2ZY2A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
521
structure length
521
Chain Sequence
SPFELKDELIKVASGKANRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTVGVGGLAKLDGIEGRFERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLTVSEQIVRQYIVREMAGGAVPPESVDLFAVEGGTAAMAYIFESLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQRPDLLILTDDVYGTFADEFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNVTCRLYGEAFSQWAVQQSSTGDMLFRVADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRRLADELYEQYKALGKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords L-aspartate 4-carboxylyase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 154
structure length 521
sequence length 521
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy2A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy2A01
1M0NA 3KKIA 3LVLB 1YJSA 4WXGA 4WBTA 1TATA 2BIEA 3KGWA 9AATA 1LC5A 2OATA 3FSLA 4R2NA 5BJ4A 1SZSA 1B9HA 1YJYA 2D5YA 2HUUA 1YJZA 4MQPA 1I29A 1YIYA 4B98A 2BI5A 1G4VA 3BN1A 2EZ1A 2HOXA 2C7TA 3B1DA 4RKCA 4MY5A 3TFUA 5EUDA 1KL1A 1WYTB 3E2ZB 2X8UA 1AJSB 4EB5A 2R2NA 4Y0IA 4U1TA 2C0RA 1CQ6A 4OYTA 4XAUA 1N8PA 2PB2A 1LW4A 3RCHA 1Z3ZA 4A0GA 1C7GA 1DGDA 1GC2A 3BCAA 1ELUA 1LK9A 3PDXA 5EAVA 3NUBA 3NU8A 2CH1A 3GSBA 1EQBA 2AATA 3NX3A 4WYCA 3PDBB 1ZOBA 3EUCA 3LWSA 1GC3A 3FQ7A 1M4NA 2VI9A 2FN6A 2AY5A 3R9AA 2F8JA 3N5MA 1GEWA 1V2EA 3AEOA 3PAAA 2CTZA 1DJUA 3CQ5A 2QB2A 4CBRA 1ASNA 5EAAA 3JWBA 3ZZKA 1DKAA 1DJ9A 3FDBA 4XJOA 5IWQA 1LS3A 1TOGA 1N2TA 2HORA 4MSOA 4E77A 1OHYA 1W7NA 1VEFA 1BQDA 2PB0A 4JF0A 1SVVA 4LW2A 3UAKA 4W5KA 4GSAA 2YKYA 1MLYA 1V72A 2QA3A 3AEMA 3NTJA 3WLXA 3A9YA 3VOMA 4IXOA 4ISYA 4XJMA 4M2KA 1X29A 3AEJA 5HDMA 2W7FA 3DYDA 2JJFA 3WZFA 1OXOA 1BJNA 1GC4A 1PG8A 4PFNA 1GDEA 4M2MA 3T32A 5G09A 3PA9A 4RKDA 5DJ1A 1T3IA 2W7GA 3B46A 4ZSWA 2CB1A 2AY3A 2AY8A 2HOYA 1IBJA 1LW5A 5DJ9A 5G4IA 1C0NA 1O4SA 4Y0HA 2W7HA 4JEVA 4ADBA 1TOJA 2AY7A 3E77A 4UHOA 3AOVA 2BWPA 1G7WA 4IX8A 2BIGA 5D5SA 2Z20A 1C7NA 1AIAA 3AEPA 3ZRPA 2WK9A 2EO5A 1WKGA 1W7LA 3MC6C 1D7VA 1SPAA 2BYJA 2Z1ZA 4PIWA 1DJEA 2E7IA 3MKJA 1S07A 3GJUA 3I4JA 3OKSA 2W7LA 1O69A 3FVXA 1AMQA 5G4JA 3BWNC 1S06A 2VGZA 4F5GA 4E3RA 1AMAA 4FFCA 1WYTA 4OTLA 1JS6A 1AJSA 3WGCA 4WYEA 4W1WA 4AO9A 5FT5A 1QGNA 2WKAA 3K28A 4HF8A 2HOZA 1IVRA 2AY6A 4EMYA 2GMSA 1AKCA 3FVSA 2JGTA 4LW4A 1KL2A 4ADDA 1M7YA 3EI9A 1WYVB 2OGEA 2VI8A 4H51A 2WK8A 3LG0A 4ZAHA 1ASMA 1VJOA 5DB5A 3M5UA 1ASGA 2BHXA 3PDBA 4MQRA 3E9KA 1GD9A 4PVFA 3F0HA 2W7DA 2JG2A 3QM2A 2BI9A 3PD6B 3DZZA 4IYOB 1GEYA 4BHDA 2VGTA 5FT4A 3ELEA 4Q31A 3ZZJA 3MAUA 2E7JA 2O7CA 2BI3A 2QLRA 1QJ3A 1JG8A 1B8GA 1I43A 1MGVA 3E2YA 1C4KA 5AX8A 3CBFA 3EI8A 4XK1A 4DGTA 2D66A 4JEWA 5M4DA 3EZSA 2Q7WA 1BJOA 2W7KA 1YAAA 2E54A 1QIRA 3DC1A 3VK3A 1SF2A 3RQ1A 2D7YA 4ITGA 5EIGB 1E5EA 4IXSA 4ZDPA 4CVQA 1I48A 3I5TA 2V0YA 5M46A 2W8VA 1AY8A 3CQ6A 1TPLA 3VK4A 1X28A 1FC4A 1EJIA 2O0RA 2D61A 3ATHA 2ZY4A 1YIZA 1SFFA 1M6SA 4GEBA 3TQXA 4DBCA 4MKKA 2CSTA 1OXPA 1MDZA 3B1EA 2ZSMA 4ZWMA 4F5LA 3QI6A 3GZCA 4LNMA 1AHFA 3HL2A 4HVKA 2ZUKA 3PGYA 2HP1A 1IX6A 1RVUA 1D7SA 3DXWA 3QBOA 3FDDA 4Q76A 1ORDA 2ZSLA 4CBSA 3FQAA 1W23A 2QBTA 1KMJA 2VMNA 2G6WA 2Z1YA 3ASAA 4I8AA 5I92A 1B9IA 2X5DA 5M49A 4WYFA 4BA5A 1PFFA 5FT6A 1AIBA 4ATPA 3MBBA 1ZC9A 4RAEA 4W91A 2C81A 1TASA 3BC8A 2VMTA 3JWAA 2VMSA 4XJPA 4GE7A 1AMRA 4U2HA 2C44A 1BS0A 2QB3A 1BJWA 2VMPA 4OMAA 1UU0A 2CFBA 2JJGA 3P1TA 3B8XA 3KGXA 5F9SA 2ZY3A 1WYVA 3GBXA 3AOWA 1H0CA 5EQCA 1BJOB 8AATA 4GE9A 1AY4A 2EZ2A 1AAWA 3NYUA 1JS3A 1CZCA 2FM1A 1S08A 4F5MA 1KMKA 1CQ7A 2AY4A 2HZPA 2V1PA 2YKVA 3HLMA 3II0A 3PD6A 3PJ0A 4KAMA 4WP0A 1AICA 1RV4A 1IAYA 4IYOA 2CANA 3K7YA 3EI6A 1G7XA 1MAQA 2VMXA 1M0OA 4Y0DA 4AO4A 2CJGA 4M2JA 3OP7A 2VMVA 2YHKA 1ASFA 3N75A 1B5OA 2YRRA 5F8VA 3UE8A 2EPJA 2HUFA 3R4TA 4UOYA 3AENA 3MADA 5G2QA 1O62A 2BWOA 2OQXA 3G7QA 4ZASA 1LC8A 5EIGA 4R8DA 2W7MA 4F5HA 5E5IA 1ASEA 1XI9A 1C7OA 1JF9A 2HP2A 1O61A 1V2DA 4IXZA 1ARTA 2VMRA 1ARGA 2AY9A 4TN4A 1BT4A 2R5CB 4PFFA 4L0OA 5E3KA 3BV0A 4Q75A 3DR4A 3MEBA 1B5PA 2ORDA 3BS8A 2YKXA 4F5JA 1W3UA 5EUEA 3LV2A 5DX5A 1UU2A 1QISA 1M32A 3ACZA 4WXFA 2BWNA 2E7UA 3H7FA 1DGEA 1QZ9A 3QGUA 5FT8A 4F5FA 1RVYA 2VIAA 3QN6A 2EH6A 3DODA 2EGYA 4J5UA 1M0PA 4MKJA 3AELA 2R5EA 1MAPA 2RFVA 2GQNA 5HHYA 4ZSYA 2YKUA 3FFRA 4A0HA 3COGA 1BKGA 2X5FA 5D95A 1AKBA 1CJ0A 2VMYA 3ASBA 3FCRA 3P6KA 1X0MA 3QPGA 1SZKA 2VMQA 2ZP7A 3AEMC 1OHVA 3NYTA 3AENB 3TATA 3E2FA 2FYFA 4A00A 1E5FA 4AOAA 4ZM4A 3NUIA 3AEJC 3PIUA 4F4EA 3EI5A 4KYOA 2XBNA 1WSTA 2FNUA 2W7IA 4FL0A 1BW0A 1AHEA 4W8IA 4WLHA 4A72A 3PPLA 4GRXA 1WYUA 4JEYA 4B9BA 1GBNA 4XQ2A 3HQTA 4ZDLA 1MDOA 7AATA 2OGAA 2VGWA 4K2BA 3VAXA 1LC7A 1H1CA 2W7EA 4ITXA 4XEWA 5K8BA 3ISLA 2BI2A 1ARIA 1IJIA 2CJDA 3FRKA 3G8MA 4IY7A 3ZRRA 1QITA 3ELPA 3K40A 4RJYA 4UQVA 4OCAA 3FTBA 3RUYA 3NU7A 1GC0A 1ASAA 4ADCA 3VK2A 3RI6A 5TF5A 1AHXA 2VMUA 2ZC0A 3HDOA 3Q8NA 4E3QA 4A6UA 1OATA 4QGRA 1CQ8A 2BYLA 3L8AA 1Z7DA 3MC6A 3CAIA 2AY1A 1KKPA 1CZEA 3A2BA 4WB0B 1ARSA 2VGSA 3EIBA 2W8TA 4IW7A 1U08A 3MAFB 4XJLA 3LY1A 2D63A 2R5CA 2ZY5A 4WYAA 5G0AA 2TPLA 1AJRA 3BWNA 3GZDC 2DKJA 1M0QA 4N0WA 5G2PA 1VP4A 2JJHA 4MQQA 3FVUA 3TCMA 2D65A 3NRAA 1LKCA 1CL1A 1EG5A 3DRDA 1CL2A 3KE3A 2JJEA 2FNIA 2YOBA 4OT8A 4WYDA 1W7MA 4WYGA 4EU1A 1V2FA 2YCNA 1N31A 4W1VA 4JF1A 1D7RA 4OC9A 4A6RA 1AHYA 2VMWA 3FQ8A 2W8JA 1QJ5A 4GDYA 4WLJA 4WXBA 2VIBA 1TOIA 3WKRA 2BIAA 3JW9A 4ZWVA 1MLZA 1WYUB 2CY8A 1SZUA 4P3MA 3WX9A 2ZJGA 4ADEA 2YCPA 1IX8A 1AHGA 2VLFA 3F9TA 4E1OA 1B4XA 1AMSA 2D64A 4EFFA 3DR7A 4JEZA 3TFTA 1GCKA 5EUNA 1D2FA 4BQ0A 2DR1A 3HMUA 3ZRQA 3E6GA 2PO3A 4LNLA 3FFHA 4A0FA 1J04A 2BI1A 4LNJA 5C6UA 5HXXA 2YRIA 1J32A 1ASDA 2CJHA 4A0RA 4F5IA 3BB8A 2W8UA 3JTXA 4ZLVA 3LVJA 2VLHA 4K2IA 3CQ4A 1C9CA 3L44A 2GSAA 2R0TA 1X2AA 1CS1A 3DXVA 4K2MA 1IUGA 1BQAA 1GEXA 2W7JA 3WKSA 5J8QA 3RCHB 4O6ZA 4TMRA 4LC3A 4BA4A 1MDXA 1ASCA 1ARHA 1KKJA 3UWCA 2BKWA 3A8UX 1ASBA 4GE4A 1P3WA 2VMZA 2O1BA 3B1CA 1IX7A 1ECXA 1WKHA 2FQ6A 3FKDA 3GETA 3QHXA 5BJ3A 1Y4IA 5E4ZA 3D6KA 3NDNA 4EB7A 2GB3A 3EI7A 3IHJA 4Q6RA 4KXKA 2HUIA 4WD2A 4ATQA 3BCXA 2VGVA 3BWOA 4JEXA 4WB0A 4AZJA 5EFSA 2W8WA 3MAFA 2VGUA 2VYCA 1TOKA 2AY2A 3NNKA 3GZDA 3EIAA 3USFA 1G4XA 3E2ZA 1IAXA 1AX4A 3A9ZA 4W1XA 2ZY2A 5JAYA 4R5FA 4DQ6A 3BCBA 4F5KA 3AV7A 4ZM3A 5M4BA 2GMUA 3NYSA 4R5ZA 2DOUA 2D7ZA 2Z9VA 4BMKA 1I41A 1UKJA 3RBLA 1DFOA 1S09A 3EZ1A 1ASLA 2ZYJA 3WGBA 4UHNA 4UHMA 2Z9XA 4CXQA 1YNUA 4A6TA 2YCTA 3DU4A 1RV3A 1AAMA 3A9XA 3LVMA 4CXRA 4AH3A 2XH1A 2Z9UA 3N0LA 1BJ4A 2CH2A 2CINA 1DTYA 1FG7A 2QMAA 3WY7A 2Z9WA 1OHWA 1UU1A 3GR9A 3RBFA 2DKBA 2VMOA 1ELQA 4AZKA 1D7UA 3AATA 4NOGA 1TOEA 3LVKA 1AKAA 1FG3A 3F6TA 2WK7A 2Z61A 2NMPA 3ECDA 1AY5A 1TARA 4P7YA 1ZODA 4ZDOA 1YOOA 1S0AA
chains in the Genus database with same CATH superfamily
4X23D 1P3GC 3KKIA 1YJSA 3X1UB 3X1UC 5BNVA 1LC5A 4G92B 3WCNA 3BN1A 1P3OA 2EZ1A 2HOXA 5AVCB 4MY5A 3TFUA 1M19C 1KL1A 3E2ZB 2X8UA 1AJSB 2R2NA 4XAUA 1LW4A 5B1LD 4NE3A 5B2IA 4J8VD 3C1BA 3AZHC 1DGDA 5EAVA 3NUBA 1EQBA 3C1CA 2AATA 1ZOBA 3AL0C 2HUEB 1P3IC 2FN6A 2AY5A 5B32B 5B40A 5EAAA 3FDBA 5B33A 4ZUXD 1AOIC 1LS3A 1P3KA 1N2TA 4WV4B 3WAAB 1OHYA 1W7NA 1VEFA 2G5IC 1MLYA 3REIB 5B32G 4QLCD 3B0DB 1V72A 3A9YA 4IXOA 4XJMA 3LELB 4H9PB 2W8SA 3WZFA 4CAYA 1GDEA 3T32A 3PA9A 5DJ1A 1T3IA 1P3LD 2HOYA 1IBJA 5DJ9A 5G4IA 3TU4D 3H9XA 3W96D 2VQRA 3E77A 1M1AD 5D5SA 3KWQB 1P34C 5G49B 1WKGA 5GT0B 2DGKA 1SPAA 3AZLD 2BYJA 2Z1ZA 1DJEA 1M18D 5CPIC 5AV5D 2E7IA 1S07A 3GJUA 3OKSA 5B40B 3RELC 2IO5C 1AMAA 4FFCA 1WYTA 3WGCA 4AO9A 3K28A 4HF8A 2HOZA 1IVRA 3MGQB 3B0CT 2JGTA 4LW4A 3LJAA 4AWLC 1KL2A 4ADDA 3W97A 3LG0A 4XZQB 1VJOA 2BHXA 3PDBA 4MQRA 1GD9A 2HIOD 3F0HA 3LZ1B 2W7DA 5GT3C 1XEYA 3AFAC 4CAYB 2VGTA 2DQNC 2QLRA 5CP6D 1JG8A 3A6NC 1I43A 4WNNA 3AN2A 1KX5C 2E54A 3MGSD 1BH8B 2D7YA 1F1EA 1I48A 3FD0A 3I5TA 3VH6T 1AY8A 3VK4A 1ZLAC 3UTBB 1EJIA 4RJ0A 1SFFA 4KGCA 4GEBA 4DBCA 3AV2D 4F5LA 3UTAD 3A1IA 4J8WD 3W97B 1IX6A 1TAFA 3FDDA 3FQAA 4YM6A 2Z1YA 2RVQD 3AZJB 3B6FA 3AV1A 4WYFA 5FT6A 2C81A 3BC8A 1P3FD 3MNNB 4XJPA 1AMRA 4U2HA 4OMAA 3AZFD 4YS3D 1UU0A 3B8XA 3W99A 2FJ7A 1JS3A 3X1VC 3KXBB 5JA4A 2EYQA 1KMKA 2YKVA 4WP0A 1AICA 1RV4A 5B0YD 4AO4A 4KGCB 1TZYA 3OP7A 5GXQD 2L5AA 2EPJA 1BFMA 1U35A 3AENA 5DNNA 2OQXA 3G7QA 4F5HA 5EIGA 2AROC 5AVCD 4JJNB 4IXZA 1V2DA 1ARTA 5DNMA 1ARGA 4TN4A 4PFFA 3B6FB 5E3KA 3MGRC 1EQZA 2ORDA 4R8PB 2J8PA 2BWNA 2DGMA 1QZ9A 5FT8A 5B32D 5CPKB 3KUYC 1P3PA 4Z5TB 4MKJA 3AELA 1P3BC 3REKA 1MAPA 3WAAD 2YKUA 4A0HA 3REID 2BG1A 5D95A 2VMYA 1TZYB 3AZMB 3P6KA 3LELD 1P3MB 3WKJA 1OHVA 3AENB 4Z66A 1E5FA 4CSRA 3NUIA 3PIUA 4KYOA 2W7IA 3REHA 5B31B 4FL0A 1BW0A 5GSUB 1KX4A 4W8IA 2NQBC 4GRXA 7AATA 1MDOA 2OGAA 4LD9B 2W7EA 1H1CA 5K8BA 3ISLA 1EQZB 1ARIA 2BI2A 3MGPA 3FRKA 3KWQD 4IY7A 5B31G 3FTBA 5B24C 5GT0D 1ASAA 3RI6A 5TF5A 3WA9A 3X1TC 4E3QA 5B40D 2BYLA 