB 5IWQA 1KX3B 5GSUA 3RELB 3REIA 3NUIA 2YKXA 4A0RA 1BQAA 1OXOA 3KGWA 3AZLA 2OGEA 5EUEA 5G49A 1DJ9A 4WD2A 2VMYA 1AY4A 1I43A 1M19D 3EI9A 4E77A 4XUJC 3AZMA 1ASAA 3FFRA 1M0OA 3B1EA 4J8XD 3CQ6A 3COGA 5AV5A 2OKJA 4LD9A 3R45A 2O7CA 2C44A 3MNNA 1WYVA 3FQAA 3GETA 5CP6D 2PB0A 1G7XA 3AZIB 3E9KA 1M1AC 1HTAA 5AV9B 1X29A 3MGRB 3VP6A 2WKAA 1O4SA 3MAFB 3BN1A 1X2AA 3KFUG 3A6NA 1EQZA 2F8NB 4RKCA 1RVYA 3X1TD 5JRGA 5B1LC 3AZED 5AV8A 5C6UA 3GZCA 2D65A 4OYTA 3UTBD 3X1UB 2YRRA 4CXQA 3ZZJA 4JJNB 1KMKA 4ZUXC 2VGTA 1BFMA 4DRAA 5FT5A 4Z66C 1AOID 3ATHA 4E3QA 1LW4A 2W7MA 4I8AA 2LY8A 3EI6A 3VK3A 1OXPA 4J8UD 1AMRA 2YKYA 4OT8A 2CV5A 3N7NA 5CPKB 2HP2A 2ZP7A 5GT3C 3AZJB 4H9PA 3MVDA 1WWIA 2VMRA 3MGQC 4MQPA 3WCOA 5F99A 3B0BA 1P3OC 1P3KA 3N4RA 1TZYC 2Y2PA 4ADBA 4DBCA 4WU9B 3WKJA 4UUZA 2VMXA 5B1MA 1IX8A 3RCHB 1D7RA 4LNJA 4J8WA 1AHYA 3X1VA 4OBVA 5E4ZA 3AOVA 3UT9D 4R8PC 3WTPA 4H9OA 2OATA 3AEPA 1KX3D 3RELD 4L0OA 5AV6A 3WTPE 2BIAA 4W1VA 3G8MA 2BIGA 4Z2MG 1AMAA 1BJOB 3NU8A 4ZLVA 2BWPA 1R4VA 5B0YA 4YS3A 3C1CA 5I92A 1XI9A 4NE5A 2Y2QA 4F4EA 4AZKA 2D63A 2CTZA 3NYSA 5GXQC 2EZ1A 4WV4B 1ASGA 3KXBB 3KE3A 3AZID 1F1EA 2RVQD 5AV9D 1DTYA 4QLCD 4RITA 5AX8A 1ID3C 3MGSA 3BCBA 4X23A 4YM6B 1VEFA 1GEYA 2Q7WA 5CPJA 1IJIA 1SPAA 5BT1D 1N31A 4J8VC 1P3BA 3VH6A 4XJPA 2ZY5A 2ZYJA 2PYOA 3GBXA 2D66A 3WAAC 3FZ6A 4ZBJC 1WYUA 1BH8A 3QM2A 2HUUA 1V2DA 1AY5A 3W97A 3FDBA 3TU4A 2FYFA 1ARTA 5CPKD 1IAXA 4KGCB 1ASEA 4ATQA 3HLMA 1JS3A 2C0RA 3AZKC 3LZ1D 5DJ1A 4IY7A 2FNIA 4RM1A 2HP1A 1B9IA 4Y0DA 3W96B 2CFBA 2QBTA 3AV1D 3B1CA 2HOXA 3O62A 5HXXA 5B40A 2AROA 2GSAA 3M5UA 5B2JA 4UHMA 2Z1YA 3NYTA 2D7YA 2CH1A 2IO5C 4Z66B 3AZND 5AV5B 1AMQA 4NOGA 4B98A 4EU1A 4KUDB 4A0GA 1HQ3B 1H3OB 2ZY2A 1IUGA 3E2ZB 4WNNA 4XQ2A 2Y2MA 2V1PA 5EIGB 4XZQA 2W7LA 3ECDA 4LNMA 5DNMA 3A6NB 2JJGA 1P3PA 2BI3A 1TZYB 3BWNA 1P3MC 3EG5B 4RLGA 3KXBD 4CAYA 2ZY4A 4W91A 4WYDA 4KHAA 1QJ5A 3KWQC 4R8PB 3H7FA 2DGLA 4G91C 5B33B 2EGYA 1P3AC 1PMOA 2AY3A 4JEVA 1P3GC 1M6SA 3LELB 9AATA 3L44A 1FC4A 4CSRA 3X1TC 5AVBA 3FKDA 3BS8A 4K2BA 3ZRPA 1TOJA 1AMSA 4LW2A 3REKC 5GT0B 3AELA 3B8XA 2YCNA 1MLZA 1AICA 3I5TA 3UWCA 4TMRA 4BQ0A 3AZHA 4KGCD 2R5CA 4F5FA 3REHA 4PVFA 1Z2CB 1JFIB 2GMSA 1M1AD 3WCNA 4W1WA 2JJHA 3CQ5A 5AY8B 4WP0A 1ZLAA 1GD9A 3BC8A 3VH5A 1KAFA 5FUGA 3AYWA 3T32A 3W96D 2YKVA 7AATA 3DU4A 1DKAA 5AVCA 3MC6A 3LVMA 5FT8A 4ZWVA 2HORA 5JA4A 5B24A 4Z66D 5C3IC 4ZBJB 2BWNA 4ISYA 4Y0IA 3AEMA 4NFTA 4WB0B 3LZ0A 4KUDD 3TATA 3H0LC 3W99A 3LJAA 3NU7A 1CL1A 3AZGB 2HZPA 3JZLA 1KX3C 3RELC 1O69A 2FNUA 1P3IB 5GT3D 3CAIA 3LWSA 3AZKB 4EB7A 3B6GA 3MGSB 1Y4IA 1P3OD 3E2FA 2YFWB 1WYTB 3QHXA 1TZYD 4QLCA 3UTAB 2BYLA 5DNNA 1G4VA 4IX8A 1AHEA 3UE8A 4TN4A 3EPHA 4F5MA 1S08A 3ASAA 3AZFC 3C1BC 2AY2A 3ACZA 4R8PD 3P5JB 3AOWA 4HF8A 5B33D 1AY8A 2QB3A 4WU8A 1FG3A 4P7YA 2YRIA 1H0CA 2TPLA 4Q75A 5AV9C 2Y2KA 3MGRC 1SFFA 4ADEA 3FQ7A 1VP4A 3NYUA 5B2IA 3NQJA 1W3UA 2AY1A 2FJ7A 1ARIA 1C9CA 5GT0D 2XBNA 3X1UC 3LV2A 1D7VA 1C7GA 4JJNC 5GXQD 2CJGA 1P3MB 1MAPA 3LZ1A 5B0ZA 1YJYA 3VH6T 1C0NA 3B6FC 2QLRA 5KTBA 3AFAA 5AY8D 1CZCA 2HIOA 3PAAA 4DQ6A 3OKSA 1KX4B 3KWQB 2NMPA 3AV1A 3HDOA 1P3AB 1UU0A 3AZJC 3KUYA 1P3GB 3GZDA 3RBLA 4PFNA 2YFVA 1ARHA 2FKIA 5BNVB 2W8UA 2ZC0A 3REJA 1N2TA 3P1TA 1G4XA 3AENA 2JJFA 4WU9C 5HHYA 1C7NA 3REKB 1P3LB 3FVXA 3WKRA 1AKBA 2ZUKA 3AZGD 2WK9A 2XD5A 4IYOA 2R0TA 2JCHA 1P3ID 5EUDA 1BJWA 3ISLA 1P3FB 2X8UA 2EH6A 3AZKD 4CBRA 4AZJA 1LC7A 1U35B 1F66B 1GEXA 3UTAD 4ZASA 4K2IA 1AKAA 1M18A 3WA9A 3N0LA 4XJMA 5M4DA
chains in the Genus database with same CATH topology
1DJUA 3DODA 5AVBB 5E5AA 1GC2A 1B6WA 5BJ4A 2KFPA 4WJ3C 5BS7C 4UPKA 1ASNA 5C3IB 2DF4C 5B31A 1TASA 3PD6B 3B1DA 1U08A 3H9XA 4XUJA 3EZSA 2FFFB 2GB3A 3AZHB 4XJLA 2BI9A 4YM6C 2VMNA 3FD0A 2W8TA 5CHLB 4EFFA 4DQYB 3B0CW 4ZM4A 5BO0A 2XD1A 2PB2A 1BT4A 3QGUA 1P3MD 1O62A 2FQ6A 2BG1A 5B1LA 3AZFB 3C1BB 2O0RA 2VMOA 4UHNA 1KX4D 2Y2JA 3KWQD 1S06A 3VK2A 1C4KA 4KGCC 1P3AD 1P3GD 1ASLA 3LJAB 3E77A 4ZUXA 1TPLA 3AN2C 4WYAA 5GSUC 3N75A 4E45A 3REIC 3F6TA 2HUFA 3GJUA 2HUEB 3VH5T 4N0WA 3AZLC 3W96C 4ZDPA 3REKD 1M7YA 1P3LD 3A1IA 5GT3A 3PDBB 3K40A 2Z9UA 4EB5A 2V0YA 3AZMC 3MGQA 2CSTA 1BJNA 1EQBA 1P3OA 2X5FA 2Y2HA 5AV5C 4RIZA 3B6FB 1P3FD 3BWOA 4KUDC 3AV2B 5EAVA 1IX6A 1X28A 4WYGA 1HQ3C 1U35D 1F66D 2W7FA 3X1SA 4H9NA 3MGPB 4H9SC 2YCTA 2C7TA 2GQNA 3A6NC 1GBNA 1ARSA 5JRGC 1OHWA 1AJSB 3EPJA 3EIBA 5D5SA 3ELPA 1P34A 3NTJA 3R9AA 5JAYA 3D6KA 1KX5B 3QPGA 5K8BA 5BNXB 3NDNA 2VMVA 5B33C 1SZSA 5F8VA 4G92C 2VMTA 1DGDA 1MDOA 5GXQA 3LELC 3V9RA 3DYDA 2BI2A 2FM1A 1ORDA 3W98A 4A72A 1ID3A 3NNKA 4H9RA 5CPIB 2CINA 3DZZA 5GT0C 5G0AA 4ADCA 1AHFA 3AZFD 3C1BD 2OQXA 4Y0HA 2BYKA 4ITGA 1TOKA 1ULYA 1O61A 3WKJC 5B1MC 4J8VA 1N1JB 3LVLB 1QIRA 2W7GA 5AY8C 3MGRD 2NQBA 3WAAA 2DKBA 5AV6C 2F8ND 1P3WA 3AEJA 1AIBA 3AATA 4NE3A 3NQUB 5B0YC 3X1UD 2G5HC 3C1CC 4JJND 3FZ8A 4R8DA 5B32A 4Z5TB 1M18B 3QBOA 2JSSA 1KU5A 3B6FD 1AHGA 4IXSA 3AV2D 1VJOA 4BHDA 1D7UA 2ZJGA 4AO4A 1B5PA 3AZGC 1S32B 2BYMB 1IX7A 1ASFA 3MGPD 1WKGA 1P3IC 3AZJD 3HMUA 4A0FA 1TAFB 3N4SA 1GC3A 1YJZA 2Z9XA 2NZDA 4A6UA 3AN2B 3MGSC 2CJDA 4AH3A 5KDMB 4J8LA 4X23C 3A1KA 5GSUB 4P3MA 2VLHA 3REIB 3DXWA 3B0CT 3UTAC 1M0PA 5FT4A 1OHVA 5G4JA 4WU9D 1LC8A 3AZLB 1OATA 3MADA 4F5HA 5G49B 1KX5D 1JS6A 1GCKA 3VH6W 3AZMB 1S07A 2Z1ZA 2X3LA 5TF5A 4ZM3A 4ADDA 3A9ZA 3W97C 4ZAHA 2E7UA 3TU4C 1M19A 2W7KA 3EPKA 4O6ZA 4LD9B 2HOYA 3R45B 4J8XA 3MNNB 1WYVB 4A0HA 3EPLA 5EAAA 2AY8A 5CPID 4WZSB 5CP6A 1EQZB 4GSAA 1JF9A 2CH2A 5JRGB 1D2FA 5AV8B 4H9QA 2EZ2A 3FCRA 3A9XA 4WXBA 4IXZA 1S09A 3O62C 3X1TA 1YIZA 2AROC 3AZEA 2W7DA 2G5IC 4RAEA 1KX4C 1GC0A 1KL2A 1WKHA 2D5YA 3KGXA 3UTBA 1CJ0A 2O1BA 1ELQA 4YM6D 4G92B 1AOIA 4EO5C 2CV5B 2Z9WA 1SZKA 1SZUA 3X1SB 4IW7A 1KKPA 3OP7A 4Z5TD 4J8UA 3MKJA 4H9PB 3FZ7A 3MVDB 4XZQC 1CQ7A 2BYJA 3E2YA 5DNMC 5F99B 2CANA 4ZSYA 1P3LC 2WK8A 1P3PC 1PMMA 1P3KB 1BKGA 1LC5A 3BWNC 3WKSA 1S32D 1FG7A 1MGVA 3WKJB 4UUZB 2VMQA 5B1MB 4J8WB 2RFVA 1QITA 5M46A 1P3FC 3X1VB 3AN2D 4E44A 1ZOBA 3WTPB 4H9OB 1U35C 5GSUD 1F66C 1BJ4A 1CS1A 3REID 5AV6B 2Y2NA 3A9YA 4CVQA 3ZRRA 1LK9A 1YJSA 4A6TA 3TQXA 4WXFA 3UT9A 2VMSA 3AZLD 2EPJA 1KX3A 3RELA 2YCPA 5B0YB 3BB8A 4YS3B 5AVBC 3C1CB 3FVUA 3AZMD 2AY5A 2JISA 1MAQA 5B31G 3NRAA 1X0MA 5AV5D 2JE5A 1QZ9A 4LD9D 1HQ3D 3MNND 3AZHC 1AAMA 3EIAA 4XK1A 3JTXA 1ZLAC 2EO5A 2W7EA 3A6ND 1EQZD 4GDYA 3QN6A 3DR4A 3AZIA 2PO3A 3VH5W 4X23B 5JRGD 2BHXA 3WGBA 5AV9A 1ECXA 5AV8D 3MGRA 5CPJB 1YIYA 4LNLA 3MAFA 1CL2A 4K2MA 1Q9CA 2F8NA 5AVCC 1P3BB 2PYOB 3L8AA 3K7YA 1GDEA 1ZODA 3IHJA 3X1UA 1WYUB 1B4XA 2BKWA 1BH8B 3LZ0C 3MAUA 4JJNA 3W97B 4JEWA 3LJAC 3LELD 3TU4B 4RJ0A 1CQ8A 4GEBA 3DRDA 1W7MA 2CV5D 2AEUA 5G2QA 4NE6A 2HUEC 2Z61A 3MVDD 4EMYA 4U2HA 1TOIA 3B6GC 2QB2A 4LC3A 5F99D 5CPKA 3HQTA 4WBTA 1P3KD 5E5IA 2VMPA 5DNNC 3WKJD 2AEVA 4KAMA 5B1MD 2DR1A 4J8WD 3O62B 3X1VD 5B40B 3AV2C 2AROB 1BW0A 2VMUA 4MQQA 4WU9A 5B2JB 3WTPD 2CJHA 4WU8C 3RCHA 5AV6D 3Q8NA 2JGTA 3PPLA 3MGPC 2BWOA 3EI8A 1ELUA 4J8XB 4FFCA 5B0YD 4EO5B 3AZNA 3C1CD 1BJOA 4HGAB 2FJ7C 2E7JA 2FN6A 4WNNB 3WZFA 1QGNA 4XZQB 4CXRA 