2ZY2A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
521
structure length
521
Chain Sequence
b'SPFELKDELIKVASGKANRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTVGVGGLAKLDGIEGRFERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLTVSEQIVRQYIVREMAGGAVPPESVDLFAVEGGTAAMAYIFESLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQRPDLLILTDDVYGTFADEFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNVTCRLYGEAFSQWAVQQSSTGDMLFRVADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRRLADELYEQYKALGKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-aspartate 4-carboxylyase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Lyase
total genus 154
structure length 521
sequence length 521
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy2A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy2A01
1SZKA 4XQ2A 1AHGA 3COGA 3LY1A 4PFFA 3AV7A 3RUYA 4H51A 2FYFA 2GQNA 2X8UA 2XH1A 3I5TA 2V1PA 1JG8A 3E2FA 1MLZA 1QJ3A 3FVXA 4XJOA 1YNUA 1S09A 1TOGA 1V2EA 3EIAA 1M7YA 1SVVA 2W7MA 1W7LA 1ORDA 2VMQA 3DRDA 1GC2A 3VOMA 2ZY3A 1AJSB 2CINA 2AY9A 2D5YA 2D66A 1BJWA 1O61A 2OGAA 4ZWVA 4ZDPA 1C4KA 1WYVB 2VYCA 5E3KA 3P6KA 3GZDA 3UWCA 1GD9A 3CQ4A 4FL0A 3QM2A 4MQRA 3JTXA 3MC6A 4ZAHA 2VMOA 5D95A 5M49A 1BKGA 2JG2A 2WK8A 1LC5A 1FC4A 1GC3A 4OMAA 3FDBA 3PA9A 3QPGA 3A2BA 4K2MA 1ASNA 1UU1A 4HVKA 1ELQA 4BA5A 2BI9A 4CXRA 3EZ1A 4XJPA 3D6KA 2CH2A 2OGEA 2CY8A 4CBSA 2D7YA 4OC9A 2BWNA 3KGWA 1QJ5A 1W7MA 1JS6A 1ZODA 1VP4A 2JJHA 1X29A 1M6SA 4A72A 5C6UA 1D7UA 3FSLA 8AATA 2VGUA 1W3UA 4EB5A 2PB2A 1XI9A 1YJSA 2VI9A 2BHXA 4P7YA 4UQVA 1E5EA 4ITXA 3T32A 1CJ0A 4EB7A 1KKPA 1S0AA 2R0TA 4WXGA 3TATA 4ATQA 1WKHA 1V72A 3GZCA 4W1WA 1WYUB 3NX3A 1AIBA 3EI8A 4O6ZA 4CVQA 5K8BA 2CFBA 3WLXA 5FT8A 4E1OA 3FVSA 1KMKA 1LS3A 1AAWA 1I43A 1M0NA 1MAPA 3DU4A 3E2YA 5BJ4A 1O4SA 1M0QA 2QMAA 3UE8A 4ADEA 3FQ7A 2W8WA 1QIRA 1E5FA 1G4XA 1AMQA 2CANA 2YKXA 3CQ6A 1VJOA 2QA3A 2BIEA 4F5HA 4PVFA 2BIGA 3K28A 1CQ7A 3OKSA 4XAUA 1AIAA 2CSTA 5HDMA 3OP7A 1N31A 3BWNA 3F9TA 1UU2A 2AY6A 5G0AA 3DR4A 4WYDA 3A9XA 3LVJA 4QGRA 