2ZY2A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
521
structure length
521
Chain Sequence
SPFELKDELIKVASGKANRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTVGVGGLAKLDGIEGRFERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLTVSEQIVRQYIVREMAGGAVPPESVDLFAVEGGTAAMAYIFESLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQRPDLLILTDDVYGTFADEFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNVTCRLYGEAFSQWAVQQSSTGDMLFRVADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRRLADELYEQYKALGKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-aspartate 4-carboxylyase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Lyase
total genus 154
structure length 521
sequence length 521
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy2A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy2A01
2R5CB 4UHOA 2GMSA 2W7DA 4HVKA 1W23A 5E5IA 2G6WA 3BCAA 1M0OA 1Z3ZA 3N5MA 1EG5A 1QITA 3GJUA 1W7NA 3LV2A 1DJUA 4Y0HA 3ZRPA 2BI2A 1TOIA 1TOGA 3BC8A 3WX9A 4MQRA 2CINA 4WYCA 3NYSA 4XAUA 4NOGA 2DR1A 3FTBA 2Z9UA 4JEVA 2X5FA 2JJFA 4IYOB 1H0CA 5FT8A 1IBJA 1S08A 3ACZA 2VMRA 1M6SA 2BIGA 1YIZA 2X8UA 4IYOA 1DFOA 1AKAA 2E7JA 1U08A 2FN6A 3HMUA 4GE7A 3DYDA 3AELA 4IX8A 3RI6A 3LVKA 2Z9XA 2XH1A 3FFHA 3FFRA 5BJ4A 2GB3A 3GSBA 1YOOA 3IHJA 1ASBA 1DTYA 4XQ2A 5F8VA 1GC0A 1G4XA 1S0AA 2HOYA 3KE3A 4JEWA 1B5OA 1X29A 2WKAA 1BKGA 2HP1A 3VK4A 4WB0A 2ZY3A 1MAPA 1S09A 3GR9A 4A0RA 5D95A 4MQQA 4BQ0A 4F5KA 5IWQA 2BWNA 4MSOA 1W7LA 3DRDA 3N75A 2OATA 3FSLA 4W8IA 1YAAA 1BJ4A 4W91A 2OGEA 1B9IA 1TOJA 1KL2A 3UAKA 3E2YA 1C7OA 4JEXA 4WXGA 3LWSA 3K40A 1BJOA 1M4NA 1AICA 2BI3A 4KYOA 4XJMA 1MDZA 4O6ZA 1LC5A 5G4JA 2JGTA 3QI6A 4ATQA 1MGVA 2W7HA 3D6KA 7AATA 4RAEA 3VAXA 2ZY5A 4Y0DA 3AOWA 3EI5A 1D7UA 2PO3A 4KXKA 4ZDLA 4GEBA 2VIAA 1X28A 4EU1A 4GE4A 1SFFA 2FYFA 4J5UA 8AATA 1QZ9A 4ZWVA 1Y4IA 2FM1A 2BIEA 3VOMA 2W8WA 5M4BA 1E5EA 1ASGA 2VIBA 1D7VA 1OHVA 2DKJA 3NTJA 2YHKA 5G09A 2QA3A 4ZSWA 1AMQA 1I41A 3ISLA 2VMWA 3GBXA 1ELQA 3MKJA 4B9BA 1SZSA 3ASBA 4LNLA 4OT8A 4WD2A 1M0PA 1JG8A 2VMTA 3B8XA 1IVRA 1LW5A 2W7LA 3ECDA 4XJOA 3MAUA 4AO9A 3BN1A 5G2QA 2AY1A 1WYUB 3NDNA 5M4DA 3WZFA 2VLFA 1LW4A 3AEPA 4OTLA 2HOXA 3BS8A 3HLMA 3FQ7A 1AJSA 3I5TA 3RBLA 2Z1YA 3PD6B 5EFSA 3NUIA 1QISA 3QN6A 1ASLA 4AZKA 4LNJA 3WKRA 4B98A 4MQPA 3PD6A 1RVYA 3GZDA 4CBSA 4ZM4A 2HUIA 1AIBA 2GSAA 2R0TA 3EUCA 2CJHA 5EUNA 5I92A 4DGTA 4EB5A 1D7RA 3BCBA 4F5HA 4GRXA 4LW2A 3G7QA 4DBCA 1AY8A 2HP2A 2QBTA 3ZRQA 1V72A 3TFTA 4R8DA 5EIGA 4OCAA 3GZDC 1ARIA 1O62A 3DR4A 3BV0A 1BJNA 2R2NA 2YCTA 3MBBA 4E77A 1C0NA 2HUUA 2Z61A 4K2BA 1W3UA 3QHXA 1CQ6A 5FT6A 1ECXA 4A72A 4UOYA 5M49A 4Q31A 4PFNA 1D7SA 1RV4A 2EZ2A 4A00A 3CQ4A 4W1WA 1SVVA 2V0YA 2QB3A 3FDDA 1AHXA 2BYLA 3LY1A 3NYUA 1DKAA 4H51A 1CQ7A 1DGEA 1KL1A 2W8UA 1GBNA 2YKYA 4K2MA 4PIWA 1CZEA 4PVFA 4DQ6A 3F6TA 3WY7A 2E54A 4HF8A 1DGDA 1IAXA 2W7MA 1S06A 4XEWA 1ARHA 2E7IA 2X5DA 1AMRA 1AMSA 1KMJA 2VMZA 1ARSA 4JEYA 4PFFA 4WYDA 1AY5A 2AY2A 4F5IA 1RVUA 2BKWA 3LVLB 1X0MA 3HQTA 1EQBA 1ZOBA 4AOAA 1AKBA 4EMYA 2RFVA 2EZ1A 2JJEA 1BT4A 3B46A 4K2IA 1WYVA 4R5FA 4IXSA 3A8UX 4A0GA 2VGUA 4CVQA 4EB7A 1ASNA 2AY9A 3P1TA 1P3WA 1ASEA 3M5UA 1JS3A 1TPLA 3UE8A 2VMYA 4ATPA 3B1CA 3TQXA 4WB0B 2O1BA 2W7FA 1YNUA 3NU8A 5E4ZA 1YIYA 3LVJA 2QLRA 1T3IA 2W8TA 3E9KA 1N2TA 2ZYJA 2YCNA 4W5KA 1C7NA 3GETA 1ZC9A 3EI8A 3DXVA 4UHNA 1KKPA 3AEMC 1TATA 4BA4A 1BJOB 1UU2A 3R4TA 1MLZA 1RV3A 5HDMA 4UQVA 1CQ8A 3Q8NA 3NNKA 1S07A 2CH2A 1MDXA 2Z9WA 5JAYA 1MAQA 4IW7A 2F8JA 2BHXA 2BWPA 3AEOA 4TMRA 2W7KA 5J8QA 5G4IA 1GDEA 2W7IA 3E2ZA 2VYCA 4XK1A 3AV7A 3R9AA 3JWAA 3K7YA 1SF2A 4ZDPA 3CQ5A 2D5YA 1I29A 3CAIA 1CL2A 2D65A 1B4XA 1GCKA 2EPJA 1M0QA 1O69A 1OHWA 9AATA 1H1CA 2YKXA 1GC2A 1G7WA 1OHYA 3FKDA 3DZZA 3PJ0A 3NRAA 4AZJA 2CY8A 1I43A 1ASFA 1Z7DA 4WBTA 1CJ0A 4JF0A 1WYTB 1IAYA 4ISYA 3KGWA 4BHDA 3JTXA 1GD9A 2YKUA 1WYTA 5BJ3A 4L0OA 3FVUA 2Z20A 1LC7A 3FRKA 3MADA 2OGAA 3EI6A 3BB8A 3NX3A 4E3RA 5HXXA 4QGRA 4RKDA 2CFBA 1O4SA 1IJIA 2W8JA 2AY6A 3T32A 2VGTA 1AJSB 1ELUA 2HORA 4A6RA 3DODA 1ASCA 3FVXA 3LVMA 4MY5A 3FCRA 4Y0IA 4GE9A 1GC3A 4ZM3A 3PIUA 3II0A 4ADDA 3G8MA 2R5EA 4WYFA 2JJGA 3EZ1A 4KAMA 3HL2A 2BI9A 3PDXA 1BQDA 1M0NA 1AHYA 1VJOA 2V1PA 3B1DA 1IX6A 4ITGA 3L8AA 5AX8A 2ZJGA 2VMSA 4F5LA 2PB0A 3RCHB 3TCMA 2Q7WA 4BA5A 2CJDA 2CSTA 3JW9A 4OMAA 4AH3A 1M32A 3RCHA 5EIGB 3NUBA 3TATA 5FT4A 2CH1A 1GC4A 1M7YA 2YRRA 1O61A 4LC3A 3EI9A 1LC8A 1CZCA 3TFUA 2DOUA 2VMNA 1FG3A 1QIRA 4WLJA 5EAAA 1PG8A 1UKJA 2ORDA 3JWBA 4TN4A 1ZODA 4JF1A 2BYJA 1B5PA 3RUYA 3QBOA 4ZSYA 2CB1A 1TOEA 2D64A 1DJ9A 4RJYA 1AAMA 3N0LA 4Q75A 4ZAHA 4WP0A 1AMAA 2ZY4A 4ZDOA 5F9SA 2AY8A 1BJWA 2VGSA 2VMXA 3EIBA 3OKSA 3WGBA 1YJSA 3L44A 5K8BA 1AJRA 2D61A 1TOKA 3AATA 2CTZA 1SZKA 3P6KA 3F9TA 5EUDA 3PA9A 5FT5A 3HDOA 3A2BA 4WXBA 2E7UA 1AY4A 1C7GA 4IXOA 1YJZA 3AENA 1WSTA 3FQ8A 3ZZJA 3BWOA 4F5FA 4XJPA 2VGVA 2ZP7A 3AEJA 4Q76A 4U1TA 1UU1A 1WYVB 2R5CA 1ASAA 4GDYA 2VI8A 4WYAA 5EUEA 2GMUA 3KGXA 1JS6A 1DJEA 3NU7A 2WK7A 4CXQA 1N31A 3COGA 1LK9A 4AO4A 1BW0A 1AHGA 1LKCA 3WKSA 4M2JA 3AEJC 4WLHA 3RBFA 1G4VA 1WKHA 2D66A 3OP7A 3DXWA 4A6TA 1XI9A 1OXOA 3AEMA 4R5ZA 1E5FA 1C9CA 1YJYA 1VP4A 2D7ZA 3VK2A 1BQAA 1MDOA 2HZPA 1OXPA 4UHMA 3BCXA 4ADBA 4E3QA 3QGUA 1AHEA 1IUGA 3CQ6A 5G2PA 3E77A 1C4KA 1FG7A 2JG2A 2ZUKA 4N0WA 5EQCA 1V2EA 4E1OA 3A9ZA 3FDBA 4P7YA 5M46A 3K28A 1KKJA 2VMQA 3E2FA 1BS0A 2BI5A 2VMVA 2YKVA 3PAAA 2AY3A 1B9HA 1AIAA 2VGWA 3MEBA 5DJ1A 2AY5A 3PPLA 4ITXA 2YCPA 1ORDA 3E2ZB 3LG0A 3FVSA 3PGYA 4M2KA 1ASMA 1N8PA 1VEFA 2VI9A 5HHYA 2GQNA 4RKCA 3RQ1A 4F5JA 5DB5A 3F0HA 4CBRA 1QGNA 2O7CA 4F5MA 1ARTA 4F4EA 4P3MA 1AAWA 2VMPA 3I4JA 2VMUA 2CANA 2D7YA 1D2FA 5DX5A 5G0AA 4BMKA 3MC6A 2WK9A 3EZSA 1CS1A 3ZZKA 2OQXA 1EJIA 4JEZA 1CL1A 1JF9A 1LS3A 3PDBB 1AKCA 1TARA 2QB2A 3NYTA 4WYEA 3PDBA 3MC6C 1G7XA 3UWCA 2DKBA 2Z1ZA 1J32A 3QM2A 5DJ9A 4EFFA 3CBFA 3KKIA 3ELPA 2ZY2A 4IXZA 2AATA 4U2HA 2C81A 1J04A 3USFA 3WGCA 2D63A 3ASAA 2FQ6A 4R2NA 2VMOA 1QJ5A 3BWNA 2W7GA 1ARGA 2TPLA 2W7EA 3FQAA 2VGZA 4M2MA 3B1EA 5D5SA 2FNUA 3EIAA 3ELEA 2WK8A 1X2AA 4MKJA 4XJLA 4W1VA 4ADCA 5TF5A 4W1XA 2YOBA 2AY4A 1QJ3A 3BWNC 2YRIA 3QPGA 2W8VA 3A9XA 1I48A 1SZUA 2JJHA 3DC1A 5C6UA 1GEXA 2O0RA 4OYTA 2C0RA 2FNIA 4A6UA 2BWOA 2BI1A 3ZRRA 2CJGA 4LNMA 2EH6A 2PB2A 4FL0A 4WXFA 2C44A 3DU4A 4A0HA 2W7JA 2Z9VA 1AX4A 4LW4A 3VK3A 1WYUA 4ZWMA 1TASA 1FC4A 3H7FA 2HOZA 4MKKA 1W7MA 1UU0A 3ATHA 4WYGA 2ZC0A 3E6GA 4CXRA 4Q6RA 3EI7A 1GEYA 1ASDA 2EGYA 3AOVA 4FFCA 2XBNA 5EAVA 1WKGA 3DR7A 5E3KA 2ZSMA 2C7TA 1MLYA 4ZLVA 2BIAA 2NMPA 4I8AA 2EO5A 4ADEA 4ZASA 1B8GA 1SPAA 2VLHA 1IX8A 1KMKA 3MAFB 2HUFA 4GSAA 2QMAA 1IX7A 3AENB 4OC9A 1AHFA 1OATA 2ZSLA 4A0FA 2AY7A 1PFFA 1GEWA 3A9YA 3MAFA 1V2DA 4IY7A 4F5GA 3GZCA 1V2FA 3WLXA
chains in the Genus database with same CATH superfamily
4XZQD 1S32A 2W7DA 4HVKA 4J8WD 3O62D 3GJUA 3LJAC 1F66B 3LZ0B 3LV2A 3ZRPA 1S32C 1TOIA 4WYCA 5GT3D 2X5FA 4IYOB 1IBJA 1S08A 3ACZA 2VMRA 1M6SA 3B0CT 1DFOA 1AKAA 1ZLAB 4IX8A 3REIB 1P3FB 3KXBD 1KAFA 1DTYA 2HOYA 3KE3A 2WKAA 4J8XD 1BKGA 3X1TB 2HP1A 3VH6W 1S09A 4A0RA 4F5KA 4MQQA 2BWNA 2AROB 1YAAA 1BJ4A 1P3OB 4W91A 3UTBD 1TOJA 4NFTA 3E2YA 2YFWA 2Y2JA 4XJMA 1P3LB 1P3KA 4H9QB 3QI6A 2XD5A 1MGVA 4WV4B 5KDMA 4QLCD 2VIAA 1SFFA 1QZ9A 4ZWVA 1Y4IA 2BIEA 3MNND 1ASGA 1OHVA 3NTJA 2QA3A 4KUDB 1AMQA 3MKJA 1SZSA 1AOID 3ASBA 3MGRD 2W7LA 1LW5A 4HGAB 3AZFD 3AV2D 2Y2GA 1LW4A 3AEPA 3HLMA 3I5TA 3RBLA 4Z66B 4J8UA 4AZKA 3AZHD 4CBSA 2BYMB 5AVBD 3RELA 5I92A 1H3OA 2CJHA 4DGTA 4WU8D 3NQJB 4X23A 5B2JA 4WU9D 4LW2A 3LJAB 3G7QA 3TFTA 1AY8A 4H9SA 1ARIA 3RELC 2DF4C 4X23C 5B2JC 1W3UA 1M19A 4Q31A 4H9SC 2EZ2A 4W1WA 2QB3A 3FDDA 3NYUA 1Q9CA 5GXQD 3KWQA 2Y2OA 4H51A 1CQ7A 1M19C 2F8NA 4K2MA 1R4VA 1CZEA 5AY8A 5GT0D 1ARHA 3AZGA 2ZM5A 2HIOB 3KWQC 4F5IA 2BKWA 1ZOBA 1AKBA 2Y2KA 5AY8C 4K2IA 3C1CD 4A0GA 5B32D 2VGUA 3P1TA 3AZNB 3UTAA 4ATPA 1TPLA 3X1VC 1P3PD 5E4ZA 1YNUA 1YIYA 3LVJA 2QLRA 3R45B 2ZYJA 2YCNA 4W5KA 3UTAC 3EI8A 1KKPA 3AEMC 2YFWB 5JA4A 1MLZA 4UQVA 3Q8NA 1S07A 1MAQA 2BWPA 5KDMB 3AEOA 5B40B 2W7KA 5AV5B 1T3UA 2VYCA 4XK1A 3AV7A 3JWAA 3X1UA 3CQ5A 1I29A 4CAYA 3CAIA 2EPJA 1O69A 4J8VD 3DZZA 5JRGA 3WA9A 1Z7DA 4WBTA 4H9OA 3X1UC 1WYTB 1IAYA 4WZSB 3VH5A 4BHDA 1N1JA 3FRKA 5BNVB 3MADA 3NX3A 5JRGC 3EI6A 5HXXA 3WA9C 1O4SA 4UUZA 1IJIA 2W8JA 3T32A 3MGSB 4H9RB 1ELUA 3KUYA 4MY5A 3FCRA 1P3MA 5DNMD 3LELD 2HUEB 4ZM3A 5E5AA 4UPKA 4ADDA 4WYFA 4XUJA 3EZ1A 2BI9A 2L5AA 3RELB 5B32G 3AZIA 1H3OB 3B1DA 3KUYC 3L8AA 4X23B 5AX8A 2ZJGA 5B2JB 3EPJA 2JCHA 4F5LA 4BA5A 1P3MC 4KGCA 4AH3A 5BNXB 5E5AC 3RCHA 3NUBA 3TATA 3B0CW 4XUJC 4R8PA 1LC8A 3AZIC 1FG3A 5EAAA 3AFAB 2ORDA 1ZODA 1M19B 2BYJA 4KGCC 2CB1A 1AAMA 4Q75A 4R8PC 3A6NC 4YM6D 5F9SA 3EIBA 3KWQB 1YJSA 5K8BA 1TOKA 2NZDC 2F8NB 1P3GB 5AY8B 3F9TA 5EUDA 5B0YA 5C3IC 5FT5A 5B31C 1ID3D 2E7UA 4IXOA 3AENA 1WSTA 3X1VB 3W97A 