2F8NH 1WSTA 3USFA 5CP6B 2DGKA 5DNMB 1JG8A 1P3PB 1KX5C 1C7OA 1V72A 5B0ZC 2AY7A 1B67A 3VOMA 4CAYB 4GE4A 2ZSLA 4KHAB 3P6KA 4MY5A 4WLJA 4ZDOA 3AZEB 2VGUA 2Z20A 5DB5A 3MGSD 3KXBA 4X23D 5CPJD 3KUYC 3GZDC 2W7JA 3G7QA 5CPIC 1WWSA 3RQ1A 3REJC 4CSRB 1P3BD 1D7SA 2JG2A 2VMZA 2PYOD 3EZ1A 2E54A 4J8UB 3DC1A 1UKJA 2W8VA 3W97D 3TU4D 4K05A 3W1JA 4JEZA 1I29A 2Y2OA 2R5CB 3VK4A 4AO9A 3REHB 1YNUA 3RBFA 4JF1A 2Y2GA 4WYFA 1ZLAB 4KGCA 5B32G 4F5GA 1M1AA 4R5FA 5FUGB 2HUIA 2F2AC 4Z5TC 3AYWB 1M18C 3O62D 5B40D 4H63Q 4BA4A 2AROD 4JEYA 5AVCB 4M2JA 5E5AC 5EQCA 3RUYA 3EI7A 5B2JD 1RVUA 3W96A 1S32C 5JA4B 5B24B 4F5LA 2CY8A 3TCMA 4WLHA 4XEWA 3CBFA 5B31C 3LZ0B 3W99B 1SVVA 3W1HA 2QMAA 4Z66A 1E5EA 4BMKA 2OGAA 4KUDA 1I41A 3NX3A 1HQ3A 4XZQD 1H3OA 3KSYA 3B6GB 5DNMD 1P3PD 4H9SA 3E2ZA 4QLCB 5DNNB 5EIGA 3KKIA 4OMAA 5E3KA 1MDZA 1TZYA 1PG8A 4LD9C 3FDDA 5M4BA 1GC4A 3MNNC 4WU8B 3TFUA 4R8PA 1XEYA 3WX9A 5B33A 3PGYA 1M32A 1EQZC 3H0RC 2VGWA 5B2IB 4OC9A 2DOUA 3NQJB 3I4JA 3AV7A 5AVBD 3LELA 4OBUA 5AV8C 2FJ7B 2ZY3A 3FFHA 4E3RA 5G09A 4WYCA 2CB1A 3EUCA 3AZHD 3LZ1B 5B0ZB 5GT0A 3REHD 4QGRA 3I16A 2L5AA 1IBJA 3AFAB 2HIOB 3HVYA 5F9SA 2AY6A 1UU1A 1ZLAD 3N4XA 3AV1B 2CV5C 4AWLB 1JFIA 1UU2A 4JF0A 3TFTA 2ZSMA 3X1SC 4RJYA 2W8SA 5AY8A 3LY1A 3KUYB 3AYWD 3MVDC 2D61A 4KXKA 3GWPA 2YFVB 4Q31A 3DXVA 5F99C 3AZNB 3F9TA 5AVCD 3REJB 1P3KC 3UAKA 5B24D 1DFOA 3AENB 1P34C 1LS3A 1W2EA 1MDXA 3LZ0D 4J8WC 3W99D 3LJAD 3X1VC 1N8PA 3WTPC 1LW5A 1E5FA 4IYOB 4WB0A 4AOAA 5DJ9A 3AZGA 1BS0A 1SF2A 1W7NA 3B6GD 2YOBA 4IXOA 2VMWA 2F8NK 1P3IA 1TOEA 4YS3C 3W98C 5DNND 4FL0A 4W1XA 3AZKA 1BQDA 4Q6RA 2A1VA 3WA9B 5G2PA 3R4TA 2YFWA 1WYTA 3FQ8A 3UTAA 3BV0A 5E5AB 1AX4A 4WU8D 2R5EA 2VI9A 2W7HA 5B31B 4OCAA 4DRBA 3VAXA 1TOGA 1IVRA 4XUJB 3B46A 2NQBC 4BA5A 5B2ID 3AEJC 3PA9A 1M0QA 4M2KA 2FJ7D 5CPJC 1H1CA 4MSOA 2F8NG 1M4NA 5BO0B 3ELEA 3A2BA 1ASDA 2J8PA 3ASBA 4GRXA 1P3BC 1M1AB 2VGVA 4JEXA 5B32C 2PYOC 2AY9A 5B0ZD 2DKJA 1ASCA 1EJIA 5B1LB 1PFFA 3AFAD 2HIOD 2VI8A 3IP4C 1P3MA 4UHOA 1PZRA 5BJ3A 2CWEA 1ASMA 3KUYD 3FTBA 1KX4A 4ZUXB 2NZDC 3KWQA 1DJEA 3W1IA 4OTLA 1P3AA 3REJD 3LVJA 1P3GA 4M2MA 1J32A 4UOYA 4GE9A 4LW4A 5BNVA 1AIAA 1I48A 2G7JA 2ORDA 1GEWA 3QI6A 5GT3B 5B40C 3BCXA 2WB6A 2F8JA 5B2JC 3MEBA 3MGQB 3REKA 3WLXA 1P3LA 1P3OB 1M19C 1Z3ZA 1RV3A 4J8XC 4F5JA 4H51A 1CQ6A 1P3FA 4H9NB 3ZRQA 4HGAC 1AHXA 3GSBA 1M18D 3WA9D 1U35A 1F66A 5CP6C 4W5KA 4WYEA 2QA3A 4XAUA 5E5AD 2GMUA 2D64A 1AKCA 1BH9A 1YAAA 1S0AA 1P34B 1B5OA 3ZZKA 5B31D 3N5MA 4XJOA 2VIAA 3AZEC 4XUJD 1LKCA 5EFSA 1Z7DA 3UTBC 2JJEA 3PD6A 5EUNA 5HDMA 5GXQB 1AJRA 3JWAA 3GR9A 3II0A 3V9RB 1AOIC 4MQRA 1V2EA 4RKDA 3W98B 2W7IA 4J8UC 4HVKA 1ID3B 4H9RB 4PIWA 5FT6A 1IAYA 5B1LD 2VYCA 3K28A 2BYKB 4ITXA 2BIEA 1EG5A 1QISA 4E1OA 4R2NA 3REHC 4J8VB 3AZFA 3C1BA 4ZUXD 5J8QA 1B8GA 2NQBB 3HT4A 3WAAB 2RIQA 3RI6A 4U1TA 4J5UA 1T3IA 3AEOA 3WY7A 2VGSA 3UT9C 3AYWC 1ASBA 1W23A 1G7WA 3H0MC 3B0DC 2D7ZA 2BI5A 3MBBA 2W8WA 3MC6C 3PDXA 4B9BA 1CZEA 2C81A 2XH1A 4PFFA 3FRKA 5B32B 4Z2MH 3MGQD 3E6GA 2BI1A 4F5IA 2Y2IA 5B24C 3HL2A 1AAWA 3AEMC 3G0TA 5M49A 3PDBA 3W99C 2X5DA 3WGCA 2HOZA 4W8IA 3B6FA 1TATA 3X1SD 3AV2A 2VLFA 2EYQA 2Z9VA 2DGMA 2NZDB 4ZDLA 2IO5B 3AZIC 2RVQC 3MGPA 5D95A 4CBSA 3AZJA 4QLCC 2R2NA 3PJ0A 5DX5A 1QJ3A 4WXGA 1P34D 3NUBA 1B9HA 1J04A 1AJSA 2VIBA 3FSLA 3FVSA 1KMJA 2WK7A 5BT1C 1KX5A 2Y2LA 2YHKA 2QSRA 4GE7A 1M19B 3EI5A 5BNXA 4UQVA 1ARGA 2AATA 3F0HA 4MKJA 4YS3D 5B2IC 2E7IA 3W98D 3CQ4A 1ID3D 1W7LA 1M0NA 4G91B 5CPKC 2VQRA 4Q76A 2ZM5A 5CPIA 4H9QB 3LZ1C 3AL0C 2DQNC 4J8VD 3X1TB 3AFAC 4M6BA 2HIOC 2NQBD 3WAAD 5BS7A 3AV1C 1N1JA 3UTBB 4AWLC 1YOOA 2AY4A 2G6WA 2W8JA 3JW9A 2UWXA 4MKKA 1KL1A 4F5KA 4ZWMA 1RV4A 1AOIB 3AZNC 4YM6A 3JWBA 3LG0A 5B32D 2VGZA 1A7WA 3NQUA 1DGEA 4A6RA 1T3UA 4Z5TA 3A8UX 1BH9B 1TARA 3DR7A 4ZSWA 2YKUA 4KYOA 1KKJA 4A00A 1ZC9A 2NZDD 5G4IA 1S32A 3LVKA 2BYMA 3PIUA 3KXBC 3BCAA 8AATA 1MLYA 4R5ZA 1TAFA 1V2FA 3HBXA 3AN2A 1OHYA 3UT9B 4DGTA 4ATPA 2OKKA 3WA9C 5KDMA 3B0DB 5IWQA 1KX3B 5GSUA 3RELB 3REIA 3NUIA 2YKXA 4A0RA 1BQAA 1OXOA 3KGWA 3AZLA 2OGEA 5EUEA 5G49A 1DJ9A 4WD2A 2VMYA 1AY4A 1I43A 1M19D 3EI9A 4E77A 4XUJC 3AZMA 1ASAA 3FFRA 1M0OA 3B1EA 4J8XD 3CQ6A 3COGA 5AV5A 2OKJA 4LD9A 3R45A 2O7CA 2C44A 3MNNA 1WYVA 3FQAA 3GETA 5CP6D 2PB0A 1G7XA 3AZIB 3E9KA 1M1AC 1HTAA 5AV9B 1X29A 3MGRB 3VP6A 2WKAA 1O4SA 3MAFB 3BN1A 1X2AA 3KFUG 3A6NA 1EQZA 2F8NB 4RKCA 1RVYA 3X1TD 5JRGA 5B1LC 3AZED 5AV8A 5C6UA 3GZCA 2D65A 4OYTA 3UTBD 3X1UB 2YRRA 4CXQA 3ZZJA 4JJNB 1KMKA 4ZUXC 2VGTA 1BFMA 4DRAA 5FT5A 4Z66C 1AOID 3ATHA 4E3QA 1LW4A 2W7MA 4I8AA 2LY8A 3EI6A 3VK3A 1OXPA 4J8UD 1AMRA 2YKYA 4OT8A 2CV5A 3N7NA 5CPKB 2HP2A 2ZP7A 5GT3C 3AZJB 4H9PA 3MVDA 1WWIA 2VMRA 3MGQC 4MQPA 3WCOA 5F99A 3B0BA 1P3OC 1P3KA 3N4RA 1TZYC 2Y2PA 4ADBA 4DBCA 4WU9B 3WKJA 4UUZA 2VMXA 5B1MA 1IX8A 3RCHB 1D7RA 4LNJA 4J8WA 1AHYA 3X1VA 4OBVA 5E4ZA 3AOVA 3UT9D 4R8PC 3WTPA 4H9OA 2OATA 3AEPA 1KX3D 3RELD 4L0OA 5AV6A 3WTPE 2BIAA 4W1VA 3G8MA 2BIGA 4Z2MG 1AMAA 1BJOB 3NU8A 4ZLVA 2BWPA 1R4VA 5B0YA 4YS3A 3C1CA 5I92A 1XI9A 4NE5A 2Y2QA 4F4EA 4AZKA 2D63A 2CTZA 3NYSA 5GXQC 2EZ1A 4WV4B 1ASGA 3KXBB 3KE3A 3AZID 1F1EA 2RVQD 5AV9D 1DTYA 4QLCD 4RITA 5AX8A 1ID3C 3MGSA 3BCBA 4X23A 4YM6B 1VEFA 1GEYA 2Q7WA 5CPJA 1IJIA 1SPAA 5BT1D 1N31A 4J8VC 1P3BA 3VH6A 4XJPA 2ZY5A 2ZYJA 2PYOA 3GBXA 2D66A 3WAAC 3FZ6A 4ZBJC 1WYUA 1BH8A 3QM2A 2HUUA 1V2DA 1AY5A 3W97A 3FDBA 3TU4A 2FYFA 1ARTA 5CPKD 1IAXA 4KGCB 1ASEA 4ATQA 3HLMA 1JS3A 2C0RA 3AZKC 3LZ1D 5DJ1A 4IY7A 2FNIA 4RM1A 2HP1A 1B9IA 4Y0DA 3W96B 2CFBA 2QBTA 3AV1D 3B1CA 2HOXA 3O62A 5HXXA 5B40A 2AROA 2GSAA 3M5UA 5B2JA 4UHMA 2Z1YA 3NYTA 2D7YA 2CH1A 2IO5C 4Z66B 3AZND 5AV5B 1AMQA 4NOGA 4B98A 4EU1A 4KUDB 4A0GA 1HQ3B 1H3OB 2ZY2A 1IUGA 3E2ZB 4WNNA 4XQ2A 2Y2MA 2V1PA 5EIGB 4XZQA 2W7LA 3ECDA 4LNMA 5DNMA 3A6NB 2JJGA 1P3PA 2BI3A 1TZYB 3BWNA 1P3MC 3EG5B 4RLGA 3KXBD 4CAYA 2ZY4A 4W91A 4WYDA 4KHAA 1QJ5A 3KWQC 4R8PB 3H7FA 2DGLA 4G91C 5B33B 2EGYA 1P3AC 1PMOA 2AY3A 4JEVA 1P3GC 1M6SA 3LELB 9AATA 3L44A 1FC4A 4CSRA 3X1TC 5AVBA 3FKDA 3BS8A 4K2BA 3ZRPA 1TOJA 1AMSA 4LW2A 3REKC 5GT0B 3AELA 3B8XA 2YCNA 1MLZA 1AICA 3I5TA 3UWCA 4TMRA 4BQ0A 3AZHA 4KGCD 2R5CA 4F5FA 3REHA 4PVFA 1Z2CB 1JFIB 2GMSA 1M1AD 3WCNA 4W1WA 2JJHA 3CQ5A 5AY8B 4WP0A 1ZLAA 1GD9A 3BC8A 3VH5A 5FUGA 3AYWA 3T32A 3W96D 2YKVA 7AATA 3DU4A 1DKAA 5AVCA 3MC6A 3LVMA 5FT8A 4ZWVA 2HORA 5JA4A 5B24A 4Z66D 5C3IC 4ZBJB 2BWNA 4ISYA 4Y0IA 3AEMA 4NFTA 4WB0B 3LZ0A 4KUDD 3TATA 3H0LC 3W99A 3LJAA 3NU7A 1CL1A 3AZGB 2HZPA 3JZLA 1KX3C 3RELC 1O69A 2FNUA 1P3IB 5GT3D 3CAIA 3LWSA 3AZKB 4EB7A 3B6GA 3MGSB 1Y4IA 1P3OD 3E2FA 2YFWB 1WYTB 3QHXA 1TZYD 4QLCA 3UTAB 2BYLA 5DNNA 1G4VA 4IX8A 1AHEA 3UE8A 4TN4A 3EPHA 4F5MA 1S08A 3ASAA 3AZFC 3C1BC 2AY2A 3ACZA 4R8PD 3P5JB 3AOWA 4HF8A 5B33D 1AY8A 2QB3A 4WU8A 1FG3A 4P7YA 2YRIA 1H0CA 2TPLA 4Q75A 5AV9C 2Y2KA 3MGRC 1SFFA 4ADEA 3FQ7A 1VP4A 3NYUA 5B2IA 3NQJA 1W3UA 2AY1A 2FJ7A 1ARIA 1C9CA 5GT0D 2XBNA 3X1UC 3LV2A 1D7VA 1C7GA 4JJNC 5GXQD 2CJGA 1P3MB 1MAPA 3LZ1A 5B0ZA 1YJYA 3VH6T 1C0NA 3B6FC 2QLRA 5KTBA 3AFAA 5AY8D 1CZCA 2HIOA 3PAAA 4DQ6A 