4X23A 1P3AB 2VGSA 3MAFB 3VH6W 2R5CA 1AJRA 2DKJA 5G2PA 4MQQA 3MGQD 3FVUA 5B2JB 3AZNA 1CL1A 1EG5A 1CL2A 4XZQD 5B1LA 4J8VA 4WYDA 3LZ1D 5BS7C 4EU1A 1AHYA 2VMWA 4HGAC 2W8JA 1QJ5A 4WXBA 1TOIA 4NE6A 2BIAA 3JW9A 3WX9A 2ZJGA 2YCPA 1IX8A 5AV8B 4UUZA 1F66A 1AMSA 4XUJB 3TFTA 5EUNA 4BQ0A 3R45B 3ZRQA 2PO3A 5JRGB 1J04A 4LNJA 5HXXA 4QLCA 2YRIA 3UTBD 1ASDA 3BB8A 3JTXA 4ZLVA 1X2AA 2G5HC 5B0ZA 3RCHB 3AZNB 1P3LA 4BA4A 3W97D 2BYKB 1ASCA 3TU4A 2VMZA 3W96A 2FQ6A 3FKDA 3QHXA 1Y4IA 3AZJD 3NDNA 1M1AA 2GB3A 3EI7A 4WU8B 4KXKA 2HUIA 3BCXA 3BWOA 4AZJA 2BYMA 2VGUA 5F99C 2VYCA 1TOKA 3AZLA 4KUDC 5E5AC 3MNND 3USFA 5AV5A 1HQ3B 1HQ3C 2ZY2A 3BCBA 4F5KA 3NYSA 4R5ZA 4BMKA 4UUZB 1F66B 1ASLA 3AYWA 3KXBD 2G7JA 4UHNA 3VP6A 3WGBA 5AVBA 3DU4A 3W98C 4AH3A 4KGCD 2XH1A 1BJ4A 1FG7A 2Z9WA 3RBFA 5B0ZB 1FG3A 2DGLA 3ECDA 5CP6A 5AV9C 4RITA 4JJND 3WCOA 1TATA 2BIEA 2OATA 3B6FD 1B9HA 4MQPA 2BYMB 5AV6C 4R8PD 4EB5A 4H9OA 1CQ6A 4OYTA 3FZ6A 3VH5A 3W99D 1GC2A 3PDXA 1LK9A 5CPKD 2PYOC 2CH1A 3GSBA 3AV2A 4Z5TD 3AYWB 4WYCA 3UTAA 3FQ7A 4J8WA 1V2EA 2Y2NA 3AEOA 4CBRA 2QB2A 1ASNA 1TZYD 3AZMD 3JWBA 1DKAA 4XJOA 4E77A 4MSOA 1P3MD 2PB0A 4GSAA 2YKYA 1P3FA 5AY8C 3AEMA 5B31D 3WLXA 3VOMA 5GSUD 5HDMA 3REJB 3DYDA 2LY8A 3AZEB 1BJNA 3MVDC 1GC4A 1PG8A 4PFNA 3UT9C 4LD9D 4Z2MG 1EQZD 4ZSWA 2W7GA 1JFIA 1C0NA 1O4SA 2NZDB 2W7HA 4JEVA 5B0YA 4UHOA 3X1SA 5GXQA 4J8UC 2JISA 4IX8A 3WTPC 1P3AD 1C7NA 3X1UA 1T3UA 2WK9A 2EO5A 3MKJA 3I4JA 3FVXA 5B2JD 3LZ0C 5G4JA 5AVCA 3AZGC 4OTLA 1JS6A 1AJSA 3EI9A 1WYVB 1Z2CB 2WK8A 1S32C 1KX3C 5B32A 2XD1A 5C3IB 3PD6B 5AV8D 1GEYA 3N7NA 3ELEA 3ZZJA 4WU9B 4XUJD 1AOIA 2O7CA 3WAAA 3E2YA 3B6GC 1C4KA 5AX8A 3CBFA 5JRGD 3EI8A 3REIA 4DGTA 4J8XB 3EZSA 5M4DA 3X1SB 3DC1A 1P3GB 3LELA 4H9PA 4IXSA 4ZDPA 4CVQA 5CPJC 1TPLA 1X28A 3AZND 1N1JB 1M19B 3TQXA 2CV5C 2CSTA 1OXPA 1MDZA 3AZHB 4ZWMA 4WU8D 3GZCA 3KWQA 4HVKA 3PGYA 1P34A 5G49A 3DXWA 3AZKC 5GT0A 1ID3C 4Q76A 2WB6A 1P3IB 2G6WA 5B1MC 3RELA 4BA5A 1F66D 4ATPA 1ZC9A 4H9SC 1AOIB 2VMTA 2VMSA 2VMPA 3MGQA 1BS0A 2JJGA 3KGXA 3AZIC 5EQCA 4XZQA 4GE9A 1B67A 3LZ1A 2F8NK 3AFAA 2AY4A 1CQ7A 2V1PA 3PJ0A 5B0ZD 2CANA 3K7YA 3O62C 3NQJA 1MAQA 2VMXA 3G0TA 4EO5C 4M2JA 1KX5A 3KFUG 1BH8A 1P34B 3V9RA 4R8DA 5E5IA 1ASEA 1XI9A 1C7OA 2HP2A 1O61A 5CPIB 4WZSB 1P3OC 2VMRA 1BT4A 3UTBA 3RELB 2IO5B 4Q75A 3MEBA 1B5PA 5B2IC 3C1BC 3LV2A 5DX5A 1UU2A 3AYWD 4WXFA 4AWLB 3C1CC 5AVBD 3QN6A 5GT3B 3AZJA 3AFAB 4ZSYA 3FFRA 3N4RA 3COGA 5B33C 1P3KC 3NQJB 3MNNA 2JE5A 1CJ0A 3A6NB 4ZBJC 1X0MA 1SZKA 3REJD 2ZP7A 3NYTA 3H0MC 1KX5B 3E2FA 3AZED 4AOAA 3EI5A 3V9RB 1WSTA 3KXBA 2DF4C 4WLHA 4A72A 3PPLA 1ZLAB 2NZDD 4JEYA 4K2BA 5BO0B 3VAXA 4RJYA 2FFFB 3Q8NA 4NFTA 4A6UA 3MC6A 3CAIA 1KKPA 4JJNA 2W8TA 1U08A 4H9RB 2ZY5A 3BWNA 3GZDC 4N0WA 1VP4A 1PZRA 2JJHA 3TCMA 3NRAA 1LKCA 4R8PA 3KE3A 3H0LC 2FNIA 3LJAC 2YOBA 4G91C 1V2FA 5CPKA 1D7RA 4H9NB 3X1VB 4Z5TA 1H3OB 4WU9D 1P3BA 2VIBA 2CY8A 1SZUA 4P3MA 4ADEA 4J8XD 1AHGA 2VLFA 3X1SD 3AZMA 3AN2C 1P3GD 3X1UD 1D2FA 1P3MA 2DR1A 3E6GA 5C6UA 4A0FA 2BI1A 2CJHA 5B31A 2AROB 5GSUA 1M19D 3LVJA 2VLHA 3CQ4A 3L44A 2GSAA 2R0TA 3AZHD 2W7JA 3MGRB 4LD9A 4E44A 4TMRA 1KKJA 3UWCA 2BKWA 4GE4A 1P3ID 5E4ZA 4WD2A 2VGVA 4YM6C 1P3AA 3KUYB 1WWIA 3MAFA 2AY2A 3AV1C 1P3BB 1AOID 2OKJA 1G4XA 1AX4A 3JZLA 5B2JA 4DQ6A 2Z9VA 1S09A 2ZYJA 4UHMA 2Z9XA 2FJ7C 1YNUA 2UWXA 4A6TA 1AAMA 5KDMB 3LVMA 3HBXA 2NQBB 1HTAA 2CINA 1UU1A 3VH6A 1ELQA 5AV8A 4AZKA 3AATA 4XUJA 2NMPA 1P34D 1U35C 3EPKA 4P7YA 3R45A 1ZODA 5B24B 5DNNC 4ZDOA 1YOOA 5JRGA 5CPID 4WXGA 4WBTA 3X1TB 3KGWA 9AATA 3FSLA 4R2NA 3RELD 2HUUA 4B98A 1YIYA 5DNMC 2QSRA 3FZ7A 4M6BA 2C7TA 4U1TA 2C0RA 1W2EA 3RCHA 4A0GA 1C7GA 2BYKA 5BT1C 1ELUA 1WWSA 5GT3D 4WU8A 3LWSA 3AFAD 1GC3A 2VI9A 1P3PC 3R9AA 3REKC 4HGAB 3PAAA 5E5AA 3CQ5A 3A6ND 1HQ3A 2X3LA 3ZZKA 4NE5A 1KX5D 1SVVA 3EG5B 3WKJC 2QA3A 3NTJA 4Z66C 4ISYA 4M2KA 3AEJA 1ZLAD 3FZ8A 3REHC 2W7FA 2JJFA 1KX4C 3HVYA 4M2MA 5G09A 3B0BA 4RKDA 3B46A 4OBVA 2AY3A 2AY8A 3MGPC 2BWPA 5AV9A 3WA9C 1AIAA 1R4VA 1W7LA 1D7VA 4PIWA 4X23C 5F99B 1S06A 4K05A 4KUDB 5E5AB 4W1WA 5FT5A 2WKAA 2AY6A 4EMYA 2GMSA 1AKCA 5B1LC 4J8VC 1M7YA 2PYOA 2OGEA 2VI8A 4H51A 3X1VD 1ASMA 3E9KA 4PVFA 2JG2A 2BI9A 3W98B 3EPHA 3DZZA 4IYOB 4BHDA 5FUGB 5FT4A 3GWPA 2E7JA 2BI3A 1QJ3A 1B8GA 1MGVA 4ZUXC 4JEWA 5AY8A 2Q7WA 1BJOA 1YAAA 2AROD 3VK3A 5AV9B 1SF2A 3RQ1A 4QLCC 3REJA 1E5EA 3AZEA 2W8VA 3MGRD 2YFVB 5AV6B 1FC4A 2O0RA 3I16A 3ATHA 1YIZA 1M6SA 2NZDA 1P3LC 2ZSMA 3TU4C 3W96C 4LNMA 1AHFA 3HL2A 3KSYA 3KUYD 2PYOB 1M1AC 1RVUA 1P3BD 1ORDA 2ZSLA 4CBSA 5BNXB 1KMJA 5M49A 2OKKA 3AZLC 1M18C 5AV5C 1AIBA 3MBBA 1B6WA 1TASA 3JWAA 4UPKA 1BJWA 2CFBA 2ZY3A 1WYVA 5AY8B 1H0CA 1BJOB 1KX3A 1AY4A 2EZ2A 1AAWA 2NQBD 2FM1A 2HIOC 3MVDB 3PD6A 2Y2MA 4KAMA 3UT9B 3VH5W 5KTBA 2F8NB 4WU9A 5B24D 1ASFA 2YRRA 5F8VA 1KU5A 5CP6C 3UE8A 3X1TD 2HUFA 4J8XA 4J8UB 5G2QA 3WTPB 1P3GA 2BWOA 4ZASA 2F8NG 2W7MA 2Y2PA 1KAFA 3MGSC 3HT4A 2AY9A 3LZ0B 1N1JA 1M19A 3AZGB 2CV5A 3BS8A 3AZHA 1QISA 1M32A 2KFPA 3ACZA 4H63Q 3AV2C 1DGEA 4F5FA 1RVYA 1S32B 3UTAC 1KX3B 2EH6A 4J8WC 1P3IA 4J5UA 1M0PA 2RFVA 2RVQC 1AKBA 3FCRA 3B6GB 1P3FC 2VMQA 3AEMC 4A00A 3AZFC 4YS3C 4YS3B 4F4EA 5CPJB 1GBNA 4ZDLA 3HQTA 2VGWA 2CV5B 1IJIA 3G8MA 5B0YC 3ZRRA 3ELPA 4UQVA 3RUYA 1GC0A 5GXQC 4ADCA 2Y2IA 5F99D 1OATA 4OBUA 3AZKB 4G92C 4QGRA 1Z7DA 1ID3B 4KUDD 3A2BA 4WB0B 5E5AD 1ARSA 5CPIA 4IW7A 1HQ3D 5B1MB 3LY1A 4WYAA 5AVCC 2Y2QA 2TPLA 1M0QA 2D65A 3DRDA 3NQUB 3AZIB 4KHAB 4WYGA 2YFWB 2YCNA 2HUEC 1N31A 4JF1A 3W98D 5GT3A 5B32C 2Y2GA 2RIQA 4WLJA 3O62B 3WAAC 4EO5B 3F9TA 3A6NA 4EFFA 5AV9D 3REIC 1GCKA 3B0DC 3FFHA 5BNVB 3LELC 5AV6D 4E45A 2W8UA 2ZM5A 1P3OB 4K2IA 1ZLAA 5BO0A 3WKSA 5J8QA 5B2IB 3C1BB 2PYOD 1MDXA 1ASBA 1P3WA 3KWQC 2O1BA 1WKHA 3GETA 3C1CB 5GT0C 4JEXA 4H9RA 5B40C 2A1VA 3GZDA 3EIAA 4DRAA 1IAXA 3A9ZA 4W1XA 5B33B 1P3KB 3AV7A 5M4BA 2GMUA 5AY8D 4ZBJB 3MGQC 1I41A 3RBLA 1DFOA 4XZQC 3MVDD 3LZ1C 4H9NA 3UT9D 2JCHA 3X1VA 1H3OA 2F8ND 4CXRA 2Z9UA 1DTYA 2CH2A 2QMAA 3WY7A 2FKIA 2VMOA 4H9QA 1D7UA 1TOEA 4J8UD 3WTPD 3F6TA 2WK7A 2HZPA 1M0NA 3LVLB 3EPLA 3LZ0D 5BJ4A 1SZSA 2AROA 2D5YA 1YJYA 1YJZA 1I29A 3AZGD 2BI5A 3N4XA 1G4VA 3UTBC 3B1DA 4RKCA 5EUDA 1WYTB 3MGRA 4Y0IA 1N8PA 4RM1A 2PB2A 1Z3ZA 2AEUA 1A7WA 3BCAA 1S32D 1KX3D 2Y2JA 3LJAB 3A1KA 3NU8A 3W97C 3NX3A 3PDBB 4G91B 5CHLB 3EUCA 1M4NA 3KUYA 3AZJC 2F8JA 3N5MA 1GEWA 2CTZA 1DJUA 3B6GD 1DJ9A 5IWQA 3MNNC 1TOGA 2HORA 4H9QB 1BQDA 4JF0A 4LW2A 3UAKA 4WNNB 4W5KA 2Y2LA 3AN2B 4RIZA 5CPJD 1X29A 3KXBC 5KDMA 1OXOA 3H0RC 2CV5D 2NQBA 2CB1A 1LW5A 4KGCC 4Y0HA 4ADBA 1TOJA 2AY7A 3AOVA 3AZKD 1G7WA 5B24A 2BIGA 1ID3D 2Z20A 3AEPA 3ZRPA 3X1TA 5B1MD 3MC6C 1TAFB 4JJNC 4YM6B 2W7LA 1O69A 1AMQA 4F5GA 3BWNC 2VGZA 3B6FC 3AV1B 4E3RA 4WYEA 4R8PC 1QGNA 3AZID 3FVSA 3W99B 3W99C 4ZAHA 5BS7A 5DB5A 3M5UA 1ASGA 5CPKC 2FJ7B 4Z5TC 3W1JA 5JA4B 3QM2A 3O62D 4Q31A 3MAUA 1TZYC 3AZMC 4XK1A 3B0CW 4J8LA 1P3MC 2D66A 1U35B 2W7KA 5DNNB 1QIRA 4ITGA 5EIGB 1P3OD 3W1HA 5B31C 5GSUC 2V0YA 5M46A 3CQ6A 5DNMB 2D61A 2ZY4A 5B2ID 3C1BD 4LD9C 1EQZC 4MKKA 3B1EA 3C1CD 3QI6A 3IP4C 2ZUKA 2HP1A 1D7SA 3QBOA 1P3AC 3WTPE 1PMMA 1W23A 2QBTA 3ASAA 2VMNA 4I8AA 1P3PB 5I92A 1B9IA 2X5DA 5F99A 5B33D 3REKB 4DQYB 4DRBA 1P3KD 4KUDA 3VH5T 1PFFA 5B2JC 4RAEA 4W91A 4GE7A 2C44A 2QB3A 3P1TA 5F9SA 3WKJB 3GBXA 3AOWA 4Z66B 8AATA 4CSRB 2CWEA 3NYUA 3REHB 1CZCA 1KX4B 1S08A 4F5MA 3HLMA 3II0A 3W98A 4IYOA 3P5JB 1IAYA 5FUGA 3EI6A 1G7XA 1M0OA 4Y0DA 5AV8C 2CJGA 2VMVA 2YHKA 3MGPB 3N75A 1B5OA 4XUJC 4ZUXA 3R4TA 4UOYA 3MADA 5JRGC 3WA9B 1O62A 1LC8A 1JF9A 4X23B 2YFVA 5AV6A 2R5CB 4L0OA 3BV0A 3DR4A 2YKXA 3LJAD 3AZNC 4F5JA 1W3UA 5EUEA 1PMOA 2E7UA 5B1LB 4J8VB 3H7FA 3QGUA 4WU8C 2VIAA 3DODA 2EGYA 5BNXA 2XD5A 2R5EA 2F2AC 1M18A 2GQNA 5HHYA 1BKGA 3AN2D 2X5FA 3ASBA 1F66C 3QPGA 4ZUXB 3TATA 2FYFA 4ZM4A 3AEJC 4QLCB 2XBNA 2FNUA 1AHEA 2HIOA 3MVDA 3UT9A 4B9BA 1WYUA 2F8NA 4XQ2A 1Q9CA 1LC7A 4ITXA 4XEWA 5B0ZC 2CJDA 1P3LB 1QITA 3K40A 2Y2KA 4OCAA 2Y2HA 3NU7A 3TU4B 4J8UA 3VK2A 1AHXA 2VMUA 2ZC0A 3W96B 3HDOA 4YM6D 3WTPA 1M1AB 1CQ8A 3L8AA 3AV1D 2AY1A 3MGSA 1CZEA 3EIBA 4XJLA 3W1IA 2D63A 3LZ0A 3AZLB 5G0AA 1M18B 5AV5B 3AZGA 3N4SA 4Z2MH 2JJEA 4OT8A 2FJ7D 1W7MA 3AYWC 1S32A 2JSSA 4W1VA 1ULYA 4OC9A 5AVBB 5AVBC 4A6RA 2F8NH 3FQ8A 1BH9A 4GDYA 2HIOB 3WKRA 4ZWVA 1MLZA 1WYUB 1U35D 4E1OA 1B4XA 5DNND 3B6GA 2D64A 3DR7A 2Y2OA 4JEZA 5CP6B 3EPJA 3HMUA 3AZFA 4YS3A 4LNLA 5DNMD 3REJC 1J32A 3AZEC 4A0RA 4F5IA 3MGSB 5CPJA 1C9CA 1CS1A 3DXVA 4K2MA 1GEXA 1BQAA 1IUGA 4H9OB 5BT1D 2NZDC 4O6ZA 4LC3A 1ARHA 3A8UX 3B1CA 1IX7A 1ECXA 3AV2B 5BJ3A 1P3PD 3D6KA 4EB7A 3IHJA 3AZKA 3REKD 4Q6RA 3UTAB 1ID3A 4ATQA 4WB0A 2AEVA 4J8WB 5EFSA 2W8WA 5B1MA 3NNKA 1BH9B 3E2ZA 4WJ3C 5JAYA 4R5FA 3WKJD 4H9SA 4ZM3A 2DOUA 2D7ZA 4Z66D 1UKJA 3EZ1A 1P3FB 3NQUA 3AZIA 4KHAA 3REHD 4RLGA 2YFWA 1KX4D 3AZFB 4CXQA 2YCTA 1RV3A 5C3IC 3A9XA 3N0LA 3MGPD 4WU9C 1OHWA 3O62A 3GR9A 2DKBA 1JFIB 4NOGA 3LVKA 1AKAA 5B0YB 3WA9D 2Z61A 4J8XC 1AY5A 3X1SC 1TARA 5GXQB 1S0AA