3AEJA 4Q76A 3B0DC 5AVCA 3AZND 2R5CA 5DNNA 4H9NB 5B0YC 3KGXA 1JS6A 3AZMD 1BW0A 1P3BD 3W97C 3AEJC 1XEYA 4RITA 4WLHA 5AVCC 3WTPE 5DNNC 1JFIA 5B0ZC 1OXOA 4NE6A 1VP4A 3AN2D 3BCXA 1AHEA 3E77A 4N0WA 1V2EA 4E1OA 5AV5D 5AV6D 3W1JA 4J8WC 2VMVA 2AY5A 3PGYA 4M2KA 1ASMA 3X1UB 1U35D 1N8PA 4RKCA 3AZLA 1ARTA 4F4EA 2VMUA 5JRGB 5DX5A 4BMKA 2WK9A 4H9OB 4J8XA 3AZLC 1N1JB 1AKCA 2Y2LA 5B24B 3FZ7A 3PDBA 4YS3D 3AYWA 4EFFA 3ELPA 2AATA 2D63A 3UTBA 3ASAA 4ZUXA 4J8XC 2FQ6A 3KUYB 1QJ5A 2W7GA 2TPLA 3NQUB 1P3MB 1P3AD 3B1EA 3I16A 5D5SA 3TU4B 3AYWC 2PYOA 3WTPD 3UTBC 3AZIB 4ZUXC 4QLCA 2AY4A 2YRIA 1SZUA 3DC1A 4KGCB 2O0RA 3AZED 4E44A 2PYOC 1PMOA 3A6NB 2CJGA 3MNNA 4A0HA 2W7JA 4OBUA 4QLCC 1BH8A 4ZWMA 3UT9D 2NZDB 2IO5B 1UU0A 4WYGA 2ZC0A 5B33A 1AOIA 5C3IB 4Q6RA 5B31B 3EI7A 1GEYA 3MNNC 2XBNA 5EAVA 2C7TA 4ZLVA 3B0DB 2EO5A 4ADEA 5B33C 5B0YB 1AOIC 1SPAA 3MAFB 2HUFA 2QMAA 1IX7A 5B1LA 3AENB 2Y2MA 1AHFA 1P34A 4A0FA 3AZFC 3AV2C 4IY7A 4F5GA 3H0RC 5CP6D 5B1MB 5DNNB 2R5CB 3N4XA 2GMSA 5B0ZB 1KX4A 5E5IA 1TAFA 3BCAA 3N5MA 1EG5A 5AV9B 1QITA 4XZQB 1TOGA 5AVBC 3LZ0A 1KX4C 2CINA 4J8WB 4WU9C 3O62B 3FTBA 2JJFA 5FT8A 4IYOA 1ULYA 3HMUA 3LZ0C 1U08A 2FN6A 3DYDA 3RI6A 5GT3B 1ZLAA 5GT0A 3FFHA 5BJ4A 3REIA 1YOOA 3IHJA 4Z5TD 1P3FA 1GC0A 4CSRA 1S0AA 1HTAA 1B5OA 1ZLAC 4WB0A 2ZY3A 5GT0C 3KXBB 3C1CA 5B32A 5D95A 4BQ0A 5IWQA 3X1TA 1W7LA 3N75A 1KX5D 4JJND 3FSLA 4W8IA 4J8XB 1KL2A 4JEXA 4WXGA 3C1CC 3LWSA 5B32C 3K40A 4KYOA 1B6WA 2FJ7D 3UTBB 1P3LA 3AV1D 3VAXA 1P3PC 2PO3A 4J5UA 4QLCB 3MVDD 3ISLA 1I41A 2W8SA 2VMWA 3GBXA 1ELQA 4B9BA 2YFVB 2DGKA 1M0PA 2VMTA 3MNNB 1IVRA 3ECDA 4XJOA 2QSRA 3MAUA 5G2QA 2AY1A 5M4DA 1M1AD 3N4RA 3B6FD 3MGRB 4EO5C 3BS8A 4J8VC 5EFSA 3NUIA 3AZFB 3AV2B 4LNJA 4Z66A 1RVYA 3WCNA 1AIBA 2UWXA 4EB5A 2BYMA 3LELA 3BCBA 3AZHB 4DBCA 5F99D 4R8DA 5EIGA 4OCAA 1O62A 1BJNA 5AVBB 3MBBA 4WU8B 1TAFB 4K2BA 4WU9B 3W96D 3LELC 4UOYA 4A00A 1AHXA 2DGLA 3F6TA 2G7JA 4HF8A 1DGDA 4XEWA 3H0LC 1AMRA 1AMSA 4YM6A 1KMJA 2VMZA 5GXQB 1AY5A 3B6GD 2AY2A 3MGQD 4EMYA 2HIOA 5GT0B 3B46A 1WYVA 4CVQA 4EB7A 4YM6C 1ASNA 1P3WA 1ASEA 4CSRB 3UE8A 2VMYA 3TQXA 5AV8D 2HIOC 4WB0B 3AZNA 3C1CB 5B32B 2F8NK 1ID3C 5B31G 3AZMA 4Z2MH 3E9KA 1P3BA 3AZJD 3R45A 3HBXA 3AZNC 1P3PB 1UU2A 3R4TA 1CQ8A 3AZMC 1MDXA 2F8JA 2BHXA 1P3BC 4M6BA 3WCOA 5B40A 2OKKA 5AV5A 1SF2A 4ZDPA 3X1SD 1B4XA 1M0QA 2AEUA 9AATA 1GC2A 3NRAA 4AZJA 1CJ0A 5B40C 5AV5C 4ISYA 3WKJD 3KGWA 4EO5B 4J8VB 1GD9A 1WYTA 5BO0A 4L0OA 2Z20A 5B2ID 2CFBA 1U35C 5BNVA 4NE3A 2VGTA 4DRBA 3DODA 3FVXA 4Z2MG 3MGSA 4H9RA 4YS3A 4Y0IA 3II0A 3G8MA 2JJGA 4KAMA 3HL2A 3PDXA 1BQDA 3WAAD 4ITGA 1IX6A 5DNMB 3LELB 2VQRA 3MGSC 4YS3C 1M32A 5EIGB 5FT4A 2CH1A 1M7YA 2YRRA 1O61A 2HUEC 5BNXA 2DOUA 1QIRA 5GSUD 4TN4A 1P3AC 1B5PA 3AZEA 3IP4C 3AFAA 1TOEA 2D64A 3VH5T 4RJYA 4WP0A 2ZY4A 1BJWA 2VMXA 5KTBA 3L44A 3UT9A 2D61A 3AZEC 3AFAC 3PA9A 1AY4A 1P3GA 4YM6B 3ZZJA 3UT9C 2Y2IA 2VGVA 1WYVB 3V9RB 3X1VA 2G5HC 1ID3B 1P3GC 4H9NA 2DQNC 3COGA 2CV5D 1G4VA 3OP7A 3AEMA 3HVYA 3C1BD 3AZMB 2HZPA 5CPJD 1P3BB 5CP6C 1FG7A 2JG2A 5EQCA 3AN2B 1KKJA 3E2FA 1BS0A 2VGWA 4ITXA 5AV6B 1VEFA 1QGNA 4H63Q 1D2FA 5G0AA 4Z5TA 4DRAA 1U35B 1CS1A 2Y2PA 1M18D 1EJIA 4JEZA 1JF9A 5BO0B 1TARA 2QB2A 3REKD 4Z5TC 3UWCA 1KX5A 3KKIA 2RIQA 1WWSA 3W99B 2C81A 3VP6A 5B24A 2VMOA 5G49B 2VGZA 4YS3B 1WWIA 4G91B 1KX5C 3ELEA 3NQUA 5B24C 3TU4A 3REHD 1QJ3A 1P3AB 3A9XA 1I48A 5C6UA 2C0RA 2FNIA 3WTPB 2BI1A 3AV1C 3DU4A 3TU4C 2Z9VA 1WYUA 3A6NA 2HOZA 2BG1A 3AZEB 2DGMA 3ATHA 3G0TA 2NZDA 2BYKB 2EGYA 3MVDC 4FFCA 5B31A 3UT9B 5BS7C 1MLYA 4OBVA 1S32D 4I8AA 3B6FA 4ZASA 2VLHA 2IO5C 1KMKA 1OATA 2AY7A 3MAFA 1M1AC 3A9YA 4UHOA 3B6FC 4LD9D 5B1MA 1W23A 5B0ZA 5CP6B 1BFMA 1W7NA 1Z2CB 1DJUA 5AV9A 3LZ1D 4Y0HA 4XZQA 5B1MC 3NYSA 4XAUA 4NOGA 2DR1A 4JEVA 4J8WA 5AV9C 3O62A 1YIZA 3W98D 2E7JA 4GE7A 4XZQC 3W96C 2Z9XA 2XH1A 5GT3A 3FFRA 3O62C 3GSBA 4XQ2A 1KX3D 3AZKD 3MGQA 1G4XA 4JEWA 1X29A 4K05A 5GT3C 1MAPA 3GR9A 4Z5TB 1P3KD 3KXBA 3B6GC 3MGQC 2OGEA 2RVQD 3UAKA 3W99D 1C7OA 2G5IC 1M4NA 1AICA 2BI3A 1KX5B 1MDZA 4JJNB 4O6ZA 3KXBC 1LC5A 5G4JA 5FUGA 5AV8C 3AOWA 4KXKA 4GEBA 1X28A 2FJ7B 8AATA 3VH5W 2FM1A 3AV1B 2VIBA 2YHKA 4ZSWA 4J8UD 3MVDB 2YFVA 3BN1A 1WYUB 3WZFA 2VLFA 3X1SC 2NQBD 4OTLA 2HOXA 2Z1YA 2J8PA 3PD6B 3MGRA 5B2IA 1M1AB 3QN6A 1ASLA 3H0MC 3WKRA 3AZFA 3AV2A 3B6FB 3GZDA 3WKJC 1EQZD 4ZM4A 2HUIA 2GSAA 2R0TA 5EUNA 3MGRC 5B2IC 4F5HA 2QBTA 3ZRQA 1V72A 3GZDC 1HQ3D 3BV0A 2R2NA 3AZHA 1C0NA 5AVBA 3QHXA 5FT6A 1ECXA 5M49A 4WU8A 3AZGD 5F99B 1D7SA 4WU9A 1SVVA 3WAAC 3AZHC 2BYLA 5GSUA 3W96B 1DGEA 4PIWA 4DQ6A 4WU8C 3WY7A 2E54A 2W7MA 2E7IA 2X5DA 3UTAD 4JEYA 4PFFA 5GSUC 1RVUA 1X0MA 3HQTA 5GXQA 4AOAA 2JJEA 1BT4A 4R5FA 3A8UX 3B6GB 3MGQB 5GXQC 2O1BA 2W7FA 3MGPB 1N2TA 3GETA 4UHNA 2CV5A 5AV8B 1TATA 3VH6A 4BA4A 1PMMA 3C1BA 1P3PA 2CH2A 4IW7A 3AZJB 5FUGB 2CV5C 3WA9D 4TMRA 5J8QA 5G4IA 3K7YA 3C1BC 4J8LA 4H9PB 3EPKA 2D5YA 5CPJC 2D65A 3REJD 1H1CA 1G7WA 1OHYA 3FKDA 3PJ0A 4JF0A 3X1SB 3EPHA 3EG5B 2JE5A 2YKUA 3FVUA 1LC7A 5E5AD 2OGAA 4RLGA 4J8VA 4QGRA 5CHLB 1M18A 2AY6A 3WKJB 1W2EA 5B2IB 1ASCA 5BT1D 3REKA 4ZBJB 4R8PD 4GE9A 3PIUA 1M18C 2R5EA 2V1PA 1VJOA 2VMSA 2PB0A 2Q7WA 3REKC 2CSTA 4OMAA 5DNMA 4LC3A 3WAAB 1CZCA 3TFUA 2VMNA 4WLJA 3REHA 1UKJA 4JF1A 4ZSYA 1DJ9A 4ZAHA 5DNMC 1AMAA 4ZDOA 2AY8A 3OKSA 5GSUB 3W1HA 3W97D 3REHC 5AVCD 1SZKA 3P6KA 1YJZA 4XJPA 2ZP7A 2EYQA 1UU1A 2CWEA 4GDYA 5EUEA 1DJEA 3V9RA 3NU7A 1ID3A 2WK7A 4CXQA 1N31A 1LK9A 1LKCA 1AHGA 3MGPD 1TZYD 2D66A 3DXWA 4A6TA 4LD9A 1XI9A 2X3LA 2D7ZA 1MDOA 1OXPA 2AEVA 2CV5B 4E3QA 3QGUA 1IUGA 5G2PA 5CPKD 3LZ1A 1C4KA 4LD9C 3C1BB 3FDBA 3AZLD 4P7YA 5M46A 3K28A 5CPJB 4AWLB 3PAAA 1B9HA 1AIAA 3MEBA 3AN2A 3PPLA 3LZ1C 3W98A 3FVSA 2GQNA 2A1VA 3RQ1A 5DB5A 3F0HA 5AV6A 2O7CA 1AAWA 3I4JA 3AYWD 3N7NA 3AN2C 2CANA 2D7YA 1PZRA 4RJ0A 3W98C 1KX3A 3AZKA 4ZUXD 1P3ID 1U35A 1F1EA 5AV6C 2PYOD 3NYTA 2DKBA 2Z1ZA 1J32A 1KX3C 3AZKC 3CBFA 2ZY2A 1M18B 1J04A 4RIZA 3W99A 1BH9B 3REKB 4M2MA 1P3KC 5CPID 1X2AA 5G49A 4MKJA 4XJLA 4W1VA 2RVQC 4W1XA 3W99C 5B33D 2W8VA 4OYTA 1P3AA 4WXFA 4FL0A 4G91C 2C44A 3REHB 3WTPA 1B67A 1TASA 4MKKA 1W7MA 5B1LD 3E6GA 1P34D 3WTPC 1WKGA 3DR7A 2ZSMA 2BYKA 2NMPA 1KX4D 1B8GA 3KFUG 2NQBA 1IX8A 4J8UC 1S32B 3GZCA 3WLXA 1F66D 3LZ0D 2NQBC 3JZLA 1EQZA 2G6WA 1M0OA 1Z3ZA 1KU5A 1HQ3A 2BI2A 4LD9B 1EQZC 5CP6A 3BC8A 3WX9A 1ZLAD 4MQRA 3REID 2Z9UA 4E45A 1H0CA 3LZ1B 1P3FD 1HQ3C 2BIGA 2X8UA 3AELA 3LVKA 3AZGC 3X1TD 2GB3A 3W98B 3P5JB 1ASBA 2Y2NA 5F8VA 2AROD 4WJ3C 1P3OD 3VK4A 4MSOA 1P3LD 3AZKB 1KX3B 3DRDA 2OATA 1B9IA 3FD0A 1BJOA 1P3KB 2JISA 2JGTA 4ATQA 2W7HA 4JJNA 3D6KA 7AATA 2WB6A 4RAEA 2ZY5A 4Y0DA 3EI5A 1D7UA 4ZDLA 4KUDD 4EU1A 4GE4A 2FYFA 3VOMA 2W8WA 5M4BA 1E5EA 2FJ7A 4JJNC 1D7VA 2DKJA 5G09A 3AV1A 4LNLA 4OT8A 4WD2A 1JG8A 3REJA 3B8XA 2FJ7C 4AO9A 3NDNA 4Z66D 3N4SA 3MVDA 5BS7A 4J8UB 3REJC 3FQ7A 1AJSA 1QISA 4B98A 4MQPA 3LJAD 3PD6A 1M1AA 2NQBB 3EUCA 1D7RA 4GRXA 2HP2A 3DR4A 2F2AC 1EQZB 2YCTA 4E77A 4WNNA 2HUUA 2Z61A 1CQ6A 5BT1C 4A72A 4PFNA 1RV4A 3W1IA 1HQ3B 3CQ4A 2V0YA 5F99A 3LY1A 2HIOD 1DKAA 2W8UA 2JSSA 1KL1A 3AZGB 1GBNA 2YKYA 4PVFA 3B0BA 3W96A 1IAXA 1S06A 5F99C 1ARSA 4WYDA 3LVLB 1EQBA 2RFVA 2EZ1A 4NE5A 4IXSA 3UTAB 2AY9A 3H9XA 3M5UA 1JS3A 3B1CA 3B6GA 3NU8A 1T3IA 2W8TA 1C7NA 1ZC9A 3MGPA 3DXVA 5JA4B 5B40D 1TZYA 2OKJA 3KSYA 4DQYB 5AV8A 4KHAA 4G92C 1BJOB 5HDMA 1RV3A 2FKIA 3NNKA 5JAYA 2Z9WA 3MGPC 5CPKA 1TZYC 4CAYB 3AZJA 1GDEA 2W7IA 3E2ZA 3R9AA 1CL2A 1GCKA 1OHWA 3WA9B 2YKXA 2XD1A 4H9PA 5CPKC 2CY8A 3AZJC 1I43A 1ASFA 3A1KA 3REJB 3JTXA 5BJ3A 1A7WA 3MGSD 4UUZB 3X1SA 4E3RA 3BB8A 3GWPA 4RKDA 1P3IA 3RELD 1AJSB 2HORA 4A6RA 3VH6T 5E5AB 4X23D 3WKJA 5B2JD 3AL0C 3LVMA 4XUJB 1GC3A 1P3IC 1M0NA 1AHYA 2Y2QA 3RCHB 3TCMA 3AFAD 2CJDA 4R8PB 1M19D 3JW9A 5CPIA 1GC4A 4ZBJC 3EI9A 3EPLA 4WNNB 3KWQD 1PG8A 3JWBA 3WAAA 2F8ND 3RUYA 1P3GD 3QBOA 5CPIC 5AY8D 3N0LA 2VGSA 3WGBA 1AJRA 3AATA 3X1VD 2CTZA 3A1IA 3HDOA 3A2BA 4WXBA 1C7GA 3W97B 3FQ8A 3BWOA 4F5FA 5AVCB 2F8NH 4U1TA 5B1LC 4RM1A 1ASAA 2Y2HA 1P34C 2VI8A 4WYAA 2GMUA 4AO4A 3WKSA 1JFIB 4M2JA 1F66A 2KFPA 3RBFA 1WKHA 4G92B 4R5ZA 1E5FA 1C9CA 1YJYA 3VK2A 1BQAA 4UHMA 4ADBA 1F66C 3CQ6A 1TZYB 3FZ6A 2ZUKA 4KHAB 3HT4A 3A9ZA 3X1UD 2VMQA 2BI5A 2YKVA 2AY3A 5CPJA 5CPKB 5DJ1A 5JRGD 2YCPA 1ORDA 3E2ZB 3LG0A 3AZLB 2VI9A 5HHYA 4F5JA 3REIC 2LY8A 4CBRA 4F5MA 4P3MA 2VMPA 1P3FC 4AWLC 3MC6A 3EZSA 5B24D 3ZZKA 2OQXA 2F8NG 2AROA 1P3OA 1CL1A 3PDBB 1LS3A 3X1TC 3AYWB 3KUYD 4WYEA 1P3MD 3MC6C 1G7XA 3FZ8A 3QM2A 4ZUXB 5DJ9A 3TU4D 1P3IB 4IXZA 2AROC 4U2HA 3USFA 3WGCA 4XUJD 4H9QA 1P3OC 4R2NA 3AZID 2PYOB 3BWNA 1ARGA 2W7EA 3FQAA 2FNUA 1P3LC 4KGCD 3EIAA 1BH9A 2WK8A 3A6ND 4ADCA 5TF5A 2YOBA 3BWNC 3QPGA 4KUDA 2NZDD 2JJHA 1GEXA 5CPIB 4A6UA 2BWOA 1BH8B 5B31D 3ZRRA 4LNMA 2EH6A 2PB2A 1AX4A 4LW4A 3VK3A 5B33B 1AOIB 1FC4A 3H7FA 4KUDC 4CXRA 5B0YD 1ASDA 3AOVA 4HGAC 5E3KA 2FFFB 2BIAA 5B1LB 5B1MD 5DNND 1P34B 5B0ZD 4GSAA 4OC9A 3NQJA 2ZSLA 4Z66C 1PFFA 1GEWA 1V2DA 5AV9D 3LJAA 1V2FA 1KX4B