3OKSA 1KX4B 3KWQB 2NMPA 3AV1A 3HDOA 1P3AB 1UU0A 3AZJC 3KUYA 1P3GB 3GZDA 3RBLA 4PFNA 2YFVA 1ARHA 2FKIA 5BNVB 2W8UA 2ZC0A 3REJA 1N2TA 3P1TA 1G4XA 3AENA 2JJFA 4WU9C 5HHYA 1C7NA 3REKB 1P3LB 3FVXA 3WKRA 1AKBA 2ZUKA 3AZGD 2WK9A 2XD5A 4IYOA 2R0TA 2JCHA 1P3ID 5EUDA 1BJWA 3ISLA 1P3FB 2X8UA 2EH6A 3AZKD 4CBRA 4AZJA 1LC7A 1U35B 1F66B 1GEXA 3UTAD 4ZASA 4K2IA 1AKAA 1M18A 3WA9A 3N0LA 4XJMA 5M4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX8 A;  1DJE A;  1YIY A;  4LNL A;  1D7R A;  3RCH B;  1DJU A;  1CL2 A;  3DOD A;  3MAF A;  4K2M A;  4LNJ A;  4OTL A;  1AHY A;  1GC2 A;  5BJ4 A;  3LVJ A;  1ASN A;  3AOV A;  5E4Z A;  4M2M A;  1TAS A;  2OAT A;  3AEP A;  4L0O A;  1J32 A;  4UOY A;  3PD6 B;  4GE9 A;  3B1D A;  4LW4 A;  1U08 A;  2BIA A;  4W1V A;  3G8M A;  3L8A A;  3K7Y A;  2BIG A;  3EZS A;  1GDE A;  1ZOD A;  1AIA A;  1I48 A;  2GB3 A;  2ORD A;  3IHJ A;  1BJO B;  1AMA A;  1GEW A;  1B4X A;  1WYU B;  2BKW A;  3BCX A;  3NU8 A;  3QI6 A;  4ZLV A;  2BWP A;  4XJL A;  2BI9 A;  3MAU A;  4JEW A;  2F8J A;  2VMN A;  3MEB A;  1CQ8 A;  2W8T A;  3WLX A;  4GEB A;  3DRD A;  4EFF A;  1W7M A;  5I92 A;  4ZM4 A;  5G2Q A;  2PB2 A;  1XI9 A;  4F4E A;  1Z3Z A;  2Z61 A;  1BT4 A;  1RV3 A;  4AZK A;  4EMY A;  3QGU A;  4U2H A;  2D63 A;  1TOI A;  2CTZ A;  4F5J A;  2QB2 A;  4H51 A;  4LC3 A;  1CQ6 A;  4WBT A;  3HQT A;  3NYS A;  3ZRQ A;  2EZ1 A;  1O62 A;  1AHX A;  5E5I A;  2FQ6 A;  2VMP A;  3GSB A;  1ASG A;  3KE3 A;  2O0R A;  4UHN A;  2VMO A;  1DTY A;  4W5K A;  1S06 A;  3VK2 A;  4KAM A;  4WYE A;  2DR1 A;  5AX8 A;  1C4K A;  2QA3 A;  4XAU A;  2GMU A;  2D64 A;  1AKC A;  3BCB A;  1BW0 A;  1YAA A;  2VMU A;  1S0A A;  4MQQ A;  1B5O A;  1ASL A;  1VEF A;  1GEY A;  3E77 A;  1TPL A;  3ZZK A;  2Q7W A;  3N5M A;  2CJH A;  4XJO A;  1IJI A;  3RCH A;  1SPA A;  3Q8N A;  4WYA A;  2VIA A;  1LKC A;  2JGT A;  3PPL A;  3N75 A;  1N31 A;  2BWO A;  3F6T A;  3EI8 A;  5EFS A;  1Z7D A;  2HUF A;  3GJU A;  2JJE A;  1ELU A;  4XJP A;  2ZY5 A;  2ZYJ A;  3PD6 A;  4N0W A;  4FFC A;  5EUN A;  3GBX A;  5HDM A;  4ZDP A;  1M7Y A;  2D66 A;  1BJO A;  1WYU A;  1AJR A;  2E7J A;  2FN6 A;  3GR9 A;  3JWA A;  3QM2 A;  2HUU A;  1V2D A;  3II0 A;  1AY5 A;  2Z9U A;  3K40 A;  3PDB B;  2V0Y A;  3WZF A;  4EB5 A;  1QGN A;  4CXR A;  3FDB A;  4MQR A;  1WST A;  2CST A;  3USF A;  1V2E A;  4RKD A;  1BJN A;  1EQB A;  2FYF A;  1JG8 A;  2X5F A;  2W7I A;  1C7O A;  4HVK A;  1ART A;  1IAX A;  1V72 A;  3BWO A;  1ASE A;  4ATQ A;  4PIW A;  2AY7 A;  3HLM A;  5FT6 A;  1IAY A;  1JS3 A;  5EAV A;  1IX6 A;  1X28 A;  4WYG A;  3VOM A;  2C0R A;  2VYC A;  4GE4 A;  3K28 A;  2ZSL A;  3P6K A;  4ITX A;  2BIE A;  4MY5 A;  2W7F A;  1EG5 A;  4WLJ A;  4ZDO A;  5DJ1 A;  2VGU A;  1QIS A;  4IY7 A;  4E1O A;  4R2N A;  2FNI A;  2Z20 A;  5DB5 A;  2HP1 A;  2YCT A;  2C7T A;  1B9I A;  4Y0D A;  2GQN A;  5J8Q A;  1GBN A;  1ARS A;  1B8G A;  2CFB A;  2QBT A;  3B1C A;  3GZD C;  2HOX A;  1OHW A;  2W7J A;  5HXX A;  3G7Q A;  1AJS B;  3RI6 A;  4U1T A;  3EIB A;  5D5S A;  4J5U A;  1T3I A;  2GSA A;  3AEO A;  3RQ1 A;  3ELP A;  3M5U A;  3NTJ A;  4UHM A;  1D7S A;  2JG2 A;  2Z1Y A;  3WY7 A;  3NYT A;  2D7Y A;  2VMZ A;  2VGS A;  3R9A A;  2CH1 A;  5JAY A;  1ASB A;  1W23 A;  3EZ1 A;  3D6K A;  2E54 A;  1G7W A;  3QPG A;  2D7Z A;  5K8B A;  1AMQ A;  4NOG A;  4B98 A;  2BI5 A;  3MBB A;  3DC1 A;  4EU1 A;  1UKJ A;  4A0G A;  2W8V A;  2W8W A;  3NDN A;  2VMV A;  3MC6 C;  3PDX A;  4B9B A;  1CZE A;  1SZS A;  2C81 A;  2XH1 A;  4PFF A;  3FRK A;  5F8V A;  3E6G A;  2BI1 A;  4JEZ A;  4F5I A;  3HL2 A;  1I29 A;  2VMT A;  1DGD A;  1MDO A;  1AAW A;  2ZY2 A;  3AEM C;  2R5C B;  1IUG A;  3E2Z B;  3VK4 A;  4XQ2 A;  5M49 A;  3PDB A;  4AO9 A;  2V1P A;  1YNU A;  3DYD A;  5EIG B;  2X5D A;  2W7L A;  3RBF A;  3WGC A;  2BI2 A;  2FM1 A;  2HOZ A;  1ORD A;  3ECD A;  4LNM A;  4W8I A;  4JF1 A;  2JJG A;  4A72 A;  4WYF A;  2BI3 A;  1TAT A;  3NNK A;  3BWN A;  2CIN A;  2VLF A;  3DZZ A;  4F5G A;  2Z9V A;  4R5F A;  5G0A A;  4ADC A;  4W91 A;  2ZY4 A;  4WYD A;  1AHF A;  2OQX A;  2HUI A;  4Y0H A;  4ITG A;  4ZDL A;  1QJ5 A;  1TOK A;  5D95 A;  4CBS A;  1O61 A;  2R2N A;  3H7F A;  3PJ0 A;  4BA4 A;  4JEY A;  4M2J A;  5DX5 A;  1QJ3 A;  3LVL B;  4WXG A;  5EQC A;  2EGY A;  1QIR A;  3EI7 A;  3RUY A;  3NUB A;  2W7G A;  1RVU A;  2AY3 A;  4JEV A;  1B9H A;  4F5L A;  1J04 A;  1M6S A;  2CY8 A;  3TCM A;  2DKB A;  4WLH A;  4XEW A;  3CBF A;  1AJS A;  9AAT A;  2VIB A;  3L44 A;  3FSL A;  1FC4 A;  1P3W A;  3FVS A;  3AEJ A;  1KMJ A;  1SVV A;  2WK7 A;  2QMA A;  1E5E A;  3FKD A;  4BMK A;  1AIB A;  3AAT A;  2YHK A;  3BS8 A;  2OGA A;  4GE7 A;  4K2B A;  3ZRP A;  1TOJ A;  1AMS A;  3EI5 A;  4LW2 A;  4UQV A;  3AEL A;  3B8X A;  1I41 A;  3NX3 A;  1ARG A;  4R8D A;  2YCN A;  2AAT A;  3F0H A;  4MKJ A;  2E7I A;  3QBO A;  1MLZ A;  3CQ4 A;  1AIC A;  3I5T A;  3UWC A;  4TMR A;  1AHG A;  4BQ0 A;  4IXS A;  2R5C A;  3E2Z A;  1W7L A;  4F5F A;  1M0N A;  4PVF A;  1VJO A;  5EIG A;  1D7U A;  2ZJG A;  3KKI A;  2GMS A;  4BHD A;  4W1W A;  4Q76 A;  2JJH A;  1B5P A;  3CQ5 A;  4AO4 A;  4WP0 A;  4OMA A;  5E3K A;  1IX7 A;  1MDZ A;  1ASF A;  1GD9 A;  1WKG A;  3HMU A;  3BC8 A;  1PG8 A;  4A0F A;  3FDD A;  5M4B A;  1GC4 A;  1GC3 A;  1YJZ A;  2Z9X A;  4A6U A;  3T32 A;  3TFU A;  2CJD A;  4AH3 A;  2YKV A;  7AAT A;  3DU4 A;  4P3M A;  2VLH A;  1DKA A;  3DXW A;  3WX9 A;  1M0P A;  5FT4 A;  1OHV A;  3MC6 A;  5G4J A;  3LVM A;  5FT8 A;  1YOO A;  1M32 A;  1LC8 A;  3PGY A;  4ZWV A;  1OAT A;  2AY4 A;  2HOR A;  2G6W A;  2VGW A;  2W8J A;  3MAD A;  2DOU A;  4OC9 A;  3I4J A;  3AV7 A;  4F5H A;  4Y0I A;  2BWN A;  4ISY A;  1JS6 A;  3JW9 A;  1GCK A;  4MKK A;  3AEM A;  1KL1 A;  4F5K A;  4ZWM A;  2ZY3 A;  4WB0 B;  1RV4 A;  3FFH A;  4E3R A;  3TAT A;  1S07 A;  2Z1Z A;  3JWB A;  3LG0 A;  5TF5 A;  3NU7 A;  4ZM3 A;  5G09 A;  4ADD A;  1CL1 A;  3A9Z A;  4WYC A;  2CB1 A;  2HZP A;  2VGZ A;  3EUC A;  1O69 A;  4ZAH A;  2E7U A;  1DGE A;  2FNU A;  2W7K A;  4O6Z A;  4A6R A;  3CAI A;  2HOY A;  4QGR A;  3LWS A;  1WYV B;  4A0H A;  4EB7 A;  1IBJ A;  1Y4I A;  3A8U X;  1TAR A;  5EAA A;  3DR7 A;  5F9S A;  4ZSW A;  3E2F A;  2AY6 A;  1UU1 A;  2YKU A;  3QHX A;  1WYT B;  2AY8 A;  2BYL A;  4KYO A;  1G4V A;  4IX8 A;  1AHE A;  1KKJ A;  4A00 A;  3UE8 A;  1UU2 A;  4JF0 A;  3TFT A;  2ZSM A;  4TN4 A;  4RJY A;  1ZC9 A;  5G4I A;  3LY1 A;  3LVK A;  3PIU A;  4GSA A;  4F5M A;  1JF9 A;  2CH2 A;  1S08 A;  2D61 A;  3ASA A;  1D2F A;  4KXK A;  3BCA A;  4Q31 A;  8AAT A;  2AY2 A;  2EZ2 A;  3ACZ A;  3FCR A;  1MLY A;  3DXV A;  4R5Z A;  3AOW A;  1V2F A;  3F9T A;  3A9X A;  4WXB A;  4HF8 A;  4IXZ A;  1S09 A;  1AY8 A;  2QB3 A;  1OHY A;  3UAK A;  1FG3 A;  4P7Y A;  4DGT A;  1YIZ A;  4ATP A;  2YRI A;  1H0C A;  2W7D A;  4RAE A;  2TPL A;  1DFO A;  3AEN B;  4Q75 A;  5IWQ A;  1GC0 A;  1KL2 A;  1WKH A;  2D5Y A;  3KGX A;  3NUI A;  1LS3 A;  1SFF A;  2YKX A;  4A0R A;  1CJ0 A;  1MDX A;  2O1B A;  1ELQ A;  4ADE A;  3FQ7 A;  1BQA A;  1VP4 A;  1OXO A;  