chains in the Genus database with same CATH topology
4X23D 1P3GC 3KKIA 1YJSA 3X1UB 3X1UC 5BNVA 1LC5A 4G92B 3WCNA 3BN1A 1P3OA 2EZ1A 2HOXA 5AVCB 4MY5A 3TFUA 1M19C 1KL1A 3E2ZB 2X8UA 1AJSB 2R2NA 4XAUA 1LW4A 5B1LD 4NE3A 5B2IA 4J8VD 3C1BA 3AZHC 1DGDA 5EAVA 3NUBA 1EQBA 3C1CA 2AATA 1ZOBA 3AL0C 2HUEB 1P3IC 2FN6A 2AY5A 5B32B 5B40A 5EAAA 3FDBA 5B33A 4ZUXD 1AOIC 1LS3A 1P3KA 1N2TA 4WV4B 3WAAB 1OHYA 1W7NA 1VEFA 2G5IC 1MLYA 3REIB 5B32G 4QLCD 3B0DB 1V72A 3A9YA 4IXOA 4XJMA 3LELB 4H9PB 2W8SA 3WZFA 4CAYA 1GDEA 3T32A 3PA9A 5DJ1A 1T3IA 1P3LD 2HOYA 1IBJA 5DJ9A 5G4IA 3TU4D 3H9XA 3W96D 2VQRA 3E77A 1M1AD 5D5SA 3KWQB 1P34C 5G49B 1WKGA 5GT0B 2DGKA 1SPAA 3AZLD 2BYJA 2Z1ZA 1DJEA 1M18D 5CPIC 5AV5D 2E7IA 1S07A 3GJUA 3OKSA 5B40B 3RELC 2IO5C 1AMAA 4FFCA 1WYTA 3WGCA 4AO9A 3K28A 4HF8A 2HOZA 1IVRA 3MGQB 3B0CT 2JGTA 4LW4A 3LJAA 4AWLC 1KL2A 4ADDA 3W97A 3LG0A 4XZQB 1VJOA 2BHXA 3PDBA 4MQRA 1GD9A 2HIOD 3F0HA 3LZ1B 2W7DA 5GT3C 1XEYA 3AFAC 4CAYB 2VGTA 2DQNC 2QLRA 5CP6D 1JG8A 3A6NC 1I43A 4WNNA 3AN2A 1KX5C 2E54A 3MGSD 1BH8B 2D7YA 1F1EA 1I48A 3FD0A 3I5TA 3VH6T 1AY8A 3VK4A 1ZLAC 3UTBB 1EJIA 4RJ0A 1SFFA 4KGCA 4GEBA 4DBCA 3AV2D 4F5LA 3UTAD 3A1IA 4J8WD 3W97B 1IX6A 1TAFA 3FDDA 3FQAA 4YM6A 2Z1YA 2RVQD 3AZJB 3B6FA 3AV1A 4WYFA 5FT6A 2C81A 3BC8A 1P3FD 3MNNB 4XJPA 1AMRA 4U2HA 4OMAA 3AZFD 4YS3D 1UU0A 3B8XA 3W99A 2FJ7A 1JS3A 3X1VC 3KXBB 5JA4A 2EYQA 1KMKA 2YKVA 4WP0A 1AICA 1RV4A 5B0YD 4AO4A 4KGCB 1TZYA 3OP7A 5GXQD 2L5AA 2EPJA 1BFMA 1U35A 3AENA 5DNNA 2OQXA 3G7QA 4F5HA 5EIGA 2AROC 5AVCD 4JJNB 4IXZA 1V2DA 1ARTA 5DNMA 1ARGA 4TN4A 4PFFA 3B6FB 5E3KA 3MGRC 1EQZA 2ORDA 4R8PB 2J8PA 2BWNA 2DGMA 1QZ9A 5FT8A 5B32D 5CPKB 3KUYC 1P3PA 4Z5TB 4MKJA 3AELA 1P3BC 3REKA 1MAPA 3WAAD 2YKUA 4A0HA 3REID 2BG1A 5D95A 2VMYA 1TZYB 3AZMB 3P6KA 3LELD 1P3MB 3WKJA 1OHVA 3AENB 4Z66A 1E5FA 4CSRA 3NUIA 3PIUA 4KYOA 2W7IA 3REHA 5B31B 4FL0A 1BW0A 5GSUB 1KX4A 4W8IA 2NQBC 4GRXA 7AATA 1MDOA 2OGAA 4LD9B 2W7EA 1H1CA 5K8BA 3ISLA 1EQZB 1ARIA 2BI2A 3MGPA 3FRKA 3KWQD 4IY7A 5B31G 3FTBA 5B24C 5GT0D 1ASAA 3RI6A 5TF5A 3WA9A 3X1TC 4E3QA 5B40D 2BYLA 4X23A 1P3AB 2VGSA 3MAFB 3VH6W 2R5CA 1AJRA 2DKJA 5G2PA 4MQQA 3MGQD 3FVUA 5B2JB 3AZNA 1CL1A 1EG5A 1CL2A 4XZQD 5B1LA 4J8VA 4WYDA 3LZ1D 5BS7C 4EU1A 1AHYA 2VMWA 4HGAC 2W8JA 1QJ5A 4WXBA 1TOIA 4NE6A 2BIAA 3JW9A 3WX9A 2ZJGA 2YCPA 1IX8A 5AV8B 4UUZA 1F66A 1AMSA 4XUJB 3TFTA 5EUNA 4BQ0A 3R45B 3ZRQA 2PO3A 5JRGB 1J04A 4LNJA 5HXXA 4QLCA 2YRIA 3UTBD 1ASDA 3BB8A 3JTXA 4ZLVA 1X2AA 2G5HC 5B0ZA 3RCHB 3AZNB 1P3LA 4BA4A 3W97D 2BYKB 1ASCA 3TU4A 2VMZA 3W96A 2FQ6A 3FKDA 3QHXA 1Y4IA 3AZJD 3NDNA 1M1AA 2GB3A 3EI7A 4WU8B 4KXKA 2HUIA 3BCXA 3BWOA 4AZJA 2BYMA 2VGUA 5F99C 2VYCA 1TOKA 3AZLA 4KUDC 5E5AC 3MNND 3USFA 5AV5A 1HQ3B 1HQ3C 2ZY2A 3BCBA 4F5KA 3NYSA 4R5ZA 4BMKA 4UUZB 1F66B 1ASLA 3AYWA 3KXBD 2G7JA 4UHNA 3VP6A 3WGBA 5AVBA 3DU4A 3W98C 4AH3A 4KGCD 2XH1A 1BJ4A 1FG7A 2Z9WA 3RBFA 5B0ZB 1FG3A 2DGLA 3ECDA 5CP6A 5AV9C 4RITA 4JJND 3WCOA 1TATA 2BIEA 2OATA 3B6FD 1B9HA 4MQPA 2BYMB 5AV6C 4R8PD 4EB5A 4H9OA 1CQ6A 4OYTA 3FZ6A 3VH5A 3W99D 1GC2A 3PDXA 1LK9A 5CPKD 2PYOC 2CH1A 3GSBA 3AV2A 4Z5TD 3AYWB 4WYCA 3UTAA 3FQ7A 4J8WA 1V2EA 2Y2NA 3AEOA 4CBRA 2QB2A 1ASNA 1TZYD 3AZMD 3JWBA 1DKAA 4XJOA 4E77A 4MSOA 1P3MD 2PB0A 4GSAA 2YKYA 1P3FA 5AY8C 3AEMA 5B31D 3WLXA 3VOMA 5GSUD 5HDMA 3REJB 3DYDA 2LY8A 3AZEB 1BJNA 3MVDC 1GC4A 1PG8A 4PFNA 3UT9C 4LD9D 4Z2MG 1EQZD 4ZSWA 2W7GA 1JFIA 1C0NA 1O4SA 2NZDB 2W7HA 4JEVA 5B0YA 4UHOA 3X1SA 5GXQA 4J8UC 2JISA 4IX8A 3WTPC 1P3AD 1C7NA 3X1UA 1T3UA 2WK9A 2EO5A 3MKJA 3I4JA 3FVXA 5B2JD 3LZ0C 5G4JA 5AVCA 3AZGC 4OTLA 1JS6A 1AJSA 3EI9A 1WYVB 1Z2CB 2WK8A 1S32C 1KX3C 5B32A 2XD1A 5C3IB 3PD6B 5AV8D 1GEYA 3N7NA 3ELEA 3ZZJA 4WU9B 4XUJD 1AOIA 2O7CA 3WAAA 3E2YA 3B6GC 1C4KA 5AX8A 3CBFA 5JRGD 3EI8A 3REIA 4DGTA 4J8XB 3EZSA 5M4DA 3X1SB 3DC1A 1P3GB 3LELA 4H9PA 4IXSA 4ZDPA 4CVQA 5CPJC 1TPLA 1X28A 3AZND 1N1JB 1M19B 3TQXA 2CV5C 2CSTA 1OXPA 1MDZA 3AZHB 4ZWMA 4WU8D 3GZCA 3KWQA 4HVKA 3PGYA 1P34A 5G49A 3DXWA 3AZKC 5GT0A 1ID3C 4Q76A 2WB6A 1P3IB 2G6WA 5B1MC 3RELA 4BA5A 1F66D 4ATPA 1ZC9A 4H9SC 1AOIB 2VMTA 2VMSA 2VMPA 3MGQA 1BS0A 2JJGA 3KGXA 3AZIC 5EQCA 4XZQA 4GE9A 1B67A 3LZ1A 2F8NK 3AFAA 2AY4A 1CQ7A 2V1PA 3PJ0A 5B0ZD 2CANA 3K7YA 3O62C 3NQJA 1MAQA 2VMXA 3G0TA 4EO5C 4M2JA 1KX5A 3KFUG 1BH8A 1P34B 3V9RA 4R8DA 5E5IA 1ASEA 1XI9A 1C7OA 2HP2A 1O61A 5CPIB 4WZSB 1P3OC 2VMRA 1BT4A 3UTBA 3RELB 2IO5B 4Q75A 3MEBA 1B5PA 5B2IC 3C1BC 3LV2A 5DX5A 1UU2A 3AYWD 4WXFA 4AWLB 3C1CC 5AVBD 3QN6A 5GT3B 3AZJA 3AFAB 4ZSYA 3FFRA 3N4RA 3COGA 5B33C 1P3KC 3NQJB 3MNNA 2JE5A 1CJ0A 3A6NB 4ZBJC 1X0MA 1SZKA 3REJD 2ZP7A 3NYTA 3H0MC 1KX5B 3E2FA 3AZED 4AOAA 3EI5A 3V9RB 1WSTA 3KXBA 2DF4C 4WLHA 4A72A 3PPLA 1ZLAB 2NZDD 4JEYA 4K2BA 5BO0B 3VAXA 4RJYA 2FFFB 3Q8NA 4NFTA 4A6UA 3MC6A 3CAIA 1KKPA 4JJNA 2W8TA 1U08A 4H9RB 2ZY5A 3BWNA 3GZDC 4N0WA 1VP4A 1PZRA 2JJHA 3TCMA 3NRAA 1LKCA 4R8PA 3KE3A 3H0LC 2FNIA 3LJAC 2YOBA 4G91C 1V2FA 5CPKA 1D7RA 4H9NB 3X1VB 4Z5TA 1H3OB 4WU9D 1P3BA 2VIBA 2CY8A 1SZUA 4P3MA 4ADEA 4J8XD 1AHGA 2VLFA 3X1SD 3AZMA 3AN2C 1P3GD 3X1UD 1D2FA 1P3MA 2DR1A 3E6GA 5C6UA 4A0FA 2BI1A 2CJHA 5B31A 2AROB 5GSUA 1M19D 3LVJA 2VLHA 3CQ4A 3L44A 2GSAA 2R0TA 3AZHD 2W7JA 3MGRB 4LD9A 4E44A 4TMRA 1KKJA 3UWCA 2BKWA 4GE4A 1P3ID 5E4ZA 4WD2A 2VGVA 4YM6C 1P3AA 3KUYB 1WWIA 3MAFA 2AY2A 3AV1C 1P3BB 1AOID 2OKJA 1G4XA 1AX4A 3JZLA 5B2JA 4DQ6A 2Z9VA 1S09A 2ZYJA 4UHMA 2Z9XA 2FJ7C 1YNUA 2UWXA 4A6TA 1AAMA 5KDMB 3LVMA 3HBXA 2NQBB 1HTAA 2CINA 1UU1A 3VH6A 1ELQA 5AV8A 4AZKA 3AATA 4XUJA 2NMPA 1P34D 1U35C 3EPKA 4P7YA 3R45A 1ZODA 5B24B 5DNNC 4ZDOA 1YOOA 5JRGA 5CPID 4WXGA 4WBTA 3X1TB 3KGWA 9AATA 3FSLA 4R2NA 3RELD 2HUUA 4B98A 1YIYA 5DNMC 2QSRA 3FZ7A 4M6BA 2C7TA 4U1TA 2C0RA 1W2EA 3RCHA 4A0GA 1C7GA 2BYKA 5BT1C 1ELUA 1WWSA 5GT3D 4WU8A 3LWSA 3AFAD 1GC3A 2VI9A 1P3PC 3R9AA 3REKC 4HGAB 3PAAA 5E5AA 3CQ5A 3A6ND 1HQ3A 2X3LA 3ZZKA 4NE5A 1KX5D 1SVVA 3EG5B 3WKJC 2QA3A 3NTJA 4Z66C 4ISYA 4M2KA 3AEJA 1ZLAD 3FZ8A 3REHC 2W7FA 2JJFA 1KX4C 3HVYA 4M2MA 5G09A 3B0BA 4RKDA 3B46A 4OBVA 2AY3A 2AY8A 3MGPC 2BWPA 5AV9A 3WA9C 1AIAA 1R4VA 1W7LA 1D7VA 4PIWA 4X23C 5F99B 1S06A 4K05A 4KUDB 5E5AB 4W1WA 5FT5A 2WKAA 2AY6A 4EMYA 2GMSA 1AKCA 5B1LC 4J8VC 1M7YA 2PYOA 2OGEA 2VI8A 4H51A 3X1VD 1ASMA 3E9KA 4PVFA 2JG2A 2BI9A 3W98B 3EPHA 3DZZA 4IYOB 4BHDA 5FUGB 5FT4A 3GWPA 2E7JA 2BI3A 1QJ3A 1B8GA 1MGVA 4ZUXC 4JEWA 5AY8A 2Q7WA 1BJOA 1YAAA 2AROD 3VK3A 5AV9B 1SF2A 3RQ1A 4QLCC 3REJA 1E5EA 3AZEA 2W8VA 3MGRD 2YFVB 5AV6B 1FC4A 2O0RA 3I16A 3ATHA 1YIZA 1M6SA 2NZDA 1P3LC 2ZSMA 3TU4C 3W96C 4LNMA 1AHFA 3HL2A 3KSYA 3KUYD 2PYOB 1M1AC 1RVUA 1P3BD 1ORDA 2ZSLA 4CBSA 5BNXB 1KMJA 5M49A 2OKKA 3AZLC 1M18C 5AV5C 1AIBA 3MBBA 1B6WA 1TASA 3JWAA 4UPKA 1BJWA 2CFBA 2ZY3A 1WYVA 5AY8B 1H0CA 1BJOB 1KX3A 1AY4A 2EZ2A 1AAWA 2NQBD 2FM1A 2HIOC 3MVDB 3PD6A 2Y2MA 4KAMA 3UT9B 3VH5W 5KTBA 2F8NB 4WU9A 5B24D 1ASFA 2YRRA 5F8VA 1KU5A 5CP6C 3UE8A 3X1TD 2HUFA 4J8XA 4J8UB 5G2QA 3WTPB 1P3GA 2BWOA 4ZASA 2F8NG 2W7MA 2Y2PA 3MGSC 3HT4A 2AY9A 3LZ0B 1N1JA 1M19A 3AZGB 2CV5A 3BS8A 3AZHA 1QISA 1M32A 2KFPA 3ACZA 4H63Q 3AV2C 1DGEA 4F5FA 1RVYA 1S32B 3UTAC 1KX3B 2EH6A 4J8WC 1P3IA 4J5UA 1M0PA 2RFVA 2RVQC 1AKBA 3FCRA 3B6GB 1P3FC 2VMQA 3AEMC 4A00A 3AZFC 4YS3C 4YS3B 4F4EA 5CPJB 1GBNA 4ZDLA 3HQTA 2VGWA 2CV5B 1IJIA 3G8MA 5B0YC 3ZRRA 3ELPA 4UQVA 3RUYA 1GC0A 5GXQC 4ADCA 2Y2IA 5F99D 1OATA 4OBUA 3AZKB 4G92C 4QGRA 1Z7DA 1ID3B 4KUDD 3A2BA 4WB0B 5E5AD 1ARSA 5CPIA 4IW7A 1HQ3D 5B1MB 3LY1A 4WYAA 5AVCC 2Y2QA 2TPLA 1M0QA 2D65A 3DRDA 3NQUB 3AZIB 4KHAB 4WYGA 2YFWB 2YCNA 2HUEC 1N31A 4JF1A 3W98D 5GT3A 5B32C 2Y2GA 2RIQA 4WLJA 3O62B 3WAAC 4EO5B 3F9TA 3A6NA 4EFFA 5AV9D 3REIC 1GCKA 3B0DC 3FFHA 5BNVB 3LELC 5AV6D 4E45A 2W8UA 2ZM5A 1P3OB 4K2IA 1ZLAA 5BO0A 3WKSA 5J8QA 5B2IB 3C1BB 2PYOD 1MDXA 1ASBA 1P3WA 3KWQC 2O1BA 1WKHA 3GETA 3C1CB 5GT0C 4JEXA 4H9RA 5B40C 2A1VA 3GZDA 3EIAA 4DRAA 1IAXA 3A9ZA 4W1XA 5B33B 1P3KB 3AV7A 5M4BA 2GMUA 5AY8D 4ZBJB 3MGQC 1I41A 3RBLA 1DFOA 4XZQC 3MVDD 3LZ1C 4H9NA 3UT9D 2JCHA 3X1VA 1H3OA 2F8ND 4CXRA 2Z9UA 1DTYA 2CH2A 2QMAA 3WY7A 2FKIA 2VMOA 4H9QA 1D7UA 1TOEA 4J8UD 3WTPD 3F6TA 2WK7A 2HZPA 1M0NA 3LVLB 3EPLA 3LZ0D 5BJ4A 1SZSA 2AROA 2D5YA 1YJYA 1YJZA 1I29A 3AZGD 2BI5A 3N4XA 1G4VA 3UTBC 3B1DA 4RKCA 5EUDA 1WYTB 3MGRA 4Y0IA 1N8PA 4RM1A 2PB2A 1Z3ZA 2AEUA 1A7WA 3BCAA 1S32D 1KX3D 2Y2JA 3LJAB 3A1KA 3NU8A 3W97C 3NX3A 3PDBB 4G91B 5CHLB 3EUCA 1M4NA 3KUYA 3AZJC 2F8JA 3N5MA 1GEWA 2CTZA 1DJUA 3B6GD 1DJ9A 5IWQA 3MNNC 1TOGA 2HORA 4H9QB 1BQDA 4JF0A 4LW2A 3UAKA 4WNNB 4W5KA 2Y2LA 3AN2B 4RIZA 5CPJD 1X29A 3KXBC 5KDMA 1OXOA 3H0RC 2CV5D 2NQBA 2CB1A 1LW5A 4KGCC 4Y0HA 4ADBA 1TOJA 2AY7A 3AOVA 3AZKD 1G7WA 5B24A 2BIGA 1ID3D 2Z20A 3AEPA 3ZRPA 3X1TA 5B1MD 3MC6C 1TAFB 4JJNC 4YM6B 2W7LA 1O69A 1AMQA 4F5GA 