chains in the Genus database with same CATH topology
4XZQD 1S32A 2W7DA 4HVKA 4J8WD 3O62D 3GJUA 3LJAC 1F66B 3LZ0B 3LV2A 3ZRPA 1S32C 1TOIA 4WYCA 5GT3D 2X5FA 4IYOB 1IBJA 1S08A 3ACZA 2VMRA 1M6SA 3B0CT 1DFOA 1AKAA 1ZLAB 4IX8A 3REIB 1P3FB 3KXBD 1DTYA 2HOYA 3KE3A 2WKAA 4J8XD 1BKGA 3X1TB 2HP1A 3VH6W 1S09A 4A0RA 4F5KA 4MQQA 2BWNA 2AROB 1YAAA 1BJ4A 1P3OB 4W91A 3UTBD 1TOJA 4NFTA 3E2YA 2YFWA 2Y2JA 4XJMA 1P3LB 1P3KA 4H9QB 3QI6A 2XD5A 1MGVA 4WV4B 5KDMA 4QLCD 2VIAA 1SFFA 1QZ9A 4ZWVA 1Y4IA 2BIEA 3MNND 1ASGA 1OHVA 3NTJA 2QA3A 4KUDB 1AMQA 3MKJA 1SZSA 1AOID 3ASBA 3MGRD 2W7LA 1LW5A 4HGAB 3AZFD 3AV2D 2Y2GA 1LW4A 3AEPA 3HLMA 3I5TA 3RBLA 4Z66B 4J8UA 4AZKA 3AZHD 4CBSA 2BYMB 5AVBD 3RELA 5I92A 1H3OA 2CJHA 4DGTA 4WU8D 3NQJB 4X23A 5B2JA 4WU9D 4LW2A 3LJAB 3G7QA 3TFTA 1AY8A 4H9SA 1ARIA 3RELC 2DF4C 4X23C 5B2JC 1W3UA 1M19A 4Q31A 4H9SC 2EZ2A 4W1WA 2QB3A 3FDDA 3NYUA 1Q9CA 5GXQD 3KWQA 2Y2OA 4H51A 1CQ7A 1M19C 2F8NA 4K2MA 1R4VA 1CZEA 5AY8A 5GT0D 1ARHA 3AZGA 2ZM5A 2HIOB 3KWQC 4F5IA 2BKWA 1ZOBA 1AKBA 2Y2KA 5AY8C 4K2IA 3C1CD 4A0GA 5B32D 2VGUA 3P1TA 3AZNB 3UTAA 4ATPA 1TPLA 3X1VC 1P3PD 5E4ZA 1YNUA 1YIYA 3LVJA 2QLRA 3R45B 2ZYJA 2YCNA 4W5KA 3UTAC 3EI8A 1KKPA 3AEMC 2YFWB 5JA4A 1MLZA 4UQVA 3Q8NA 1S07A 1MAQA 2BWPA 5KDMB 3AEOA 5B40B 2W7KA 5AV5B 1T3UA 2VYCA 4XK1A 3AV7A 3JWAA 3X1UA 3CQ5A 1I29A 4CAYA 3CAIA 2EPJA 1O69A 4J8VD 3DZZA 5JRGA 3WA9A 1Z7DA 4WBTA 4H9OA 3X1UC 1WYTB 1IAYA 4WZSB 3VH5A 4BHDA 1N1JA 3FRKA 5BNVB 3MADA 3NX3A 5JRGC 3EI6A 5HXXA 3WA9C 1O4SA 4UUZA 1IJIA 2W8JA 3T32A 3MGSB 4H9RB 1ELUA 3KUYA 4MY5A 3FCRA 1P3MA 5DNMD 3LELD 2HUEB 4ZM3A 5E5AA 4UPKA 4ADDA 4WYFA 4XUJA 3EZ1A 2BI9A 2L5AA 3RELB 5B32G 3AZIA 1H3OB 3B1DA 3KUYC 3L8AA 4X23B 5AX8A 2ZJGA 5B2JB 3EPJA 2JCHA 4F5LA 4BA5A 1P3MC 4KGCA 4AH3A 5BNXB 5E5AC 3RCHA 3NUBA 3TATA 3B0CW 4XUJC 4R8PA 1LC8A 3AZIC 1FG3A 5EAAA 3AFAB 2ORDA 1ZODA 1M19B 2BYJA 4KGCC 2CB1A 1AAMA 4Q75A 4R8PC 3A6NC 4YM6D 5F9SA 3EIBA 3KWQB 1YJSA 5K8BA 1TOKA 2NZDC 2F8NB 1P3GB 5AY8B 3F9TA 5EUDA 5B0YA 5C3IC 5FT5A 5B31C 1ID3D 2E7UA 4IXOA 3AENA 1WSTA 3X1VB 3W97A 3AEJA 4Q76A 3B0DC 5AVCA 3AZND 2R5CA 5DNNA 4H9NB 5B0YC 3KGXA 1JS6A 3AZMD 1BW0A 1P3BD 3W97C 3AEJC 1XEYA 4RITA 4WLHA 5AVCC 3WTPE 5DNNC 1JFIA 5B0ZC 1OXOA 4NE6A 1VP4A 3AN2D 3BCXA 1AHEA 3E77A 4N0WA 1V2EA 4E1OA 5AV5D 5AV6D 3W1JA 4J8WC 2VMVA 2AY5A 3PGYA 4M2KA 1ASMA 3X1UB 1U35D 1N8PA 4RKCA 3AZLA 1ARTA 4F4EA 2VMUA 5JRGB 5DX5A 4BMKA 2WK9A 4H9OB 4J8XA 3AZLC 1N1JB 1AKCA 2Y2LA 5B24B 3FZ7A 3PDBA 4YS3D 3AYWA 4EFFA 3ELPA 2AATA 2D63A 3UTBA 3ASAA 4ZUXA 4J8XC 2FQ6A 3KUYB 1QJ5A 2W7GA 2TPLA 3NQUB 1P3MB 1P3AD 3B1EA 3I16A 5D5SA 3TU4B 3AYWC 2PYOA 3WTPD 3UTBC 3AZIB 4ZUXC 4QLCA 2AY4A 2YRIA 1SZUA 3DC1A 4KGCB 2O0RA 3AZED 4E44A 2PYOC 1PMOA 3A6NB 2CJGA 3MNNA 4A0HA 2W7JA 4OBUA 4QLCC 1BH8A 4ZWMA 3UT9D 2NZDB 2IO5B 1UU0A 4WYGA 2ZC0A 5B33A 1AOIA 5C3IB 4Q6RA 5B31B 3EI7A 1GEYA 3MNNC 2XBNA 5EAVA 2C7TA 4ZLVA 3B0DB 2EO5A 4ADEA 5B33C 5B0YB 1AOIC 1SPAA 3MAFB 2HUFA 2QMAA 1IX7A 5B1LA 3AENB 2Y2MA 1AHFA 1P34A 4A0FA 3AZFC 3AV2C 4IY7A 4F5GA 3H0RC 5CP6D 5B1MB 5DNNB 2R5CB 3N4XA 2GMSA 5B0ZB 1KX4A 5E5IA 1TAFA 3BCAA 3N5MA 1EG5A 5AV9B 1QITA 4XZQB 1TOGA 5AVBC 3LZ0A 1KX4C 2CINA 4J8WB 4WU9C 3O62B 3FTBA 2JJFA 5FT8A 4IYOA 1ULYA 3HMUA 3LZ0C 1U08A 2FN6A 3DYDA 3RI6A 5GT3B 1ZLAA 5GT0A 3FFHA 5BJ4A 3REIA 1YOOA 3IHJA 4Z5TD 1P3FA 1GC0A 4CSRA 1S0AA 1HTAA 1B5OA 1ZLAC 4WB0A 2ZY3A 5GT0C 3KXBB 3C1CA 5B32A 5D95A 4BQ0A 5IWQA 3X1TA 1W7LA 3N75A 1KX5D 4JJND 3FSLA 4W8IA 4J8XB 1KL2A 4JEXA 4WXGA 3C1CC 3LWSA 5B32C 3K40A 4KYOA 1B6WA 2FJ7D 3UTBB 1P3LA 3AV1D 3VAXA 1P3PC 2PO3A 4J5UA 4QLCB 3MVDD 3ISLA 1I41A 2W8SA 2VMWA 3GBXA 1ELQA 4B9BA 2YFVB 2DGKA 1M0PA 2VMTA 3MNNB 1IVRA 3ECDA 4XJOA 2QSRA 3MAUA 5G2QA 2AY1A 5M4DA 1M1AD 3N4RA 3B6FD 3MGRB 4EO5C 3BS8A 4J8VC 5EFSA 3NUIA 3AZFB 3AV2B 4LNJA 4Z66A 1RVYA 3WCNA 1AIBA 2UWXA 4EB5A 2BYMA 3LELA 3BCBA 3AZHB 4DBCA 5F99D 4R8DA 5EIGA 4OCAA 1O62A 1BJNA 5AVBB 3MBBA 4WU8B 1TAFB 4K2BA 4WU9B 3W96D 3LELC 4UOYA 4A00A 1AHXA 2DGLA 3F6TA 2G7JA 4HF8A 1DGDA 4XEWA 3H0LC 1AMRA 1AMSA 4YM6A 1KMJA 2VMZA 5GXQB 1AY5A 3B6GD 2AY2A 3MGQD 4EMYA 2HIOA 5GT0B 3B46A 1WYVA 4CVQA 4EB7A 4YM6C 1ASNA 1P3WA 1ASEA 4CSRB 3UE8A 2VMYA 3TQXA 5AV8D 2HIOC 4WB0B 3AZNA 3C1CB 5B32B 2F8NK 1ID3C 5B31G 3AZMA 4Z2MH 3E9KA 1P3BA 3AZJD 3R45A 3HBXA 3AZNC 1P3PB 1UU2A 3R4TA 1CQ8A 3AZMC 1MDXA 2F8JA 2BHXA 1P3BC 4M6BA 3WCOA 5B40A 2OKKA 5AV5A 1SF2A 4ZDPA 3X1SD 1B4XA 1M0QA 2AEUA 9AATA 1GC2A 3NRAA 4AZJA 1CJ0A 5B40C 5AV5C 4ISYA 3WKJD 3KGWA 4EO5B 4J8VB 1GD9A 1WYTA 5BO0A 4L0OA 2Z20A 5B2ID 2CFBA 1U35C 5BNVA 4NE3A 2VGTA 4DRBA 3DODA 3FVXA 4Z2MG 3MGSA 4H9RA 4YS3A 4Y0IA 3II0A 3G8MA 2JJGA 4KAMA 3HL2A 3PDXA 1BQDA 3WAAD 4ITGA 1IX6A 5DNMB 3LELB 2VQRA 3MGSC 4YS3C 1M32A 5EIGB 5FT4A 2CH1A 1M7YA 2YRRA 1O61A 2HUEC 5BNXA 2DOUA 1QIRA 5GSUD 4TN4A 1P3AC 1B5PA 3AZEA 3IP4C 3AFAA 1TOEA 2D64A 3VH5T 4RJYA 4WP0A 2ZY4A 1BJWA 2VMXA 5KTBA 3L44A 3UT9A 2D61A 3AZEC 3AFAC 3PA9A 1AY4A 1P3GA 4YM6B 3ZZJA 3UT9C 2Y2IA 2VGVA 1WYVB 3V9RB 3X1VA 2G5HC 1ID3B 1P3GC 4H9NA 2DQNC 3COGA 2CV5D 1G4VA 3OP7A 3AEMA 3HVYA 3C1BD 3AZMB 2HZPA 5CPJD 1P3BB 5CP6C 1FG7A 2JG2A 5EQCA 3AN2B 1KKJA 3E2FA 1BS0A 2VGWA 4ITXA 5AV6B 1VEFA 1QGNA 4H63Q 1D2FA 5G0AA 4Z5TA 4DRAA 1U35B 1CS1A 2Y2PA 1M18D 1EJIA 4JEZA 1JF9A 5BO0B 1TARA 2QB2A 3REKD 4Z5TC 3UWCA 1KX5A 3KKIA 2RIQA 1WWSA 3W99B 2C81A 3VP6A 5B24A 2VMOA 5G49B 2VGZA 4YS3B 1WWIA 4G91B 1KX5C 3ELEA 3NQUA 5B24C 3TU4A 3REHD 1QJ3A 1P3AB 3A9XA 1I48A 5C6UA 2C0RA 2FNIA 3WTPB 2BI1A 3AV1C 3DU4A 3TU4C 2Z9VA 1WYUA 3A6NA 2HOZA 2BG1A 3AZEB 2DGMA 3ATHA 3G0TA 2NZDA 2BYKB 2EGYA 3MVDC 4FFCA 5B31A 3UT9B 5BS7C 1MLYA 4OBVA 1S32D 4I8AA 3B6FA 4ZASA 2VLHA 2IO5C 1KMKA 1OATA 2AY7A 3MAFA 1M1AC 3A9YA 4UHOA 3B6FC 4LD9D 5B1MA 1W23A 5B0ZA 5CP6B 1BFMA 1W7NA 1Z2CB 1DJUA 5AV9A 3LZ1D 4Y0HA 4XZQA 5B1MC 3NYSA 4XAUA 4NOGA 2DR1A 4JEVA 4J8WA 5AV9C 3O62A 1YIZA 3W98D 2E7JA 4GE7A 4XZQC 3W96C 2Z9XA 2XH1A 5GT3A 3FFRA 3O62C 3GSBA 4XQ2A 1KX3D 3AZKD 3MGQA 1G4XA 4JEWA 1X29A 4K05A 5GT3C 1MAPA 3GR9A 4Z5TB 1P3KD 3KXBA 3B6GC 3MGQC 2OGEA 2RVQD 3UAKA 3W99D 1C7OA 2G5IC 1M4NA 1AICA 2BI3A 1KX5B 1MDZA 4JJNB 4O6ZA 3KXBC 1LC5A 5G4JA 5FUGA 5AV8C 3AOWA 4KXKA 4GEBA 1X28A 2FJ7B 8AATA 3VH5W 2FM1A 3AV1B 2VIBA 2YHKA 4ZSWA 4J8UD 3MVDB 2YFVA 3BN1A 1WYUB 3WZFA 2VLFA 3X1SC 2NQBD 4OTLA 2HOXA 2Z1YA 2J8PA 3PD6B 3MGRA 5B2IA 1M1AB 3QN6A 1ASLA 3H0MC 3WKRA 3AZFA 3AV2A 3B6FB 3GZDA 3WKJC 1EQZD 4ZM4A 2HUIA 2GSAA 2R0TA 5EUNA 3MGRC 5B2IC 4F5HA 2QBTA 3ZRQA 1V72A 3GZDC 1HQ3D 3BV0A 2R2NA 3AZHA 1C0NA 5AVBA 3QHXA 5FT6A 1ECXA 5M49A 4WU8A 3AZGD 5F99B 1D7SA 4WU9A 1SVVA 3WAAC 3AZHC 2BYLA 5GSUA 3W96B 1DGEA 4PIWA 4DQ6A 4WU8C 3WY7A 2E54A 2W7MA 2E7IA 2X5DA 3UTAD 4JEYA 4PFFA 5GSUC 1RVUA 1X0MA 3HQTA 5GXQA 4AOAA 2JJEA 1BT4A 4R5FA 3A8UX 3B6GB 3MGQB 5GXQC 2O1BA 2W7FA 3MGPB 1N2TA 3GETA 4UHNA 2CV5A 5AV8B 1TATA 3VH6A 4BA4A 1PMMA 3C1BA 1P3PA 2CH2A 4IW7A 3AZJB 5FUGB 2CV5C 3WA9D 4TMRA 5J8QA 5G4IA 3K7YA 3C1BC 4J8LA 4H9PB 3EPKA 2D5YA 5CPJC 2D65A 3REJD 1H1CA 1G7WA 1OHYA 3FKDA 3PJ0A 4JF0A 3X1SB 3EPHA 3EG5B 2JE5A 2YKUA 3FVUA 1LC7A 5E5AD 2OGAA 4RLGA 4J8VA 4QGRA 5CHLB 1M18A 2AY6A 3WKJB 1W2EA 5B2IB 1ASCA 5BT1D 3REKA 4ZBJB 4R8PD 4GE9A 3PIUA 1M18C 2R5EA 2V1PA 1VJOA 2VMSA 2PB0A 2Q7WA 3REKC 2CSTA 4OMAA 5DNMA 4LC3A 3WAAB 1CZCA 3TFUA 2VMNA 4WLJA 3REHA 1UKJA 4JF1A 4ZSYA 1DJ9A 4ZAHA 5DNMC 1AMAA 4ZDOA 2AY8A 3OKSA 5GSUB 3W1HA 3W97D 3REHC 5AVCD 1SZKA 3P6KA 1YJZA 4XJPA 2ZP7A 2EYQA 1UU1A 2CWEA 4GDYA 5EUEA 1DJEA 3V9RA 3NU7A 1ID3A 2WK7A 4CXQA 1N31A 1LK9A 1LKCA 1AHGA 3MGPD 1TZYD 2D66A 3DXWA 4A6TA 4LD9A 1XI9A 2X3LA 2D7ZA 1MDOA 1OXPA 2AEVA 2CV5B 4E3QA 3QGUA 1IUGA 5G2PA 5CPKD 3LZ1A 1C4KA 4LD9C 3C1BB 3FDBA 3AZLD 4P7YA 5M46A 3K28A 5CPJB 4AWLB 3PAAA 1B9HA 1AIAA 3MEBA 3AN2A 3PPLA 3LZ1C 3W98A 3FVSA 2GQNA 2A1VA 3RQ1A 5DB5A 3F0HA 5AV6A 2O7CA 1AAWA 3I4JA 3AYWD 3N7NA 3AN2C 2CANA 2D7YA 1PZRA 4RJ0A 3W98C 1KX3A 3AZKA 4ZUXD 1P3ID 1U35A 1F1EA 5AV6C 2PYOD 3NYTA 2DKBA 2Z1ZA 1J32A 1KX3C 3AZKC 3CBFA 2ZY2A 1M18B 1J04A 4RIZA 3W99A 1BH9B 3REKB 4M2MA 1P3KC 5CPID 1X2AA 5G49A 4MKJA 4XJLA 4W1VA 2RVQC 4W1XA 3W99C 5B33D 2W8VA 4OYTA 1P3AA 4WXFA 4FL0A 4G91C 2C44A 3REHB 3WTPA 1B67A 1TASA 4MKKA 1W7MA 5B1LD 3E6GA 1P34D 3WTPC 1WKGA 3DR7A 2ZSMA 2BYKA 2NMPA 1KX4D 1B8GA 3KFUG 2NQBA 1IX8A 4J8UC 1S32B 3GZCA 3WLXA 1F66D 3LZ0D 2NQBC 3JZLA 1EQZA 2G6WA 1M0OA 1Z3ZA 1KU5A 1HQ3A 2BI2A 4LD9B 1EQZC 5CP6A 3BC8A 3WX9A 1ZLAD 4MQRA 3REID 2Z9UA 4E45A 1H0CA 3LZ1B 1P3FD 1HQ3C 2BIGA 2X8UA 3AELA 3LVKA 3AZGC 3X1TD 2GB3A 3W98B 3P5JB 1ASBA 2Y2NA 5F8VA 2AROD 4WJ3C 1P3OD 3VK4A 4MSOA 1P3LD 3AZKB 1KX3B 3DRDA 2OATA 1B9IA 3FD0A 1BJOA 1P3KB 2JISA 2JGTA 4ATQA 2W7HA 4JJNA 3D6KA 7AATA 2WB6A 4RAEA 2ZY5A 4Y0DA 3EI5A 1D7UA 4ZDLA 4KUDD 4EU1A 4GE4A 2FYFA 3VOMA 2W8WA 