3KGW A;  3NYU A;  1N8P A;  1W3U A;  2OGE A;  5EUE A;  2AY1 A;  1DJ9 A;  4WD2 A;  2VMY A;  1AY4 A;  1I43 A;  1ARI A;  1E5F A;  1LW5 A;  4IYO B;  4WB0 A;  3EI9 A;  1C9C A;  4E77 A;  2Z9W A;  4AOA A;  1ASA A;  1SZK A;  2XBN A;  1SZU A;  1M0O A;  3FFR A;  5DJ9 A;  3B1E A;  4IW7 A;  1KKP A;  3CQ6 A;  3COG A;  1BS0 A;  3LV2 A;  1D7V A;  1SF2 A;  1W7N A;  3OP7 A;  2YOB A;  3MKJ A;  1C7G A;  4IXO A;  1CQ7 A;  2CJG A;  2VMW A;  1MAP A;  2BYJ A;  1TOE A;  1YJY A;  3E2Y A;  2CAN A;  4ZSY A;  2WK8 A;  4FL0 A;  1C0N A;  4W1X A;  2O7C A;  2C44 A;  1BQD A;  1WYV A;  2QLR A;  3FQA A;  3GET A;  4Q6R A;  1BKG A;  2PB0 A;  1LC5 A;  3BWN C;  1G7X A;  1CZC A;  3WKS A;  3PAA A;  4DQ6 A;  3OKS A;  3E9K A;  5G2P A;  1FG7 A;  3R4T A;  1MGV A;  1X29 A;  1WYT A;  3FQ8 A;  2VMQ A;  2NMP A;  2WKA A;  1O4S A;  3BV0 A;  3MAF B;  3BN1 A;  5M46 A;  2RFV A;  1QIT A;  1AX4 A;  3HDO A;  1X2A A;  1UU0 A;  4RKC A;  1RVY A;  1ZOB A;  2R5E A;  3GZD A;  3RBL A;  2VI9 A;  2W7H A;  4PFN A;  4OCA A;  3VAX A;  1BJ4 A;  1CS1 A;  5C6U A;  3GZC A;  1ARH A;  1TOG A;  1IVR A;  2D65 A;  3A9Y A;  3B46 A;  4OYT A;  4CVQ A;  3ZRR A;  2W8U A;  1LK9 A;  2ZC0 A;  1N2T A;  1YJS A;  3P1T A;  4A6T A;  3TQX A;  4WXF A;  2YRR A;  2VMS A;  4BA5 A;  1G4X A;  2EPJ A;  4CXQ A;  3AEN A;  3AEJ C;  3ZZJ A;  1KMK A;  2JJF A;  1M0Q A;  3PA9 A;  2YCP A;  5HHY A;  4M2K A;  3BB8 A;  2VGT A;  1C7N A;  5FT5 A;  1H1C A;  4MSO A;  4E3Q A;  3ATH A;  3FVU A;  3FVX A;  1LW4 A;  2AY5 A;  1M4N A;  2W7M A;  3ELE A;  1MAQ A;  3A2B A;  3WKR A;  1AKB A;  1ASD A;  3NRA A;  4I8A A;  2ZUK A;  3ASB A;  3EI6 A;  1X0M A;  3VK3 A;  2WK9 A;  1OXP A;  4GRX A;  1AMR A;  2VGV A;  4IYO A;  4JEX A;  2R0T A;  2YKY A;  2AY9 A;  4OT8 A;  1QZ9 A;  5EUD A;  1BJW A;  2DKJ A;  2HP2 A;  3ISL A;  2X8U A;  2EH6 A;  4CBR A;  2ZP7 A;  1ASC A;  1EJI A;  1AAM A;  4AZJ A;  1PFF A;  1LC7 A;  2VI8 A;  2VMR A;  4UHO A;  1GEX A;  3EIA A;  4MQP A;  4XK1 A;  3JTX A;  4ZAS A;  4K2I A;  5BJ3 A;  2EO5 A;  2W7E A;  1ASM A;  1AKA A;  4GDY A;  3N0L A;  3DR4 A;  3QN6 A;  4XJM A;  2PO3 A;  3FTB A;  4ADB A;  2BHX A;  3WGB A;  4DBC A;  5M4D A;  1ECX A;  2VMX A; 
#chains in the Genus database with same CATH topology
 1DJU A;  3DOD A;  5AVB B;  5E5A A;  1GC2 A;  1B6W A;  5BJ4 A;  2KFP A;  4WJ3 C;  5BS7 C;  4UPK A;  1ASN A;  5C3I B;  2DF4 C;  5B31 A;  1TAS A;  3PD6 B;  3B1D A;  1U08 A;  3H9X A;  4XUJ A;  3EZS A;  2FFF B;  2GB3 A;  3AZH B;  4XJL A;  2BI9 A;  4YM6 C;  2VMN A;  3FD0 A;  2W8T A;  5CHL B;  4EFF A;  4DQY B;  3B0C W;  4ZM4 A;  5BO0 A;  2XD1 A;  2PB2 A;  1BT4 A;  3QGU A;  1P3M D;  1O62 A;  2FQ6 A;  2BG1 A;  5B1L A;  3AZF B;  3C1B B;  2O0R A;  2VMO A;  4UHN A;  1KX4 D;  2Y2J A;  3KWQ D;  1S06 A;  3VK2 A;  1C4K A;  4KGC C;  1P3A D;  1P3G D;  1ASL A;  3LJA B;  3E77 A;  4ZUX A;  1TPL A;  3AN2 C;  4WYA A;  5GSU C;  3N75 A;  4E45 A;  3REI C;  3F6T A;  2HUF A;  3GJU A;  2HUE B;  3VH5 T;  4N0W A;  3AZL C;  3W96 C;  4ZDP A;  3REK D;  1M7Y A;  1P3L D;  3A1I A;  5GT3 A;  3PDB B;  3K40 A;  2Z9U A;  4EB5 A;  2V0Y A;  3AZM C;  3MGQ A;  2CST A;  1BJN A;  1EQB A;  1P3O A;  2X5F A;  2Y2H A;  5AV5 C;  4RIZ A;  3B6F B;  1P3F D;  3BWO A;  4KUD C;  3AV2 B;  5EAV A;  1IX6 A;  1X28 A;  4WYG A;  1HQ3 C;  1U35 D;  1F66 D;  2W7F A;  3X1S A;  4H9N A;  3MGP B;  4H9S C;  2YCT A;  2C7T A;  2GQN A;  3A6N C;  1GBN A;  1ARS A;  5JRG C;  1OHW A;  1AJS B;  3EPJ A;  3EIB A;  5D5S A;  3ELP A;  1P34 A;  3NTJ A;  3R9A A;  5JAY A;  3D6K A;  1KX5 B;  3QPG A;  5K8B A;  5BNX B;  3NDN A;  2VMV A;  5B33 C;  1SZS A;  5F8V A;  4G92 C;  2VMT A;  1DGD A;  1MDO A;  5GXQ A;  3LEL C;  3V9R A;  3DYD A;  2BI2 A;  2FM1 A;  1ORD A;  3W98 A;  4A72 A;  1ID3 A;  3NNK A;  4H9R A;  5CPI B;  2CIN A;  3DZZ A;  5GT0 C;  5G0A A;  4ADC A;  1AHF A;  3AZF D;  3C1B D;  2OQX A;  4Y0H A;  2BYK A;  4ITG A;  1TOK A;  1ULY A;  1O61 A;  3WKJ C;  5B1M C;  4J8V A;  1N1J B;  3LVL B;  1QIR A;  2W7G A;  5AY8 C;  3MGR D;  2NQB A;  3WAA A;  2DKB A;  5AV6 C;  2F8N D;  1P3W A;  3AEJ A;  1AIB A;  3AAT A;  4NE3 A;  3NQU B;  5B0Y C;  3X1U D;  2G5H C;  3C1C C;  4JJN D;  3FZ8 A;  4R8D A;  5B32 A;  4Z5T B;  1M18 B;  3QBO A;  2JSS A;  1KU5 A;  3B6F D;  1AHG A;  4IXS A;  3AV2 D;  1VJO A;  4BHD A;  1D7U A;  2ZJG A;  4AO4 A;  1B5P A;  3AZG C;  1S32 B;  2BYM B;  1IX7 A;  1ASF A;  3MGP D;  1WKG A;  1P3I C;  3AZJ D;  3HMU A;  4A0F A;  1TAF B;  3N4S A;  1GC3 A;  1YJZ A;  2Z9X A;  2NZD A;  4A6U A;  3AN2 B;  3MGS C;  2CJD A;  4AH3 A;  5KDM B;  4J8L A;  4X23 C;  3A1K A;  5GSU B;  4P3M A;  2VLH A;  3REI B;  3DXW A;  3B0C T;  3UTA C;  1M0P A;  5FT4 A;  1OHV A;  5G4J A;  4WU9 D;  1LC8 A;  3AZL B;  1OAT A;  3MAD A;  4F5H A;  5G49 B;  1KX5 D;  1JS6 A;  1GCK A;  3VH6 W;  3AZM B;  1S07 A;  2Z1Z A;  2X3L A;  5TF5 A;  4ZM3 A;  4ADD A;  3A9Z A;  3W97 C;  4ZAH A;  2E7U A;  3TU4 C;  1M19 A;  2W7K A;  3EPK A;  4O6Z A;  4LD9 B;  2HOY A;  3R45 B;  4J8X A;  3MNN B;  1WYV B;  4A0H A;  3EPL A;  5EAA A;  2AY8 A;  5CPI D;  4WZS B;  5CP6 A;  1EQZ B;  4GSA A;  1JF9 A;  2CH2 A;  5JRG B;  1D2F A;  5AV8 B;  4H9Q A;  2EZ2 A;  3FCR A;  3A9X A;  4WXB A;  4IXZ A;  1S09 A;  3O62 C;  3X1T A;  1YIZ A;  2ARO C;  3AZE A;  2W7D A;  2G5I C;  4RAE A;  1KX4 C;  1GC0 A;  1KL2 A;  1WKH A;  2D5Y A;  3KGX A;  3UTB A;  1CJ0 A;  2O1B A;  1ELQ A;  4YM6 D;  4G92 B;  1AOI A;  4EO5 C;  2CV5 B;  2Z9W A;  1SZK A;  1SZU A;  3X1S B;  4IW7 A;  1KKP A;  3OP7 A;  4Z5T D;  4J8U A;  3MKJ A;  4H9P B;  3FZ7 A;  3MVD B;  4XZQ C;  1CQ7 A;  2BYJ A;  3E2Y A;  5DNM C;  5F99 B;  2CAN A;  4ZSY A;  1P3L C;  2WK8 A;  1P3P C;  1PMM A;  1P3K B;  1BKG A;  1LC5 A;  3BWN C;  3WKS A;  1S32 D;  1FG7 A;  1MGV A;  3WKJ B;  4UUZ B;  2VMQ A;  5B1M B;  4J8W B;  2RFV A;  1QIT A;  5M46 A;  1P3F C;  3X1V B;  3AN2 D;  4E44 A;  1ZOB A;  3WTP B;  4H9O B;  1U35 C;  5GSU D;  1F66 C;  1BJ4 A;  1CS1 A;  3REI D;  5AV6 B;  2Y2N A;  3A9Y A;  4CVQ A;  3ZRR A;  1LK9 A;  1YJS A;  4A6T A;  3TQX A;  4WXF A;  3UT9 A;  2VMS A;  3AZL D;  2EPJ A;  1KX3 A;  3REL A;  2YCP A;  5B0Y B;  3BB8 A;  4YS3 B;  5AVB C;  3C1C B;  3FVU A;  3AZM D;  2AY5 A;  2JIS A;  1MAQ A;  5B31 G;  3NRA A;  1X0M A;  5AV5 D;  2JE5 A;  1QZ9 A;  4LD9 D;  1HQ3 D;  3MNN D;  3AZH C;  1AAM A;  3EIA A;  4XK1 A;  3JTX A;  1ZLA C;  2EO5 A;  2W7E A;  3A6N D;  1EQZ D;  4GDY A;  3QN6 A;  3DR4 A;  3AZI A;  2PO3 A;  3VH5 W;  4X23 B;  5JRG D;  2BHX A;  3WGB A;  5AV9 A;  1ECX A;  5AV8 D;  3MGR A;  5CPJ B;  1YIY A;  4LNL A;  3MAF A;  1CL2 A;  4K2M A;  1Q9C A;  2F8N A;  5AVC C;  1P3B B;  2PYO B;  3L8A A;  3K7Y A;  1GDE A;  1ZOD A;  3IHJ A;  3X1U A;  1WYU B;  1B4X A;  2BKW A;  1BH8 B;  3LZ0 C;  3MAU A;  4JJN A;  3W97 B;  4JEW A;  3LJA C;  3LEL D;  3TU4 B;  4RJ0 A;  1CQ8 A;  4GEB A;  3DRD A;  1W7M A;  2CV5 D;  2AEU A;  5G2Q A;  4NE6 A;  2HUE C;  2Z61 A;  3MVD D;  4EMY A;  4U2H A;  1TOI A;  3B6G C;  2QB2 A;  4LC3 A;  5F99 D;  5CPK A;  3HQT A;  4WBT A;  1P3K