4TN4A 2QLRA 3LVMA 4WYEA 5M46A 1H0CA 1D7RA 2ZYJA 2WKAA 3PD6B 2VGTA 3EZSA 2OATA 3UAKA 3B46A 2HOYA 1V2FA 2C0RA 3LWSA 4JEWA 4P3MA 4Q6RA 5E4ZA 4F5LA 4K2BA 2YRRA 3A9ZA 1LK9A 1AY5A 2WK9A 3GZDC 4AZKA 4W8IA 1ASDA 3LVLB 1PG8A 2E7IA 1VEFA 1IBJA 3A9YA 1BJNA 2VI8A 3PDBB 1IAYA 4GEBA 3PGYA 5TF5A 1SZUA 3AATA 1LC8A 3VK3A 2FNUA 5F8VA 1X2AA 2PB0A 3QHXA 3FVUA 3NU8A 2AY2A 3PIUA 4AOAA 2D61A 4LNJA 4BA4A 1UKJA 1T3IA 4CXQA 1IX8A 1MDXA 4E3RA 4OTLA 1CZEA 1J32A 1M0PA 2ZP7A 1ARTA 1GEWA 1I41A 4I8AA 3R9AA 3PDXA 4A0FA 4ZDOA 1PFFA 1CL1A 2ZY2A 3E77A 4IXSA 1ASMA 2YCPA 3AENA 2BKWA 1GEXA 2E7JA 1D7VA 2JJEA 3DODA 1B9HA 1BJ4A 4R5FA 3DC1A 3WKRA 1OXOA 4R8DA 2GMUA 4A0HA 4Q31A 2HUUA 1O62A 1LW4A 2BIAA 1AY8A 1B9IA 3NYTA 2WK7A 3HDOA 3K7YA 4A00A 1AKAA 4UHMA 2Z61A 3Q8NA 7AATA 2YHKA 1IUGA 1Z3ZA 1LC7A 4WP0A 4JF1A 3L8AA 3FKDA 1ASEA 1MDZA 4MKJA 4W1VA 2BI2A 2E7UA 2EPJA 2HUFA 4JEYA 4XJMA 2W7DA 5F9SA 2W7LA 4IW7A 3ZRRA 2BWPA 2BI3A 2HUIA 1DTYA 2JGTA 3CAIA 1DFOA 3AEJC 3B1DA 5G4IA 5HHYA 3DR7A 2VMUA 4A0GA 3I4JA 3BWNC 2VGSA 3GBXA 1OHVA 1DJEA 3ATHA 5BJ3A 5DX5A 1C7GA 2Z9WA 1WYTA 4A6RA 1AJSA 2YKUA 3LG0A 1O69A 2RFVA 3E6GA 1DGEA 1WYVA 3LVKA 4KAMA 1DGDA 1SF2A 2W8UA 2HOZA 1KKJA 3GETA 1M4NA 1G4VA 1TOEA 4ZM4A 3BS8A 5M4DA 2YRIA 4IXZA 2ZSMA 3ACZA 1YJZA 3TQXA 1RV3A 4PFNA 4LW2A 4MY5A 4F5FA 2NMPA 3TFUA 1ASFA 5HXXA 1S07A 4GRXA 5FT5A 3WGBA 5G09A 1ASGA 4IY7A 2OQXA 2VMSA 4RKDA 2Z20A 4Y0HA 1G7XA 3F6TA 3F0HA 3FQ8A 3NRAA 4ITGA 4R5ZA 3RQ1A 2HORA 1KMJA 4UOYA 1EQBA 4AO4A 3BCBA 3RCHA 4ZDLA 4ADBA 1TPLA 1SFFA 3ASAA 2HP2A 1C7OA 2AY5A 1ARSA 1WYUA 4OT8A 4WLHA 4DQ6A 4F5KA 1YOOA 1CQ8A 2X5DA 1I48A 3NYSA 2AY1A 1AX4A 3ASBA 4ZSWA 3DXWA 3GR9A 1MLYA 3AELA 3ZZJA 5EAAA 1AICA 1TATA 1DJUA 2W7FA 3AEJA 3JWAA 4LNLA 1EJIA 1W23A 2O0RA 1QISA 1W7NA 1I29A 1ZOBA 1AMRA 1IVRA 2VMTA 3FFRA 3GSBA 3JWBA 4WYCA 3TCMA 2VMYA 1BW0A 1Y4IA 3II0A 3EIBA 1RVUA 2YOBA 2Z9VA 5G2PA 2W7HA 3ZZKA 1U08A 4AZJA 3ELPA 4WB0A 2W7KA 2VMNA 3VK2A 1IAXA 2VGWA 2R5EA 3E2ZA 5I92A 3LV2A 2AATA 3EI9A 2GB3A 5M4BA 2ZY5A 4Y0DA 1J04A 5EIGA 3N0LA 1S06A 1TARA 2CH1A 3MAFA 2VMPA 5FT6A 4ATPA 3TFTA 