5M4BA 1E5EA 2FJ7A 4JJNC 1D7VA 2DKJA 5G09A 3AV1A 4LNLA 4OT8A 4WD2A 1JG8A 3REJA 3B8XA 2FJ7C 4AO9A 3NDNA 4Z66D 3N4SA 3MVDA 5BS7A 4J8UB 3REJC 3FQ7A 1AJSA 1QISA 4B98A 4MQPA 3LJAD 3PD6A 1M1AA 2NQBB 3EUCA 1D7RA 4GRXA 2HP2A 3DR4A 2F2AC 1EQZB 2YCTA 4E77A 4WNNA 2HUUA 2Z61A 1CQ6A 5BT1C 4A72A 4PFNA 1RV4A 3W1IA 1HQ3B 3CQ4A 2V0YA 5F99A 3LY1A 2HIOD 1DKAA 2W8UA 2JSSA 1KL1A 3AZGB 1GBNA 2YKYA 4PVFA 3B0BA 3W96A 1IAXA 1S06A 5F99C 1ARSA 4WYDA 3LVLB 1EQBA 2RFVA 2EZ1A 4NE5A 4IXSA 3UTAB 2AY9A 3H9XA 3M5UA 1JS3A 3B1CA 3B6GA 3NU8A 1T3IA 2W8TA 1C7NA 1ZC9A 3MGPA 3DXVA 5JA4B 5B40D 1TZYA 2OKJA 3KSYA 4DQYB 5AV8A 4KHAA 4G92C 1BJOB 5HDMA 1RV3A 2FKIA 3NNKA 5JAYA 2Z9WA 3MGPC 5CPKA 1TZYC 4CAYB 3AZJA 1GDEA 2W7IA 3E2ZA 3R9AA 1CL2A 1GCKA 1OHWA 3WA9B 2YKXA 2XD1A 4H9PA 5CPKC 2CY8A 3AZJC 1I43A 1ASFA 3A1KA 3REJB 3JTXA 5BJ3A 1A7WA 3MGSD 4UUZB 3X1SA 4E3RA 3BB8A 3GWPA 4RKDA 1P3IA 3RELD 1AJSB 2HORA 4A6RA 3VH6T 5E5AB 4X23D 3WKJA 5B2JD 3AL0C 3LVMA 4XUJB 1GC3A 1P3IC 1M0NA 1AHYA 2Y2QA 3RCHB 3TCMA 3AFAD 2CJDA 4R8PB 1M19D 3JW9A 5CPIA 1GC4A 4ZBJC 3EI9A 3EPLA 4WNNB 3KWQD 1PG8A 3JWBA 3WAAA 2F8ND 3RUYA 1P3GD 3QBOA 5CPIC 5AY8D 3N0LA 2VGSA 3WGBA 1AJRA 3AATA 3X1VD 2CTZA 3A1IA 3HDOA 3A2BA 4WXBA 1C7GA 3W97B 3FQ8A 3BWOA 4F5FA 5AVCB 2F8NH 4U1TA 5B1LC 4RM1A 1ASAA 2Y2HA 1P34C 2VI8A 4WYAA 2GMUA 4AO4A 3WKSA 1JFIB 4M2JA 1F66A 2KFPA 3RBFA 1WKHA 4G92B 4R5ZA 1E5FA 1C9CA 1YJYA 3VK2A 1BQAA 4UHMA 4ADBA 1F66C 3CQ6A 1TZYB 3FZ6A 2ZUKA 4KHAB 3HT4A 3A9ZA 3X1UD 2VMQA 2BI5A 2YKVA 2AY3A 5CPJA 5CPKB 5DJ1A 5JRGD 2YCPA 1ORDA 3E2ZB 3LG0A 3AZLB 2VI9A 5HHYA 4F5JA 3REIC 2LY8A 4CBRA 4F5MA 4P3MA 2VMPA 1P3FC 4AWLC 3MC6A 3EZSA 5B24D 3ZZKA 2OQXA 2F8NG 2AROA 1P3OA 1CL1A 3PDBB 1LS3A 3X1TC 3AYWB 3KUYD 4WYEA 1P3MD 3MC6C 1G7XA 3FZ8A 3QM2A 4ZUXB 5DJ9A 3TU4D 1P3IB 4IXZA 2AROC 4U2HA 3USFA 3WGCA 4XUJD 4H9QA 1P3OC 4R2NA 3AZID 2PYOB 3BWNA 1ARGA 2W7EA 3FQAA 2FNUA 1P3LC 4KGCD 3EIAA 1BH9A 2WK8A 3A6ND 4ADCA 5TF5A 2YOBA 3BWNC 3QPGA 4KUDA 2NZDD 2JJHA 1GEXA 5CPIB 4A6UA 2BWOA 1BH8B 5B31D 3ZRRA 4LNMA 2EH6A 2PB2A 1AX4A 4LW4A 3VK3A 5B33B 1AOIB 1FC4A 3H7FA 4KUDC 4CXRA 5B0YD 1ASDA 3AOVA 4HGAC 5E3KA 2FFFB 2BIAA 5B1LB 5B1MD 5DNND 1P34B 5B0ZD 4GSAA 4OC9A 3NQJA 2ZSLA 4Z66C 1PFFA 1GEWA 1V2DA 5AV9D 3LJAA 1V2FA 1KX4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5C B;  4UHO A;  2GMS A;  2W7D A;  4HVK A;  1W23 A;  5E5I A;  2G6W A;  3BCA A;  1M0O A;  1Z3Z A;  3N5M A;  1EG5 A;  1QIT A;  3GJU A;  1W7N A;  3LV2 A;  1DJU A;  4Y0H A;  3ZRP A;  2BI2 A;  1TOI A;  1TOG A;  3BC8 A;  3WX9 A;  4MQR A;  2CIN A;  4WYC A;  3NYS A;  4XAU A;  4NOG A;  2DR1 A;  3FTB A;  2Z9U A;  4JEV A;  2X5F A;  2JJF A;  4IYO B;  1H0C A;  5FT8 A;  1IBJ A;  1S08 A;  3ACZ A;  2VMR A;  1M6S A;  2BIG A;  1YIZ A;  2X8U A;  4IYO A;  1DFO A;  1AKA A;  2E7J A;  1U08 A;  2FN6 A;  3HMU A;  4GE7 A;  3DYD A;  3AEL A;  4IX8 A;  3RI6 A;  3LVK A;  2Z9X A;  2XH1 A;  3FFH A;  3FFR A;  5BJ4 A;  2GB3 A;  3GSB A;  1YOO A;  3IHJ A;  1ASB A;  1DTY A;  4XQ2 A;  5F8V A;  1GC0 A;  1G4X A;  1S0A A;  2HOY A;  3KE3 A;  4JEW A;  1B5O A;  1X29 A;  2WKA A;  1BKG A;  2HP1 A;  3VK4 A;  4WB0 A;  2ZY3 A;  1MAP A;  1S09 A;  3GR9 A;  4A0R A;  5D95 A;  4MQQ A;  4BQ0 A;  4F5K A;  5IWQ A;  2BWN A;  4MSO A;  1W7L A;  3DRD A;  3N75 A;  2OAT A;  3FSL A;  4W8I A;  1YAA A;  1BJ4 A;  4W91 A;  2OGE A;  1B9I A;  1TOJ A;  1KL2 A;  3UAK A;  3E2Y A;  1C7O A;  4JEX A;  4WXG A;  3LWS A;  3K40 A;  1BJO A;  1M4N A;  1AIC A;  2BI3 A;  4KYO A;  4XJM A;  1MDZ A;  4O6Z A;  1LC5 A;  5G4J A;  2JGT A;  3QI6 A;  4ATQ A;  1MGV A;  2W7H A;  3D6K A;  7AAT A;  4RAE A;  3VAX A;  2ZY5 A;  4Y0D A;  3AOW A;  3EI5 A;  1D7U A;  2PO3 A;  4KXK A;  4ZDL A;  4GEB A;  2VIA A;  1X28 A;  4EU1 A;  4GE4 A;  1SFF A;  2FYF A;  4J5U A;  8AAT A;  1QZ9 A;  4ZWV A;  1Y4I A;  2FM1 A;  2BIE A;  3VOM A;  2W8W A;  5M4B A;  1E5E A;  1ASG A;  2VIB A;  1D7V A;  1OHV A;  2DKJ A;  3NTJ A;  2YHK A;  5G09 A;  2QA3 A;  4ZSW A;  1AMQ A;  1I41 A;  3ISL A;  2VMW A;  3GBX A;  1ELQ A;  3MKJ A;  4B9B A;  1SZS A;  3ASB A;  4LNL A;  4OT8 A;  4WD2 A;  1M0P A;  1JG8 A;  2VMT A;  3B8X A;  1IVR A;  1LW5 A;  2W7L A;  3ECD A;  4XJO A;  3MAU A;  4AO9 A;  3BN1 A;  5G2Q A;  2AY1 A;  1WYU B;  3NDN A;  5M4D A;  3WZF A;  2VLF A;  1LW4 A;  3AEP A;  4OTL A;  2HOX A;  3BS8 A;  3HLM A;  3FQ7 A;  1AJS A;  3I5T A;  3RBL A;  2Z1Y A;  3PD6 B;  5EFS A;  3NUI A;  1QIS A;  3QN6 A;  1ASL A;  4AZK A;  4LNJ A;  3WKR A;  4B98 A;  4MQP A;  3PD6 A;  1RVY A;  3GZD A;  4CBS A;  4ZM4 A;  2HUI A;  1AIB A;  2GSA A;  2R0T A;  3EUC A;  2CJH A;  5EUN A;  5I92 A;  4DGT A;  4EB5 A;  1D7R A;  3BCB A;  4F5H A;  4GRX A;  4LW2 A;  3G7Q A;  4DBC A;  1AY8 A;  2HP2 A;  2QBT A;  3ZRQ A;  1V72 A;  3TFT A;  4R8D A;  5EIG A;  4OCA A;  3GZD C;  1ARI A;  1O62 A;  3DR4 A;  3BV0 A;  1BJN A;  2R2N A;  2YCT A;  3MBB A;  4E77 A;  1C0N A;  2HUU A;  2Z61 A;  4K2B A;  1W3U A;  3QHX A;  1CQ6 A;  5FT6 A;  1ECX A;  4A72 A;  4UOY A;  5M49 A;  4Q31 A;  4PFN A;  1D7S A;  1RV4 A;  2EZ2 A;  4A00 A;  3CQ4 A;  4W1W A;  1SVV A;  2V0Y A;  2QB3 A;  3FDD A;  1AHX A;  2BYL A;  3LY1 A;  3NYU A;  1DKA A;  4H51 A;  1CQ7 A;  1DGE A;  1KL1 A;  2W8U A;  1GBN A;  2YKY A;  4K2M A;  4PIW A;  1CZE A;  4PVF A;  4DQ6 A;  3F6T A;  3WY7 A;  2E54 A;  4HF8 A;  1DGD A;  1IAX A;  2W7M A;  1S06 A;  4XEW A;  1ARH A;  2E7I A;  2X5D A;  1AMR A;  1AMS A;  1KMJ A;  2VMZ A;  1ARS A;  4JEY A;  4PFF A;  4WYD A;  1AY5 A;  2AY2 A;  4F5I A;  1RVU A;  2BKW A;  3LVL B;  1X0M A;  3HQT A;  1EQB A;  1ZOB A;  4AOA A;  1AKB A;  4EMY A;  2RFV A;  2EZ1 A;  2JJE A;  1BT4 A;  3B46 A;  4K2I A;  1WYV A;  4R5F A;  4IXS A;  3A8U X;  4A0G A;  2VGU A;  4CVQ A;  4EB7 A;  1ASN A;  2AY9 A;  3P1T A;  1P3W A;  1ASE A;  3M5U A;  1JS3 A;  1TPL A;  3UE8 A;  2VMY A;  4ATP A;  3B1C A;  3TQX A;  4WB0 B;  2O1B A;  2W7F A;  1YNU A;  3NU8 A;  5E4Z A;  1YIY A;  3LVJ A;  2QLR A;  1T3I A;  2W8T A;  3E9K A;  1N2T A;  2ZYJ A;  2YCN A;  4W5K A;  1C7N A;  3GET A;  1ZC9 A;  3EI8 A;  3DXV A;  4UHN A;  1KKP A;  3AEM C;  1TAT A;  4BA4 A;  1BJO B;  1UU2 A;  3R4T A;  1MLZ A;  1RV3 A;  5HDM A;  4UQV A;  1CQ8 A;  3Q8N A;  3NNK A;  1S07 A;  2CH2 A;  1MDX A;  2Z9W A;  5JAY A;  1MAQ A;  4IW7 A;  2F8J A;  2BHX A;  2BWP A;  3AEO A;  4TMR A;  2W7K A;  5J8Q A;  5G4I A;  1GDE A;  2W7I A;  3E2Z A;  2VYC A;  4XK1 A;  3AV7 A;  3R9A A;  3JWA A;  3K7Y A;  1SF2 A;  4ZDP A;  3CQ5 A;  2D5Y A;  1I29 A;  3CAI A;  1CL2 A;  2D65 A;  1B4X A;  1GCK A;  2EPJ A;  1M0Q A;  1O69 A;  1OHW A;  9AAT A;  1H1C A;  2YKX A;  1GC2 A;  1G7W A;  1OHY A;  3FKD A;  3DZZ A;  3PJ0 A;  3NRA A;  4AZJ A;  2CY8 A;  1I43 A;  1ASF A;  1Z7D A;  4WBT A;  1CJ0 A;  4JF0 A;  1WYT B;  1IAY A;  4ISY A;  3KGW A;  4BHD A;  3JTX A;  1GD9 A;  2YKU A;  1WYT A;  5BJ3 A;  4L0O A;  3FVU A;  2Z20 A;  1LC7 A;  3FRK A;  3MAD A;  2OGA A;  3EI6 A;  3BB8 A;  3NX3 A;  4E3R A;  5HXX A;  4QGR A;  4RKD A;  2CFB A;  1O4S A;  1IJI A;  2W8J A;  2AY6 A;  3T32 A;  2VGT A;  1AJS B;  1ELU A;  2HOR A;  4A6R A;  3DOD A;  1ASC A;  3FVX A;  3LVM A;  4MY5 A;  3FCR A;  4Y0I A;  4GE9 A;  1GC3 A;  4ZM3 A;  3PIU A;  3II0 A;  4ADD A;  3G8M A;  2R5E A;  4WYF A;  2JJG A;  3EZ1 A;  4KAM A;  3HL2 A;  2BI9 A;  3PDX A;  1BQD A;  1M0N A;  1AHY A;  1VJO A;  2V1P A;  3B1D A;  1IX6 A;  4ITG A;  3L8A A;  5AX8 A;  2ZJG A;  2VMS A;  4F5L A;  2PB0 A;  3RCH B;  3TCM A;  2Q7W A;  4BA5 A;  2CJD A;  2CST A;  3JW9 A;  4OMA A;  4AH3 A;  1M32 A;  3RCH A;  5EIG B;  3NUB A;  3TAT A;  5FT4 A;  2CH1 A;  1GC4 A;  1M7Y A;  2YRR A;  1O61 A;  4LC3 A;  3EI9 A;  1LC8 A;  1CZC A;  3TFU A;  2DOU A;  2VMN A;  1FG3 A;  1QIR A;  4WLJ A;  5EAA A;  1PG8 A;  1UKJ A;  2ORD A;  3JWB A;  4TN4 A;  1ZOD A;  4JF1 A;  2BYJ A;  1B5P A;  3RUY A;  3QBO A;  4ZSY A;  2CB1 A;  1TOE A;  2D64 A;  1DJ9 A;  4RJY A;  1AAM A;  3N0L A;  4Q75 A;  4ZAH A;  4WP0 A;  1AMA A;  2ZY4 A;  4ZDO A;  5F9S A;  2AY8 A;  1BJW A;  2VGS A;  2VMX A;  3EIB A;  3OKS A;  3WGB A;  1YJS A;  3L44 A;  5K8B A;  1AJR A;  2D61 A;  1TOK A;  3AAT A;  2CTZ A;  1SZK A;  3P6K A;  3F9T A;  5EUD A;  3PA9 A;  5FT5 A;  3HDO A;  3A2B A;  4WXB A;  2E7U A;  1AY4 A;  1C7G A;  4IXO A;  1YJZ A;  3AEN A;  1WST A;  3FQ8 A;  3ZZJ A;  3BWO A;  4F5F A;  4XJP A;  2VGV A;  2ZP7 A;  3AEJ A;  4Q76 A;  4U1T A;  1UU1 A;  1WYV B;  2R5C A;  1ASA A;  4GDY A;  2VI8 A;  4WYA A;  5EUE A;  2GMU A;  3KGX A;  1JS6 A;  1DJE A;  3NU7 A;  2WK7 A;  4CXQ A;  1N31 A;  3COG A;  1LK9 A;  4AO4 A;  1BW0 A;  1AHG A;  1LKC A;  3WKS A;  4M2J A;  3AEJ C;  4WLH A;  3RBF A;  1G4V A;  1WKH A;  2D66 A;  3OP7 A;  3DXW A;  4A6T A;  1XI9 A;  1OXO A;  3AEM A;  4R5Z A;  1E5F A;  1C9C A;  1YJY A;  1VP4 A;  2D7Z A;  3VK2 A;  1BQA A;  1MDO A;  2HZP A;  1OXP A;  4UHM