D;  5E5I A;  2VMP A;  5DNN C;  3WKJ D;  2AEV A;  4KAM A;  5B1M D;  2DR1 A;  4J8W D;  3O62 B;  3X1V D;  5B40 B;  3AV2 C;  2ARO B;  1BW0 A;  2VMU A;  4MQQ A;  4WU9 A;  5B2J B;  3WTP D;  2CJH A;  4WU8 C;  3RCH A;  5AV6 D;  3Q8N A;  2JGT A;  3PPL A;  3MGP C;  2BWO A;  3EI8 A;  1ELU A;  4J8X B;  4FFC A;  5B0Y D;  4EO5 B;  3AZN A;  3C1C D;  1BJO A;  4HGA B;  2FJ7 C;  2E7J A;  2FN6 A;  4WNN B;  3WZF A;  1QGN A;  4XZQ B;  4CXR A;  2F8N H;  1WST A;  3USF A;  5CP6 B;  2DGK A;  5DNM B;  1JG8 A;  1P3P B;  1KX5 C;  1C7O A;  1V72 A;  5B0Z C;  2AY7 A;  1B67 A;  3VOM A;  4CAY B;  4GE4 A;  2ZSL A;  4KHA B;  3P6K A;  4MY5 A;  4WLJ A;  4ZDO A;  3AZE B;  2VGU A;  2Z20 A;  5DB5 A;  3MGS D;  3KXB A;  4X23 D;  5CPJ D;  3KUY C;  3GZD C;  2W7J A;  3G7Q A;  5CPI C;  1WWS A;  3RQ1 A;  3REJ C;  4CSR B;  1P3B D;  1D7S A;  2JG2 A;  2VMZ A;  2PYO D;  3EZ1 A;  2E54 A;  4J8U B;  3DC1 A;  1UKJ A;  2W8V A;  3W97 D;  3TU4 D;  4K05 A;  3W1J A;  4JEZ A;  1I29 A;  2Y2O A;  2R5C B;  3VK4 A;  4AO9 A;  3REH B;  1YNU A;  3RBF A;  4JF1 A;  2Y2G A;  4WYF A;  1ZLA B;  4KGC A;  5B32 G;  4F5G A;  1M1A A;  4R5F A;  5FUG B;  2HUI A;  2F2A C;  4Z5T C;  3AYW B;  1M18 C;  3O62 D;  5B40 D;  4H63 Q;  4BA4 A;  2ARO D;  4JEY A;  5AVC B;  4M2J A;  5E5A C;  5EQC A;  3RUY A;  3EI7 A;  5B2J D;  1RVU A;  3W96 A;  1S32 C;  5JA4 B;  5B24 B;  4F5L A;  2CY8 A;  3TCM A;  4WLH A;  4XEW A;  3CBF A;  5B31 C;  3LZ0 B;  3W99 B;  1SVV A;  3W1H A;  2QMA A;  4Z66 A;  1E5E A;  4BMK A;  2OGA A;  4KUD A;  1I41 A;  3NX3 A;  1HQ3 A;  4XZQ D;  1H3O A;  3KSY A;  3B6G B;  5DNM D;  1P3P D;  4H9S A;  3E2Z A;  4QLC B;  5DNN B;  5EIG A;  3KKI A;  4OMA A;  5E3K A;  1MDZ A;  1TZY A;  1PG8 A;  4LD9 C;  3FDD A;  5M4B A;  1GC4 A;  3MNN C;  4WU8 B;  3TFU A;  4R8P A;  1XEY A;  3WX9 A;  5B33 A;  3PGY A;  1M32 A;  1EQZ C;  3H0R C;  2VGW A;  5B2I B;  4OC9 A;  2DOU A;  3NQJ B;  3I4J A;  3AV7 A;  5AVB D;  3LEL A;  4OBU A;  5AV8 C;  2FJ7 B;  2ZY3 A;  3FFH A;  4E3R A;  5G09 A;  4WYC A;  2CB1 A;  3EUC A;  3AZH D;  3LZ1 B;  5B0Z B;  5GT0 A;  3REH D;  4QGR A;  3I16 A;  2L5A A;  1IBJ A;  3AFA B;  2HIO B;  3HVY A;  5F9S A;  2AY6 A;  1UU1 A;  1ZLA D;  3N4X A;  3AV1 B;  2CV5 C;  4AWL B;  1JFI A;  1UU2 A;  4JF0 A;  3TFT A;  2ZSM A;  3X1S C;  4RJY A;  2W8S A;  5AY8 A;  3LY1 A;  3KUY B;  3AYW D;  3MVD C;  2D61 A;  4KXK A;  3GWP A;  2YFV B;  4Q31 A;  3DXV A;  5F99 C;  3AZN B;  3F9T A;  5AVC D;  3REJ B;  1P3K C;  3UAK A;  5B24 D;  1DFO A;  3AEN B;  1P34 C;  1LS3 A;  1W2E A;  1MDX A;  3LZ0 D;  4J8W C;  3W99 D;  3LJA D;  3X1V C;  1N8P A;  3WTP C;  1LW5 A;  1E5F A;  4IYO B;  4WB0 A;  4AOA A;  5DJ9 A;  3AZG A;  1BS0 A;  1SF2 A;  1W7N A;  3B6G D;  2YOB A;  4IXO A;  2VMW A;  2F8N K;  1P3I A;  1TOE A;  4YS3 C;  3W98 C;  5DNN D;  4FL0 A;  4W1X A;  3AZK A;  1BQD A;  4Q6R A;  2A1V A;  3WA9 B;  5G2P A;  3R4T A;  2YFW A;  1WYT A;  3FQ8 A;  3UTA A;  3BV0 A;  5E5A B;  1AX4 A;  4WU8 D;  2R5E A;  2VI9 A;  2W7H A;  5B31 B;  4OCA A;  4DRB A;  3VAX A;  1TOG A;  1IVR A;  4XUJ B;  3B46 A;  2NQB C;  4BA5 A;  5B2I D;  3AEJ C;  3PA9 A;  1M0Q A;  4M2K A;  2FJ7 D;  5CPJ C;  1H1C A;  4MSO A;  2F8N G;  1M4N A;  5BO0 B;  3ELE A;  3A2B A;  1ASD A;  2J8P A;  3ASB A;  4GRX A;  1P3B C;  1M1A B;  2VGV A;  4JEX A;  5B32 C;  2PYO C;  2AY9 A;  5B0Z D;  2DKJ A;  1ASC A;  1EJI A;  5B1L B;  1PFF A;  3AFA D;  2HIO D;  2VI8 A;  3IP4 C;  1P3M A;  4UHO A;  1PZR A;  5BJ3 A;  2CWE A;  1ASM A;  3KUY D;  3FTB A;  1KX4 A;  4ZUX B;  2NZD C;  3KWQ A;  1DJE A;  3W1I A;  4OTL A;  1P3A A;  3REJ D;  3LVJ A;  1P3G A;  4M2M A;  1J32 A;  4UOY A;  4GE9 A;  4LW4 A;  5BNV A;  1AIA A;  1I48 A;  2G7J A;  2ORD A;  1GEW A;  3QI6 A;  5GT3 B;  5B40 C;  3BCX A;  2WB6 A;  2F8J A;  5B2J C;  3MEB A;  3MGQ B;  3REK A;  3WLX A;  1P3L A;  1P3O B;  1M19 C;  1Z3Z A;  1RV3 A;  4J8X C;  4F5J A;  4H51 A;  1CQ6 A;  1P3F A;  4H9N B;  3ZRQ A;  4HGA C;  1AHX A;  3GSB A;  1M18 D;  3WA9 D;  1U35 A;  1F66 A;  5CP6 C;  4W5K A;  4WYE A;  2QA3 A;  4XAU A;  5E5A D;  2GMU A;  2D64 A;  1AKC A;  1BH9 A;  1YAA A;  1S0A A;  1P34 B;  1B5O A;  3ZZK A;  5B31 D;  3N5M A;  4XJO A;  2VIA A;  3AZE C;  4XUJ D;  1LKC A;  5EFS A;  1Z7D A;  3UTB C;  2JJE A;  3PD6 A;  5EUN A;  5HDM A;  5GXQ B;  1AJR A;  3JWA A;  3GR9 A;  3II0 A;  3V9R B;  1AOI C;  4MQR A;  1V2E A;  4RKD A;  3W98 B;  2W7I A;  4J8U C;  4HVK A;  1ID3 B;  4H9R B;  4PIW A;  5FT6 A;  1IAY A;  5B1L D;  2VYC A;  3K28 A;  2BYK B;  4ITX A;  2BIE A;  1EG5 A;  1QIS A;  4E1O A;  4R2N A;  3REH C;  4J8V B;  3AZF A;  3C1B A;  4ZUX D;  5J8Q A;  1B8G A;  2NQB B;  3HT4 A;  3WAA B;  2RIQ A;  3RI6 A;  4U1T A;  4J5U A;  1T3I A;  3AEO A;  3WY7 A;  2VGS A;  3UT9 C;  3AYW C;  1ASB A;  1W23 A;  1G7W A;  3H0M C;  3B0D C;  2D7Z A;  2BI5 A;  3MBB A;  2W8W A;  3MC6 C;  3PDX A;  4B9B A;  1CZE A;  2C81 A;  2XH1 A;  4PFF A;  3FRK A;  5B32 B;  4Z2M H;  3MGQ D;  3E6G A;  2BI1 A;  4F5I A;  2Y2I A;  5B24 C;  3HL2 A;  1AAW A;  3AEM C;  3G0T A;  5M49 A;  3PDB A;  3W99 C;  2X5D A;  3WGC A;  2HOZ A;  4W8I A;  3B6F A;  1TAT A;  3X1S D;  3AV2 A;  2VLF A;  2EYQ A;  2Z9V A;  2DGM A;  2NZD B;  4ZDL A;  2IO5 B;  3AZI C;  2RVQ C;  3MGP A;  5D95 A;  4CBS A;  3AZJ A;  4QLC C;  2R2N A;  3PJ0 A;  5DX5 A;  1QJ3 A;  4WXG A;  1P34 D;  3NUB A;  1B9H A;  1J04 A;  1AJS A;  2VIB A;  3FSL A;  3FVS A;  1KMJ A;  2WK7 A;  5BT1 C;  1KX5 A;  2Y2L A;  2YHK A;  2QSR A;  4GE7 A;  1M19 B;  3EI5 A;  5BNX A;  4UQV A;  1ARG A;  2AAT A;  3F0H A;  4MKJ A;  4YS3 D;  5B2I C;  2E7I A;  3W98 D;  3CQ4 A;  1ID3 D;  1W7L A;  1M0N A;  4G91 B;  5CPK C;  2VQR A;  4Q76 A;  2ZM5 A;  5CPI A;  4H9Q B;  3LZ1 C;  3AL0 C;  2DQN C;  4J8V D;  3X1T B;  3AFA C;  4M6B A;  2HIO C;  2NQB D;  3WAA D;  5BS7 A;  3AV1 C;  1N1J A;  3UTB B;  4AWL C;  1YOO A;  2AY4 A;  2G6W A;  2W8J A;  3JW9 A;  2UWX A;  4MKK A;  1KL1 A;  4F5K A;  4ZWM A;  1RV4 A;  1AOI B;  3AZN C;  4YM6 A;  3JWB A;  3LG0 A;  5B32 D;  2VGZ A;  1A7W A;  3NQU A;  1DGE A;  4A6R A;  1T3U A;  4Z5T A;  3A8U X;  1BH9 B;  1TAR A;  3DR7 A;  4ZSW A;  2YKU A;  4KYO A;  1KKJ A;  4A00 A;  1ZC9 A;  2NZD D;  5G4I A;  1S32 A;  3LVK A;  2BYM A;  3PIU A;  3KXB C;  3BCA A;  8AAT A;  1MLY A;  4R5Z A;  1TAF A;  1V2F A;  3HBX A;  3AN2 A;  1OHY A;  3UT9 B;  4DGT A;  4ATP A;  2OKK A;  3WA9 C;  5KDM A;  3B0D B;  5IWQ A;  1KX3 B;  5GSU A;  3REL B;  3REI A;  3NUI A;  2YKX A;  4A0R A;  1BQA A;  1OXO A;  3KGW A;  3AZL A;  2OGE A;  5EUE A;  5G49 A;  1DJ9 A;  4WD2 A;  2VMY A;  1AY4 A;  1I43 A;  1M19 D;  3EI9 A;  4E77 A;  4XUJ C;  3AZM A;  1ASA A;  3FFR A;  1M0O A;  3B1E A;  4J8X D;  3CQ6 A;  3COG A;  5AV5 A;  2OKJ A;  4LD9 A;  3R45 A;  2O7C A;  2C44 A;  3MNN A;  1WYV A;  3FQA A;  3GET A;  5CP6 D;  2PB0 A;  1G7X A;  3AZI B;  3E9K A;  1M1A C;  1HTA A;  5AV9 B;  1X29 A;  3MGR B;  3VP6 A;  2WKA A;  1O4S A;  3MAF B;  3BN1 A;  1X2A A;  3KFU G;  3A6N A;  1EQZ A;  2F8N B;  4RKC A;  1RVY A;  3X1T D;  5JRG A;  5B1L