1AMSA 2C81A 4PIWA 4WYFA 4BMKA 4EMYA 2G6WA 3B1EA 3NUBA 2QBTA 4W1XA 2W7IA 1X0MA 2R5CA 4RJYA 3FCRA 2CJGA 4GE7A 3VAXA 1YIYA 2HP1A 1ASLA 4XEWA 4RAEA 4JEZA 1BJOB 1OXPA 3CQ5A 4JF0A 2Q7WA 4LNMA 1AJRA 3MKJA 3ZRQA 4IYOB 4OYTA 4TMRA 4L0OA 4U1TA 1JS3A 5FT4A 4DBCA 1QZ9A 3RBLA 2VMVA 3L44A 2W8VA 3MADA 1MDOA 1S08A 2W8TA 5E5IA 1IX7A 2BYLA 3AENB 3FQAA 3DXVA 2D65A 3MBBA 5EUDA 4ADCA 1AHFA 3NNKA 3RI6A 4WD2A 1GCKA 3WGCA 1BT4A 1FG3A 4NOGA 1B8GA 2BI5A 2HZPA 3JW9A 4XJLA 4DGTA 2VIBA 3BC8A 1X28A 2ZY4A 2EO5A 1AKCA 4F5IA 1AMAA 2AY7A 2VGZA 2EGYA 4Q75A 1AHYA 1WKGA 4N0WA 3HQTA 4AO9A 1RVYA 3BCAA 5D5SA 4ZWMA 1GC4A 4JEVA 4E77A 2CJDA 2JJFA 4MKKA 2QB3A 1DJ9A 1V2DA 2YCTA 2VLHA 3FRKA 2YKVA 4M2JA 4XK1A 2Z1ZA 1AY4A 1MGVA 2CB1A 3HLMA 4MQQA 2YCNA 3ECDA 1B5OA 1QITA 2ZJGA 1C9CA 2ZC0A 2E54A 2ZSLA 1Z7DA 4IXOA 4M2MA 1ASBA 1CQ6A 4RKCA 1BQDA 4B98A 4BQ0A 2F8JA 3BWOA 2O7CA 3BV0A 3R4TA 1ARGA 1P3WA 2GSAA 1WYTB 3CBFA 1SZSA 2D64A 3M5UA 2DKJA 4KXKA 4EFFA 1ARIA 1M32A 1CL2A 2W7GA 3AEPA 1D2FA 3B8XA 4JEXA 2D63A 4Y0IA 2W7EA 4CBRA 4A6UA 4W91A 2D7ZA 3NTJA 1BQAA 3WZFA 4WLJA 5EQCA 4WBTA 5G4JA 3QGUA 4ZSYA 3B1CA 3ZRPA 3PJ0A 1B4XA 4OCAA 1QGNA 5DJ1A 1ARHA 5J8QA 3USFA 3FFHA 2FN6A 2EZ2A 4KYOA 4F5GA 4BHDA 3WX9A 1CZCA 3EI5A 4J5UA 1AHEA 4A6TA 2BYJA 5EAVA 4B9BA 4F5MA 4LC3A 1YAAA 3KKIA 3BN1A 2HOXA 1OHYA 3G7QA 2AY3A 3QBOA 4ADDA 1OHWA 2YKYA 3E9KA 4IX8A 1GC0A 2ORDA 4E3QA 2DKBA 3FTBA 3NYUA 4WYAA 1LKCA 1UU0A 3RCHB 3H7FA 1FG7A 1H1CA 1C7NA 2Z9UA 3PAAA 4ZLVA 1YIZA 1ASCA 3HL2A 3A8UX 3ISLA 1G7WA 1KL1A 3NU7A 3G8MA 4UHNA 3ELEA 3PPLA 2AY4A 1AHXA 1CS1A 2TPLA 3AEMC 4U2HA 4FFCA 3RBFA 4HF8A 3N5MA 3VK4A 3MEBA 2QB2A 1B5PA 5EFSA 4AH3A 2FQ6A 4GSAA 1D7SA 5JAYA 2GMSA 4K2IA 4W5KA 3BCXA 3NDNA 3EI7A 4WXBA 4EU1A 2BI1A 3AEOA 2W7JA 4MSOA 1JF9A 4R2NA 1TOIA 5EUEA 3AOVA 1IJIA 3DYDA 1KL2A 1ZC9A 3PD6A 1N2TA 1ASAA 2VGVA 1BS0A 5IWQA 3QN6A 2EH6A 5EUNA 1GEYA 2EZ1A 1IX6A 2VMWA 5DJ9A 1MAQA 1ELUA 3P1TA 4WB0B 2Z1YA 2BWOA 3KGXA 4M2KA 4LW4A 1TASA 2AY8A 3E2ZB 3IHJA 1SPAA 4ZM3A 3QI6A 3WKSA 3GJUA 2CTZA 3BB8A 2VMXA 1YJYA 3MAUA 2W8JA 2Z9XA 1TOJA 1ECXA 5EIGB 3PDBA 