3BWNC 2VGZA 3B6FC 3AV1B 4E3RA 4WYEA 4R8PC 1QGNA 3AZID 3FVSA 3W99B 3W99C 4ZAHA 5BS7A 5DB5A 3M5UA 1ASGA 5CPKC 2FJ7B 4Z5TC 3W1JA 5JA4B 3QM2A 3O62D 4Q31A 3MAUA 1TZYC 3AZMC 4XK1A 3B0CW 4J8LA 1P3MC 2D66A 1U35B 2W7KA 5DNNB 1QIRA 4ITGA 5EIGB 1P3OD 3W1HA 5B31C 5GSUC 2V0YA 5M46A 3CQ6A 5DNMB 2D61A 2ZY4A 5B2ID 3C1BD 4LD9C 1EQZC 4MKKA 3B1EA 3C1CD 3QI6A 3IP4C 2ZUKA 2HP1A 1D7SA 3QBOA 1P3AC 3WTPE 1PMMA 1W23A 2QBTA 3ASAA 2VMNA 4I8AA 1P3PB 5I92A 1B9IA 2X5DA 5F99A 5B33D 3REKB 4DQYB 4DRBA 1P3KD 4KUDA 3VH5T 1PFFA 5B2JC 4RAEA 4W91A 4GE7A 2C44A 2QB3A 3P1TA 5F9SA 3WKJB 3GBXA 3AOWA 4Z66B 8AATA 4CSRB 2CWEA 3NYUA 3REHB 1CZCA 1KX4B 1S08A 4F5MA 3HLMA 3II0A 3W98A 4IYOA 3P5JB 1IAYA 5FUGA 3EI6A 1G7XA 1M0OA 4Y0DA 5AV8C 2CJGA 2VMVA 2YHKA 3MGPB 3N75A 1B5OA 4XUJC 4ZUXA 3R4TA 4UOYA 3MADA 5JRGC 3WA9B 1O62A 1LC8A 1JF9A 4X23B 2YFVA 5AV6A 2R5CB 4L0OA 3BV0A 3DR4A 2YKXA 3LJAD 3AZNC 4F5JA 1W3UA 5EUEA 1PMOA 2E7UA 5B1LB 4J8VB 3H7FA 3QGUA 4WU8C 2VIAA 3DODA 2EGYA 5BNXA 2XD5A 2R5EA 2F2AC 1M18A 2GQNA 5HHYA 1BKGA 3AN2D 2X5FA 3ASBA 1F66C 3QPGA 4ZUXB 3TATA 2FYFA 4ZM4A 3AEJC 4QLCB 2XBNA 2FNUA 1AHEA 2HIOA 3MVDA 3UT9A 4B9BA 1WYUA 2F8NA 4XQ2A 1Q9CA 1LC7A 4ITXA 4XEWA 5B0ZC 2CJDA 1P3LB 1QITA 3K40A 2Y2KA 4OCAA 2Y2HA 3NU7A 3TU4B 4J8UA 3VK2A 1AHXA 2VMUA 2ZC0A 3W96B 3HDOA 4YM6D 3WTPA 1M1AB 1CQ8A 3L8AA 3AV1D 2AY1A 3MGSA 1CZEA 3EIBA 4XJLA 3W1IA 2D63A 3LZ0A 3AZLB 5G0AA 1M18B 5AV5B 3AZGA 3N4SA 4Z2MH 2JJEA 4OT8A 2FJ7D 1W7MA 3AYWC 1S32A 2JSSA 4W1VA 1ULYA 4OC9A 5AVBB 5AVBC 4A6RA 2F8NH 3FQ8A 1BH9A 4GDYA 2HIOB 3WKRA 4ZWVA 1MLZA 1WYUB 1U35D 4E1OA 1B4XA 5DNND 3B6GA 2D64A 3DR7A 2Y2OA 4JEZA 5CP6B 3EPJA 3HMUA 3AZFA 4YS3A 4LNLA 5DNMD 3REJC 1J32A 3AZEC 4A0RA 4F5IA 3MGSB 5CPJA 1C9CA 1CS1A 3DXVA 4K2MA 1GEXA 1BQAA 1IUGA 4H9OB 5BT1D 2NZDC 4O6ZA 4LC3A 1ARHA 3A8UX 3B1CA 1IX7A 1ECXA 3AV2B 5BJ3A 1P3PD 3D6KA 4EB7A 3IHJA 3AZKA 3REKD 4Q6RA 3UTAB 1ID3A 4ATQA 4WB0A 2AEVA 4J8WB 5EFSA 2W8WA 5B1MA 3NNKA 1BH9B 3E2ZA 4WJ3C 5JAYA 4R5FA 3WKJD 4H9SA 4ZM3A 2DOUA 2D7ZA 4Z66D 1UKJA 3EZ1A 1P3FB 3NQUA 3AZIA 4KHAA 3REHD 4RLGA 2YFWA 1KX4D 3AZFB 4CXQA 2YCTA 1RV3A 5C3IC 3A9XA 3N0LA 3MGPD 4WU9C 1OHWA 3O62A 3GR9A 2DKBA 1JFIB 4NOGA 3LVKA 1AKAA 5B0YB 3WA9D 2Z61A 4J8XC 1AY5A 3X1SC 1TARA 5GXQB 1S0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M0N A;  3KKI A;  3LVL B;  1YJS A;  4WXG A;  4WBT A;  1TAT A;  2BIE A;  3KGW A;  9AAT A;  1LC5 A;  2OAT A;  3FSL A;  4R2N A;  5BJ4 A;  1SZS A;  1B9H A;  1YJY A;  2D5Y A;  2HUU A;  1YJZ A;  4MQP A;  1I29 A;  1YIY A;  4B98 A;  2BI5 A;  1G4V A;  3BN1 A;  2EZ1 A;  2HOX A;  2C7T A;  3B1D A;  4RKC A;  4MY5 A;  3TFU A;  5EUD A;  1KL1 A;  1WYT B;  3E2Z B;  2X8U A;  1AJS B;  4EB5 A;  2R2N A;  4Y0I A;  4U1T A;  2C0R A;  1CQ6 A;  4OYT A;  4XAU A;  1N8P A;  2PB2 A;  1LW4 A;  3RCH A;  1Z3Z A;  4A0G A;  1C7G A;  1DGD A;  1GC2 A;  3BCA A;  1ELU A;  1LK9 A;  3PDX A;  5EAV A;  3NUB A;  3NU8 A;  2CH1 A;  3GSB A;  1EQB A;  2AAT A;  3NX3 A;  4WYC A;  3PDB B;  1ZOB A;  3EUC A;  3LWS A;  1GC3 A;  3FQ7 A;  1M4N A;  2VI9 A;  2FN6 A;  2AY5 A;  3R9A A;  2F8J A;  3N5M A;  1GEW A;  1V2E A;  3AEO A;  3PAA A;  2CTZ A;  1DJU A;  3CQ5 A;  2QB2 A;  4CBR A;  1ASN A;  5EAA A;  3JWB A;  3ZZK A;  1DKA A;  1DJ9 A;  3FDB A;  4XJO A;  5IWQ A;  1LS3 A;  1TOG A;  1N2T A;  2HOR A;  4MSO A;  4E77 A;  1OHY A;  1W7N A;  1VEF A;  1BQD A;  2PB0 A;  4JF0 A;  1SVV A;  4LW2 A;  3UAK A;  4W5K A;  4GSA A;  2YKY A;  1MLY A;  1V72 A;  2QA3 A;  3AEM A;  3NTJ A;  3WLX A;  3A9Y A;  3VOM A;  4IXO A;  4ISY A;  4XJM A;  4M2K A;  1X29 A;  3AEJ A;  5HDM A;  2W7F A;  3DYD A;  2JJF A;  3WZF A;  1OXO A;  1BJN A;  1GC4 A;  1PG8 A;  4PFN A;  1GDE A;  4M2M A;  3T32 A;  5G09 A;  3PA9 A;  4RKD A;  5DJ1 A;  1T3I A;  2W7G A;  3B46 A;  4ZSW A;  2CB1 A;  2AY3 A;  2AY8 A;  2HOY A;  1IBJ A;  1LW5 A;  5DJ9 A;  5G4I A;  1C0N A;  1O4S A;  4Y0H A;  2W7H A;  4JEV A;  4ADB A;  1TOJ A;  2AY7 A;  3E77 A;  4UHO A;  3AOV A;  2BWP A;  1G7W A;  4IX8 A;  2BIG A;  5D5S A;  2Z20 A;  1C7N A;  1AIA A;  3AEP A;  3ZRP A;  2WK9 A;  2EO5 A;  1WKG A;  1W7L A;  3MC6 C;  1D7V A;  1SPA A;  2BYJ A;  2Z1Z A;  4PIW A;  1DJE A;  2E7I A;  3MKJ A;  1S07 A;  3GJU A;  3I4J A;  3OKS A;  2W7L A;  1O69 A;  3FVX A;  1AMQ A;  5G4J A;  3BWN C;  1S06 A;  2VGZ A;  4F5G A;  4E3R A;  1AMA A;  4FFC A;  1WYT A;  4OTL A;  1JS6 A;  1AJS A;  3WGC A;  4WYE A;  4W1W A;  4AO9 A;  5FT5 A;  1QGN A;  2WKA A;  3K28 A;  4HF8 A;  2HOZ A;  1IVR A;  2AY6 A;  4EMY A;  2GMS A;  1AKC A;  3FVS A;  2JGT A;  4LW4 A;  1KL2 A;  4ADD A;  1M7Y A;  3EI9 A;  1WYV B;  2OGE A;  2VI8 A;  4H51 A;  2WK8 A;  3LG0 A;  4ZAH A;  1ASM A;  1VJO A;  5DB5 A;  3M5U A;  1ASG A;  2BHX A;  3PDB A;  4MQR A;  3E9K A;  1GD9 A;  4PVF A;  3F0H A;  2W7D A;  2JG2 A;  3QM2 A;  2BI9 A;  3PD6 B;  3DZZ A;  4IYO B;  1GEY A;  4BHD A;  2VGT A;  5FT4 A;  3ELE A;  4Q31 A;  3ZZJ A;  3MAU A;  2E7J A;  2O7C A;  2BI3 A;  2QLR A;  1QJ3 A;  1JG8 A;  1B8G A;  1I43 A;  1MGV A;  3E2Y A;  1C4K A;  5AX8 A;  3CBF A;  3EI8 A;  4XK1 A;  4DGT A;  2D66 A;  4JEW A;  5M4D A;  3EZS A;  2Q7W A;  1BJO A;  2W7K A;  1YAA A;  2E54 A;  1QIR A;  3DC1 A;  3VK3 A;  1SF2 A;  3RQ1 A;  2D7Y A;  4ITG A;  5EIG B;  1E5E A;  4IXS A;  4ZDP A;  4CVQ A;  1I48 A;  3I5T A;  2V0Y A;  5M46 A;  2W8V A;  1AY8 A;  3CQ6 A;  1TPL A;  3VK4 A;  1X28 A;  1FC4 A;  1EJI A;  2O0R A;  2D61 A;  3ATH A;  2ZY4 A;  1YIZ A;  1SFF A;  1M6S A;  4GEB A;  3TQX A;  4DBC A;  4MKK A;  2CST A;  1OXP A;  1MDZ A;  3B1E A;  2ZSM A;  4ZWM A;  4F5L A;  3QI6 A;  3GZC A;  4LNM A;  1AHF A;  3HL2 A;  4HVK A;  2ZUK A;  3PGY A;  2HP1 A;  1IX6 A;  1RVU A;  1D7S A;  3DXW A;  3QBO A;  3FDD A;  4Q76 A;  1ORD A;  2ZSL A;  4CBS A;  3FQA A;  1W23 A;  2QBT A;  1KMJ A;  2VMN A;  2G6W A;  2Z1Y A;  3ASA A;  4I8A A;  5I92 A;  1B9I A;  2X5D A;  5M49 A;  4WYF A;  4BA5 A;  1PFF A;  5FT6 A;  1AIB A;  4ATP A;  3MBB A;  1ZC9 A;  4RAE A;  4W91 A;  2C81 A;  1TAS A;  3BC8 A;  2VMT A;  3JWA A;  2VMS A;  4XJP A;  4GE7 A;  1AMR A;  4U2H A;  2C44 A;  1BS0 A;  2QB3 A;  1BJW A;  2VMP A;  4OMA A;  1UU0 A;  2CFB A;  2JJG A;  3P1T A;  3B8X A;  3KGX A;  5F9S A;  2ZY3 A;  1WYV A;  3GBX A;  3AOW A;  1H0C A;  5EQC A;  1BJO B;  8AAT A;  4GE9 A;  1AY4 A;  2EZ2 A;  1AAW A;  3NYU A;  1JS3 A;  1CZC A;  2FM1 A;  1S08 A;  4F5M A;  1KMK A;  1CQ7 A;  2AY4 A;  2HZP A;  2V1P A;  2YKV A;  3HLM A;  3II0 A;  3PD6 A;  3PJ0 A;  4KAM A;  4WP0 A;  1AIC A;  1RV4 A;  1IAY A;  4IYO A;  2CAN A;  3K7Y A;  3EI6 A;  1G7X A;  1MAQ A;  2VMX A;  1M0O A;  4Y0D A;  4AO4 A;  2CJG A;  4M2J A;  3OP7 A;  2VMV A;  2YHK A;  1ASF A;  3N75 A;  1B5O A;  2YRR A;  5F8V A;  3UE8 A;  2EPJ A;  2HUF A;  3R4T A;  4UOY A;  3AEN A;  3MAD A;  5G2Q A;  1O62 A;  2BWO A;  2OQX A;  3G7Q A;  4ZAS A;  1LC8 A;  5EIG A;  4R8D A;  2W7M A;  4F5H A;  5E5I A;  1ASE A;  1XI9 A;  1C7O A;  1JF9 A;  2HP2 A;  1O61 A;  1V2D A;  4IXZ A;  1ART A;  2VMR A;  1ARG A;  2AY9 A;  4TN4 A;  1BT4 A;  2R5C B;  4PFF A;  4L0O A;  5E3K A;  3BV0 A;  4Q75 A;  3DR4 A;  3MEB A;  1B5P A;  2ORD A;  3BS8 A;  2YKX A;  4F5J A;  1W3U A;  5EUE A;  3LV2 A;  5DX5 A;  1UU2 A;  1QIS A;  1M32 A;  3ACZ A;  4WXF A;  2BWN A;  2E7U A;  3H7F A;  1DGE A;  1QZ9 A;  3QGU A;  5FT8 A;  4F5F A;  1RVY A;  2VIA A;  3QN6 A;  2EH6 A;  3DOD A;  2EGY A;  4J5U A;  1M0P A;  4MKJ A;  3AEL A;  2R5E A;  1MAP A;  2RFV A;  2GQN A;  5HHY A;  4ZSY A;  2YKU A;  3FFR A;  4A0H A;  3COG A;  1BKG A;  2X5F A;  5D95 A;  1AKB A;  1CJ0 A;  2VMY A;  3ASB A;  3FCR A;  3P6K A;  1X0M A;  3QPG A;  1SZK A;  2VMQ A;  2ZP7 A;  3AEM C;  1OHV A;  3NYT A;  3AEN B;  3TAT A;  3E2F A;  2FYF A;  4A00 A;  1E5F A;  4AOA A;  4ZM4 A;  3NUI A;  3AEJ C;  3PIU A;  4F4E A;  3EI5 A;  4KYO A;  2XBN A;  1WST A;  2FNU A;  2W7I A;  4FL0 A;  1BW0 A;  1AHE A;  4W8I A;  4WLH A;  4A72 A;  3PPL A;  4GRX A;  1WYU A;  4JEY A;  4B9B A;  1GBN A;  4XQ2 A;  3HQT A;  4ZDL A;  1MDO A;  7AAT A;  2OGA A;  2VGW A;  4K2B A;  3VAX A;  1LC7 A;  1H1C A;  2W7E A;  4ITX A;  4XEW A;  5K8B A;  3ISL A;  2BI2 A;  1ARI A;  1IJI A;  2CJD A;  3FRK A;  3G8M A;  4IY7 A;  3ZRR A;  1QIT A;  3ELP A;  3K40 A;  4RJY A;  4UQV A;  4OCA A;  3FTB A;  3RUY A;  3NU7 A;  1GC0 A;  1ASA A;  4ADC A;  3VK2 A;  3RI6 A;  5TF5 A;  1AHX A;  2VMU A;  2ZC0 A;  3HDO A;  3Q8N A;  4E3Q A;  4A6U A;  1OAT A;  4QGR A;  1CQ8 A;  2BYL A;  3L8A A;  1Z7D A;  3MC6 A;  3CAI A;  2AY1 A;  1KKP A;  1CZE A;  3A2B A;  4WB0 B;  1ARS A;  2VGS A;  3EIB A;  2W8T A;  4IW7 A;  1U08 A;  3MAF B;  4XJL A;  3LY1 A;  2D63 A;  2R5C A;  2ZY5 A;  4WYA A;  5G0A A;  2TPL A;  1AJR A;  3BWN A;  3GZD C;  2DKJ A;  1M0Q A;  4N0W A;  5G2P A;  1VP4 A;  2JJH A;  4MQQ A;  3FVU A;  3TCM A;  2D65 A;  3NRA A;  1LKC A;  1CL1 A;  1EG5 A;  