C;  3AZE D;  5AV8 A;  5C6U A;  3GZC A;  2D65 A;  4OYT A;  3UTB D;  3X1U B;  2YRR A;  4CXQ A;  3ZZJ A;  4JJN B;  1KMK A;  4ZUX C;  2VGT A;  1BFM A;  4DRA A;  5FT5 A;  4Z66 C;  1AOI D;  3ATH A;  4E3Q A;  1LW4 A;  2W7M A;  4I8A A;  2LY8 A;  3EI6 A;  3VK3 A;  1OXP A;  4J8U D;  1AMR A;  2YKY A;  4OT8 A;  2CV5 A;  3N7N A;  5CPK B;  2HP2 A;  2ZP7 A;  5GT3 C;  3AZJ B;  4H9P A;  3MVD A;  1WWI A;  2VMR A;  3MGQ C;  4MQP A;  3WCO A;  5F99 A;  3B0B A;  1P3O C;  1P3K A;  3N4R A;  1TZY C;  2Y2P A;  4ADB A;  4DBC A;  4WU9 B;  3WKJ A;  4UUZ A;  2VMX A;  5B1M A;  1IX8 A;  3RCH B;  1D7R A;  4LNJ A;  4J8W A;  1AHY A;  3X1V A;  4OBV A;  5E4Z A;  3AOV A;  3UT9 D;  4R8P C;  3WTP A;  4H9O A;  2OAT A;  3AEP A;  1KX3 D;  3REL D;  4L0O A;  5AV6 A;  3WTP E;  2BIA A;  4W1V A;  3G8M A;  2BIG A;  4Z2M G;  1AMA A;  1BJO B;  3NU8 A;  4ZLV A;  2BWP A;  1R4V A;  5B0Y A;  4YS3 A;  3C1C A;  5I92 A;  1XI9 A;  4NE5 A;  2Y2Q A;  4F4E A;  4AZK A;  2D63 A;  2CTZ A;  3NYS A;  5GXQ C;  2EZ1 A;  4WV4 B;  1ASG A;  3KXB B;  3KE3 A;  3AZI D;  1F1E A;  2RVQ D;  5AV9 D;  1DTY A;  4QLC D;  4RIT A;  5AX8 A;  1ID3 C;  3MGS A;  3BCB A;  4X23 A;  4YM6 B;  1VEF A;  1GEY A;  2Q7W A;  5CPJ A;  1IJI A;  1SPA A;  5BT1 D;  1N31 A;  4J8V C;  1P3B A;  3VH6 A;  4XJP A;  2ZY5 A;  2ZYJ A;  2PYO A;  3GBX A;  2D66 A;  3WAA C;  3FZ6 A;  4ZBJ C;  1WYU A;  1BH8 A;  3QM2 A;  2HUU A;  1V2D A;  1AY5 A;  3W97 A;  3FDB A;  3TU4 A;  2FYF A;  1ART A;  5CPK D;  1IAX A;  4KGC B;  1ASE A;  4ATQ A;  3HLM A;  1JS3 A;  2C0R A;  3AZK C;  3LZ1 D;  5DJ1 A;  4IY7 A;  2FNI A;  4RM1 A;  2HP1 A;  1B9I A;  4Y0D A;  3W96 B;  2CFB A;  2QBT A;  3AV1 D;  3B1C A;  2HOX A;  3O62 A;  5HXX A;  5B40 A;  2ARO A;  2GSA A;  3M5U A;  5B2J A;  4UHM A;  2Z1Y A;  3NYT A;  2D7Y A;  2CH1 A;  2IO5 C;  4Z66 B;  3AZN D;  5AV5 B;  1AMQ A;  4NOG A;  4B98 A;  4EU1 A;  4KUD B;  4A0G A;  1HQ3 B;  1H3O B;  2ZY2 A;  1IUG A;  3E2Z B;  4WNN A;  4XQ2 A;  2Y2M A;  2V1P A;  5EIG B;  4XZQ A;  2W7L A;  3ECD A;  4LNM A;  5DNM A;  3A6N B;  2JJG A;  1P3P A;  2BI3 A;  1TZY B;  3BWN A;  1P3M C;  3EG5 B;  4RLG A;  3KXB D;  4CAY A;  2ZY4 A;  4W91 A;  4WYD A;  4KHA A;  1QJ5 A;  3KWQ C;  4R8P B;  3H7F A;  2DGL A;  4G91 C;  5B33 B;  2EGY A;  1P3A C;  1PMO A;  2AY3 A;  4JEV A;  1P3G C;  1M6S A;  3LEL B;  9AAT A;  3L44 A;  1FC4 A;  4CSR A;  3X1T C;  5AVB A;  3FKD A;  3BS8 A;  4K2B A;  3ZRP A;  1TOJ A;  1AMS A;  4LW2 A;  3REK C;  5GT0 B;  3AEL A;  3B8X A;  2YCN A;  1MLZ A;  1AIC A;  3I5T A;  3UWC A;  4TMR A;  4BQ0 A;  3AZH A;  4KGC D;  2R5C A;  4F5F A;  3REH A;  4PVF A;  1Z2C B;  1JFI B;  2GMS A;  1M1A D;  3WCN A;  4W1W A;  2JJH A;  3CQ5 A;  5AY8 B;  4WP0 A;  1ZLA A;  1GD9 A;  3BC8 A;  3VH5 A;  1KAF A;  5FUG A;  3AYW A;  3T32 A;  3W96 D;  2YKV A;  7AAT A;  3DU4 A;  1DKA A;  5AVC A;  3MC6 A;  3LVM A;  5FT8 A;  4ZWV A;  2HOR A;  5JA4 A;  5B24 A;  4Z66 D;  5C3I C;  4ZBJ B;  2BWN A;  4ISY A;  4Y0I A;  3AEM A;  4NFT A;  4WB0 B;  3LZ0 A;  4KUD D;  3TAT A;  3H0L C;  3W99 A;  3LJA A;  3NU7 A;  1CL1 A;  3AZG B;  2HZP A;  3JZL A;  1KX3 C;  3REL C;  1O69 A;  2FNU A;  1P3I B;  5GT3 D;  3CAI A;  3LWS A;  3AZK B;  4EB7 A;  3B6G A;  3MGS B;  1Y4I A;  1P3O D;  3E2F A;  2YFW B;  1WYT B;  3QHX A;  1TZY D;  4QLC A;  3UTA B;  2BYL A;  5DNN A;  1G4V A;  4IX8 A;  1AHE A;  3UE8 A;  4TN4 A;  3EPH A;  4F5M A;  1S08 A;  3ASA A;  3AZF C;  3C1B C;  2AY2 A;  3ACZ A;  4R8P D;  3P5J B;  3AOW A;  4HF8 A;  5B33 D;  1AY8 A;  2QB3 A;  4WU8 A;  1FG3 A;  4P7Y A;  2YRI A;  1H0C A;  2TPL A;  4Q75 A;  5AV9 C;  2Y2K A;  3MGR C;  1SFF A;  4ADE A;  3FQ7 A;  1VP4 A;  3NYU A;  5B2I A;  3NQJ A;  1W3U A;  2AY1 A;  2FJ7 A;  1ARI A;  1C9C A;  5GT0 D;  2XBN A;  3X1U C;  3LV2 A;  1D7V A;  1C7G A;  4JJN C;  5GXQ D;  2CJG A;  1P3M B;  1MAP A;  3LZ1 A;  5B0Z A;  1YJY A;  3VH6 T;  1C0N A;  3B6F C;  2QLR A;  5KTB A;  3AFA A;  5AY8 D;  1CZC A;  2HIO A;  3PAA A;  4DQ6 A;  3OKS A;  1KX4 B;  3KWQ B;  2NMP A;  3AV1 A;  3HDO A;  1P3A B;  1UU0 A;  3AZJ C;  3KUY A;  1P3G B;  3GZD A;  3RBL A;  4PFN A;  2YFV A;  1ARH A;  2FKI A;  5BNV B;  2W8U A;  2ZC0 A;  3REJ A;  1N2T A;  3P1T A;  1G4X A;  3AEN A;  2JJF A;  4WU9 C;  5HHY A;  1C7N A;  3REK B;  1P3L B;  3FVX A;  3WKR A;  1AKB A;  2ZUK A;  3AZG D;  2WK9 A;  2XD5 A;  4IYO A;  2R0T A;  2JCH A;  1P3I D;  5EUD A;  1BJW A;  3ISL A;  1P3F B;  2X8U A;  2EH6 A;  3AZK D;  4CBR A;  4AZJ A;  1LC7 A;  1U35 B;  1F66 B;  1GEX A;  3UTA D;  4ZAS A;  4K2I A;  1AKA A;  1M18 A;  3WA9 A;  3N0L A;  4XJM A;  5M4D A; 
#chains in the Genus database with same CATH homology
 1DJU A;  3DOD A;  5AVB B;  5E5A A;  1GC2 A;  1B6W A;  5BJ4 A;  2KFP A;  4WJ3 C;  5BS7 C;  4UPK A;  1ASN A;  5C3I B;  2DF4 C;  5B31 A;  1TAS A;  3PD6 B;  3B1D A;  1U08 A;  3H9X A;  4XUJ A;  3EZS A;  2FFF B;  2GB3 A;  3AZH B;  4XJL A;  2BI9 A;  4YM6 C;  2VMN A;  3FD0 A;  2W8T A;  5CHL B;  4EFF A;  4DQY B;  3B0C W;  4ZM4 A;  5BO0 A;  2XD1 A;  2PB2 A;  1BT4 A;  3QGU A;  1P3M D;  1O62 A;  2FQ6 A;  2BG1 A;  5B1L A;  3AZF B;  3C1B B;  2O0R A;  2VMO A;  4UHN A;  1KX4 D;  2Y2J A;  3KWQ D;  1S06 A;  3VK2 A;  1C4K A;  4KGC C;  1P3A D;  1P3G D;  1ASL A;  3LJA B;  3E77 A;  4ZUX A;  1TPL A;  3AN2 C;  4WYA A;  5GSU C;  3N75 A;  4E45 A;  3REI C;  3F6T A;  2HUF A;  3GJU A;  2HUE B;  3VH5 T;  4N0W A;  3AZL C;  3W96 C;  4ZDP A;  3REK D;  1M7Y A;  1P3L D;  3A1I A;  5GT3 A;  3PDB B;  3K40 A;  2Z9U A;  4EB5 A;  2V0Y A;  3AZM C;  3MGQ A;  2CST A;  1BJN A;  1EQB A;  1P3O A;  2X5F A;  2Y2H A;  5AV5 C;  4RIZ A;  3B6F B;  1P3F D;  3BWO A;  4KUD C;  3AV2 B;  5EAV A;  1IX6 A;  1X28 A;  4WYG A;  1HQ3 C;  1U35 D;  1F66 D;  2W7F A;  3X1S A;  4H9N A;  3MGP B;  4H9S C;  2YCT A;  2C7T A;  2GQN A;  3A6N C;  1GBN A;  1ARS A;  5JRG C;  1OHW A;  1AJS B;  3EPJ A;  3EIB A;  5D5S A;  3ELP A;  1P34 A;  3NTJ A;  3R9A A;  5JAY A;  3D6K A;  1KX5 B;  3QPG A;  5K8B A;  5BNX B;  3NDN A;  2VMV A;  5B33 C;  1SZS A;  5F8V A;  4G92 C;  2VMT A;  1DGD A;  1MDO A;  5GXQ A;  3LEL C;  3V9R A;  3DYD A;  2BI2 A;  2FM1 A;  1ORD A;  3W98 A;  4A72 A;  1ID3 A;  3NNK A;  4H9R A;  5CPI B;  2CIN A;  3DZZ A;  5GT0 C;  5G0A A;  4ADC A;  1AHF A;  3AZF D;  3C1B D;  2OQX A;  4Y0H A;  2BYK A;  4ITG A;  1TOK A;  1ULY A;  1O61 A;  3WKJ C;  5B1M C;  4J8V A;  1N1J B;  3LVL B;  1QIR A;  2W7G A;  5AY8 C;  3MGR D;  2NQB A;  3WAA A;  2DKB A;  5AV6 C;  2F8N D;  1P3W A;  3AEJ A;  1AIB A;  3AAT A;  4NE3 A;  3NQU B;  5B0Y C;  3X1U D;  2G5H C;  3C1C C;  4JJN D;  3FZ8 A;  4R8D A;  5B32 A;  4Z5T B;  1M18 B;  3QBO A;  2JSS A;  1KU5 A;  3B6F D;  1AHG A;  4IXS A;  3AV2 D;  1VJO A;  4BHD A;  1D7U A;  2ZJG A;  4AO4 A;  1B5P A;  3AZG C;  1S32 B;  2BYM B;  1IX7 A;  1ASF A;  3MGP D;  1WKG A;  1P3I C;  3AZJ D;  3HMU A;  4A0F A;  1TAF B;  3N4S A;  1GC3 A;  1YJZ A;  2Z9X A;  2NZD A;  4A6U A;  3AN2 B;  3MGS C;  2CJD A;  4AH3 A;  5KDM B;  4J8L A;  4X23 C;  3A1K A;  5GSU B;  4P3M A;  2VLH A;  3REI