A;  3BCX A;  4ADB A;  4E3Q A;  3QGU A;  1AHE A;  1IUG A;  3CQ6 A;  5G2P A;  3E77 A;  1C4K A;  1FG7 A;  2JG2 A;  2ZUK A;  4N0W A;  5EQC A;  1V2E A;  4E1O A;  3A9Z A;  3FDB A;  4P7Y A;  5M46 A;  3K28 A;  1KKJ A;  2VMQ A;  3E2F A;  1BS0 A;  2BI5 A;  2VMV A;  2YKV A;  3PAA A;  2AY3 A;  1B9H A;  1AIA A;  2VGW A;  3MEB A;  5DJ1 A;  2AY5 A;  3PPL A;  4ITX A;  2YCP A;  1ORD A;  3E2Z B;  3LG0 A;  3FVS A;  3PGY A;  4M2K A;  1ASM A;  1N8P A;  1VEF A;  2VI9 A;  5HHY A;  2GQN A;  4RKC A;  3RQ1 A;  4F5J A;  5DB5 A;  3F0H A;  4CBR A;  1QGN A;  2O7C A;  4F5M A;  1ART A;  4F4E A;  4P3M A;  1AAW A;  2VMP A;  3I4J A;  2VMU A;  2CAN A;  2D7Y A;  1D2F A;  5DX5 A;  5G0A A;  4BMK A;  3MC6 A;  2WK9 A;  3EZS A;  1CS1 A;  3ZZK A;  2OQX A;  1EJI A;  4JEZ A;  1CL1 A;  1JF9 A;  1LS3 A;  3PDB B;  1AKC A;  1TAR A;  2QB2 A;  3NYT A;  4WYE A;  3PDB A;  3MC6 C;  1G7X A;  3UWC A;  2DKB A;  2Z1Z A;  1J32 A;  3QM2 A;  5DJ9 A;  4EFF A;  3CBF A;  3KKI A;  3ELP A;  2ZY2 A;  4IXZ A;  2AAT A;  4U2H A;  2C81 A;  1J04 A;  3USF A;  3WGC A;  2D63 A;  3ASA A;  2FQ6 A;  4R2N A;  2VMO A;  1QJ5 A;  3BWN A;  2W7G A;  1ARG A;  2TPL A;  2W7E A;  3FQA A;  2VGZ A;  4M2M A;  3B1E A;  5D5S A;  2FNU A;  3EIA A;  3ELE A;  2WK8 A;  1X2A A;  4MKJ A;  4XJL A;  4W1V A;  4ADC A;  5TF5 A;  4W1X A;  2YOB A;  2AY4 A;  1QJ3 A;  3BWN C;  2YRI A;  3QPG A;  2W8V A;  3A9X A;  1I48 A;  1SZU A;  2JJH A;  3DC1 A;  5C6U A;  1GEX A;  2O0R A;  4OYT A;  2C0R A;  2FNI A;  4A6U A;  2BWO A;  2BI1 A;  3ZRR A;  2CJG A;  4LNM A;  2EH6 A;  2PB2 A;  4FL0 A;  4WXF A;  2C44 A;  3DU4 A;  4A0H A;  2W7J A;  2Z9V A;  1AX4 A;  4LW4 A;  3VK3 A;  1WYU A;  4ZWM A;  1TAS A;  1FC4 A;  3H7F A;  2HOZ A;  4MKK A;  1W7M A;  1UU0 A;  3ATH A;  4WYG A;  2ZC0 A;  3E6G A;  4CXR A;  4Q6R A;  3EI7 A;  1GEY A;  1ASD A;  2EGY A;  3AOV A;  4FFC A;  2XBN A;  5EAV A;  1WKG A;  3DR7 A;  5E3K A;  2ZSM A;  2C7T A;  1MLY A;  4ZLV A;  2BIA A;  2NMP A;  4I8A A;  2EO5 A;  4ADE A;  4ZAS A;  1B8G A;  1SPA A;  2VLH A;  1IX8 A;  1KMK A;  3MAF B;  2HUF A;  4GSA A;  2QMA A;  1IX7 A;  3AEN B;  4OC9 A;  1AHF A;  1OAT A;  2ZSL A;  4A0F A;  2AY7 A;  1PFF A;  1GEW A;  3A9Y A;  3MAF A;  1V2D A;  4IY7 A;  4F5G A;  3GZC A;  1V2F A;  3WLX A; 
#chains in the Genus database with same CATH topology
 4XZQ D;  1S32 A;  2W7D A;  4HVK A;  4J8W D;  3O62 D;  3GJU A;  3LJA C;  1F66 B;  3LZ0 B;  3LV2 A;  3ZRP A;  1S32 C;  1TOI A;  4WYC A;  5GT3 D;  2X5F A;  4IYO B;  1IBJ A;  1S08 A;  3ACZ A;  2VMR A;  1M6S A;  3B0C T;  1DFO A;  1AKA A;  1ZLA B;  4IX8 A;  3REI B;  1P3F B;  3KXB D;  1KAF A;  1DTY A;  2HOY A;  3KE3 A;  2WKA A;  4J8X D;  1BKG A;  3X1T B;  2HP1 A;  3VH6 W;  1S09 A;  4A0R A;  4F5K A;  4MQQ A;  2BWN A;  2ARO B;  1YAA A;  1BJ4 A;  1P3O B;  4W91 A;  3UTB D;  1TOJ A;  4NFT A;  3E2Y A;  2YFW A;  2Y2J A;  4XJM A;  1P3L B;  1P3K A;  4H9Q B;  3QI6 A;  2XD5 A;  1MGV A;  4WV4 B;  5KDM A;  4QLC D;  2VIA A;  1SFF A;  1QZ9 A;  4ZWV A;  1Y4I A;  2BIE A;  3MNN D;  1ASG A;  1OHV A;  3NTJ A;  2QA3 A;  4KUD B;  1AMQ A;  3MKJ A;  1SZS A;  1AOI D;  3ASB A;  3MGR D;  2W7L A;  1LW5 A;  4HGA B;  3AZF D;  3AV2 D;  2Y2G A;  1LW4 A;  3AEP A;  3HLM A;  3I5T A;  3RBL A;  4Z66 B;  4J8U A;  4AZK A;  3AZH D;  4CBS A;  2BYM B;  5AVB D;  3REL A;  5I92 A;  1H3O A;  2CJH A;  4DGT A;  4WU8 D;  3NQJ B;  4X23 A;  5B2J A;  4WU9 D;  4LW2 A;  3LJA B;  3G7Q A;  3TFT A;  1AY8 A;  4H9S A;  1ARI A;  3REL C;  2DF4 C;  4X23 C;  5B2J C;  1W3U A;  1M19 A;  4Q31 A;  4H9S C;  2EZ2 A;  4W1W A;  2QB3 A;  3FDD A;  3NYU A;  1Q9C A;  5GXQ D;  3KWQ A;  2Y2O A;  4H51 A;  1CQ7 A;  1M19 C;  2F8N A;  4K2M A;  1R4V A;  1CZE A;  5AY8 A;  5GT0 D;  1ARH A;  3AZG A;  2ZM5 A;  2HIO B;  3KWQ C;  4F5I A;  2BKW A;  1ZOB A;  1AKB A;  2Y2K A;  5AY8 C;  4K2I A;  3C1C D;  4A0G A;  5B32 D;  2VGU A;  3P1T A;  3AZN B;  3UTA A;  4ATP A;  1TPL A;  3X1V C;  1P3P D;  5E4Z A;  1YNU A;  1YIY A;  3LVJ A;  2QLR A;  3R45 B;  2ZYJ A;  2YCN A;  4W5K A;  3UTA C;  3EI8 A;  1KKP A;  3AEM C;  2YFW B;  5JA4 A;  1MLZ A;  4UQV A;  3Q8N A;  1S07 A;  1MAQ A;  2BWP A;  5KDM B;  3AEO A;  5B40 B;  2W7K A;  5AV5 B;  1T3U A;  2VYC A;  4XK1 A;  3AV7 A;  3JWA A;  3X1U A;  3CQ5 A;  1I29 A;  4CAY A;  3CAI A;  2EPJ A;  1O69 A;  4J8V D;  3DZZ A;  5JRG A;  3WA9 A;  1Z7D A;  4WBT A;  4H9O A;  3X1U C;  1WYT B;  1IAY A;  4WZS B;  3VH5 A;  4BHD A;  1N1J A;  3FRK A;  5BNV B;  3MAD A;  3NX3 A;  5JRG C;  3EI6 A;  5HXX A;  3WA9 C;  1O4S A;  4UUZ A;  1IJI A;  2W8J A;  3T32 A;  3MGS B;  4H9R B;  1ELU A;  3KUY A;  4MY5 A;  3FCR A;  1P3M A;  5DNM D;  3LEL D;  2HUE B;  4ZM3 A;  5E5A A;  4UPK A;  4ADD A;  4WYF A;  4XUJ A;  3EZ1 A;  2BI9 A;  2L5A A;  3REL B;  5B32 G;  3AZI A;  1H3O B;  3B1D A;  3KUY C;  3L8A A;  4X23 B;  5AX8 A;  2ZJG A;  5B2J B;  3EPJ A;  2JCH A;  4F5L A;  4BA5 A;  1P3M C;  4KGC A;  4AH3 A;  5BNX B;  5E5A C;  3RCH A;  3NUB A;  3TAT A;  3B0C W;  4XUJ C;  4R8P A;  1LC8 A;  3AZI C;  1FG3 A;  5EAA A;  3AFA B;  2ORD A;  1ZOD A;  1M19 B;  2BYJ A;  4KGC C;  2CB1 A;  1AAM A;  4Q75 A;  4R8P C;  3A6N C;  4YM6 D;  5F9S A;  3EIB A;  3KWQ B;  1YJS A;  5K8B A;  1TOK A;  2NZD C;  2F8N B;  1P3G B;  5AY8 B;  3F9T A;  5EUD A;  5B0Y A;  5C3I C;  5FT5 A;  5B31 C;  1ID3 D;  2E7U A;  4IXO A;  3AEN A;  1WST A;  3X1V B;  3W97 A;  3AEJ A;  4Q76 A;  3B0D C;  5AVC A;  3AZN D;  2R5C A;  5DNN A;  4H9N B;  5B0Y C;  3KGX A;  1JS6 A;  3AZM D;  1BW0 A;  1P3B D;  3W97 C;  3AEJ C;  1XEY A;  4RIT A;  4WLH A;  5AVC C;  3WTP E;  5DNN C;  1JFI A;  5B0Z C;  1OXO A;  4NE6 A;  1VP4 A;  3AN2 D;  3BCX A;  1AHE A;  3E77 A;  4N0W A;  1V2E A;  4E1O A;  5AV5 D;  5AV6 D;  3W1J A;  4J8W C;  2VMV A;  2AY5 A;  3PGY A;  4M2K A;  1ASM A;  3X1U B;  1U35 D;  1N8P A;  4RKC A;  3AZL A;  1ART A;  4F4E A;  2VMU A;  5JRG B;  5DX5 A;  4BMK A;  2WK9 A;  4H9O B;  4J8X A;  3AZL C;  1N1J B;  1AKC A;  2Y2L A;  5B24 B;  3FZ7 A;  3PDB A;  4YS3 D;  3AYW A;  4EFF A;  3ELP A;  2AAT A;  2D63 A;  3UTB A;  3ASA A;  4ZUX A;  4J8X C;  2FQ6 A;  3KUY B;  1QJ5 A;  2W7G A;  2TPL A;  3NQU B;  1P3M B;  1P3A D;  3B1E A;  3I16 A;  5D5S A;  3TU4 B;  3AYW C;  2PYO A;  3WTP D;  3UTB C;  3AZI B;  4ZUX C;  4QLC A;  2AY4 A;  2YRI A;  1SZU A;  3DC1 A;  4KGC B;  2O0R A;  3AZE D;  4E44 A;  2PYO C;  1PMO A;  3A6N B;  2CJG A;  3MNN A;  4A0H A;  2W7J A;  4OBU A;  4QLC C;  1BH8 A;  4ZWM A;  3UT9 D;  2NZD B;  2IO5 B;  1UU0 A;  4WYG A;  2ZC0 A;  5B33 A;  1AOI A;  5C3I B;  4Q6R A;  5B31 B;  3EI7 A;  1GEY A;  3MNN C;  2XBN A;  5EAV A;  2C7T A;  4ZLV A;  3B0D B;  2EO5 A;  4ADE A;  5B33 C;  5B0Y B;  1AOI C;  1SPA A;  3MAF B;  2HUF A;  2QMA A;  1IX7 A;  5B1L A;  3AEN B;  2Y2M A;  1AHF A;  1P34 A;  4A0F A;  3AZF C;  3AV2 C;  4IY7 A;  4F5G A;  3H0R C;  5CP6 D;  5B1M B;  5DNN B;  2R5C B;  3N4X A;  2GMS A;  5B0Z B;  1KX4 A;  5E5I A;  1TAF A;  3BCA A;  3N5M A;  1EG5 A;  5AV9 B;  1QIT A;  4XZQ B;  1TOG A;  5AVB C;  3LZ0 A;  1KX4 C;  2CIN A;  4J8W B;  4WU9 C;  3O62 B;  3FTB A;  2JJF A;  5FT8 A;  4IYO A;  1ULY A;  3HMU A;  3LZ0 C;  1U08 A;  2FN6 A;  3DYD A;  3RI6 A;  5GT3 B;  1ZLA A;  5GT0 A;  3FFH A;  5BJ4 A;  3REI A;  1YOO A;  3IHJ A;  4Z5T D;  1P3F A;  1GC0 A;  4CSR A;  1S0A A;  1HTA A;  1B5O A;  1ZLA C;  4WB0 A;  2ZY3 A;  5GT0 C;  3KXB B;  3C1C A;  5B32 A;  5D95 A;  4BQ0 A;  5IWQ A;  3X1T A;  1W7L A;  3N75 A;  1KX5 D;  4JJN D;  3FSL A;  4W8I A;  4J8X B;  1KL2 A;  4JEX A;  4WXG A;  3C1C C;  3LWS A;  5B32 C;  3K40 A;  4KYO A;  1B6W A;  2FJ7 D;  3UTB B;  1P3L A;  3AV1 D;  3VAX A;  1P3P C;  2PO3 A;  4J5U A;  4QLC B;  3MVD D;  3ISL A;  1I41 A;  2W8S A;  2VMW A;  3GBX A;  1ELQ A;  4B9B A;  2YFV B;  2DGK A;  1M0P A;  2VMT A;  3MNN B;  1IVR A;  3ECD A;  4XJO A;  2QSR A;  3MAU A;  5G2Q A;  2AY1 A;  5M4D A;  1M1A D;  3N4R A;  3B6F D;  3MGR B;  4EO5 C;  3BS8 A;  4J8V C;  5EFS A;  3NUI A;  3AZF B;  3AV2 B;  4LNJ A;  4Z66 A;  1RVY A;  3WCN A;  1AIB A;  2UWX A;  4EB5 A;  2BYM A;  3LEL A;  3BCB A;  3AZH B;  4DBC A;  5F99 D;  4R8D A;  5EIG A;  4OCA A;  1O62 A;  1BJN A;  5AVB B;  3MBB A;  4WU8 B;  1TAF B;  4K2B A;  4WU9 B;  3W96 D;  3LEL C;  4UOY A;  4A00 A;  1AHX A;  2DGL A;  3F6T A;  2G7J A;  4HF8 A;  1DGD A;  4XEW A;  3H0L C;  1AMR A;  1AMS A;  4YM6 A;  1KMJ A;  2VMZ A;  5GXQ B;  1AY5 A;  3B6G D;  2AY2 A;  3MGQ D;  4EMY A;  2HIO A;  5GT0 B;  3B46 A;  1WYV A;  4CVQ A;  4EB7 A;  4YM6 C;  1ASN A;  1P3W A;  1ASE A;  4CSR B;  3UE8 A;  2VMY A;  3TQX A;  5AV8 D;  2HIO C;  4WB0 B;  3AZN A;  3C1C B;  5B32 B;  2F8N K;  1ID3 C;  5B31 G;  3AZM A;  4Z2M H;  3E9K A;  1P3B A;  3AZJ D;  3R45 A;  3HBX A;  3AZN C;  1P3P B;  1UU2 A;  3R4T A;  1CQ8 A;  3AZM C;  1MDX A;  2F8J A;  2BHX A;  1P3B C;  4M6B A;  