3DRD A;  1CL2 A;  3KE3 A;  2JJE A;  2FNI A;  2YOB A;  4OT8 A;  4WYD A;  1W7M A;  4WYG A;  4EU1 A;  1V2F A;  2YCN A;  1N31 A;  4W1V A;  4JF1 A;  1D7R A;  4OC9 A;  4A6R A;  1AHY A;  2VMW A;  3FQ8 A;  2W8J A;  1QJ5 A;  4GDY A;  4WLJ A;  4WXB A;  2VIB A;  1TOI A;  3WKR A;  2BIA A;  3JW9 A;  4ZWV A;  1MLZ A;  1WYU B;  2CY8 A;  1SZU A;  4P3M A;  3WX9 A;  2ZJG A;  4ADE A;  2YCP A;  1IX8 A;  1AHG A;  2VLF A;  3F9T A;  4E1O A;  1B4X A;  1AMS A;  2D64 A;  4EFF A;  3DR7 A;  4JEZ A;  3TFT A;  1GCK A;  5EUN A;  1D2F A;  4BQ0 A;  2DR1 A;  3HMU A;  3ZRQ A;  3E6G A;  2PO3 A;  4LNL A;  3FFH A;  4A0F A;  1J04 A;  2BI1 A;  4LNJ A;  5C6U A;  5HXX A;  2YRI A;  1J32 A;  1ASD A;  2CJH A;  4A0R A;  4F5I A;  3BB8 A;  2W8U A;  3JTX A;  4ZLV A;  3LVJ A;  2VLH A;  4K2I A;  3CQ4 A;  1C9C A;  3L44 A;  2GSA A;  2R0T A;  1X2A A;  1CS1 A;  3DXV A;  4K2M A;  1IUG A;  1BQA A;  1GEX A;  2W7J A;  3WKS A;  5J8Q A;  3RCH B;  4O6Z A;  4TMR A;  4LC3 A;  4BA4 A;  1MDX A;  1ASC A;  1ARH A;  1KKJ A;  3UWC A;  2BKW A;  3A8U X;  1ASB A;  4GE4 A;  1P3W A;  2VMZ A;  2O1B A;  3B1C A;  1IX7 A;  1ECX A;  1WKH A;  2FQ6 A;  3FKD A;  3GET A;  3QHX A;  5BJ3 A;  1Y4I A;  5E4Z A;  3D6K A;  3NDN A;  4EB7 A;  2GB3 A;  3EI7 A;  3IHJ A;  4Q6R A;  4KXK A;  2HUI A;  4WD2 A;  4ATQ A;  3BCX A;  2VGV A;  3BWO A;  4JEX A;  4WB0 A;  4AZJ A;  5EFS A;  2W8W A;  3MAF A;  2VGU A;  2VYC A;  1TOK A;  2AY2 A;  3NNK A;  3GZD A;  3EIA A;  3USF A;  1G4X A;  3E2Z A;  1IAX A;  1AX4 A;  3A9Z A;  4W1X A;  2ZY2 A;  5JAY A;  4R5F A;  4DQ6 A;  3BCB A;  4F5K A;  3AV7 A;  4ZM3 A;  5M4B A;  2GMU A;  3NYS A;  4R5Z A;  2DOU A;  2D7Z A;  2Z9V A;  4BMK A;  1I41 A;  1UKJ A;  3RBL A;  1DFO A;  1S09 A;  3EZ1 A;  1ASL A;  2ZYJ A;  3WGB A;  4UHN A;  4UHM A;  2Z9X A;  4CXQ A;  1YNU A;  4A6T A;  2YCT A;  3DU4 A;  1RV3 A;  1AAM A;  3A9X A;  3LVM A;  4CXR A;  4AH3 A;  2XH1 A;  2Z9U A;  3N0L A;  1BJ4 A;  2CH2 A;  2CIN A;  1DTY A;  1FG7 A;  2QMA A;  3WY7 A;  2Z9W A;  1OHW A;  1UU1 A;  3GR9 A;  3RBF A;  2DKB A;  2VMO A;  1ELQ A;  4AZK A;  1D7U A;  3AAT A;  4NOG A;  1TOE A;  3LVK A;  1AKA A;  1FG3 A;  3F6T A;  2WK7 A;  2Z61 A;  2NMP A;  3ECD A;  1AY5 A;  1TAR A;  4P7Y A;  1ZOD A;  4ZDO A;  1YOO A;  1S0A A; 
#chains in the Genus database with same CATH topology
 4X23 D;  1P3G C;  3KKI A;  1YJS A;  3X1U B;  3X1U C;  5BNV A;  1LC5 A;  4G92 B;  3WCN A;  3BN1 A;  1P3O A;  2EZ1 A;  2HOX A;  5AVC B;  4MY5 A;  3TFU A;  1M19 C;  1KL1 A;  3E2Z B;  2X8U A;  1AJS B;  2R2N A;  4XAU A;  1LW4 A;  5B1L D;  4NE3 A;  5B2I A;  4J8V D;  3C1B A;  3AZH C;  1DGD A;  5EAV A;  3NUB A;  1EQB A;  3C1C A;  2AAT A;  1ZOB A;  3AL0 C;  2HUE B;  1P3I C;  2FN6 A;  2AY5 A;  5B32 B;  5B40 A;  5EAA A;  3FDB A;  5B33 A;  4ZUX D;  1AOI C;  1LS3 A;  1P3K A;  1N2T A;  4WV4 B;  3WAA B;  1OHY A;  1W7N A;  1VEF A;  2G5I C;  1MLY A;  3REI B;  5B32 G;  4QLC D;  3B0D B;  1V72 A;  3A9Y A;  4IXO A;  4XJM A;  3LEL B;  4H9P B;  2W8S A;  3WZF A;  4CAY A;  1GDE A;  3T32 A;  3PA9 A;  5DJ1 A;  1T3I A;  1P3L D;  2HOY A;  1IBJ A;  5DJ9 A;  5G4I A;  3TU4 D;  3H9X A;  3W96 D;  2VQR A;  3E77 A;  1M1A D;  5D5S A;  3KWQ B;  1P34 C;  5G49 B;  1WKG A;  5GT0 B;  2DGK A;  1SPA A;  3AZL D;  2BYJ A;  2Z1Z A;  1DJE A;  1M18 D;  5CPI C;  5AV5 D;  2E7I A;  1S07 A;  3GJU A;  3OKS A;  5B40 B;  3REL C;  2IO5 C;  1AMA A;  4FFC A;  1WYT A;  3WGC A;  4AO9 A;  3K28 A;  4HF8 A;  2HOZ A;  1IVR A;  3MGQ B;  3B0C T;  2JGT A;  4LW4 A;  3LJA A;  4AWL C;  1KL2 A;  4ADD A;  3W97 A;  3LG0 A;  4XZQ B;  1VJO A;  2BHX A;  3PDB A;  4MQR A;  1GD9 A;  2HIO D;  3F0H A;  3LZ1 B;  2W7D A;  5GT3 C;  1XEY A;  3AFA C;  4CAY B;  2VGT A;  2DQN C;  2QLR A;  5CP6 D;  1JG8 A;  3A6N C;  1I43 A;  4WNN A;  3AN2 A;  1KX5 C;  2E54 A;  3MGS D;  1BH8 B;  2D7Y A;  1F1E A;  1I48 A;  3FD0 A;  3I5T A;  3VH6 T;  1AY8 A;  3VK4 A;  1ZLA C;  3UTB B;  1EJI A;  4RJ0 A;  1SFF A;  4KGC A;  4GEB A;  4DBC A;  3AV2 D;  4F5L A;  3UTA D;  3A1I A;  4J8W D;  3W97 B;  1IX6 A;  1TAF A;  3FDD A;  3FQA A;  4YM6 A;  2Z1Y A;  2RVQ D;  3AZJ B;  3B6F A;  3AV1 A;  4WYF A;  5FT6 A;  2C81 A;  3BC8 A;  1P3F D;  3MNN B;  4XJP A;  1AMR A;  4U2H A;  4OMA A;  3AZF D;  4YS3 D;  1UU0 A;  3B8X A;  3W99 A;  2FJ7 A;  1JS3 A;  3X1V C;  3KXB B;  5JA4 A;  2EYQ A;  1KMK A;  2YKV A;  4WP0 A;  1AIC A;  1RV4 A;  5B0Y D;  4AO4 A;  4KGC B;  1TZY A;  3OP7 A;  5GXQ D;  2L5A A;  2EPJ A;  1BFM A;  1U35 A;  3AEN A;  5DNN A;  2OQX A;  3G7Q A;  4F5H A;  5EIG A;  2ARO C;  5AVC D;  4JJN B;  4IXZ A;  1V2D A;  1ART A;  5DNM A;  1ARG A;  4TN4 A;  4PFF A;  3B6F B;  5E3K A;  3MGR C;  1EQZ A;  2ORD A;  4R8P B;  2J8P A;  2BWN A;  2DGM A;  1QZ9 A;  5FT8 A;  5B32 D;  5CPK B;  3KUY C;  1P3P A;  4Z5T B;  4MKJ A;  3AEL A;  1P3B C;  3REK A;  1MAP A;  3WAA D;  2YKU A;  4A0H A;  3REI D;  2BG1 A;  5D95 A;  2VMY A;  1TZY B;  3AZM B;  3P6K A;  3LEL D;  1P3M B;  3WKJ A;  1OHV A;  3AEN B;  4Z66 A;  1E5F A;  4CSR A;  3NUI A;  3PIU A;  4KYO A;  2W7I A;  3REH A;  5B31 B;  4FL0 A;  1BW0 A;  5GSU B;  1KX4 A;  4W8I A;  2NQB C;  4GRX A;  7AAT A;  1MDO A;  2OGA A;  4LD9 B;  2W7E A;  1H1C A;  5K8B A;  3ISL A;  1EQZ B;  1ARI A;  2BI2 A;  3MGP A;  3FRK A;  3KWQ D;  4IY7 A;  5B31 G;  3FTB A;  5B24 C;  5GT0 D;  1ASA A;  3RI6 A;  5TF5 A;  3WA9 A;  3X1T C;  4E3Q A;  5B40 D;  2BYL A;  4X23 A;  1P3A B;  2VGS A;  3MAF B;  3VH6 W;  2R5C A;  1AJR A;  2DKJ A;  5G2P A;  4MQQ A;  3MGQ D;  3FVU A;  5B2J B;  3AZN A;  1CL1 A;  1EG5 A;  1CL2 A;  4XZQ D;  5B1L A;  4J8V A;  4WYD A;  3LZ1 D;  5BS7 C;  4EU1 A;  1AHY A;  2VMW A;  4HGA C;  2W8J A;  1QJ5 A;  4WXB A;  1TOI A;  4NE6 A;  2BIA A;  3JW9 A;  3WX9 A;  2ZJG A;  2YCP A;  1IX8 A;  5AV8 B;  4UUZ A;  1F66 A;  1AMS A;  4XUJ B;  3TFT A;  5EUN A;  4BQ0 A;  3R45 B;  3ZRQ A;  2PO3 A;  5JRG B;  1J04 A;  4LNJ A;  5HXX A;  4QLC A;  2YRI A;  3UTB D;  1ASD A;  3BB8 A;  3JTX A;  4ZLV A;  1X2A A;  2G5H C;  5B0Z A;  3RCH B;  3AZN B;  1P3L A;  4BA4 A;  3W97 D;  2BYK B;  1ASC A;  3TU4 A;  2VMZ A;  3W96 A;  2FQ6 A;  3FKD A;  3QHX A;  1Y4I A;  3AZJ D;  3NDN A;  1M1A A;  2GB3 A;  3EI7 A;  4WU8 B;  4KXK A;  2HUI A;  3BCX A;  3BWO A;  4AZJ A;  2BYM A;  2VGU A;  5F99 C;  2VYC A;  1TOK A;  3AZL A;  4KUD C;  5E5A C;  3MNN D;  3USF A;  5AV5 A;  1HQ3 B;  1HQ3 C;  2ZY2 A;  3BCB A;  4F5K A;  3NYS A;  4R5Z A;  4BMK A;  4UUZ B;  1F66 B;  1ASL A;  3AYW A;  3KXB D;  2G7J A;  4UHN A;  3VP6 A;  3WGB A;  5AVB A;  3DU4 A;  3W98 C;  4AH3 A;  4KGC D;  2XH1 A;  1BJ4 A;  1FG7 A;  2Z9W A;  3RBF A;  5B0Z B;  1FG3 A;  2DGL A;  3ECD A;  5CP6 A;  5AV9 C;  4RIT A;  4JJN D;  3WCO A;  1TAT A;  2BIE A;  2OAT A;  3B6F D;  1B9H A;  4MQP A;  2BYM B;  5AV6 C;  4R8P D;  4EB5 A;  4H9O A;  1CQ6 A;  4OYT A;  3FZ6 A;  3VH5 A;  3W99 D;  1GC2 A;  3PDX A;  1LK9 A;  5CPK D;  2PYO C;  2CH1 A;  3GSB A;  3AV2 A;  4Z5T D;  3AYW B;  4WYC A;  3UTA A;  3FQ7 A;  4J8W A;  1V2E A;  2Y2N A;  3AEO A;  4CBR A;  2QB2 A;  1ASN A;  1TZY D;  3AZM D;  3JWB A;  1DKA A;  4XJO A;  4E77 A;  4MSO A;  1P3M D;  2PB0 A;  4GSA A;  2YKY A;  1P3F A;  5AY8 C;  3AEM A;  5B31 D;  3WLX A;  3VOM A;  5GSU D;  5HDM A;  3REJ B;  3DYD A;  2LY8 A;  3AZE B;  1BJN A;  3MVD C;  1GC4 A;  1PG8 A;  4PFN A;  3UT9 C;  4LD9 D;  4Z2M G;  1EQZ D;  4ZSW A;  2W7G A;  1JFI A;  1C0N A;  1O4S A;  2NZD B;  2W7H A;  4JEV A;  5B0Y A;  4UHO A;  3X1S A;  5GXQ A;  4J8U C;  2JIS A;  4IX8 A;  3WTP C;  1P3A D;  1C7N A;  3X1U A;  1T3U A;  2WK9 A;  2EO5 A;  3MKJ A;  3I4J A;  3FVX A;  5B2J D;  3LZ0 C;  5G4J A;  5AVC A;  3AZG C;  4OTL A;  1JS6 A;  1AJS A;  3EI9 A;  1WYV B;  1Z2C B;  2WK8 A;  1S32 C;  1KX3 C;  5B32 A;  2XD1 A;  5C3I B;  3PD6 B;  5AV8 D;  1GEY A;  3N7N A;  3ELE A;  3ZZJ A;  4WU9 B;  4XUJ D;  1AOI A;  2O7C A;  3WAA A;  3E2Y A;  3B6G C;  1C4K A;  5AX8 A;  3CBF A;  5JRG D;  3EI8 A;  3REI A;  4DGT A;  4J8X B;  3EZS A;  5M4D A;  3X1S B;  3DC1 A;  1P3G B;  3LEL A;  4H9P A;  4IXS A;  4ZDP A;  4CVQ A;  5CPJ C;  1TPL A;  1X28 A;  3AZN D;  1N1J B;  1M19 B;  3TQX A;  2CV5 C;  2CST A;  1OXP A;  1MDZ A;  3AZH B;  4ZWM A;  4WU8 D;  3GZC A;  3KWQ A;  4HVK A;  3PGY A;  1P34 A;  5G49 A;  3DXW A;  3AZK C;  5GT0 A;  1ID3 C;  4Q76 A;  2WB6 A;  1P3I B;  2G6W A;  5B1M C;  3REL A;  4BA5 A;  1F66 D;  4ATP A;  1ZC9 A;  4H9S C;  1AOI B;  2VMT A;  2VMS A;  2VMP A;  3MGQ A;  1BS0 A;  2JJG A;  3KGX A;  3AZI C;  5EQC A;  4XZQ A;  4GE9 A;  1B67 A;  3LZ1 A;  2F8N K;  3AFA A;  2AY4 A;  1CQ7 A;  2V1P A;  3PJ0 A;  5B0Z D;  2CAN A;  3K7Y A;  3O62 C;  3NQJ A;  1MAQ A;  2VMX A;  3G0T A;  4EO5 C;  4M2J A;  1KX5 A;  3KFU G;  1BH8 A;  1P34 B;  3V9R A;  4R8D A;  5E5I A;  1ASE A;  1XI9 A;  1C7O A;  2HP2 A;  1O61 A;  5CPI B;  4WZS B;  1P3O C;  2VMR