B;  3DXW A;  3B0C T;  3UTA C;  1M0P A;  5FT4 A;  1OHV A;  5G4J A;  4WU9 D;  1LC8 A;  3AZL B;  1OAT A;  3MAD A;  4F5H A;  5G49 B;  1KX5 D;  1JS6 A;  1GCK A;  3VH6 W;  3AZM B;  1S07 A;  2Z1Z A;  2X3L A;  5TF5 A;  4ZM3 A;  4ADD A;  3A9Z A;  3W97 C;  4ZAH A;  2E7U A;  3TU4 C;  1M19 A;  2W7K A;  3EPK A;  4O6Z A;  4LD9 B;  2HOY A;  3R45 B;  4J8X A;  3MNN B;  1WYV B;  4A0H A;  3EPL A;  5EAA A;  2AY8 A;  5CPI D;  4WZS B;  5CP6 A;  1EQZ B;  4GSA A;  1JF9 A;  2CH2 A;  5JRG B;  1D2F A;  5AV8 B;  4H9Q A;  2EZ2 A;  3FCR A;  3A9X A;  4WXB A;  4IXZ A;  1S09 A;  3O62 C;  3X1T A;  1YIZ A;  2ARO C;  3AZE A;  2W7D A;  2G5I C;  4RAE A;  1KX4 C;  1GC0 A;  1KL2 A;  1WKH A;  2D5Y A;  3KGX A;  3UTB A;  1CJ0 A;  2O1B A;  1ELQ A;  4YM6 D;  4G92 B;  1AOI A;  4EO5 C;  2CV5 B;  2Z9W A;  1SZK A;  1SZU A;  3X1S B;  4IW7 A;  1KKP A;  3OP7 A;  4Z5T D;  4J8U A;  3MKJ A;  4H9P B;  3FZ7 A;  3MVD B;  4XZQ C;  1CQ7 A;  2BYJ A;  3E2Y A;  5DNM C;  5F99 B;  2CAN A;  4ZSY A;  1P3L C;  2WK8 A;  1P3P C;  1PMM A;  1P3K B;  1BKG A;  1LC5 A;  3BWN C;  3WKS A;  1S32 D;  1FG7 A;  1MGV A;  3WKJ B;  4UUZ B;  2VMQ A;  5B1M B;  4J8W B;  2RFV A;  1QIT A;  5M46 A;  1P3F C;  3X1V B;  3AN2 D;  4E44 A;  1ZOB A;  3WTP B;  4H9O B;  1U35 C;  5GSU D;  1F66 C;  1BJ4 A;  1CS1 A;  3REI D;  5AV6 B;  2Y2N A;  3A9Y A;  4CVQ A;  3ZRR A;  1LK9 A;  1YJS A;  4A6T A;  3TQX A;  4WXF A;  3UT9 A;  2VMS A;  3AZL D;  2EPJ A;  1KX3 A;  3REL A;  2YCP A;  5B0Y B;  3BB8 A;  4YS3 B;  5AVB C;  3C1C B;  3FVU A;  3AZM D;  2AY5 A;  2JIS A;  1MAQ A;  5B31 G;  3NRA A;  1X0M A;  5AV5 D;  2JE5 A;  1QZ9 A;  4LD9 D;  1HQ3 D;  3MNN D;  3AZH C;  1AAM A;  3EIA A;  4XK1 A;  3JTX A;  1ZLA C;  2EO5 A;  2W7E A;  3A6N D;  1EQZ D;  4GDY A;  3QN6 A;  3DR4 A;  3AZI A;  2PO3 A;  3VH5 W;  4X23 B;  5JRG D;  2BHX A;  3WGB A;  5AV9 A;  1ECX A;  5AV8 D;  3MGR A;  5CPJ B;  1YIY A;  4LNL A;  3MAF A;  1CL2 A;  4K2M A;  1Q9C A;  2F8N A;  5AVC C;  1P3B B;  2PYO B;  3L8A A;  3K7Y A;  1GDE A;  1ZOD A;  3IHJ A;  3X1U A;  1WYU B;  1B4X A;  2BKW A;  1BH8 B;  3LZ0 C;  3MAU A;  4JJN A;  3W97 B;  4JEW A;  3LJA C;  3LEL D;  3TU4 B;  4RJ0 A;  1CQ8 A;  4GEB A;  3DRD A;  1W7M A;  2CV5 D;  2AEU A;  5G2Q A;  4NE6 A;  2HUE C;  2Z61 A;  3MVD D;  4EMY A;  4U2H A;  1TOI A;  3B6G C;  2QB2 A;  4LC3 A;  5F99 D;  5CPK A;  3HQT A;  4WBT A;  1P3K D;  5E5I A;  2VMP A;  5DNN C;  3WKJ D;  2AEV A;  4KAM A;  5B1M D;  2DR1 A;  4J8W D;  3O62 B;  3X1V D;  5B40 B;  3AV2 C;  2ARO B;  1BW0 A;  2VMU A;  4MQQ A;  4WU9 A;  5B2J B;  3WTP D;  2CJH A;  4WU8 C;  3RCH A;  5AV6 D;  3Q8N A;  2JGT A;  3PPL A;  3MGP C;  2BWO A;  3EI8 A;  1ELU A;  4J8X B;  4FFC A;  5B0Y D;  4EO5 B;  3AZN A;  3C1C D;  1BJO A;  4HGA B;  2FJ7 C;  2E7J A;  2FN6 A;  4WNN B;  3WZF A;  1QGN A;  4XZQ B;  4CXR A;  2F8N H;  1WST A;  3USF A;  5CP6 B;  2DGK A;  5DNM B;  1JG8 A;  1P3P B;  1KX5 C;  1C7O A;  1V72 A;  5B0Z C;  2AY7 A;  1B67 A;  3VOM A;  4CAY B;  4GE4 A;  2ZSL A;  4KHA B;  3P6K A;  4MY5 A;  4WLJ A;  4ZDO A;  3AZE B;  2VGU A;  2Z20 A;  5DB5 A;  3MGS D;  3KXB A;  4X23 D;  5CPJ D;  3KUY C;  3GZD C;  2W7J A;  3G7Q A;  5CPI C;  1WWS A;  3RQ1 A;  3REJ C;  4CSR B;  1P3B D;  1D7S A;  2JG2 A;  2VMZ A;  2PYO D;  3EZ1 A;  2E54 A;  4J8U B;  3DC1 A;  1UKJ A;  2W8V A;  3W97 D;  3TU4 D;  4K05 A;  3W1J A;  4JEZ A;  1I29 A;  2Y2O A;  2R5C B;  3VK4 A;  4AO9 A;  3REH B;  1YNU A;  3RBF A;  4JF1 A;  2Y2G A;  4WYF A;  1ZLA B;  4KGC A;  5B32 G;  4F5G A;  1M1A A;  4R5F A;  5FUG B;  2HUI A;  2F2A C;  4Z5T C;  3AYW B;  1M18 C;  3O62 D;  5B40 D;  4H63 Q;  4BA4 A;  2ARO D;  4JEY A;  5AVC B;  4M2J A;  5E5A C;  5EQC A;  3RUY A;  3EI7 A;  5B2J D;  1RVU A;  3W96 A;  1S32 C;  5JA4 B;  5B24 B;  4F5L A;  2CY8 A;  3TCM A;  4WLH A;  4XEW A;  3CBF A;  5B31 C;  3LZ0 B;  3W99 B;  1SVV A;  3W1H A;  2QMA A;  4Z66 A;  1E5E A;  4BMK A;  2OGA A;  4KUD A;  1I41 A;  3NX3 A;  1HQ3 A;  4XZQ D;  1H3O A;  3KSY A;  3B6G B;  5DNM D;  1P3P D;  4H9S A;  3E2Z A;  4QLC B;  5DNN B;  5EIG A;  3KKI A;  4OMA A;  5E3K A;  1MDZ A;  1TZY A;  1PG8 A;  4LD9 C;  3FDD A;  5M4B A;  1GC4 A;  3MNN C;  4WU8 B;  3TFU A;  4R8P A;  1XEY A;  3WX9 A;  5B33 A;  3PGY A;  1M32 A;  1EQZ C;  3H0R C;  2VGW A;  5B2I B;  4OC9 A;  2DOU A;  3NQJ B;  3I4J A;  3AV7 A;  5AVB D;  3LEL A;  4OBU A;  5AV8 C;  2FJ7 B;  2ZY3 A;  3FFH A;  4E3R A;  5G09 A;  4WYC A;  2CB1 A;  3EUC A;  3AZH D;  3LZ1 B;  5B0Z B;  5GT0 A;  3REH D;  4QGR A;  3I16 A;  2L5A A;  1IBJ A;  3AFA B;  2HIO B;  3HVY A;  5F9S A;  2AY6 A;  1UU1 A;  1ZLA D;  3N4X A;  3AV1 B;  2CV5 C;  4AWL B;  1JFI A;  1UU2 A;  4JF0 A;  3TFT A;  2ZSM A;  3X1S C;  4RJY A;  2W8S A;  5AY8 A;  3LY1 A;  3KUY B;  3AYW D;  3MVD C;  2D61 A;  4KXK A;  3GWP A;  2YFV B;  4Q31 A;  3DXV A;  5F99 C;  3AZN B;  3F9T A;  5AVC D;  3REJ B;  1P3K C;  3UAK A;  5B24 D;  1DFO A;  3AEN B;  1P34 C;  1LS3 A;  1W2E A;  1MDX A;  3LZ0 D;  4J8W C;  3W99 D;  3LJA D;  3X1V C;  1N8P A;  3WTP C;  1LW5 A;  1E5F A;  4IYO B;  4WB0 A;  4AOA A;  5DJ9 A;  3AZG A;  1BS0 A;  1SF2 A;  1W7N A;  3B6G D;  2YOB A;  4IXO A;  2VMW A;  2F8N K;  1P3I A;  1TOE A;  4YS3 C;  3W98 C;  5DNN D;  4FL0 A;  4W1X A;  3AZK A;  1BQD A;  4Q6R A;  2A1V A;  3WA9 B;  5G2P A;  3R4T A;  2YFW A;  1WYT A;  3FQ8 A;  3UTA A;  3BV0 A;  5E5A B;  1AX4 A;  4WU8 D;  2R5E A;  2VI9 A;  2W7H A;  5B31 B;  4OCA A;  4DRB A;  3VAX A;  1TOG A;  1IVR A;  4XUJ B;  3B46 A;  2NQB C;  4BA5 A;  5B2I D;  3AEJ C;  3PA9 A;  1M0Q A;  4M2K A;  2FJ7 D;  5CPJ C;  1H1C A;  4MSO A;  2F8N G;  1M4N A;  5BO0 B;  3ELE A;  3A2B A;  1ASD A;  2J8P A;  3ASB A;  4GRX A;  1P3B C;  1M1A B;  2VGV A;  4JEX A;  5B32 C;  2PYO C;  2AY9 A;  5B0Z D;  2DKJ A;  1ASC A;  1EJI A;  5B1L B;  1PFF A;  3AFA D;  2HIO D;  2VI8 A;  3IP4 C;  1P3M A;  4UHO A;  1PZR A;  5BJ3 A;  2CWE A;  1ASM A;  3KUY D;  3FTB A;  1KX4 A;  4ZUX B;  2NZD C;  3KWQ A;  1DJE A;  3W1I A;  4OTL A;  1P3A A;  3REJ D;  3LVJ A;  1P3G A;  4M2M A;  1J32 A;  4UOY A;  4GE9 A;  4LW4 A;  5BNV A;  1AIA A;  1I48 A;  2G7J A;  2ORD A;  1GEW A;  3QI6 A;  5GT3 B;  5B40 C;  3BCX A;  2WB6 A;  2F8J A;  5B2J C;  3MEB A;  3MGQ B;  3REK A;  3WLX A;  1P3L A;  1P3O B;  1M19 C;  1Z3Z A;  1RV3 A;  4J8X C;  4F5J A;  4H51 A;  1CQ6 A;  1P3F A;  4H9N B;  3ZRQ A;  4HGA C;  1AHX A;  3GSB A;  1M18 D;  3WA9 D;  1U35 A;  1F66 A;  5CP6 C;  4W5K A;  4WYE A;  2QA3 A;  4XAU A;  5E5A D;  2GMU A;  2D64 A;  1AKC A;  1BH9 A;  1YAA A;  1S0A A;  1P34 B;  1B5O A;  3ZZK A;  5B31 D;  3N5M A;  4XJO A;  2VIA A;  3AZE C;  4XUJ D;  1LKC A;  5EFS A;  1Z7D A;  3UTB C;  2JJE A;  3PD6 A;  5EUN A;  5HDM A;  5GXQ B;  1AJR A;  3JWA A;  3GR9 A;  3II0 A;  3V9R B;  1AOI C;  4MQR A;  1V2E A;  4RKD A;  3W98 B;  2W7I A;  4J8U C;  4HVK A;  1ID3 B;  4H9R B;  4PIW A;  5FT6 A;  1IAY A;  5B1L D;  2VYC A;  3K28 A;  2BYK B;  4ITX A;  2BIE A;  1EG5 A;  1QIS A;  4E1O A;  4R2N A;  3REH C;  4J8V B;  3AZF A;  3C1B A;  4ZUX D;  5J8Q A;  1B8G