3WCO A;  5B40 A;  2OKK A;  5AV5 A;  1SF2 A;  4ZDP A;  3X1S D;  1B4X A;  1M0Q A;  2AEU A;  9AAT A;  1GC2 A;  3NRA A;  4AZJ A;  1CJ0 A;  5B40 C;  5AV5 C;  4ISY A;  3WKJ D;  3KGW A;  4EO5 B;  4J8V B;  1GD9 A;  1WYT A;  5BO0 A;  4L0O A;  2Z20 A;  5B2I D;  2CFB A;  1U35 C;  5BNV A;  4NE3 A;  2VGT A;  4DRB A;  3DOD A;  3FVX A;  4Z2M G;  3MGS A;  4H9R A;  4YS3 A;  4Y0I A;  3II0 A;  3G8M A;  2JJG A;  4KAM A;  3HL2 A;  3PDX A;  1BQD A;  3WAA D;  4ITG A;  1IX6 A;  5DNM B;  3LEL B;  2VQR A;  3MGS C;  4YS3 C;  1M32 A;  5EIG B;  5FT4 A;  2CH1 A;  1M7Y A;  2YRR A;  1O61 A;  2HUE C;  5BNX A;  2DOU A;  1QIR A;  5GSU D;  4TN4 A;  1P3A C;  1B5P A;  3AZE A;  3IP4 C;  3AFA A;  1TOE A;  2D64 A;  3VH5 T;  4RJY A;  4WP0 A;  2ZY4 A;  1BJW A;  2VMX A;  5KTB A;  3L44 A;  3UT9 A;  2D61 A;  3AZE C;  3AFA C;  3PA9 A;  1AY4 A;  1P3G A;  4YM6 B;  3ZZJ A;  3UT9 C;  2Y2I A;  2VGV A;  1WYV B;  3V9R B;  3X1V A;  2G5H C;  1ID3 B;  1P3G C;  4H9N A;  2DQN C;  3COG A;  2CV5 D;  1G4V A;  3OP7 A;  3AEM A;  3HVY A;  3C1B D;  3AZM B;  2HZP A;  5CPJ D;  1P3B B;  5CP6 C;  1FG7 A;  2JG2 A;  5EQC A;  3AN2 B;  1KKJ A;  3E2F A;  1BS0 A;  2VGW A;  4ITX A;  5AV6 B;  1VEF A;  1QGN A;  4H63 Q;  1D2F A;  5G0A A;  4Z5T A;  4DRA A;  1U35 B;  1CS1 A;  2Y2P A;  1M18 D;  1EJI A;  4JEZ A;  1JF9 A;  5BO0 B;  1TAR A;  2QB2 A;  3REK D;  4Z5T C;  3UWC A;  1KX5 A;  3KKI A;  2RIQ A;  1WWS A;  3W99 B;  2C81 A;  3VP6 A;  5B24 A;  2VMO A;  5G49 B;  2VGZ A;  4YS3 B;  1WWI A;  4G91 B;  1KX5 C;  3ELE A;  3NQU A;  5B24 C;  3TU4 A;  3REH D;  1QJ3 A;  1P3A B;  3A9X A;  1I48 A;  5C6U A;  2C0R A;  2FNI A;  3WTP B;  2BI1 A;  3AV1 C;  3DU4 A;  3TU4 C;  2Z9V A;  1WYU A;  3A6N A;  2HOZ A;  2BG1 A;  3AZE B;  2DGM A;  3ATH A;  3G0T A;  2NZD A;  2BYK B;  2EGY A;  3MVD C;  4FFC A;  5B31 A;  3UT9 B;  5BS7 C;  1MLY A;  4OBV A;  1S32 D;  4I8A A;  3B6F A;  4ZAS A;  2VLH A;  2IO5 C;  1KMK A;  1OAT A;  2AY7 A;  3MAF A;  1M1A C;  3A9Y A;  4UHO A;  3B6F C;  4LD9 D;  5B1M A;  1W23 A;  5B0Z A;  5CP6 B;  1BFM A;  1W7N A;  1Z2C B;  1DJU A;  5AV9 A;  3LZ1 D;  4Y0H A;  4XZQ A;  5B1M C;  3NYS A;  4XAU A;  4NOG A;  2DR1 A;  4JEV A;  4J8W A;  5AV9 C;  3O62 A;  1YIZ A;  3W98 D;  2E7J A;  4GE7 A;  4XZQ C;  3W96 C;  2Z9X A;  2XH1 A;  5GT3 A;  3FFR A;  3O62 C;  3GSB A;  4XQ2 A;  1KX3 D;  3AZK D;  3MGQ A;  1G4X A;  4JEW A;  1X29 A;  4K05 A;  5GT3 C;  1MAP A;  3GR9 A;  4Z5T B;  1P3K D;  3KXB A;  3B6G C;  3MGQ C;  2OGE A;  2RVQ D;  3UAK A;  3W99 D;  1C7O A;  2G5I C;  1M4N A;  1AIC A;  2BI3 A;  1KX5 B;  1MDZ A;  4JJN B;  4O6Z A;  3KXB C;  1LC5 A;  5G4J A;  5FUG A;  5AV8 C;  3AOW A;  4KXK A;  4GEB A;  1X28 A;  2FJ7 B;  8AAT A;  3VH5 W;  2FM1 A;  3AV1 B;  2VIB A;  2YHK A;  4ZSW A;  4J8U D;  3MVD B;  2YFV A;  3BN1 A;  1WYU B;  3WZF A;  2VLF A;  3X1S C;  2NQB D;  4OTL A;  2HOX A;  2Z1Y A;  2J8P A;  3PD6 B;  3MGR A;  5B2I A;  1M1A B;  3QN6 A;  1ASL A;  3H0M C;  3WKR A;  3AZF A;  3AV2 A;  3B6F B;  3GZD A;  3WKJ C;  1EQZ D;  4ZM4 A;  2HUI A;  2GSA A;  2R0T A;  5EUN A;  3MGR C;  5B2I C;  4F5H A;  2QBT A;  3ZRQ A;  1V72 A;  3GZD C;  1HQ3 D;  3BV0 A;  2R2N A;  3AZH A;  1C0N A;  5AVB A;  3QHX A;  5FT6 A;  1ECX A;  5M49 A;  4WU8 A;  3AZG D;  5F99 B;  1D7S A;  4WU9 A;  1SVV A;  3WAA C;  3AZH C;  2BYL A;  5GSU A;  3W96 B;  1DGE A;  4PIW A;  4DQ6 A;  4WU8 C;  3WY7 A;  2E54 A;  2W7M A;  2E7I A;  2X5D A;  3UTA D;  4JEY A;  4PFF A;  5GSU C;  1RVU A;  1X0M A;  3HQT A;  5GXQ A;  4AOA A;  2JJE A;  1BT4 A;  4R5F A;  3A8U X;  3B6G B;  3MGQ B;  5GXQ C;  2O1B A;  2W7F A;  3MGP B;  1N2T A;  3GET A;  4UHN A;  2CV5 A;  5AV8 B;  1TAT A;  3VH6 A;  4BA4 A;  1PMM A;  3C1B A;  1P3P A;  2CH2 A;  4IW7 A;  3AZJ B;  5FUG B;  2CV5 C;  3WA9 D;  4TMR A;  5J8Q A;  5G4I A;  3K7Y A;  3C1B C;  4J8L A;  4H9P B;  3EPK A;  2D5Y A;  5CPJ C;  2D65 A;  3REJ D;  1H1C A;  1G7W A;  1OHY A;  3FKD A;  3PJ0 A;  4JF0 A;  3X1S B;  3EPH A;  3EG5 B;  2JE5 A;  2YKU A;  3FVU A;  1LC7 A;  5E5A D;  2OGA A;  4RLG A;  4J8V A;  4QGR A;  5CHL B;  1M18 A;  2AY6 A;  3WKJ B;  1W2E A;  5B2I B;  1ASC A;  5BT1 D;  3REK A;  4ZBJ B;  4R8P D;  4GE9 A;  3PIU A;  1M18 C;  2R5E A;  2V1P A;  1VJO A;  2VMS A;  2PB0 A;  2Q7W A;  3REK C;  2CST A;  4OMA A;  5DNM A;  4LC3 A;  3WAA B;  1CZC A;  3TFU A;  2VMN A;  4WLJ A;  3REH A;  1UKJ A;  4JF1 A;  4ZSY A;  1DJ9 A;  4ZAH A;  5DNM C;  1AMA A;  4ZDO A;  2AY8 A;  3OKS A;  5GSU B;  3W1H A;  3W97 D;  3REH C;  5AVC D;  1SZK A;  3P6K A;  1YJZ A;  4XJP A;  2ZP7 A;  2EYQ A;  1UU1 A;  2CWE A;  4GDY A;  5EUE A;  1DJE A;  3V9R A;  3NU7 A;  1ID3 A;  2WK7 A;  4CXQ A;  1N31 A;  1LK9 A;  1LKC A;  1AHG A;  3MGP D;  1TZY D;  2D66 A;  3DXW A;  4A6T A;  4LD9 A;  1XI9 A;  2X3L A;  2D7Z A;  1MDO A;  1OXP A;  2AEV A;  2CV5 B;  4E3Q A;  3QGU A;  1IUG A;  5G2P A;  5CPK D;  3LZ1 A;  1C4K A;  4LD9 C;  3C1B B;  3FDB A;  3AZL D;  4P7Y A;  5M46 A;  3K28 A;  5CPJ B;  4AWL B;  3PAA A;  1B9H A;  1AIA A;  3MEB A;  3AN2 A;  3PPL A;  3LZ1 C;  3W98 A;  3FVS A;  2GQN A;  2A1V A;  3RQ1 A;  5DB5 A;  3F0H A;  5AV6 A;  2O7C A;  1AAW A;  3I4J A;  3AYW D;  3N7N A;  3AN2 C;  2CAN A;  2D7Y A;  1PZR A;  4RJ0 A;  3W98 C;  1KX3 A;  3AZK A;  4ZUX D;  1P3I D;  1U35 A;  1F1E A;  5AV6 C;  2PYO D;  3NYT A;  2DKB A;  2Z1Z A;  1J32 A;  1KX3 C;  3AZK C;  3CBF A;  2ZY2 A;  1M18 B;  1J04 A;  4RIZ A;  3W99 A;  1BH9 B;  3REK B;  4M2M A;  1P3K C;  5CPI D;  1X2A A;  5G49 A;  4MKJ A;  4XJL A;  4W1V A;  2RVQ C;  4W1X A;  3W99 C;  5B33 D;  2W8V A;  4OYT A;  1P3A A;  4WXF A;  4FL0 A;  4G91 C;  2C44 A;  3REH B;  3WTP A;  1B67 A;  1TAS A;  4MKK A;  1W7M A;  5B1L D;  3E6G A;  1P34 D;  3WTP C;  1WKG A;  3DR7 A;  2ZSM A;  2BYK A;  2NMP A;  1KX4 D;  1B8G A;  3KFU G;  2NQB A;  1IX8 A;  4J8U C;  1S32 B;  3GZC A;  3WLX A;  1F66 D;  3LZ0 D;  2NQB C;  3JZL A;  1EQZ A;  2G6W A;  1M0O A;  1Z3Z A;  1KU5 A;  1HQ3 A;  2BI2 A;  4LD9 B;  1EQZ C;  5CP6 A;  3BC8 A;  3WX9 A;  1ZLA D;  4MQR A;  3REI D;  2Z9U A;  4E45 A;  1H0C A;  3LZ1 B;  1P3F D;  1HQ3 C;  2BIG A;  2X8U A;  3AEL A;  3LVK A;  3AZG C;  3X1T D;  2GB3 A;  3W98 B;  3P5J B;  1ASB A;  2Y2N A;  5F8V A;  2ARO D;  4WJ3 C;  1P3O D;  3VK4 A;  4MSO A;  1P3L D;  3AZK B;  1KX3 B;  3DRD A;  2OAT A;  1B9I A;  3FD0 A;  1BJO A;  1P3K B;  2JIS A;  2JGT A;  4ATQ A;  2W7H A;  4JJN A;  3D6K A;  7AAT A;  2WB6 A;  4RAE A;  2ZY5 A;  4Y0D A;  3EI5 A;  1D7U A;  4ZDL A;  4KUD D;  4EU1 A;  4GE4 A;  2FYF A;  3VOM A;  2W8W A;  5M4B A;  1E5E A;  2FJ7 A;  4JJN C;  1D7V A;  2DKJ A;  5G09 A;  3AV1 A;  4LNL A;  4OT8 A;  4WD2 A;  1JG8 A;  3REJ A;  3B8X A;  2FJ7 C;  4AO9 A;  3NDN A;  4Z66 D;  3N4S A;  3MVD A;  5BS7 A;  4J8U B;  3REJ C;  3FQ7 A;  1AJS A;  1QIS A;  4B98 A;  4MQP A;  3LJA D;  3PD6 A;  1M1A A;  2NQB B;  3EUC A;  1D7R A;  4GRX A;  2HP2 A;  3DR4 A;  2F2A C;  1EQZ B;  2YCT A;  4E77 A;  4WNN A;  2HUU A;  2Z61 A;  1CQ6 A;  5BT1 C;  4A72 A;  4PFN A;  1RV4 A;  3W1I A;  1HQ3 B;  3CQ4 A;  2V0Y A;  5F99 A;  3LY1 A;  2HIO D;  1DKA A;  2W8U A;  2JSS A;  1KL1 A;  3AZG B;  1GBN A;  2YKY A;  4PVF A;  3B0B A;  3W96 A;  1IAX A;  1S06 A;  5F99 C;  1ARS A;  4WYD A;  3LVL B;  1EQB A;  2RFV A;  2EZ1 A;  4NE5 A;  4IXS A;  3UTA B;  2AY9 A;  3H9X A;  3M5U A;  1JS3 A;  3B1C A;  3B6G A;  3NU8 A;  1T3I A;  2W8T A;  1C7N A;  1ZC9 A;  3MGP A;  3DXV A;  5JA4 B;  5B40 D;  1TZY A;  2OKJ A;  3KSY A;  4DQY B;  5AV8 A;  4KHA A;  4G92 C;  1BJO B;  5HDM A;  1RV3 A;  2FKI A;  3NNK A;  5JAY A;  2Z9W A;  3MGP C;  5CPK A;  1TZY C;  4CAY B;  3AZJ A;  1GDE A;  2W7I A;  3E2Z A;  3R9A A;  1CL2 A;  1GCK A;  1OHW A;  3WA9 B;  2YKX A;  2XD1 A;  4H9P A;  5CPK C;  2CY8 A;  3AZJ C;  1I43 A;  1ASF A;  3A1K A;  3REJ B;  3JTX A;  5BJ3 A;  1A7W A;  3MGS D;  4UUZ B;  3X1S A;  4E3R A;  3BB8 A;  3GWP A;  4RKD A;  1P3I A;  3REL D;  1AJS B;  2HOR A;  4A6R A;  3VH6 T;  5E5A B;  4X23 D;  3WKJ A;  5B2J D;  3AL0 C;  3LVM A;  4XUJ B;  1GC3 A;  1P3I C;  1M0N A;  1AHY A;  2Y2Q A;  3RCH B;  3TCM A;  3AFA D;  2CJD A;  4R8P B;  1M19 D;  3JW9 A;  5CPI A;  1GC4 A;  4ZBJ C;  3EI9 A;  3EPL A;  4WNN B;  3KWQ D;  1PG8 A;  3JWB A;  3WAA A;  2F8N D;  3RUY A;  1P3G D;  3QBO A;  5CPI C;  5AY8 D;  3N0L A;  2VGS A;  3WGB A;  1AJR A;  3AAT A;  3X1V D;  2CTZ A;  3A1I A;  3HDO A;  3A2B A;  4WXB A;  1C7G A;  3W97 B;  3FQ8 A;  3BWO A;  4F5F A;  5AVC B;  2F8N H;  4U1T A;  5B1L C;  4RM1 A;  1ASA A;  2Y2H A;  1P34 C;  2VI8 A;  4WYA A;  2GMU A;  4AO4 A;  3WKS A;  1JFI B;  4M2J A;  1F66 A;  2KFP A;  3RBF A;  1WKH A;  4G92 B;  4R5Z A;  1E5F A;  1C9C A;  1YJY A;  3VK2 A;  1BQA A;  4UHM A;  4ADB A;  1F66 C;  3CQ6 A;  1TZY B;  3FZ6 A;  2ZUK A;  4KHA B;  3HT4 A;  3A9Z A;  3X1U D;  2VMQ A;  2BI5 A;  2YKV A;  2AY3 A;  5CPJ A;  5CPK B;  5DJ1 A;  5JRG D;  2YCP A;  1ORD A;  3E2Z B;  3LG0 A;  3AZL B;  2VI9 A;  5HHY A;  4F5J A;  3REI C;  2LY8 A;  4CBR A;  4F5M A;  4P3M A;  2VMP A;  1P3F C;  4AWL C;  3MC6 A;  3EZS A;  5B24 D;  3ZZK A;  2OQX A;  2F8N G;  2ARO A;  1P3O A;  1CL1 A;  3PDB B;  1LS3 A;  3X1T C;  3AYW B;  3KUY D;  4WYE A;  1P3M D;  3MC6 C;  1G7X A;  3FZ8 A;  3QM2 A;  4ZUX B;  5DJ9 A;  3TU4 D;  1P3I B;  4IXZ A;  2ARO C;  4U2H A;  3USF A;  3WGC A;  4XUJ D;  4H9Q A;  1P3O C;  4R2N A;  3AZI D;  2PYO B;  3BWN A;  1ARG A;  2W7E A;  3FQA A;  2FNU A;  1P3L C;  4KGC D;  3EIA A;  1BH9 A;  2WK8 A;  3A6N D;  4ADC A;  5TF5 A;  2YOB A;  3BWN C;  3QPG A;  4KUD A;  2NZD D;  2JJH A;  1GEX A;  5CPI B;  4A6U A;  2BWO A;  1BH8 B;  5B31 D;  3ZRR A;  4LNM A;  2EH6 A;  2PB2 A;  1AX4 A;  4LW4 A;  3VK3 A;  5B33 B;  1AOI B;  1FC4 A;  3H7F A;  4KUD C;  4CXR A;  5B0Y D;  1ASD A;  3AOV A;  4HGA C;  5E3K A;  2FFF B;  2BIA A;  5B1L B;  5B1M D;  5DNN D;  1P34 B;  5B0Z D;  4GSA A;  4OC9 A;  3NQJ A;  2ZSL A;  4Z66 C;  1PFF A;  1GEW A;  1V2D A;  5AV9 D;  3LJA A;  1V2F A;  1KX4 B; 