A;  1BT4 A;  3UTB A;  3REL B;  2IO5 B;  4Q75 A;  3MEB A;  1B5P A;  5B2I C;  3C1B C;  3LV2 A;  5DX5 A;  1UU2 A;  3AYW D;  4WXF A;  4AWL B;  3C1C C;  5AVB D;  3QN6 A;  5GT3 B;  3AZJ A;  3AFA B;  4ZSY A;  3FFR A;  3N4R A;  3COG A;  5B33 C;  1P3K C;  3NQJ B;  3MNN A;  2JE5 A;  1CJ0 A;  3A6N B;  4ZBJ C;  1X0M A;  1SZK A;  3REJ D;  2ZP7 A;  3NYT A;  3H0M C;  1KX5 B;  3E2F A;  3AZE D;  4AOA A;  3EI5 A;  3V9R B;  1WST A;  3KXB A;  2DF4 C;  4WLH A;  4A72 A;  3PPL A;  1ZLA B;  2NZD D;  4JEY A;  4K2B A;  5BO0 B;  3VAX A;  4RJY A;  2FFF B;  3Q8N A;  4NFT A;  4A6U A;  3MC6 A;  3CAI A;  1KKP A;  4JJN A;  2W8T A;  1U08 A;  4H9R B;  2ZY5 A;  3BWN A;  3GZD C;  4N0W A;  1VP4 A;  1PZR A;  2JJH A;  3TCM A;  3NRA A;  1LKC A;  4R8P A;  3KE3 A;  3H0L C;  2FNI A;  3LJA C;  2YOB A;  4G91 C;  1V2F A;  5CPK A;  1D7R A;  4H9N B;  3X1V B;  4Z5T A;  1H3O B;  4WU9 D;  1P3B A;  2VIB A;  2CY8 A;  1SZU A;  4P3M A;  4ADE A;  4J8X D;  1AHG A;  2VLF A;  3X1S D;  3AZM A;  3AN2 C;  1P3G D;  3X1U D;  1D2F A;  1P3M A;  2DR1 A;  3E6G A;  5C6U A;  4A0F A;  2BI1 A;  2CJH A;  5B31 A;  2ARO B;  5GSU A;  1M19 D;  3LVJ A;  2VLH A;  3CQ4 A;  3L44 A;  2GSA A;  2R0T A;  3AZH D;  2W7J A;  3MGR B;  4LD9 A;  4E44 A;  4TMR A;  1KKJ A;  3UWC A;  2BKW A;  4GE4 A;  1P3I D;  5E4Z A;  4WD2 A;  2VGV A;  4YM6 C;  1P3A A;  3KUY B;  1WWI A;  3MAF A;  2AY2 A;  3AV1 C;  1P3B B;  1AOI D;  2OKJ A;  1G4X A;  1AX4 A;  3JZL A;  5B2J A;  4DQ6 A;  2Z9V A;  1S09 A;  2ZYJ A;  4UHM A;  2Z9X A;  2FJ7 C;  1YNU A;  2UWX A;  4A6T A;  1AAM A;  5KDM B;  3LVM A;  3HBX A;  2NQB B;  1HTA A;  2CIN A;  1UU1 A;  3VH6 A;  1ELQ A;  5AV8 A;  4AZK A;  3AAT A;  4XUJ A;  2NMP A;  1P34 D;  1U35 C;  3EPK A;  4P7Y A;  3R45 A;  1ZOD A;  5B24 B;  5DNN C;  4ZDO A;  1YOO A;  5JRG A;  5CPI D;  4WXG A;  4WBT A;  3X1T B;  3KGW A;  9AAT A;  3FSL A;  4R2N A;  3REL D;  2HUU A;  4B98 A;  1YIY A;  5DNM C;  2QSR A;  3FZ7 A;  4M6B A;  2C7T A;  4U1T A;  2C0R A;  1W2E A;  3RCH A;  4A0G A;  1C7G A;  2BYK A;  5BT1 C;  1ELU A;  1WWS A;  5GT3 D;  4WU8 A;  3LWS A;  3AFA D;  1GC3 A;  2VI9 A;  1P3P C;  3R9A A;  3REK C;  4HGA B;  3PAA A;  5E5A A;  3CQ5 A;  3A6N D;  1HQ3 A;  2X3L A;  3ZZK A;  4NE5 A;  1KX5 D;  1SVV A;  3EG5 B;  3WKJ C;  2QA3 A;  3NTJ A;  4Z66 C;  4ISY A;  4M2K A;  3AEJ A;  1ZLA D;  3FZ8 A;  3REH C;  2W7F A;  2JJF A;  1KX4 C;  3HVY A;  4M2M A;  5G09 A;  3B0B A;  4RKD A;  3B46 A;  4OBV A;  2AY3 A;  2AY8 A;  3MGP C;  2BWP A;  5AV9 A;  3WA9 C;  1AIA A;  1R4V A;  1W7L A;  1D7V A;  4PIW A;  4X23 C;  5F99 B;  1S06 A;  4K05 A;  4KUD B;  5E5A B;  4W1W A;  5FT5 A;  2WKA A;  2AY6 A;  4EMY A;  2GMS A;  1AKC A;  5B1L C;  4J8V C;  1M7Y A;  2PYO A;  2OGE A;  2VI8 A;  4H51 A;  3X1V D;  1ASM A;  3E9K A;  4PVF A;  2JG2 A;  2BI9 A;  3W98 B;  3EPH A;  3DZZ A;  4IYO B;  4BHD A;  5FUG B;  5FT4 A;  3GWP A;  2E7J A;  2BI3 A;  1QJ3 A;  1B8G A;  1MGV A;  4ZUX C;  4JEW A;  5AY8 A;  2Q7W A;  1BJO A;  1YAA A;  2ARO D;  3VK3 A;  5AV9 B;  1SF2 A;  3RQ1 A;  4QLC C;  3REJ A;  1E5E A;  3AZE A;  2W8V A;  3MGR D;  2YFV B;  5AV6 B;  1FC4 A;  2O0R A;  3I16 A;  3ATH A;  1YIZ A;  1M6S A;  2NZD A;  1P3L C;  2ZSM A;  3TU4 C;  3W96 C;  4LNM A;  1AHF A;  3HL2 A;  3KSY A;  3KUY D;  2PYO B;  1M1A C;  1RVU A;  1P3B D;  1ORD A;  2ZSL A;  4CBS A;  5BNX B;  1KMJ A;  5M49 A;  2OKK A;  3AZL C;  1M18 C;  5AV5 C;  1AIB A;  3MBB A;  1B6W A;  1TAS A;  3JWA A;  4UPK A;  1BJW A;  2CFB A;  2ZY3 A;  1WYV A;  5AY8 B;  1H0C A;  1BJO B;  1KX3 A;  1AY4 A;  2EZ2 A;  1AAW A;  2NQB D;  2FM1 A;  2HIO C;  3MVD B;  3PD6 A;  2Y2M A;  4KAM A;  3UT9 B;  3VH5 W;  5KTB A;  2F8N B;  4WU9 A;  5B24 D;  1ASF A;  2YRR A;  5F8V A;  1KU5 A;  5CP6 C;  3UE8 A;  3X1T D;  2HUF A;  4J8X A;  4J8U B;  5G2Q A;  3WTP B;  1P3G A;  2BWO A;  4ZAS A;  2F8N G;  2W7M A;  2Y2P A;  1KAF A;  3MGS C;  3HT4 A;  2AY9 A;  3LZ0 B;  1N1J A;  1M19 A;  3AZG B;  2CV5 A;  3BS8 A;  3AZH A;  1QIS A;  1M32 A;  2KFP A;  3ACZ A;  4H63 Q;  3AV2 C;  1DGE A;  4F5F A;  1RVY A;  1S32 B;  3UTA C;  1KX3 B;  2EH6 A;  4J8W C;  1P3I A;  4J5U A;  1M0P A;  2RFV A;  2RVQ C;  1AKB A;  3FCR A;  3B6G B;  1P3F C;  2VMQ A;  3AEM C;  4A00 A;  3AZF C;  4YS3 C;  4YS3 B;  4F4E A;  5CPJ B;  1GBN A;  4ZDL A;  3HQT A;  2VGW A;  2CV5 B;  1IJI A;  3G8M A;  5B0Y C;  3ZRR A;  3ELP A;  4UQV A;  3RUY A;  1GC0 A;  5GXQ C;  4ADC A;  2Y2I A;  5F99 D;  1OAT A;  4OBU A;  3AZK B;  4G92 C;  4QGR A;  1Z7D A;  1ID3 B;  4KUD D;  3A2B A;  4WB0 B;  5E5A D;  1ARS A;  5CPI A;  4IW7 A;  1HQ3 D;  5B1M B;  3LY1 A;  4WYA A;  5AVC C;  2Y2Q A;  2TPL A;  1M0Q A;  2D65 A;  3DRD A;  3NQU B;  3AZI B;  4KHA B;  4WYG A;  2YFW B;  2YCN A;  2HUE C;  1N31 A;  4JF1 A;  3W98 D;  5GT3 A;  5B32 C;  2Y2G A;  2RIQ A;  4WLJ A;  3O62 B;  3WAA C;  4EO5 B;  3F9T A;  3A6N A;  4EFF A;  5AV9 D;  3REI C;  1GCK A;  3B0D C;  3FFH A;  5BNV B;  3LEL C;  5AV6 D;  4E45 A;  2W8U A;  2ZM5 A;  1P3O B;  4K2I A;  1ZLA A;  5BO0 A;  3WKS A;  5J8Q A;  5B2I B;  3C1B B;  2PYO D;  1MDX A;  1ASB A;  1P3W A;  3KWQ C;  2O1B A;  1WKH A;  3GET A;  3C1C B;  5GT0 C;  4JEX A;  4H9R A;  5B40 C;  2A1V A;  3GZD A;  3EIA A;  4DRA A;  1IAX A;  3A9Z A;  4W1X A;  5B33 B;  1P3K B;  3AV7 A;  5M4B A;  2GMU A;  5AY8 D;  4ZBJ B;  3MGQ C;  1I41 A;  3RBL A;  1DFO A;  4XZQ C;  3MVD D;  3LZ1 C;  4H9N A;  3UT9 D;  2JCH A;  3X1V A;  1H3O A;  2F8N D;  4CXR A;  2Z9U A;  1DTY A;  2CH2 A;  2QMA A;  3WY7 A;  2FKI A;  2VMO A;  4H9Q A;  1D7U A;  1TOE A;  4J8U D;  3WTP D;  3F6T A;  2WK7 A;  2HZP A;  1M0N A;  3LVL B;  3EPL A;  3LZ0 D;  5BJ4 A;  1SZS A;  2ARO A;  2D5Y A;  1YJY A;  1YJZ A;  1I29 A;  3AZG D;  2BI5 A;  3N4X A;  1G4V A;  3UTB C;  3B1D A;  4RKC A;  5EUD A;  1WYT B;  3MGR A;  4Y0I A;  1N8P A;  4RM1 A;  2PB2 A;  1Z3Z A;  2AEU A;  1A7W A;  3BCA A;  1S32 D;  1KX3 D;  2Y2J A;  3LJA B;  3A1K A;  3NU8 A;  3W97 C;  3NX3 A;  3PDB B;  4G91 B;  5CHL B;  3EUC A;  1M4N A;  3KUY A;  3AZJ C;  2F8J A;  3N5M A;  1GEW A;  2CTZ A;  1DJU A;  3B6G D;  1DJ9 A;  5IWQ A;  3MNN C;  1TOG A;  2HOR A;  4H9Q B;  1BQD A;  4JF0 A;  4LW2 A;  3UAK A;  4WNN B;  4W5K A;  2Y2L A;  3AN2 B;  4RIZ A;  5CPJ D;  1X29 A;  3KXB C;  5KDM A;  1OXO A;  3H0R C;  2CV5 D;  2NQB A;  2CB1 A;  1LW5 A;  4KGC C;  4Y0H A;  4ADB A;  1TOJ A;  2AY7 A;  3AOV A;  3AZK D;  1G7W A;  5B24 A;  2BIG A;  1ID3 D;  2Z20 A;  3AEP A;  3ZRP A;  3X1T A;  5B1M D;  3MC6 C;  1TAF B;  4JJN C;  4YM6 B;  2W7L A;  1O69 A;  1AMQ A;  4F5G A;  3BWN C;  2VGZ A;  3B6F C;  3AV1 B;  4E3R A;  4WYE A;  4R8P C;  1QGN A;  3AZI D;  3FVS A;  3W99 B;  3W99 C;  4ZAH A;  5BS7 A;  5DB5 A;  3M5U A;  1ASG A;  5CPK C;  2FJ7 B;  4Z5T C;  3W1J A;  5JA4 B;  3QM2 A;  3O62 D;  4Q31 A;  3MAU A;  1TZY C;  3AZM C;  4XK1 A;  3B0C W;  4J8L A;  1P3M C;  2D66 A;  1U35 B;  2W7K A;  5DNN B;  1QIR A;  4ITG A;  5EIG B;  1P3O D;  3W1H A;  5B31 C;  5GSU C;  2V0Y A;  5M46 A;  3CQ6 A;  5DNM B;  2D61 A;  2ZY4 A;  5B2I D;  3C1B D;  4LD9 C;  1EQZ C;  4MKK A;  3B1E A;  3C1C D;  3QI6 A;  3IP4 C;  2ZUK A;  2HP1 A;  1D7S A;  3QBO A;  1P3A C;  3WTP E;  1PMM A;  1W23 A;  2QBT A;  3ASA A;  2VMN A;  4I8A A;  1P3P B;  5I92 A;  1B9I A;  2X5D A;  5F99 A;  5B33 D;  3REK B;  4DQY B;  4DRB A;  1P3K D;  4KUD A;  3VH5 T;  1PFF A;  5B2J C;  4RAE A;  4W91 A;  4GE7 A;  2C44 A;  2QB3 A;  3P1T A;  5F9S A;  3WKJ B;  3GBX A;  3AOW A;  4Z66 B;  8AAT A;  4CSR B;  2CWE A;  3NYU A;  3REH B;  1CZC A;  1KX4 B;  1S08 A;  4F5M A;  3HLM A;  3II0 A;  3W98 A;  4IYO A;  3P5J B;  1IAY A;  5FUG A;  3EI6 A;  1G7X A;  1M0O A;  4Y0D A;  5AV8 C;  2CJG A;  2VMV A;  2YHK A;  3MGP B;  3N75 A;  1B5O A;  4XUJ C;  4ZUX A;  3R4T A;  4UOY A;  3MAD A;  5JRG C;  3WA9 B;  1O62 A;  1LC8 A;  1JF9 A;  4X23 B;  2YFV A;  5AV6 A;  2R5C B;  4L0O A;  3BV0 A;  3DR4 A;  2YKX A;  3LJA D;  3AZN C;  4F5J A;  1W3U A;  5EUE A;  1PMO A;  2E7U A;  5B1L B;  4J8V B;  3H7F A;  3QGU A;  4WU8 C;  2VIA A;  3DOD A;  2EGY A;  5BNX A;  2XD5 A;  2R5E A;  2F2A C;  1M18 A;  2GQN A;  5HHY A;  1BKG A;  3AN2 D;  2X5F A;  3ASB A;  1F66 C;  3QPG A;  4ZUX B;  3TAT A;  2FYF A;  4ZM4 A;  3AEJ C;  4QLC B;  2XBN A;  2FNU A;  1AHE A;  2HIO A;  3MVD A;  3UT9 A;  4B9B A;  1WYU A;  2F8N A;  4XQ2 A;  1Q9C A;  1LC7 A;  4ITX A;  4XEW A;  5B0Z C;  2CJD A;  1P3L B;  1QIT A;  3K40 A;  2Y2K A;  4OCA A;  2Y2H A;  3NU7 A;  3TU4 B;  4J8U A;  3VK2 A;  1AHX A;  2VMU A;  2ZC0 A;  3W96 B;  3HDO A;  4YM6 D;  3WTP A;  1M1A B;  1CQ8 A;  3L8A A;  3AV1 D;  2AY1 A;  3MGS A;  1CZE A;  3EIB A;  4XJL A;  3W1I A;  2D63 A;  3LZ0 A;  3AZL B;  5G0A A;  1M18 B;  5AV5 B;  3AZG A;  3N4S A;  4Z2M H;  2JJE A;  4OT8 A;  2FJ7 D;  1W7M A;  3AYW C;  1S32 A;  2JSS A;  4W1V A;  1ULY A;  4OC9 A;  5AVB B;  5AVB C;  4A6R A;  2F8N H;  3FQ8 A;  1BH9 A;  4GDY A;  2HIO B;  3WKR A;  4ZWV A;  1MLZ A;  1WYU B;  1U35 D;  4E1O A;  1B4X A;  5DNN D;  3B6G A;  2D64 A;  3DR7 A;  2Y2O A;  4JEZ A;  5CP6 B;  3EPJ A;  3HMU A;  3AZF A;  4YS3 A;  4LNL A;  5DNM D;  3REJ C;  1J32 A;  3AZE C;  4A0R A;  4F5I A;  3MGS B;  5CPJ A;  1C9C A;  1CS1 A;  3DXV A;  4K2M A;  1GEX A;  1BQA A;  1IUG A;  4H9O B;  5BT1 D;  2NZD C;  4O6Z A;  4LC3 A;  1ARH A;  3A8U X;  3B1C A;  1IX7 A;  1ECX A;  3AV2 B;  5BJ3 A;  1P3P D;  3D6K A;  4EB7 A;  3IHJ A;  3AZK A;  3REK D;  4Q6R A;  3UTA B;  1ID3 A;  4ATQ A;  4WB0 A;  2AEV A;  4J8W B;  5EFS A;  2W8W A;  5B1M A;  3NNK A;  1BH9 B;  3E2Z A;  4WJ3 C;  5JAY A;  4R5F A;  3WKJ D;  4H9S A;  4ZM3 A;  2DOU A;  2D7Z A;  4Z66 D;  1UKJ A;  3EZ1 A;  1P3F B;  3NQU A;  3AZI A;  4KHA A;  3REH D;  4RLG A;  2YFW A;  1KX4 D;  3AZF B;  4CXQ A;  2YCT A;  1RV3 A;  5C3I C;  3A9X A;  3N0L A;  3MGP D;  4WU9 C;  1OHW A;  3O62 A;  3GR9 A;  2DKB A;  1JFI B;  4NOG A;  3LVK A;  1AKA A;  5B0Y B;  3WA9 D;  2Z61 A;  4J8X C;  1AY5 A;  3X1S C;  1TAR A;  5GXQ B;  1S0A A; 