1GBNA 3DZZA 3MAFB 4UHOA 4ISYA 1OATA 2VMZA 2C44A 2VMRA 3AOWA 3MC6C 2CJHA 4Q76A 1AKBA 1EG5A 2R5CB 4F4EA 3K40A 2X5FA 2VLFA 1GDEA 3EI6A 1DKAA 2C7TA 2DOUA 4GDYA 1N8PA 4GE9A 4F5JA 3N75A 4WXFA 5G2QA 4ZASA 1AAMA 3HMUA 5AX8A 1BJOA 2XBNA 3WY7A 3FDDA 2JJGA 2V0YA 2FNIA 2VIAA 3NUIA 4IYOA 1RV4A 1TOKA 2PO3A 3AEMA 5DB5A 2FM1A 4WYGA 2ZUKA 2DR1A 1M0OA 9AATA 4A0RA 4GE4A 3EUCA 1WSTA 1LW5A 2O1BA 1C0NA 3KE3A 4MQPA 2R2NA
chains in the Genus database with same CATH superfamily
5BNXB 3VH5A 3LY1A 4PFFA 5DNMD 3RUYA 3KUYC 3MNNB 1P3BD 3AV1A 1MLZA 4G91C 1YNUA 1M7YA 3KXBC 1O61A 2OGAA 2Y2KA 3GZDA 3X1SC 4JJNA 5CPJB 2HIOA 4MQRA 3MC6A 3B6FB 3FZ7A 2WK8A 1LC5A 1GC3A 5CPID 4CXRA 3EZ1A 5B40A 1ID3B 3KGWA 3W1HA 1QJ5A 4RIZA 2JJHA 1VP4A 1X29A 3W98D 4ZBJC 4KHAA 1YJSA 1P3OB 2VI9A 5AV5C 1E5EA 3VH5T 1P3PA 1S0AA 3UTBD 3NQJB 1V72A 3GZCA 5K8BA 1AIBA 3EI8A 4O6ZA 4CVQA 5B1LC 5FT8A 4E1OA 3WAAD 3KWQB 1KMKA 2UWXA 1O4SA 2DGMA 1KX5D 1E5FA 2QA3A 1M18C 3K28A 1CQ7A 2PYOA 1AIAA 2CSTA 4UPKA 1ZLAC 5HDMA 3OP7A 3W97D 3BWNA 3WKJB 5G0AA 2AY6A 2DGKA 3DR4A 1M19C 3EZSA 4M6BA 3UAKA 4WV4B 2C0RA 1AY5A 2WK9A 4W8IA 3AZNA 2E7IA 1VEFA 2X3LA 3MVDB 1EQZC 1P3KD 5TF5A 3REJD 2FNUA 1X2AA 3WA9D 5DNMA 3FVUA 4AOAA 1P3BA 1T3IA 1IX8A 1MDXA 1CZEA 5AV5B 3C1CD 3RELC 1ARTA 1GEWA 4I8AA 4ZDOA 2ZY2A 4IXSA 5AY8D 2YCPA 5B24C 2E7JA 1D7VA 1W2EA 3WKRA 1U35D 2GMUA 1O62A 1LW4A 1AY8A 2J8PA 3HDOA 1AKAA 4Z66B 5B0YD 1LC7A 3W96C 5GT0C 3NQUA 2BI2A 2EPJA 4J8XC 3N7NA 4YM6D 3W98A 5G49B 3B1DA 5HHYA 5BJ3A 1C7GA 2RVQC 1KX4D 1WYTA 3LG0A 4X23C 4E44A 5JRGB 3UTBA 5KTBA 4NFTA 1TOEA 2NQBB 2YRIA 3WAAA 1P3GC 5KDMB 4DQYB 4MY5A 3AYWD 5CPKB 1KX5A 3MGPD 3UTAB 5FT5A 3AZID 5B31A 2VMSA 2Z20A 1P34B 3F6TA 3F0HA 4R5ZA 5GXQB 1KMJA 5B24B 1EQBA 3BCBA 3RCHA 3HT4A 4WU9C 5AV8D 2Y2QA 1C7OA 1ID3D 5GSUC 1AX4A 1P3ID 3DXWA 1MLYA 5EAAA 3LJAC 1P3KA 1W7NA 1IVRA 3FFRA 3GSBA 3REJA 4WYCA 3TCMA 3WA9A 3EIBA 3X1VA 3ZZKA 2CV5D 3ELPA 3C1CA 3KWQD 3LV2A 4J8WB 5AY8A 2F8NK 2ZY5A 1TAFB 1J04A 4YS3A 5EIGA 3N0LA 1S06A 1U35A 4BMKA 2QBTA 2W7IA 2AEUA 3AZGC 3AFAC 2CJGA 5BO0B 5B0YA 3KXBD 4XEWA 1BJOB 