#chains in the Genus database with same CATH homology
 4XZQ D;  1S32 A;  2W7D A;  4HVK A;  4J8W D;  3O62 D;  3GJU A;  3LJA C;  1F66 B;  3LZ0 B;  3LV2 A;  3ZRP A;  1S32 C;  1TOI A;  4WYC A;  5GT3 D;  2X5F A;  4IYO B;  1IBJ A;  1S08 A;  3ACZ A;  2VMR A;  1M6S A;  3B0C T;  1DFO A;  1AKA A;  1ZLA B;  4IX8 A;  3REI B;  1P3F B;  3KXB D;  1DTY A;  2HOY A;  3KE3 A;  2WKA A;  4J8X D;  1BKG A;  3X1T B;  2HP1 A;  3VH6 W;  1S09 A;  4A0R A;  4F5K A;  4MQQ A;  2BWN A;  2ARO B;  1YAA A;  1BJ4 A;  1P3O B;  4W91 A;  3UTB D;  1TOJ A;  4NFT A;  3E2Y A;  2YFW A;  2Y2J A;  4XJM A;  1P3L B;  1P3K A;  4H9Q B;  3QI6 A;  2XD5 A;  1MGV A;  4WV4 B;  5KDM A;  4QLC D;  2VIA A;  1SFF A;  1QZ9 A;  4ZWV A;  1Y4I A;  2BIE A;  3MNN D;  1ASG A;  1OHV A;  3NTJ A;  2QA3 A;  4KUD B;  1AMQ A;  3MKJ A;  1SZS A;  1AOI D;  3ASB A;  3MGR D;  2W7L A;  1LW5 A;  4HGA B;  3AZF D;  3AV2 D;  2Y2G A;  1LW4 A;  3AEP A;  3HLM A;  3I5T A;  3RBL A;  4Z66 B;  4J8U A;  4AZK A;  3AZH D;  4CBS A;  2BYM B;  5AVB D;  3REL A;  5I92 A;  1H3O A;  2CJH A;  4DGT A;  4WU8 D;  3NQJ B;  4X23 A;  5B2J A;  4WU9 D;  4LW2 A;  3LJA B;  3G7Q A;  3TFT A;  1AY8 A;  4H9S A;  1ARI A;  3REL C;  2DF4 C;  4X23 C;  5B2J C;  1W3U A;  1M19 A;  4Q31 A;  4H9S C;  2EZ2 A;  4W1W A;  2QB3 A;  3FDD A;  3NYU A;  1Q9C A;  5GXQ D;  3KWQ A;  2Y2O A;  4H51 A;  1CQ7 A;  1M19 C;  2F8N A;  4K2M A;  1R4V A;  1CZE A;  5AY8 A;  5GT0 D;  1ARH A;  3AZG A;  2ZM5 A;  2HIO B;  3KWQ C;  4F5I A;  2BKW A;  1ZOB A;  1AKB A;  2Y2K A;  5AY8 C;  4K2I A;  3C1C D;  4A0G A;  5B32 D;  2VGU A;  3P1T A;  3AZN B;  3UTA A;  4ATP A;  1TPL A;  3X1V C;  1P3P D;  5E4Z A;  1YNU A;  1YIY A;  3LVJ A;  2QLR A;  3R45 B;  2ZYJ A;  2YCN A;  4W5K A;  3UTA C;  3EI8 A;  1KKP A;  3AEM C;  2YFW B;  5JA4 A;  1MLZ A;  4UQV A;  3Q8N A;  1S07 A;  1MAQ A;  2BWP A;  5KDM B;  3AEO A;  5B40 B;  2W7K A;  5AV5 B;  1T3U A;  2VYC A;  4XK1 A;  3AV7 A;  3JWA A;  3X1U A;  3CQ5 A;  1I29 A;  4CAY A;  3CAI A;  2EPJ A;  1O69 A;  4J8V D;  3DZZ A;  5JRG A;  3WA9 A;  1Z7D A;  4WBT A;  4H9O A;  3X1U C;  1WYT B;  1IAY A;  4WZS B;  3VH5 A;  4BHD A;  1N1J A;  3FRK A;  5BNV B;  3MAD A;  3NX3 A;  5JRG C;  3EI6 A;  5HXX A;  3WA9 C;  1O4S A;  4UUZ A;  1IJI A;  2W8J A;  3T32 A;  3MGS B;  4H9R B;  1ELU A;  3KUY A;  4MY5 A;  3FCR A;  1P3M A;  5DNM D;  3LEL D;  2HUE B;  4ZM3 A;  5E5A A;  4UPK A;  4ADD A;  4WYF A;  4XUJ A;  3EZ1 A;  2BI9 A;  2L5A A;  3REL B;  5B32 G;  3AZI A;  1H3O B;  3B1D A;  3KUY C;  3L8A A;  4X23 B;  5AX8 A;  2ZJG A;  5B2J B;  3EPJ A;  2JCH A;  4F5L A;  4BA5 A;  1P3M C;  4KGC A;  4AH3 A;  5BNX B;  5E5A C;  3RCH A;  3NUB A;  3TAT A;  3B0C W;  4XUJ C;  4R8P A;  1LC8 A;  3AZI C;  1FG3 A;  5EAA A;  3AFA B;  2ORD A;  1ZOD A;  1M19 B;  2BYJ A;  4KGC C;  2CB1 A;  1AAM A;  4Q75 A;  4R8P C;  3A6N C;  4YM6 D;  5F9S A;  3EIB A;  3KWQ B;  1YJS A;  5K8B A;  1TOK A;  2NZD C;  2F8N B;  1P3G B;  5AY8 B;  3F9T A;  5EUD A;  5B0Y A;  5C3I C;  5FT5 A;  5B31 C;  1ID3 D;  2E7U A;  4IXO A;  3AEN A;  1WST A;  3X1V B;  3W97 A;  3AEJ A;  4Q76 A;  3B0D C;  5AVC A;  3AZN D;  2R5C A;  5DNN A;  4H9N B;  5B0Y C;  3KGX A;  1JS6 A;  3AZM D;  1BW0 A;  1P3B D;  3W97 C;  3AEJ C;  1XEY A;  4RIT A;  4WLH A;  5AVC C;  3WTP E;  5DNN C;  1JFI A;  5B0Z C;  1OXO A;  4NE6 A;  1VP4 A;  3AN2 D;  3BCX A;  1AHE A;  3E77 A;  4N0W A;  1V2E A;  4E1O A;  5AV5 D;  5AV6 D;  3W1J A;  4J8W C;  2VMV A;  2AY5 A;  3PGY A;  4M2K A;  1ASM A;  3X1U B;  1U35 D;  1N8P A;  4RKC A;  3AZL A;  1ART A;  4F4E A;  2VMU A;  5JRG B;  5DX5 A;  4BMK A;  2WK9 A;  4H9O B;  4J8X A;  3AZL C;  1N1J B;  1AKC A;  2Y2L A;  5B24 B;  3FZ7 A;  3PDB A;  4YS3 D;  3AYW A;  4EFF A;  3ELP A;  2AAT A;  2D63 A;  3UTB A;  3ASA A;  4ZUX A;  4J8X C;  2FQ6 A;  3KUY B;  1QJ5 A;  2W7G A;  2TPL A;  3NQU B;  1P3M B;  1P3A D;  3B1E A;  3I16 A;  5D5S A;  3TU4 B;  3AYW C;  2PYO A;  3WTP D;  3UTB C;  3AZI B;  4ZUX C;  4QLC A;  2AY4 A;  2YRI A;  1SZU A;  3DC1 A;  4KGC B;  2O0R A;  3AZE D;  4E44 A;  2PYO C;  1PMO A;  3A6N B;  2CJG A;  3MNN A;  4A0H A;  2W7J A;  4OBU A;  4QLC C;  1BH8 A;  4ZWM A;  3UT9 D;  2NZD B;  2IO5 B;  1UU0 A;  4WYG A;  2ZC0 A;  5B33 A;  1AOI A;  5C3I B;  4Q6R A;  5B31 B;  3EI7 A;  1GEY A;  3MNN C;  2XBN A;  5EAV A;  2C7T A;  4ZLV A;  3B0D B;  2EO5 A;  4ADE A;  5B33 C;  5B0Y B;  1AOI C;  1SPA A;  3MAF B;  2HUF A;  2QMA A;  1IX7 A;  5B1L A;  3AEN B;  2Y2M A;  1AHF A;  1P34 A;  4A0F A;  3AZF C;  3AV2 C;  4IY7 A;  4F5G A;  3H0R C;  5CP6 D;  5B1M B;  5DNN B;  2R5C B;  3N4X A;  2GMS A;  5B0Z B;  1KX4 A;  5E5I A;  1TAF A;  3BCA A;  3N5M A;  1EG5 A;  5AV9 B;  1QIT A;  4XZQ B;  1TOG A;  5AVB C;  3LZ0 A;  1KX4 C;  2CIN A;  4J8W B;  4WU9 C;  3O62 B;  3FTB A;  2JJF A;  5FT8 A;  4IYO A;  1ULY A;  3HMU A;  3LZ0 C;  1U08 A;  2FN6 A;  3DYD A;  3RI6 A;  5GT3 B;  1ZLA A;  5GT0 A;  3FFH A;  5BJ4 A;  3REI A;  1YOO A;  3IHJ A;  4Z5T D;  1P3F A;  1GC0 A;  4CSR A;  1S0A A;  1HTA A;  1B5O A;  1ZLA C;  4WB0 A;  2ZY3 A;  5GT0 C;  3KXB B;  3C1C A;  5B32 A;  5D95 A;  4BQ0 A;  5IWQ A;  3X1T A;  1W7L A;  3N75 A;  1KX5 D;  4JJN D;  3FSL A;  4W8I A;  4J8X B;  1KL2 A;  4JEX A;  4WXG A;  3C1C C;  3LWS A;  5B32 C;  3K40 A;  4KYO A;  1B6W A;  2FJ7 D;  3UTB B;  1P3L A;  3AV1 D;  3VAX A;  1P3P C;  2PO3 A;  4J5U A;  4QLC B;  3MVD D;  3ISL A;  1I41 A;  2W8S A;  2VMW A;  3GBX A;  1ELQ A;  4B9B A;  2YFV B;  2DGK A;  1M0P A;  2VMT A;  3MNN B;  1IVR A;  3ECD A;  4XJO A;  2QSR A;  3MAU A;  5G2Q A;  2AY1 A;  5M4D A;  1M1A D;  3N4R A;  3B6F D;  3MGR B;  4EO5 C;  3BS8 A;  4J8V C;  5EFS A;  3NUI A;  3AZF B;  3AV2 B;  4LNJ A;  4Z66 A;  1RVY A;  3WCN A;  1AIB A;  2UWX A;  4EB5 A;  2BYM A;  3LEL A;  3BCB A;  3AZH B;  4DBC A;  5F99 D;  4R8D A;  5EIG A;  4OCA A;  1O62 A;  1BJN A;  5AVB B;  3MBB A;  4WU8 B;  1TAF B;  4K2B A;  4WU9 B;  3W96 D;  3LEL C;  4UOY A;  4A00 A;  1AHX A;  2DGL A;  3F6T A;  2G7J A;  4HF8 A;  1DGD A;  4XEW A;  3H0L C;  1AMR A;  1AMS A;  4YM6 A;  1KMJ A;  2VMZ A;  5GXQ B;  1AY5 A;  3B6G D;  2AY2 A;  3MGQ D;  4EMY A;  2HIO A;  5GT0 B;  3B46 A;  1WYV A;  4CVQ A;  4EB7 A;  4YM6 C;  1ASN A;  1P3W A;  1ASE A;  4CSR B;  3UE8 A;  2VMY A;  3TQX A;  5AV8 D;  2HIO C;  4WB0 B;  3AZN A;  3C1C B;  5B32 B;  2F8N K;  1ID3 C;  5B31 G;  3AZM A;  4Z2M H;  3E9K A;  1P3B A;  3AZJ D;  3R45 A;  3HBX A;  3AZN C;  1P3P B;  1UU2 A;  3R4T A;  1CQ8 A;  3AZM C;  1MDX A;  2F8J A;  2BHX A;  1P3B C;  4M6B A;  3WCO A;  5B40 A;  2OKK A;  5AV5 A;  1SF2 A;  4ZDP A;  3X1S D;  1B4X A;  1M0Q A;  2AEU A;  9AAT A;  1GC2 A;  3NRA A;  4AZJ A;  1CJ0 A;  5B40 C;  5AV5 C;  4ISY A;  3WKJ D;  3KGW A;  4EO5 B;  4J8V B;  1GD9 A;  1WYT A;  5BO0 A;  4L0O A;  2Z20 A;  5B2I D;  2CFB A;  1U35 C;  5BNV A;  4NE3 A;  2VGT A;  4DRB A;  3DOD A;  3FVX A;  4Z2M G;  3MGS A;  4H9R A;  4YS3 A;  4Y0I A;  3II0 A;  3G8M A;  2JJG A;  4KAM A;  3HL2 A;  3PDX A;  1BQD A;  3WAA D;  4ITG A;  1IX6 A;  5DNM B;  3LEL B;  2VQR A;  3MGS C;  4YS3 C;  1M32 A;  5EIG B;  5FT4 A;  2CH1 A;  1M7Y A;  2YRR A;  1O61 A;  2HUE C;  5BNX A;  2DOU A;  1QIR A;  5GSU D;  4TN4 A;  1P3A C;  1B5P A;  3AZE A;  3IP4 C;  3AFA A;  1TOE A;  2D64 A;  3VH5 T;  4RJY A;  4WP0 A;  2ZY4 A;  1BJW A;  2VMX A;  5KTB A;  3L44 A;  3UT9 A;  2D61 A;  3AZE C;  3AFA C;  3PA9 A;  1AY4 A;  1P3G A;  4YM6 B;  3ZZJ A;  3UT9 C;  2Y2I A;  2VGV A;  1WYV B;  3V9R B;  3X1V A;  2G5H C;  1ID3 B;  1P3G C;  4H9N A;  2DQN C;  3COG A;  2CV5 D;  1G4V A;  3OP7 A;  3AEM A;  3HVY A;  3C1B D;  3AZM B;  2HZP A;  5CPJ D;  1P3B B;  5CP6 C;  1FG7 A;  2JG2 A;  5EQC A;  3AN2 B;  1KKJ A;  3E2F A;  1BS0 A;  