#chains in the Genus database with same CATH homology
 4X23 D;  1P3G C;  3KKI A;  1YJS A;  3X1U B;  3X1U C;  5BNV A;  1LC5 A;  4G92 B;  3WCN A;  3BN1 A;  1P3O A;  2EZ1 A;  2HOX A;  5AVC B;  4MY5 A;  3TFU A;  1M19 C;  1KL1 A;  3E2Z B;  2X8U A;  1AJS B;  2R2N A;  4XAU A;  1LW4 A;  5B1L D;  4NE3 A;  5B2I A;  4J8V D;  3C1B A;  3AZH C;  1DGD A;  5EAV A;  3NUB A;  1EQB A;  3C1C A;  2AAT A;  1ZOB A;  3AL0 C;  2HUE B;  1P3I C;  2FN6 A;  2AY5 A;  5B32 B;  5B40 A;  5EAA A;  3FDB A;  5B33 A;  4ZUX D;  1AOI C;  1LS3 A;  1P3K A;  1N2T A;  4WV4 B;  3WAA B;  1OHY A;  1W7N A;  1VEF A;  2G5I C;  1MLY A;  3REI B;  5B32 G;  4QLC D;  3B0D B;  1V72 A;  3A9Y A;  4IXO A;  4XJM A;  3LEL B;  4H9P B;  2W8S A;  3WZF A;  4CAY A;  1GDE A;  3T32 A;  3PA9 A;  5DJ1 A;  1T3I A;  1P3L D;  2HOY A;  1IBJ A;  5DJ9 A;  5G4I A;  3TU4 D;  3H9X A;  3W96 D;  2VQR A;  3E77 A;  1M1A D;  5D5S A;  3KWQ B;  1P34 C;  5G49 B;  1WKG A;  5GT0 B;  2DGK A;  1SPA A;  3AZL D;  2BYJ A;  2Z1Z A;  1DJE A;  1M18 D;  5CPI C;  5AV5 D;  2E7I A;  1S07 A;  3GJU A;  3OKS A;  5B40 B;  3REL C;  2IO5 C;  1AMA A;  4FFC A;  1WYT A;  3WGC A;  4AO9 A;  3K28 A;  4HF8 A;  2HOZ A;  1IVR A;  3MGQ B;  3B0C T;  2JGT A;  4LW4 A;  3LJA A;  4AWL C;  1KL2 A;  4ADD A;  3W97 A;  3LG0 A;  4XZQ B;  1VJO A;  2BHX A;  3PDB A;  4MQR A;  1GD9 A;  2HIO D;  3F0H A;  3LZ1 B;  2W7D A;  5GT3 C;  1XEY A;  3AFA C;  4CAY B;  2VGT A;  2DQN C;  2QLR A;  5CP6 D;  1JG8 A;  3A6N C;  1I43 A;  4WNN A;  3AN2 A;  1KX5 C;  2E54 A;  3MGS D;  1BH8 B;  2D7Y A;  1F1E A;  1I48 A;  3FD0 A;  3I5T A;  3VH6 T;  1AY8 A;  3VK4 A;  1ZLA C;  3UTB B;  1EJI A;  4RJ0 A;  1SFF A;  4KGC A;  4GEB A;  4DBC A;  3AV2 D;  4F5L A;  3UTA D;  3A1I A;  4J8W D;  3W97 B;  1IX6 A;  1TAF A;  3FDD A;  3FQA A;  4YM6 A;  2Z1Y A;  2RVQ D;  3AZJ B;  3B6F A;  3AV1 A;  4WYF A;  5FT6 A;  2C81 A;  3BC8 A;  1P3F D;  3MNN B;  4XJP A;  1AMR A;  4U2H A;  4OMA A;  3AZF D;  4YS3 D;  1UU0 A;  3B8X A;  3W99 A;  2FJ7 A;  1JS3 A;  3X1V C;  3KXB B;  5JA4 A;  2EYQ A;  1KMK A;  2YKV A;  4WP0 A;  1AIC A;  1RV4 A;  5B0Y D;  4AO4 A;  4KGC B;  1TZY A;  3OP7 A;  5GXQ D;  2L5A A;  2EPJ A;  1BFM A;  1U35 A;  3AEN A;  5DNN A;  2OQX A;  3G7Q A;  4F5H A;  5EIG A;  2ARO C;  5AVC D;  4JJN B;  4IXZ A;  1V2D A;  1ART A;  5DNM A;  1ARG A;  4TN4 A;  4PFF A;  3B6F B;  5E3K A;  3MGR C;  1EQZ A;  2ORD A;  4R8P B;  2J8P A;  2BWN A;  2DGM A;  1QZ9 A;  5FT8 A;  5B32 D;  5CPK B;  3KUY C;  1P3P A;  4Z5T B;  4MKJ A;  3AEL A;  1P3B C;  3REK A;  1MAP A;  3WAA D;  2YKU A;  4A0H A;  3REI D;  2BG1 A;  5D95 A;  2VMY A;  1TZY B;  3AZM B;  3P6K A;  3LEL D;  1P3M B;  3WKJ A;  1OHV A;  3AEN B;  4Z66 A;  1E5F A;  4CSR A;  3NUI A;  3PIU A;  4KYO A;  2W7I A;  3REH A;  5B31 B;  4FL0 A;  1BW0 A;  5GSU B;  1KX4 A;  4W8I A;  2NQB C;  4GRX A;  7AAT A;  1MDO A;  2OGA A;  4LD9 B;  2W7E A;  1H1C A;  5K8B A;  3ISL A;  1EQZ B;  1ARI A;  2BI2 A;  3MGP A;  3FRK A;  3KWQ D;  4IY7 A;  5B31 G;  3FTB A;  5B24 C;  5GT0 D;  1ASA A;  3RI6 A;  5TF5 A;  3WA9 A;  3X1T C;  4E3Q A;  5B40 D;  2BYL A;  4X23 A;  1P3A B;  2VGS A;  3MAF B;  3VH6 W;  2R5C A;  1AJR A;  2DKJ A;  5G2P A;  4MQQ A;  3MGQ D;  3FVU A;  5B2J B;  3AZN A;  1CL1 A;  1EG5 A;  1CL2 A;  4XZQ D;  5B1L A;  4J8V A;  4WYD A;  3LZ1 D;  5BS7 C;  4EU1 A;  1AHY A;  2VMW A;  4HGA C;  2W8J A;  1QJ5 A;  4WXB A;  1TOI A;  4NE6 A;  2BIA A;  3JW9 A;  3WX9 A;  2ZJG A;  2YCP A;  1IX8 A;  5AV8 B;  4UUZ A;  1F66 A;  1AMS A;  4XUJ B;  3TFT A;  5EUN A;  4BQ0 A;  3R45 B;  3ZRQ A;  2PO3 A;  5JRG B;  1J04 A;  4LNJ A;  5HXX A;  4QLC A;  2YRI A;  3UTB D;  1ASD A;  3BB8 A;  3JTX A;  4ZLV A;  1X2A A;  2G5H C;  5B0Z A;  3RCH B;  3AZN B;  1P3L A;  4BA4 A;  3W97 D;  2BYK B;  1ASC A;  3TU4 A;  2VMZ A;  3W96 A;  2FQ6 A;  3FKD A;  3QHX A;  1Y4I A;  3AZJ D;  3NDN A;  1M1A A;  2GB3 A;  3EI7 A;  4WU8 B;  4KXK A;  2HUI A;  3BCX A;  3BWO A;  4AZJ A;  2BYM A;  2VGU A;  5F99 C;  2VYC A;  1TOK A;  3AZL A;  4KUD C;  5E5A C;  3MNN D;  3USF A;  5AV5 A;  1HQ3 B;  1HQ3 C;  2ZY2 A;  3BCB A;  4F5K A;  3NYS A;  4R5Z A;  4BMK A;  4UUZ B;  1F66 B;  1ASL A;  3AYW A;  3KXB D;  2G7J A;  4UHN A;  3VP6 A;  3WGB A;  5AVB A;  3DU4 A;  3W98 C;  4AH3 A;  4KGC D;  2XH1 A;  1BJ4 A;  1FG7 A;  2Z9W A;  3RBF A;  5B0Z B;  1FG3 A;  2DGL A;  3ECD A;  5CP6 A;  5AV9 C;  4RIT A;  4JJN D;  3WCO A;  1TAT A;  2BIE A;  2OAT A;  3B6F D;  1B9H A;  4MQP A;  2BYM B;  5AV6 C;  4R8P D;  4EB5 A;  4H9O A;  1CQ6 A;  4OYT A;  3FZ6 A;  3VH5 A;  3W99 D;  1GC2 A;  3PDX A;  1LK9 A;  5CPK D;  2PYO C;  2CH1 A;  3GSB A;  3AV2 A;  4Z5T D;  3AYW B;  4WYC A;  3UTA A;  3FQ7 A;  4J8W A;  1V2E A;  2Y2N A;  3AEO A;  4CBR A;  2QB2 A;  1ASN A;  1TZY D;  3AZM D;  3JWB A;  1DKA A;  4XJO A;  4E77 A;  4MSO A;  1P3M D;  2PB0 A;  4GSA A;  2YKY A;  1P3F A;  5AY8 C;  3AEM A;  5B31 D;  3WLX A;  3VOM A;  5GSU D;  5HDM A;  3REJ B;  3DYD A;  2LY8 A;  3AZE B;  1BJN A;  3MVD C;  1GC4 A;  1PG8 A;  4PFN A;  3UT9 C;  4LD9 D;  4Z2M G;  1EQZ D;  4ZSW A;  2W7G A;  1JFI A;  1C0N A;  1O4S A;  2NZD B;  2W7H A;  4JEV A;  5B0Y A;  4UHO A;  3X1S A;  5GXQ A;  4J8U C;  2JIS A;  4IX8 A;  3WTP C;  1P3A D;  1C7N A;  3X1U A;  1T3U A;  2WK9 A;  2EO5 A;  3MKJ A;  3I4J A;  3FVX A;  5B2J D;  3LZ0 C;  5G4J A;  5AVC A;  3AZG C;  4OTL A;  1JS6 A;  1AJS A;  3EI9 A;  1WYV B;  1Z2C B;  2WK8 A;  1S32 C;  1KX3 C;  5B32 A;  2XD1 A;  5C3I B;  3PD6 B;  5AV8 D;  1GEY A;  3N7N A;  3ELE A;  3ZZJ A;  4WU9 B;  4XUJ D;  1AOI A;  2O7C A;  3WAA A;  3E2Y A;  3B6G C;  1C4K A;  5AX8 A;  3CBF A;  5JRG D;  3EI8 A;  3REI A;  4DGT A;  4J8X B;  3EZS A;  5M4D A;  3X1S B;  3DC1 A;  1P3G B;  3LEL A;  4H9P A;  4IXS A;  4ZDP A;  4CVQ A;  5CPJ C;  1TPL A;  1X28 A;  3AZN D;  1N1J B;  1M19 B;  3TQX A;  2CV5 C;  2CST A;  1OXP A;  1MDZ A;  3AZH B;  4ZWM A;  4WU8 D;  3GZC A;  3KWQ A;  4HVK A;  3PGY A;  1P34 A;  5G49 A;  3DXW A;  3AZK C;  5GT0 A;  1ID3 C;  4Q76 A;  2WB6 A;  1P3I B;  2G6W A;  5B1M C;  3REL A;  4BA5 A;  1F66 D;  4ATP A;  1ZC9 A;  4H9S C;  1AOI B;  2VMT A;  2VMS A;  2VMP A;  3MGQ A;  1BS0 A;  2JJG A;  3KGX A;  3AZI C;  5EQC A;  4XZQ A;  4GE9 A;  1B67 A;  3LZ1 A;  2F8N K;  3AFA A;  2AY4 A;  1CQ7 A;  2V1P A;  3PJ0 A;  5B0Z D;  2CAN A;  3K7Y A;  3O62 C;  3NQJ A;  1MAQ A;  2VMX A;  3G0T A;  4EO5 C;  4M2J A;  1KX5 A;  3KFU G;  1BH8 A;  1P34 B;  3V9R A;  4R8D A;  5E5I A;  1ASE A;  1XI9 A;  1C7O A;  2HP2 A;  1O61 A;  5CPI B;  4WZS B;  1P3O C;  2VMR A;  1BT4 A;  3UTB A;  3REL B;  2IO5 B;  4Q75 A;  3MEB A;  1B5P A;  5B2I C;  3C1B C;  3LV2 A;  5DX5 A;  1UU2 A;  3AYW D;  4WXF A;  4AWL B;  3C1C C;  5AVB D;  3QN6 A;  5GT3 B;  3AZJ A;  3AFA B;  4ZSY A;  3FFR A;  3N4R A;  3COG A;  5B33 C;  1P3K C;  3NQJ B;  3MNN A;  2JE5 A;  1CJ0 A;  3A6N B;  4ZBJ C;  1X0M A;  1SZK A;  3REJ D;  2ZP7 A;  3NYT A;  3H0M C;  1KX5 B;  3E2F A;  3AZE D;  4AOA A;  3EI5 A;  3V9R B;  1WST A;  3KXB A;  2DF4 C;  4WLH A;  4A72 A;  3PPL A;  1ZLA B;  2NZD D;  4JEY A;  4K2B A;  5BO0 B;  3VAX A;  4RJY A;  2FFF B;  3Q8N A;  4NFT A;  4A6U A;  3MC6 A;  3CAI A;  1KKP A;  4JJN A;  2W8T A;  1U08 A;  4H9R B;  2ZY5 A;  3BWN A;  3GZD C;  4N0W A;  1VP4 A;  1PZR A;  2JJH A;  3TCM A;  3NRA A;  1LKC A;  4R8P A;  3KE3 A;  3H0L C;  2FNI A;  3LJA C;  2YOB A;  4G91 C;  1V2F A;  5CPK A;  1D7R A;  4H9N B;  3X1V B;  4Z5T A;  1H3O B;  4WU9 D;  1P3B A;  2VIB A;  2CY8 A;  1SZU A;  4P3M A;  4ADE A;  4J8X D;  1AHG A;  2VLF A;  3X1S D;  3AZM A;  3AN2 C;  1P3G D;  3X1U D;  1D2F A;  1P3M A;  2DR1 A;  3E6G A;  5C6U A;  4A0F A;  2BI1 A;  2CJH A;  5B31 A;  2ARO B;  5GSU A;  1M19 D;  3LVJ A;  