3LZ0C 1P3FC 4TMRA 5FT4A 4DBCA 4YM6A 3L44A 3MADA 3X1UC 3W1JA 2W8TA 2NZDC 4H9QB 3MVDD 3MBBA 1KX4A 1GCKA 3C1BB 4NOGA 1B8GA 4XJLA 5GSUB 5BNXA 1X28A 2EO5A 3N4XA 1AKCA 2A1VA 2VGZA 2EGYA 4Q75A 4AO9A 1WKGA 1XEYA 5AV5D 1GC4A 4JEVA 3VH6W 2CJDA 2JJFA 4E77A 4Z5TC 2QB3A 2BYMB 5B33B 4ZUXC 3AV2C 1DJ9A 3AYWA 3MGPA 4XK1A 5B1LD 3AZIA 2F8JA 4JJNB 4H9NB 2GSAA 5CPJA 3B6FA 1M18D 3AEPA 3B8XA 5AV8A 5B40B 5B1MB 4CBRA 4A6UA 4W91A 3NTJA 1ZLAD 1ID3A 4WLJA 3QGUA 5B0ZB 3ZRPA 3B1CA 3PJ0A 3R45B 5AVBC 2EZ2A 4KYOA 4WU8B 4BHDA 3WX9A 1P3PB 4F5MA 2YFVB 3BN1A 3AZFC 2HOXA 5JRGD 3NQJA 2ORDA 4IX8A 3FTBA 1UU0A 2CV5A 1EQZD 3KWQA 4G92C 5GT3B 3HL2A 3ISLA 2Y2IA 1KL1A 2AY4A 1AHXA 3AEMC 2QB2A 1P34D 4W5KA 5BNVB 5B24D 3BCXA 4DRAA 4MSOA 4AWLC 5EUEA 3AOVA 1KL2A 3REKC 1N2TA 3FZ8A 2EH6A 1ELUA 3P1TA 3KGXA 4M2KA 4LW4A 3E2ZB 1SPAA 3WKSA 5GT0D 1YJYA 3MVDA 2F8NB 1P3MC 4ISYA 2VMRA 3H0LC 2CJHA 4Q76A 1EG5A 3K40A 1GDEA 1DKAA 2DOUA 3X1TC 4GDYA 2RVQD 5AV5A 5G2QA 3KSYA 4J8WD 2FNIA 2VIAA 3NUIA 5B1LA 5DB5A 4WZSB 2DR1A 4A0RA 1LW5A 2O1BA 5CPIB 1M18A 1P3AB 3COGA 2GQNA 2X8UA 1ZLAA 3AL0C 4EO5C 1JG8A 4J8LA 3FVXA 5CP6C 5C3IC 1S09A 4WU9D 1W7LA 1ORDA 2ZY3A 2D5YA 2D66A 3C1BD 3AZLC 5GSUD 4Z2MH 3CQ4A 5JRGA 4ZAHA 4UUZB 5D95A 2JG2A 3W1IA 1FC4A 1EQZA 3PA9A 4K2MA 5AVCC 1ELQA 5B33D 1BH8B 1KX5B 3MGSB 2CH2A 2OGEA 4CBSA 5CPKA 1KU5A 2D7YA 1W7MA 4XZQB 1D7UA 8AATA 2VGUA 1P34A 4EB5A 1XI9A 1A7WA 3W97B 5GXQA 3TU4C 4HGAC 3GWPA 5B24A 1CJ0A 4EB7A 5DNNC 1KKPA 2R0TA 4WXGA 5B1MD 3NX3A 4KUDC 3AZGD 5B0ZD 1LS3A 1AAWA 3AFAD 1I43A 3UE8A 4ADEA 1QIRA 4F5HA 4WU8D 2JSSA 4KGCC 3CQ6A 3LZ0D 4H9RB 3REIC 1P3FD 3REHC 5CP6B 5C3IB 1UU2A 4WYDA 3LVJA 4J8VC 4TN4A 5GT3D 1H0CA 1D7RA 2ZYJA 2WKAA 3PD6B 3AZLB 5AY8B 4J8WA 1S32C 1TAFA 3MGQC 4AZKA 1HTAA 1PG8A 1IBJA 4Z5TD 3AV2D 2VI8A 4GEBA 1SZUA 5BO0A 1LC8A 4XUJB 2PB0A 2HUEC 2FKIA 2AY2A 5B32B 3AZMC 4E3RA 5AV6C 4YM6B 1J32A 1I41A 3W99C 3E77A 3VH5W 1ASMA 4H9QA 1GEXA 1KX4B 1BJ4A 3DC1A 3C1BA 2AROB 5GSUA 1B9IA 5AVBD 3NYTA 2WK7A 3K7YA 3Q8NA 2DQNC 7AATA 2YHKA 4JF1A 2BYMA 5B33A 1ASEA 3AZFD 4W1VA 3AYWB 2FJ7C 4JEYA 3MGPB 3AZKB 