2VGW A;  4ITX A;  5AV6 B;  1VEF A;  1QGN A;  4H63 Q;  1D2F A;  5G0A A;  4Z5T A;  4DRA A;  1U35 B;  1CS1 A;  2Y2P A;  1M18 D;  1EJI A;  4JEZ A;  1JF9 A;  5BO0 B;  1TAR A;  2QB2 A;  3REK D;  4Z5T C;  3UWC A;  1KX5 A;  3KKI A;  2RIQ A;  1WWS A;  3W99 B;  2C81 A;  3VP6 A;  5B24 A;  2VMO A;  5G49 B;  2VGZ A;  4YS3 B;  1WWI A;  4G91 B;  1KX5 C;  3ELE A;  3NQU A;  5B24 C;  3TU4 A;  3REH D;  1QJ3 A;  1P3A B;  3A9X A;  1I48 A;  5C6U A;  2C0R A;  2FNI A;  3WTP B;  2BI1 A;  3AV1 C;  3DU4 A;  3TU4 C;  2Z9V A;  1WYU A;  3A6N A;  2HOZ A;  2BG1 A;  3AZE B;  2DGM A;  3ATH A;  3G0T A;  2NZD A;  2BYK B;  2EGY A;  3MVD C;  4FFC A;  5B31 A;  3UT9 B;  5BS7 C;  1MLY A;  4OBV A;  1S32 D;  4I8A A;  3B6F A;  4ZAS A;  2VLH A;  2IO5 C;  1KMK A;  1OAT A;  2AY7 A;  3MAF A;  1M1A C;  3A9Y A;  4UHO A;  3B6F C;  4LD9 D;  5B1M A;  1W23 A;  5B0Z A;  5CP6 B;  1BFM A;  1W7N A;  1Z2C B;  1DJU A;  5AV9 A;  3LZ1 D;  4Y0H A;  4XZQ A;  5B1M C;  3NYS A;  4XAU A;  4NOG A;  2DR1 A;  4JEV A;  4J8W A;  5AV9 C;  3O62 A;  1YIZ A;  3W98 D;  2E7J A;  4GE7 A;  4XZQ C;  3W96 C;  2Z9X A;  2XH1 A;  5GT3 A;  3FFR A;  3O62 C;  3GSB A;  4XQ2 A;  1KX3 D;  3AZK D;  3MGQ A;  1G4X A;  4JEW A;  1X29 A;  4K05 A;  5GT3 C;  1MAP A;  3GR9 A;  4Z5T B;  1P3K D;  3KXB A;  3B6G C;  3MGQ C;  2OGE A;  2RVQ D;  3UAK A;  3W99 D;  1C7O A;  2G5I C;  1M4N A;  1AIC A;  2BI3 A;  1KX5 B;  1MDZ A;  4JJN B;  4O6Z A;  3KXB C;  1LC5 A;  5G4J A;  5FUG A;  5AV8 C;  3AOW A;  4KXK A;  4GEB A;  1X28 A;  2FJ7 B;  8AAT A;  3VH5 W;  2FM1 A;  3AV1 B;  2VIB A;  2YHK A;  4ZSW A;  4J8U D;  3MVD B;  2YFV A;  3BN1 A;  1WYU B;  3WZF A;  2VLF A;  3X1S C;  2NQB D;  4OTL A;  2HOX A;  2Z1Y A;  2J8P A;  3PD6 B;  3MGR A;  5B2I A;  1M1A B;  3QN6 A;  1ASL A;  3H0M C;  3WKR A;  3AZF A;  3AV2 A;  3B6F B;  3GZD A;  3WKJ C;  1EQZ D;  4ZM4 A;  2HUI A;  2GSA A;  2R0T A;  5EUN A;  3MGR C;  5B2I C;  4F5H A;  2QBT A;  3ZRQ A;  1V72 A;  3GZD C;  1HQ3 D;  3BV0 A;  2R2N A;  3AZH A;  1C0N A;  5AVB A;  3QHX A;  5FT6 A;  1ECX A;  5M49 A;  4WU8 A;  3AZG D;  5F99 B;  1D7S A;  4WU9 A;  1SVV A;  3WAA C;  3AZH C;  2BYL A;  5GSU A;  3W96 B;  1DGE A;  4PIW A;  4DQ6 A;  4WU8 C;  3WY7 A;  2E54 A;  2W7M A;  2E7I A;  2X5D A;  3UTA D;  4JEY A;  4PFF A;  5GSU C;  1RVU A;  1X0M A;  3HQT A;  5GXQ A;  4AOA A;  2JJE A;  1BT4 A;  4R5F A;  3A8U X;  3B6G B;  3MGQ B;  5GXQ C;  2O1B A;  2W7F A;  3MGP B;  1N2T A;  3GET A;  4UHN A;  2CV5 A;  5AV8 B;  1TAT A;  3VH6 A;  4BA4 A;  1PMM A;  3C1B A;  1P3P A;  2CH2 A;  4IW7 A;  3AZJ B;  5FUG B;  2CV5 C;  3WA9 D;  4TMR A;  5J8Q A;  5G4I A;  3K7Y A;  3C1B C;  4J8L A;  4H9P B;  3EPK A;  2D5Y A;  5CPJ C;  2D65 A;  3REJ D;  1H1C A;  1G7W A;  1OHY A;  3FKD A;  3PJ0 A;  4JF0 A;  3X1S B;  3EPH A;  3EG5 B;  2JE5 A;  2YKU A;  3FVU A;  1LC7 A;  5E5A D;  2OGA A;  4RLG A;  4J8V A;  4QGR A;  5CHL B;  1M18 A;  2AY6 A;  3WKJ B;  1W2E A;  5B2I B;  1ASC A;  5BT1 D;  3REK A;  4ZBJ B;  4R8P D;  4GE9 A;  3PIU A;  1M18 C;  2R5E A;  2V1P A;  1VJO A;  2VMS A;  2PB0 A;  2Q7W A;  3REK C;  2CST A;  4OMA A;  5DNM A;  4LC3 A;  3WAA B;  1CZC A;  3TFU A;  2VMN A;  4WLJ A;  3REH A;  1UKJ A;  4JF1 A;  4ZSY A;  1DJ9 A;  4ZAH A;  5DNM C;  1AMA A;  4ZDO A;  2AY8 A;  3OKS A;  5GSU B;  3W1H A;  3W97 D;  3REH C;  5AVC D;  1SZK A;  3P6K A;  1YJZ A;  4XJP A;  2ZP7 A;  2EYQ A;  1UU1 A;  2CWE A;  4GDY A;  5EUE A;  1DJE A;  3V9R A;  3NU7 A;  1ID3 A;  2WK7 A;  4CXQ A;  1N31 A;  1LK9 A;  1LKC A;  1AHG A;  3MGP D;  1TZY D;  2D66 A;  3DXW A;  4A6T A;  4LD9 A;  1XI9 A;  2X3L A;  2D7Z A;  1MDO A;  1OXP A;  2AEV A;  2CV5 B;  4E3Q A;  3QGU A;  1IUG A;  5G2P A;  5CPK D;  3LZ1 A;  1C4K A;  4LD9 C;  3C1B B;  3FDB A;  3AZL D;  4P7Y A;  5M46 A;  3K28 A;  5CPJ B;  4AWL B;  3PAA A;  1B9H A;  1AIA A;  3MEB A;  3AN2 A;  3PPL A;  3LZ1 C;  3W98 A;  3FVS A;  2GQN A;  2A1V A;  3RQ1 A;  5DB5 A;  3F0H A;  5AV6 A;  2O7C A;  1AAW A;  3I4J A;  3AYW D;  3N7N A;  3AN2 C;  2CAN A;  2D7Y A;  1PZR A;  4RJ0 A;  3W98 C;  1KX3 A;  3AZK A;  4ZUX D;  1P3I D;  1U35 A;  1F1E A;  5AV6 C;  2PYO D;  3NYT A;  2DKB A;  2Z1Z A;  1J32 A;  1KX3 C;  3AZK C;  3CBF A;  2ZY2 A;  1M18 B;  1J04 A;  4RIZ A;  3W99 A;  1BH9 B;  3REK B;  4M2M A;  1P3K C;  5CPI D;  1X2A A;  5G49 A;  4MKJ A;  4XJL A;  4W1V A;  2RVQ C;  4W1X A;  3W99 C;  5B33 D;  2W8V A;  4OYT A;  1P3A A;  4WXF A;  4FL0 A;  4G91 C;  2C44 A;  3REH B;  3WTP A;  1B67 A;  1TAS A;  4MKK A;  1W7M A;  5B1L D;  3E6G A;  1P34 D;  3WTP C;  1WKG A;  3DR7 A;  2ZSM A;  2BYK A;  2NMP A;  1KX4 D;  1B8G A;  3KFU G;  2NQB A;  1IX8 A;  4J8U C;  1S32 B;  3GZC A;  3WLX A;  1F66 D;  3LZ0 D;  2NQB C;  3JZL A;  1EQZ A;  2G6W A;  1M0O A;  1Z3Z A;  1KU5 A;  1HQ3 A;  2BI2 A;  4LD9 B;  1EQZ C;  5CP6 A;  3BC8 A;  3WX9 A;  1ZLA D;  4MQR A;  3REI D;  2Z9U A;  4E45 A;  1H0C A;  3LZ1 B;  1P3F D;  1HQ3 C;  2BIG A;  2X8U A;  3AEL A;  3LVK A;  3AZG C;  3X1T D;  2GB3 A;  3W98 B;  3P5J B;  1ASB A;  2Y2N A;  5F8V A;  2ARO D;  4WJ3 C;  1P3O D;  3VK4 A;  4MSO A;  1P3L D;  3AZK B;  1KX3 B;  3DRD A;  2OAT A;  1B9I A;  3FD0 A;  1BJO A;  1P3K B;  2JIS A;  2JGT A;  4ATQ A;  2W7H A;  4JJN A;  3D6K A;  7AAT A;  2WB6 A;  4RAE A;  2ZY5 A;  4Y0D A;  3EI5 A;  1D7U A;  4ZDL A;  4KUD D;  4EU1 A;  4GE4 A;  2FYF A;  3VOM A;  2W8W A;  5M4B A;  1E5E A;  2FJ7 A;  4JJN C;  1D7V A;  2DKJ A;  5G09 A;  3AV1 A;  4LNL A;  4OT8 A;  4WD2 A;  1JG8 A;  3REJ A;  3B8X A;  2FJ7 C;  4AO9 A;  3NDN A;  4Z66 D;  3N4S A;  3MVD A;  5BS7 A;  4J8U B;  3REJ C;  3FQ7 A;  1AJS A;  1QIS A;  4B98 A;  4MQP A;  3LJA D;  3PD6 A;  1M1A A;  2NQB B;  3EUC A;  1D7R A;  4GRX A;  2HP2 A;  3DR4 A;  2F2A C;  1EQZ B;  2YCT A;  4E77 A;  4WNN A;  2HUU A;  2Z61 A;  1CQ6 A;  5BT1 C;  4A72 A;  4PFN A;  1RV4 A;  3W1I A;  1HQ3 B;  3CQ4 A;  2V0Y A;  5F99 A;  3LY1 A;  2HIO D;  1DKA A;  2W8U A;  2JSS A;  1KL1 A;  3AZG B;  1GBN A;  2YKY A;  4PVF A;  3B0B A;  3W96 A;  1IAX A;  1S06 A;  5F99 C;  1ARS A;  4WYD A;  3LVL B;  1EQB A;  2RFV A;  2EZ1 A;  4NE5 A;  4IXS A;  3UTA B;  2AY9 A;  3H9X A;  3M5U A;  1JS3 A;  3B1C A;  3B6G A;  3NU8 A;  1T3I A;  2W8T A;  1C7N A;  1ZC9 A;  3MGP A;  3DXV A;  5JA4 B;  5B40 D;  1TZY A;  2OKJ A;  3KSY A;  4DQY B;  5AV8 A;  4KHA A;  4G92 C;  1BJO B;  5HDM A;  1RV3 A;  2FKI A;  3NNK A;  5JAY A;  2Z9W A;  3MGP C;  5CPK A;  1TZY C;  4CAY B;  3AZJ A;  1GDE A;  2W7I A;  3E2Z A;  3R9A A;  1CL2 A;  1GCK A;  1OHW A;  3WA9 B;  2YKX A;  2XD1 A;  4H9P A;  5CPK C;  2CY8 A;  3AZJ C;  1I43 A;  1ASF A;  3A1K A;  3REJ B;  3JTX A;  5BJ3 A;  1A7W A;  3MGS D;  4UUZ B;  3X1S A;  4E3R A;  3BB8 A;  3GWP A;  4RKD A;  1P3I A;  3REL D;  1AJS B;  2HOR A;  4A6R A;  3VH6 T;  5E5A B;  4X23 D;  3WKJ A;  5B2J D;  3AL0 C;  3LVM A;  4XUJ B;  1GC3 A;  1P3I C;  1M0N A;  1AHY A;  2Y2Q A;  3RCH B;  3TCM A;  3AFA D;  2CJD A;  4R8P B;  1M19 D;  3JW9 A;  5CPI A;  1GC4 A;  4ZBJ C;  3EI9 A;  3EPL A;  4WNN B;  3KWQ D;  1PG8 A;  3JWB A;  3WAA A;  2F8N D;  3RUY A;  1P3G D;  3QBO A;  5CPI C;  5AY8 D;  3N0L A;  2VGS A;  3WGB A;  1AJR A;  3AAT A;  3X1V D;  2CTZ A;  3A1I A;  3HDO A;  3A2B A;  4WXB A;  1C7G A;  3W97 B;  3FQ8 A;  3BWO A;  4F5F A;  5AVC B;  2F8N H;  4U1T A;  5B1L C;  4RM1 A;  1ASA A;  2Y2H A;  1P34 C;  2VI8 A;  4WYA A;  2GMU A;  4AO4 A;  3WKS A;  1JFI B;  4M2J A;  1F66 A;  2KFP A;  3RBF A;  1WKH A;  4G92 B;  4R5Z A;  1E5F A;  1C9C A;  1YJY A;  3VK2 A;  1BQA A;  4UHM A;  4ADB A;  1F66 C;  3CQ6 A;  1TZY B;  3FZ6 A;  2ZUK A;  4KHA B;  3HT4 A;  3A9Z A;  3X1U D;  2VMQ A;  2BI5 A;  2YKV A;  2AY3 A;  5CPJ A;  5CPK B;  5DJ1 A;  5JRG D;  2YCP A;  1ORD A;  3E2Z B;  3LG0 A;  3AZL B;  2VI9 A;  5HHY A;  4F5J A;  3REI C;  2LY8 A;  4CBR A;  4F5M A;  4P3M A;  2VMP A;  1P3F C;  4AWL C;  3MC6 A;  3EZS A;  5B24 D;  3ZZK A;  2OQX A;  2F8N G;  2ARO A;  1P3O A;  1CL1 A;  3PDB B;  1LS3 A;  3X1T C;  3AYW B;  3KUY D;  4WYE A;  1P3M D;  3MC6 C;  1G7X A;  3FZ8 A;  3QM2 A;  4ZUX B;  5DJ9 A;  3TU4 D;  1P3I B;  4IXZ A;  2ARO C;  4U2H A;  3USF A;  3WGC A;  4XUJ D;  4H9Q A;  1P3O C;  4R2N A;  3AZI D;  2PYO B;  3BWN A;  1ARG A;  2W7E A;  3FQA A;  2FNU A;  1P3L C;  4KGC D;  3EIA A;  1BH9 A;  2WK8 A;  3A6N D;  4ADC A;  5TF5 A;  2YOB A;  3BWN C;  3QPG A;  4KUD A;  2NZD D;  2JJH A;  1GEX A;  5CPI B;  4A6U A;  2BWO A;  1BH8 B;  5B31 D;  3ZRR A;  4LNM A;  2EH6 A;  2PB2 A;  1AX4 A;  4LW4 A;  3VK3 A;  5B33 B;  1AOI B;  1FC4 A;  3H7F A;  4KUD C;  4CXR A;  5B0Y D;  1ASD A;  3AOV A;  4HGA C;  5E3K A;  2FFF B;  2BIA A;  5B1L B;  5B1M D;  5DNN D;  1P34 B;  5B0Z D;  4GSA A;  4OC9 A;  3NQJ A;  2ZSL A;  4Z66 C;  1PFF A;  1GEW A;  1V2D A;  5AV9 D;  3LJA A;  1V2F A;  1KX4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...