2VLH A;  3CQ4 A;  3L44 A;  2GSA A;  2R0T A;  3AZH D;  2W7J A;  3MGR B;  4LD9 A;  4E44 A;  4TMR A;  1KKJ A;  3UWC A;  2BKW A;  4GE4 A;  1P3I D;  5E4Z A;  4WD2 A;  2VGV A;  4YM6 C;  1P3A A;  3KUY B;  1WWI A;  3MAF A;  2AY2 A;  3AV1 C;  1P3B B;  1AOI D;  2OKJ A;  1G4X A;  1AX4 A;  3JZL A;  5B2J A;  4DQ6 A;  2Z9V A;  1S09 A;  2ZYJ A;  4UHM A;  2Z9X A;  2FJ7 C;  1YNU A;  2UWX A;  4A6T A;  1AAM A;  5KDM B;  3LVM A;  3HBX A;  2NQB B;  1HTA A;  2CIN A;  1UU1 A;  3VH6 A;  1ELQ A;  5AV8 A;  4AZK A;  3AAT A;  4XUJ A;  2NMP A;  1P34 D;  1U35 C;  3EPK A;  4P7Y A;  3R45 A;  1ZOD A;  5B24 B;  5DNN C;  4ZDO A;  1YOO A;  5JRG A;  5CPI D;  4WXG A;  4WBT A;  3X1T B;  3KGW A;  9AAT A;  3FSL A;  4R2N A;  3REL D;  2HUU A;  4B98 A;  1YIY A;  5DNM C;  2QSR A;  3FZ7 A;  4M6B A;  2C7T A;  4U1T A;  2C0R A;  1W2E A;  3RCH A;  4A0G A;  1C7G A;  2BYK A;  5BT1 C;  1ELU A;  1WWS A;  5GT3 D;  4WU8 A;  3LWS A;  3AFA D;  1GC3 A;  2VI9 A;  1P3P C;  3R9A A;  3REK C;  4HGA B;  3PAA A;  5E5A A;  3CQ5 A;  3A6N D;  1HQ3 A;  2X3L A;  3ZZK A;  4NE5 A;  1KX5 D;  1SVV A;  3EG5 B;  3WKJ C;  2QA3 A;  3NTJ A;  4Z66 C;  4ISY A;  4M2K A;  3AEJ A;  1ZLA D;  3FZ8 A;  3REH C;  2W7F A;  2JJF A;  1KX4 C;  3HVY A;  4M2M A;  5G09 A;  3B0B A;  4RKD A;  3B46 A;  4OBV A;  2AY3 A;  2AY8 A;  3MGP C;  2BWP A;  5AV9 A;  3WA9 C;  1AIA A;  1R4V A;  1W7L A;  1D7V A;  4PIW A;  4X23 C;  5F99 B;  1S06 A;  4K05 A;  4KUD B;  5E5A B;  4W1W A;  5FT5 A;  2WKA A;  2AY6 A;  4EMY A;  2GMS A;  1AKC A;  5B1L C;  4J8V C;  1M7Y A;  2PYO A;  2OGE A;  2VI8 A;  4H51 A;  3X1V D;  1ASM A;  3E9K A;  4PVF A;  2JG2 A;  2BI9 A;  3W98 B;  3EPH A;  3DZZ A;  4IYO B;  4BHD A;  5FUG B;  5FT4 A;  3GWP A;  2E7J A;  2BI3 A;  1QJ3 A;  1B8G A;  1MGV A;  4ZUX C;  4JEW A;  5AY8 A;  2Q7W A;  1BJO A;  1YAA A;  2ARO D;  3VK3 A;  5AV9 B;  1SF2 A;  3RQ1 A;  4QLC C;  3REJ A;  1E5E A;  3AZE A;  2W8V A;  3MGR D;  2YFV B;  5AV6 B;  1FC4 A;  2O0R A;  3I16 A;  3ATH A;  1YIZ A;  1M6S A;  2NZD A;  1P3L C;  2ZSM A;  3TU4 C;  3W96 C;  4LNM A;  1AHF A;  3HL2 A;  3KSY A;  3KUY D;  2PYO B;  1M1A C;  1RVU A;  1P3B D;  1ORD A;  2ZSL A;  4CBS A;  5BNX B;  1KMJ A;  5M49 A;  2OKK A;  3AZL C;  1M18 C;  5AV5 C;  1AIB A;  3MBB A;  1B6W A;  1TAS A;  3JWA A;  4UPK A;  1BJW A;  2CFB A;  2ZY3 A;  1WYV A;  5AY8 B;  1H0C A;  1BJO B;  1KX3 A;  1AY4 A;  2EZ2 A;  1AAW A;  2NQB D;  2FM1 A;  2HIO C;  3MVD B;  3PD6 A;  2Y2M A;  4KAM A;  3UT9 B;  3VH5 W;  5KTB A;  2F8N B;  4WU9 A;  5B24 D;  1ASF A;  2YRR A;  5F8V A;  1KU5 A;  5CP6 C;  3UE8 A;  3X1T D;  2HUF A;  4J8X A;  4J8U B;  5G2Q A;  3WTP B;  1P3G A;  2BWO A;  4ZAS A;  2F8N G;  2W7M A;  2Y2P A;  3MGS C;  3HT4 A;  2AY9 A;  3LZ0 B;  1N1J A;  1M19 A;  3AZG B;  2CV5 A;  3BS8 A;  3AZH A;  1QIS A;  1M32 A;  2KFP A;  3ACZ A;  4H63 Q;  3AV2 C;  1DGE A;  4F5F A;  1RVY A;  1S32 B;  3UTA C;  1KX3 B;  2EH6 A;  4J8W C;  1P3I A;  4J5U A;  1M0P A;  2RFV A;  2RVQ C;  1AKB A;  3FCR A;  3B6G B;  1P3F C;  2VMQ A;  3AEM C;  4A00 A;  3AZF C;  4YS3 C;  4YS3 B;  4F4E A;  5CPJ B;  1GBN A;  4ZDL A;  3HQT A;  2VGW A;  2CV5 B;  1IJI A;  3G8M A;  5B0Y C;  3ZRR A;  3ELP A;  4UQV A;  3RUY A;  1GC0 A;  5GXQ C;  4ADC A;  2Y2I A;  5F99 D;  1OAT A;  4OBU A;  3AZK B;  4G92 C;  4QGR A;  1Z7D A;  1ID3 B;  4KUD D;  3A2B A;  4WB0 B;  5E5A D;  1ARS A;  5CPI A;  4IW7 A;  1HQ3 D;  5B1M B;  3LY1 A;  4WYA A;  5AVC C;  2Y2Q A;  2TPL A;  1M0Q A;  2D65 A;  3DRD A;  3NQU B;  3AZI B;  4KHA B;  4WYG A;  2YFW B;  2YCN A;  2HUE C;  1N31 A;  4JF1 A;  3W98 D;  5GT3 A;  5B32 C;  2Y2G A;  2RIQ A;  4WLJ A;  3O62 B;  3WAA C;  4EO5 B;  3F9T A;  3A6N A;  4EFF A;  5AV9 D;  3REI C;  1GCK A;  3B0D C;  3FFH A;  5BNV B;  3LEL C;  5AV6 D;  4E45 A;  2W8U A;  2ZM5 A;  1P3O B;  4K2I A;  1ZLA A;  5BO0 A;  3WKS A;  5J8Q A;  5B2I B;  3C1B B;  2PYO D;  1MDX A;  1ASB A;  1P3W A;  3KWQ C;  2O1B A;  1WKH A;  3GET A;  3C1C B;  5GT0 C;  4JEX A;  4H9R A;  5B40 C;  2A1V A;  3GZD A;  3EIA A;  4DRA A;  1IAX A;  3A9Z A;  4W1X A;  5B33 B;  1P3K B;  3AV7 A;  5M4B A;  2GMU A;  5AY8 D;  4ZBJ B;  3MGQ C;  1I41 A;  3RBL A;  1DFO A;  4XZQ C;  3MVD D;  3LZ1 C;  4H9N A;  3UT9 D;  2JCH A;  3X1V A;  1H3O A;  2F8N D;  4CXR A;  2Z9U A;  1DTY A;  2CH2 A;  2QMA A;  3WY7 A;  2FKI A;  2VMO A;  4H9Q A;  1D7U A;  1TOE A;  4J8U D;  3WTP D;  3F6T A;  2WK7 A;  2HZP A;  1M0N A;  3LVL B;  3EPL A;  3LZ0 D;  5BJ4 A;  1SZS A;  2ARO A;  2D5Y A;  1YJY A;  1YJZ A;  1I29 A;  3AZG D;  2BI5 A;  3N4X A;  1G4V A;  3UTB C;  3B1D A;  4RKC A;  5EUD A;  1WYT B;  3MGR A;  4Y0I A;  1N8P A;  4RM1 A;  2PB2 A;  1Z3Z A;  2AEU A;  1A7W A;  3BCA A;  1S32 D;  1KX3 D;  2Y2J A;  3LJA B;  3A1K A;  3NU8 A;  3W97 C;  3NX3 A;  3PDB B;  4G91 B;  5CHL B;  3EUC A;  1M4N A;  3KUY A;  3AZJ C;  2F8J A;  3N5M A;  1GEW A;  2CTZ A;  1DJU A;  3B6G D;  1DJ9 A;  5IWQ A;  3MNN C;  1TOG A;  2HOR A;  4H9Q B;  1BQD A;  4JF0 A;  4LW2 A;  3UAK A;  4WNN B;  4W5K A;  2Y2L A;  3AN2 B;  4RIZ A;  5CPJ D;  1X29 A;  3KXB C;  5KDM A;  1OXO A;  3H0R C;  2CV5 D;  2NQB A;  2CB1 A;  1LW5 A;  4KGC C;  4Y0H A;  4ADB A;  1TOJ A;  2AY7 A;  3AOV A;  3AZK D;  1G7W A;  5B24 A;  2BIG A;  1ID3 D;  2Z20 A;  3AEP A;  3ZRP A;  3X1T A;  5B1M D;  3MC6 C;  1TAF B;  4JJN C;  4YM6 B;  2W7L A;  1O69 A;  1AMQ A;  4F5G A;  3BWN C;  2VGZ A;  3B6F C;  3AV1 B;  4E3R A;  4WYE A;  4R8P C;  1QGN A;  3AZI D;  3FVS A;  3W99 B;  3W99 C;  4ZAH A;  5BS7 A;  5DB5 A;  3M5U A;  1ASG A;  5CPK C;  2FJ7 B;  4Z5T C;  3W1J A;  5JA4 B;  3QM2 A;  3O62 D;  4Q31 A;  3MAU A;  1TZY C;  3AZM C;  4XK1 A;  3B0C W;  4J8L A;  1P3M C;  2D66 A;  1U35 B;  2W7K A;  5DNN B;  1QIR A;  4ITG A;  5EIG B;  1P3O D;  3W1H A;  5B31 C;  5GSU C;  2V0Y A;  5M46 A;  3CQ6 A;  5DNM B;  2D61 A;  2ZY4 A;  5B2I D;  3C1B D;  4LD9 C;  1EQZ C;  4MKK A;  3B1E A;  3C1C D;  3QI6 A;  3IP4 C;  2ZUK A;  2HP1 A;  1D7S A;  3QBO A;  1P3A C;  3WTP E;  1PMM A;  1W23 A;  2QBT A;  3ASA A;  2VMN A;  4I8A A;  1P3P B;  5I92 A;  1B9I A;  2X5D A;  5F99 A;  5B33 D;  3REK B;  4DQY B;  4DRB A;  1P3K D;  4KUD A;  3VH5 T;  1PFF A;  5B2J C;  4RAE A;  4W91 A;  4GE7 A;  2C44 A;  2QB3 A;  3P1T A;  5F9S A;  3WKJ B;  3GBX A;  3AOW A;  4Z66 B;  8AAT A;  4CSR B;  2CWE A;  3NYU A;  3REH B;  1CZC A;  1KX4 B;  1S08 A;  4F5M A;  3HLM A;  3II0 A;  3W98 A;  4IYO A;  3P5J B;  1IAY A;  5FUG A;  3EI6 A;  1G7X A;  1M0O A;  4Y0D A;  5AV8 C;  2CJG A;  2VMV A;  2YHK A;  3MGP B;  3N75 A;  1B5O A;  4XUJ C;  4ZUX A;  3R4T A;  4UOY A;  3MAD A;  5JRG C;  3WA9 B;  1O62 A;  1LC8 A;  1JF9 A;  4X23 B;  2YFV A;  5AV6 A;  2R5C B;  4L0O A;  3BV0 A;  3DR4 A;  2YKX A;  3LJA D;  3AZN C;  4F5J A;  1W3U A;  5EUE A;  1PMO A;  2E7U A;  5B1L B;  4J8V B;  3H7F A;  3QGU A;  4WU8 C;  2VIA A;  3DOD A;  2EGY A;  5BNX A;  2XD5 A;  2R5E A;  2F2A C;  1M18 A;  2GQN A;  5HHY A;  1BKG A;  3AN2 D;  2X5F A;  3ASB A;  1F66 C;  3QPG A;  4ZUX B;  3TAT A;  2FYF A;  4ZM4 A;  3AEJ C;  4QLC B;  2XBN A;  2FNU A;  1AHE A;  2HIO A;  3MVD A;  3UT9 A;  4B9B A;  1WYU A;  2F8N A;  4XQ2 A;  1Q9C A;  1LC7 A;  4ITX A;  4XEW A;  5B0Z C;  2CJD A;  1P3L B;  1QIT A;  3K40 A;  2Y2K A;  4OCA A;  2Y2H A;  3NU7 A;  3TU4 B;  4J8U A;  3VK2 A;  1AHX A;  2VMU A;  2ZC0 A;  3W96 B;  3HDO A;  4YM6 D;  3WTP A;  1M1A B;  1CQ8 A;  3L8A A;  3AV1 D;  2AY1 A;  3MGS A;  1CZE A;  3EIB A;  4XJL A;  3W1I A;  2D63 A;  3LZ0 A;  3AZL B;  5G0A A;  1M18 B;  5AV5 B;  3AZG A;  3N4S A;  4Z2M H;  2JJE A;  4OT8 A;  2FJ7 D;  1W7M A;  3AYW C;  1S32 A;  2JSS A;  4W1V A;  1ULY A;  4OC9 A;  5AVB B;  5AVB C;  4A6R A;  2F8N H;  3FQ8 A;  1BH9 A;  4GDY A;  2HIO B;  3WKR A;  4ZWV A;  1MLZ A;  1WYU B;  1U35 D;  4E1O A;  1B4X A;  5DNN D;  3B6G A;  2D64 A;  3DR7 A;  2Y2O A;  4JEZ A;  5CP6 B;  3EPJ A;  3HMU A;  3AZF A;  4YS3 A;  4LNL A;  5DNM D;  3REJ C;  1J32 A;  3AZE C;  4A0R A;  4F5I A;  3MGS B;  5CPJ A;  1C9C A;  1CS1 A;  3DXV A;  4K2M A;  1GEX A;  1BQA A;  1IUG A;  4H9O B;  5BT1 D;  2NZD C;  4O6Z A;  4LC3 A;  1ARH A;  3A8U X;  3B1C A;  1IX7 A;  1ECX A;  3AV2 B;  5BJ3 A;  1P3P D;  3D6K A;  4EB7 A;  3IHJ A;  3AZK A;  3REK D;  4Q6R A;  3UTA B;  1ID3 A;  4ATQ A;  4WB0 A;  2AEV A;  4J8W B;  5EFS A;  2W8W A;  5B1M A;  3NNK A;  1BH9 B;  3E2Z A;  4WJ3 C;  5JAY A;  4R5F A;  3WKJ D;  4H9S A;  4ZM3 A;  2DOU A;  2D7Z A;  4Z66 D;  1UKJ A;  3EZ1 A;  1P3F B;  3NQU A;  3AZI A;  4KHA A;  3REH D;  4RLG A;  2YFW A;  1KX4 D;  3AZF B;  4CXQ A;  2YCT A;  1RV3 A;  5C3I C;  3A9X A;  3N0L A;  3MGP D;  4WU9 C;  1OHW A;  3O62 A;  3GR9 A;  2DKB A;  1JFI B;  4NOG A;  3LVK A;  1AKA A;  5B0Y B;  3WA9 D;  2Z61 A;  4J8X C;  1AY5 A;  3X1S C;  1TAR A;  5GXQ B;  1S0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...