3ZRRA 3AZIB 2BWPA 4J8UC 1DTYA 2JGTA 3AZEC 3CAIA 4RITA 3DR7A 3AZJC 3GBXA 5F99C 1DJEA 4H9NA 2JISA 1WWSA 4A6RA 2YKUA 5AV8B 3E6GA 1P3AD 1DGEA 1WYVA 3LVKA 4KAMA 5AV9C 3GETA 5B1MA 1G4VA 5M4DA 4IXZA 3AZGA 5B0ZA 3AFAA 3TQXA 1P3IB 3R45A 2NMPA 3TFUA 3REKD 4WU8A 2ZM5A 4GRXA 5G09A 3LZ0A 2YFVA 3A6NC 3FQ8A 2HORA 2CV5B 3P5JB 4AO4A 4ADBA 1TPLA 5GT3A 3ASAA 3MGSD 4WLHA 3KUYB 4DQ6A 1B67A 1I48A 3ASBA 4XZQD 3X1TD 4G91B 3GR9A 4Z5TA 1TATA 3AEJA 2W7FA 1EJIA 2O0RA 1QISA 1I29A 3KXBB 5BNVA 4R8PC 4QLCC 4J8UB 1BW0A 3WTPC 3II0A 3X1SB 1U08A 2VGWA 3E2ZA 2R5EA 2AATA 3EI9A 2GB3A 5M4BA 2F8NA 4Y0DA 1H3OA 2CH1A 4NE5A 4WYFA 3B1EA 3NUBA 5CP6D 1X0MA 4ZBJB 4RJYA 3FCRA 4GE7A 2HP1A 3AZLD 4LNMA 5B2IC 3MKJA 3ZRQA 4U1TA 1JS3A 2CWEA 5B1LB 3RBLA 3H9XA 5E5IA 5AVCD 2BYLA 3RI6A 4WD2A 1BT4A 1M18B 5CPIA 2BI5A 4XUJD 1P3AA 3BC8A 1AMAA 2AY7A 1ZLAB 3HVYA 4N0WA 1KX3C 5B32D 5D5SA 3TU4D 4MKKA 4NE3A 1M19B 3LELC 4QLCB 2VLHA 3FRKA 2YKVA 3REKA 2Z1ZA 2YCNA 3ECDA 1B5OA 4KUDD 2ZC0A 4M2MA 4B98A 1ASBA 1BQDA 3BWOA 2AROD 2BYKB 3R4TA 4WJ3C 4RJ0A 4UUZA 3O62C 1EQZB 1M32A 4LD9C 2D63A 3AZHC 1BH8A 4Z2MG 3MGSA 3AZKD 4WBTA 2Y2OA 4XZQA 3X1TA 1B4XA 4OCAA 4CSRB 3RELB 1QGNA 4K05A 2FN6A 3W97A 4J5UA 1S32D 5FUGB 3EPKA 2BYJA 5EAVA 2AEVA 3KKIA 3MGQD 4WNNB 2AY3A 3QBOA 2VQRA 2YKYA 3E9KA 1GC0A 2DKBA 3NYUA 3UT9C 3H7FA 2Y2LA 1C7NA 3W96B 5GT0B 3G8MA 5B31G 3PPLA 2TPLA 4J8XB 3RBFA 4HF8A 3N5MA 2F2AC 3MEBA 4H9RA 3AZMD 1B5PA 5EFSA 5CP6A 3LELB 3W99D 5JAYA 2GMSA 4K2IA 3EI7A 2BI1A 2W7JA 1TOIA 4X23B 3PD6A 3AV1C 3AZLA 2VGVA 5EUNA 3KUYD 4WB0B 2Z1YA 1TASA 3O62B 2AY8A 2YFWB 2KFPA 3GJUA 2CTZA 1P3GB 1HQ3C 1Q9CA 1ECXA 3MAFB 2VMZA 2HIOC 2C44A 4XUJA 3MC6C 4J8UD 5JA4B 3X1SD 2X5FA 5B32A 4GE9A 4F5JA 3TU4A 3N75A 4ZASA 3EPHA 3HMUA 4WU9B 3WY7A 1Z2CB 2JJGA 4IYOA 4CAYB 4KUDA 2PO3A 2AROA 2G5HC 1M0OA 3LZ1C 4GE4A 3EUCA 3KE3A 3LJAB 2R2NA 1SZKA 1AHGA 4H51A 2FYFA 3A6ND 2QSRA 3AN2C 3AZKA 2V1PA 3E2FA 1QJ3A 1V2EA 2VMQA 3VOMA 1GC2A 1S32A 2CINA 2AY9A 3G0TA 1BJWA 2PYOC 4ZWVA 4ZDPA 3B0CW 1C4KA 3MGQA 1WYVB 3UWCA 3H0RC 1GD9A 4FL0A 3QM2A 3JTXA 5BT1C 4OMAA 3AZGB 4RLGA 3QPGA 