A;  2NQB B;  3HT4 A;  3WAA B;  2RIQ A;  3RI6 A;  4U1T A;  4J5U A;  1T3I A;  3AEO A;  3WY7 A;  2VGS A;  3UT9 C;  3AYW C;  1ASB A;  1W23 A;  1G7W A;  3H0M C;  3B0D C;  2D7Z A;  2BI5 A;  3MBB A;  2W8W A;  3MC6 C;  3PDX A;  4B9B A;  1CZE A;  2C81 A;  2XH1 A;  4PFF A;  3FRK A;  5B32 B;  4Z2M H;  3MGQ D;  3E6G A;  2BI1 A;  4F5I A;  2Y2I A;  5B24 C;  3HL2 A;  1AAW A;  3AEM C;  3G0T A;  5M49 A;  3PDB A;  3W99 C;  2X5D A;  3WGC A;  2HOZ A;  4W8I A;  3B6F A;  1TAT A;  3X1S D;  3AV2 A;  2VLF A;  2EYQ A;  2Z9V A;  2DGM A;  2NZD B;  4ZDL A;  2IO5 B;  3AZI C;  2RVQ C;  3MGP A;  5D95 A;  4CBS A;  3AZJ A;  4QLC C;  2R2N A;  3PJ0 A;  5DX5 A;  1QJ3 A;  4WXG A;  1P34 D;  3NUB A;  1B9H A;  1J04 A;  1AJS A;  2VIB A;  3FSL A;  3FVS A;  1KMJ A;  2WK7 A;  5BT1 C;  1KX5 A;  2Y2L A;  2YHK A;  2QSR A;  4GE7 A;  1M19 B;  3EI5 A;  5BNX A;  4UQV A;  1ARG A;  2AAT A;  3F0H A;  4MKJ A;  4YS3 D;  5B2I C;  2E7I A;  3W98 D;  3CQ4 A;  1ID3 D;  1W7L A;  1M0N A;  4G91 B;  5CPK C;  2VQR A;  4Q76 A;  2ZM5 A;  5CPI A;  4H9Q B;  3LZ1 C;  3AL0 C;  2DQN C;  4J8V D;  3X1T B;  3AFA C;  4M6B A;  2HIO C;  2NQB D;  3WAA D;  5BS7 A;  3AV1 C;  1N1J A;  3UTB B;  4AWL C;  1YOO A;  2AY4 A;  2G6W A;  2W8J A;  3JW9 A;  2UWX A;  4MKK A;  1KL1 A;  4F5K A;  4ZWM A;  1RV4 A;  1AOI B;  3AZN C;  4YM6 A;  3JWB A;  3LG0 A;  5B32 D;  2VGZ A;  1A7W A;  3NQU A;  1DGE A;  4A6R A;  1T3U A;  4Z5T A;  3A8U X;  1BH9 B;  1TAR A;  3DR7 A;  4ZSW A;  2YKU A;  4KYO A;  1KKJ A;  4A00 A;  1ZC9 A;  2NZD D;  5G4I A;  1S32 A;  3LVK A;  2BYM A;  3PIU A;  3KXB C;  3BCA A;  8AAT A;  1MLY A;  4R5Z A;  1TAF A;  1V2F A;  3HBX A;  3AN2 A;  1OHY A;  3UT9 B;  4DGT A;  4ATP A;  2OKK A;  3WA9 C;  5KDM A;  3B0D B;  5IWQ A;  1KX3 B;  5GSU A;  3REL B;  3REI A;  3NUI A;  2YKX A;  4A0R A;  1BQA A;  1OXO A;  3KGW A;  3AZL A;  2OGE A;  5EUE A;  5G49 A;  1DJ9 A;  4WD2 A;  2VMY A;  1AY4 A;  1I43 A;  1M19 D;  3EI9 A;  4E77 A;  4XUJ C;  3AZM A;  1ASA A;  3FFR A;  1M0O A;  3B1E A;  4J8X D;  3CQ6 A;  3COG A;  5AV5 A;  2OKJ A;  4LD9 A;  3R45 A;  2O7C A;  2C44 A;  3MNN A;  1WYV A;  3FQA A;  3GET A;  5CP6 D;  2PB0 A;  1G7X A;  3AZI B;  3E9K A;  1M1A C;  1HTA A;  5AV9 B;  1X29 A;  3MGR B;  3VP6 A;  2WKA A;  1O4S A;  3MAF B;  3BN1 A;  1X2A A;  3KFU G;  3A6N A;  1EQZ A;  2F8N B;  4RKC A;  1RVY A;  3X1T D;  5JRG A;  5B1L C;  3AZE D;  5AV8 A;  5C6U A;  3GZC A;  2D65 A;  4OYT A;  3UTB D;  3X1U B;  2YRR A;  4CXQ A;  3ZZJ A;  4JJN B;  1KMK A;  4ZUX C;  2VGT A;  1BFM A;  4DRA A;  5FT5 A;  4Z66 C;  1AOI D;  3ATH A;  4E3Q A;  1LW4 A;  2W7M A;  4I8A A;  2LY8 A;  3EI6 A;  3VK3 A;  1OXP A;  4J8U D;  1AMR A;  2YKY A;  4OT8 A;  2CV5 A;  3N7N A;  5CPK B;  2HP2 A;  2ZP7 A;  5GT3 C;  3AZJ B;  4H9P A;  3MVD A;  1WWI A;  2VMR A;  3MGQ C;  4MQP A;  3WCO A;  5F99 A;  3B0B A;  1P3O C;  1P3K A;  3N4R A;  1TZY C;  2Y2P A;  4ADB A;  4DBC A;  4WU9 B;  3WKJ A;  4UUZ A;  2VMX A;  5B1M A;  1IX8 A;  3RCH B;  1D7R A;  4LNJ A;  4J8W A;  1AHY A;  3X1V A;  4OBV A;  5E4Z A;  3AOV A;  3UT9 D;  4R8P C;  3WTP A;  4H9O A;  2OAT A;  3AEP A;  1KX3 D;  3REL D;  4L0O A;  5AV6 A;  3WTP E;  2BIA A;  4W1V A;  3G8M A;  2BIG A;  4Z2M G;  1AMA A;  1BJO B;  3NU8 A;  4ZLV A;  2BWP A;  1R4V A;  5B0Y A;  4YS3 A;  3C1C A;  5I92 A;  1XI9 A;  4NE5 A;  2Y2Q A;  4F4E A;  4AZK A;  2D63 A;  2CTZ A;  3NYS A;  5GXQ C;  2EZ1 A;  4WV4 B;  1ASG A;  3KXB B;  3KE3 A;  3AZI D;  1F1E A;  2RVQ D;  5AV9 D;  1DTY A;  4QLC D;  4RIT A;  5AX8 A;  1ID3 C;  3MGS A;  3BCB A;  4X23 A;  4YM6 B;  1VEF A;  1GEY A;  2Q7W A;  5CPJ A;  1IJI A;  1SPA A;  5BT1 D;  1N31 A;  4J8V C;  1P3B A;  3VH6 A;  4XJP A;  2ZY5 A;  2ZYJ A;  2PYO A;  3GBX A;  2D66 A;  3WAA C;  3FZ6 A;  4ZBJ C;  1WYU A;  1BH8 A;  3QM2 A;  2HUU A;  1V2D A;  1AY5 A;  3W97 A;  3FDB A;  3TU4 A;  2FYF A;  1ART A;  5CPK D;  1IAX A;  4KGC B;  1ASE A;  4ATQ A;  3HLM A;  1JS3 A;  2C0R A;  3AZK C;  3LZ1 D;  5DJ1 A;  4IY7 A;  2FNI A;  4RM1 A;  2HP1 A;  1B9I A;  4Y0D A;  3W96 B;  2CFB A;  2QBT A;  3AV1 D;  3B1C A;  2HOX A;  3O62 A;  5HXX A;  5B40 A;  2ARO A;  2GSA A;  3M5U A;  5B2J A;  4UHM A;  2Z1Y A;  3NYT A;  2D7Y A;  2CH1 A;  2IO5 C;  4Z66 B;  3AZN D;  5AV5 B;  1AMQ A;  4NOG A;  4B98 A;  4EU1 A;  4KUD B;  4A0G A;  1HQ3 B;  1H3O B;  2ZY2 A;  1IUG A;  3E2Z B;  4WNN A;  4XQ2 A;  2Y2M A;  2V1P A;  5EIG B;  4XZQ A;  2W7L A;  3ECD A;  4LNM A;  5DNM A;  3A6N B;  2JJG A;  1P3P A;  2BI3 A;  1TZY B;  3BWN A;  1P3M C;  3EG5 B;  4RLG A;  3KXB D;  4CAY A;  2ZY4 A;  4W91 A;  4WYD A;  4KHA A;  1QJ5 A;  3KWQ C;  4R8P B;  3H7F A;  2DGL A;  4G91 C;  5B33 B;  2EGY A;  1P3A C;  1PMO A;  2AY3 A;  4JEV A;  1P3G C;  1M6S A;  3LEL B;  9AAT A;  3L44 A;  1FC4 A;  4CSR A;  3X1T C;  5AVB A;  3FKD A;  3BS8 A;  4K2B A;  3ZRP A;  1TOJ A;  1AMS A;  4LW2 A;  3REK C;  5GT0 B;  3AEL A;  3B8X A;  2YCN A;  1MLZ A;  1AIC A;  3I5T A;  3UWC A;  4TMR A;  4BQ0 A;  3AZH A;  4KGC D;  2R5C A;  4F5F A;  3REH A;  4PVF A;  1Z2C B;  1JFI B;  2GMS A;  1M1A D;  3WCN A;  4W1W A;  2JJH A;  3CQ5 A;  5AY8 B;  4WP0 A;  1ZLA A;  1GD9 A;  3BC8 A;  3VH5 A;  5FUG A;  3AYW A;  3T32 A;  3W96 D;  2YKV A;  7AAT A;  3DU4 A;  1DKA A;  5AVC A;  3MC6 A;  3LVM A;  5FT8 A;  4ZWV A;  2HOR A;  5JA4 A;  5B24 A;  4Z66 D;  5C3I C;  4ZBJ B;  2BWN A;  4ISY A;  4Y0I A;  3AEM A;  4NFT A;  4WB0 B;  3LZ0 A;  4KUD D;  3TAT A;  3H0L C;  3W99 A;  3LJA A;  3NU7 A;  1CL1 A;  3AZG B;  2HZP A;  3JZL A;  1KX3 C;  3REL C;  1O69 A;  2FNU A;  1P3I B;  5GT3 D;  3CAI A;  3LWS A;  3AZK B;  4EB7 A;  3B6G A;  3MGS B;  1Y4I A;  1P3O D;  3E2F A;  2YFW B;  1WYT B;  3QHX A;  1TZY D;  4QLC A;  3UTA B;  2BYL A;  5DNN A;  1G4V A;  4IX8 A;  1AHE A;  3UE8 A;  4TN4 A;  3EPH A;  4F5M A;  1S08 A;  3ASA A;  3AZF C;  3C1B C;  2AY2 A;  3ACZ A;  4R8P D;  3P5J B;  3AOW A;  4HF8 A;  5B33 D;  1AY8 A;  2QB3 A;  4WU8 A;  1FG3 A;  4P7Y A;  2YRI A;  1H0C A;  2TPL A;  4Q75 A;  5AV9 C;  2Y2K A;  3MGR C;  1SFF A;  4ADE A;  3FQ7 A;  1VP4 A;  3NYU A;  5B2I A;  3NQJ A;  1W3U A;  2AY1 A;  2FJ7 A;  1ARI A;  1C9C A;  5GT0 D;  2XBN A;  3X1U C;  3LV2 A;  1D7V A;  1C7G A;  4JJN C;  5GXQ D;  2CJG A;  1P3M B;  1MAP A;  3LZ1 A;  5B0Z A;  1YJY A;  3VH6 T;  1C0N A;  3B6F C;  2QLR A;  5KTB A;  3AFA A;  5AY8 D;  1CZC A;  2HIO A;  3PAA A;  4DQ6 A;  3OKS A;  1KX4 B;  3KWQ B;  2NMP A;  3AV1 A;  3HDO A;  1P3A B;  1UU0 A;  3AZJ C;  3KUY A;  1P3G B;  3GZD A;  3RBL A;  4PFN A;  2YFV A;  1ARH A;  2FKI A;  5BNV B;  2W8U A;  2ZC0 A;  3REJ A;  1N2T A;  3P1T A;  1G4X A;  3AEN A;  2JJF A;  4WU9 C;  5HHY A;  1C7N A;  3REK B;  1P3L B;  3FVX A;  3WKR A;  1AKB A;  2ZUK A;  3AZG D;  2WK9 A;  2XD5 A;  4IYO A;  2R0T A;  2JCH A;  1P3I D;  5EUD A;  1BJW A;  3ISL A;  1P3F B;  2X8U A;  2EH6 A;  3AZK D;  4CBR A;  4AZJ A;  1LC7 A;  1U35 B;  1F66 B;  1GEX A;  3UTA D;  4ZAS A;  4K2I A;  1AKA A;  1M18 A;  3WA9 A;  3N0L A;  4XJM A;  5M4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...