3AFAB 3A2BA 1ASNA 1UU1A 4HVKA 1M19D 1P3IA 3D6KA 1F66C 4QLCD 2CY8A 3AZNC 4OC9A 2BWNA 3LZ0B 1JS6A 1ZODA 1P3FB 1M6SA 4A72A 5C6UA 3FSLA 1W3UA 3X1UB 2BHXA 3W99A 2NZDB 4ITXA 3B0DC 5DNMC 3TATA 1P3BC 3H0MC 4W1WA 2CFBA 3KUYA 1MAPA 3DU4A 5BJ4A 3E2YA 2QMAA 3FQ7A 3RELD 2W8WA 4Z5TB 1G4XA 3AV2B 4ZUXB 1AMQA 2CANA 5B2ID 3KXBA 4XAUA 4J8UA 3X1SA 3F9TA 3A9XA 4QGRA 2QLRA 4WYEA 5M46A 3W96D 2VGTA 2OATA 3B46A 4JEWA 1V2FA 3LWSA 4Q6RA 2YRRA 1H3OB 3W98C 1LK9A 4J8XD 3A9YA 5AVBB 1JFIA 3LELD 3PDBB 3PGYA 3AATA 3VK3A 3UTBC 5F8VA 4X23D 2F8NH 3AZFB 3PIUA 3WAAC 2D61A 1UKJA 1M0PA 2ZP7A 3O62D 3PDXA 4G92B 1P3GD 2JCHA 1TZYC 5B31C 2JJEA 1AOIC 4R5FA 4A0HA 3VP6A 2BIAA 4UHMA 1Z3ZA 3L8AA 3FKDA 1M19A 4AWLB 2E7UA 4QLCA 4XJMA 3REKB 2W7LA 4IW7A 2BI3A 3UT9D 4A0GA 5G4IA 3I4JA 2BYKA 2VGSA 1P3KC 3ATHA 5DX5A 2Z9WA 3REJC 1AJSA 2BG1A 2FFFB 2G5IC 3LJAD 1O69A 1P3MB 3HBXA 3X1VC 1DGDA 1SF2A 2W8UA 2HOZA 4ZM4A 3BS8A 2ZSMA 3ACZA 1YJZA 3X1TB 4PFNA 4LW2A 4CSRA 3RELA 4F5FA 4YS3C 5HXXA 5E5AC 1S07A 3AV1D 5FUGA 1ASGA 5B2IA 4IY7A 4Y0HA 4WNNA 5B0YC 1HQ3D 4UOYA 3MGRC 3W96A 5GT0A 2AY5A 1ARSA 2JE5A 1KAFA 1WYUA 4F5KA 4J8XA 3NYSA 2IO5C 4EO5B 1M1AC 2OKKA 3AELA 3EPLA 3X1UD 1AICA 1DJUA 3JWAA 4LNLA 3LELA 2G7JA 2NZDD 2VMYA 2XD1A 3MNNC 4X23A 4OBUA 1RVUA 3LZ1D 2Z9VA 5G2PA 2W7HA 4WB0A 2W7KA 3O62A 2YFWA 5AVCB 2DF4C 1P3GA 4ZUXD 1TARA 3MAFA 3AN2D 2VMPA 2C81A 5CPJC 3N4SA 1WWIA 5JA4A 3B6FC 3VAXA 3TU4B 4HGAB 4RAEA 5DNNB 4H9SC 1OXPA 3CQ5A 4WU9A 4JF0A 1AJRA 4IYOB 1P3LC 4KUDB 4CAYA 5BT1D 3UT9A 2W8VA 1MDOA 3MGRB 1P3OC 1S08A 3AENB 3DXVA 2D65A 5EUDA 1F66D 4ADCA 1AHFA 3NNKA 4KGCB 1FG3A 3LJAA 3JW9A 4DGTA 3REIB 3REHB 3KWQC 4E45A 3BCAA 4ZWMA 4J8VB 4M2JA 1S32B 1AY4A 2WB6A 2CB1A 2E54A 4IXOA 5BS7C 3MGQB 1Z7DA 1CQ6A 4RKCA 2O7CA 3JZLA 3WKJC 1HQ3A 1SZSA 2D64A 4KXKA 2DKJA 1ARIA 3N4RA 1CL2A 4DRBA 5B2JC 4JEXA 2W7EA 2HUEB 1BQAA 3WZFA 5EQCA 5G4JA 2OKJA 3AZMB 1P3FA 4ZSYA 5AV6B 3MVDC 5DJ1A 3FFHA 3X1UA 3A1KA 3W99B 4F5GA 1AHEA 2NZDA 4B9BA 4LC3A 1YAAA 1P3LB 1P3MD 1OHWA 3LZ1A 4WYAA 3V9RB 4ZLVA 1YIZA 1G7WA 3B6GC 3AV2A 4ZUXA 3ELEA 2FJ7B 3AN2A 1B6WA 3AZEB 3AZJB 4Z66C 5F99B 1D7SA 1TZYD 5B31D 4EU1A 3AEOA 1JF9A 1AOID 4R2NA 1IJIA 1ZC9A 2Y2GA 1ASAA 5IWQA 1BS0A 5AV9B 3QN6A 1GEYA 2EZ1A 3WCNA 5DJ9A 2BWOA 3IHJA 4ZM3A 3QI6A 5B2JB 1JFIB 2W8JA 5AVBA 1TOJA 3FD0A 1F66A 3PDBA 4UHOA 5JRGC 3AOWA 4OBVA 1AKBA 3AZFA 2NQBC 2R5CB 3A6NB 2VLFA 2C7TA 1N8PA 3WCOA 1F1EA 5CPKC 2F8NG 3UTAC 2XBNA 3FDDA 3X1VD 2V0YA 1P34C 1TOKA 2L5AA 3AEMA 2FM1A 4WYGA 5GXQC 3I16A 3B6GB 4YS3D 5E5AD 4MQPA 4XQ2A 4R8PB 5DNND 3AV7A 3WTPB 2XH1A 4H9PB 3I5TA 4XJOA 1TOGA 3EIAA 3MGRD 1SVVA 2W7MA 3DRDA 1AJSB 4KGCD 5E3KA 2VYCA 3P6KA 3REID 1P3MA 1M1AD 3REHD 2VMOA 5M49A 1BKGA 3FDBA 4J8WC 4BA5A 2BI9A 4J8VD 4XJPA 3MNND 5B2IB 5CHLB 3EPJA 2PB2A 2Y2MA 4P7YA 4UQVA 3T32A 1TZYA 2Y2HA 1AOIA 4ATQA 1WKHA 5CPJD 1WYUB 3WLXA 3B6FD 3FVSA 1BH9B 1KX3B 1M0NA 5AV6D 1M0QA 2YKXA 1PZRA 1VJOA 2BIEA 3C1BC 4PVFA 2BIGA 1P3LD 3OKSA 1BFMA 1P3OD 1N31A 5B33C 3LVMA 4LD9B 5AVCA 4P3MA 2HOYA 5E4ZA 3AZHB 4K2BA 4F5LA 2FJ7D 3A9ZA 3GZDC 1ASDA 3LVLB 1N1JB 4JJNC 3AZED 1BJNA 3AZJD 5F99D 1IAYA 5E5AA 3QHXA 5B40C 5B1MC 5DNNA 3A1IA 3NU8A 4H9OA 4LNJA 5B0ZC 5AV9D 4BA4A 1ULYA 3WKJD 4CXQA 4OTLA 3UT9B 3R9AA 4A0FA 4WU8C 1CL1A 3MGRA 1PFFA 5B2JD 3AENA 1P3PC 2BKWA 3DODA 1B9HA 4KGCA 1OXOA 4R8DA 4Q31A 3REIA 2HUUA 5B32G 1M1AA 3REHA 4A00A 2Z61A 5GT3C 1IUGA 4WP0A 4J8VA 1MDZA 4MKJA 2HUFA 3MNNA 3AV1B 2W7DA 5F9SA 2HUIA 1DFOA 3AEJC 2VMUA 3BWNC 1OHVA 1R4VA 1HQ3B 3B6GD 3VH6A 2RFVA 4R8PD 2HIOB 1KKJA 3WTPD 1M4NA 4Z66D 3AZMA 1RV3A 5AV6A 1ASFA 4H9SA 3WGBA 2OQXA 4RKDA 1P3LA 1G7XA 4KHAB 3NRAA 3RQ1A 4ITGA 1P3OA 3LZ1B 3V9RA 4ZDLA 1SFFA 2HP2A 4OT8A 2NQBD 2FJ7A 1YOOA 1CQ8A 2X5DA 3AN2B 2AY1A 4ZSWA 3AZEA 3ZZJA 3VH6T 5CPKD 3AZJA 5CPIC 1W23A 3UTAD 5F99A 1ZOBA 1P3AC 1AMRA 2VMTA 3JWBA 2PYOB 1Y4IA 5BS7A 5GXQD 2YOBA 4AZJA 5AV9A 3WKJA 1KX3D 2VMNA 3VK2A 1IAXA 5I92A 2W8SA 3B0BA 5B2JA 3B0CT 1F66B 3AZNB 3TFTA 5FT6A 4ATPA 1AMSA 4PIWA 4EMYA 2G6WA 4W1XA 2R5CA 3A6NA 1PMOA 1YIYA 1ASLA 3B0DB 1KX5C 4JEZA 4LD9D 3MGSC 5DNMB 1T3UA 2Q7WA 1P3BB 3AZHD 4OYTA 4L0OA 4XZQC 1QZ9A 2VMVA 3W97C 1IX7A 3FQAA 3B6GA 3WGCA 2HZPA 2VIBA 4R8PA 2ZY4A 4F5IA 3WTPA 1AHYA 3KFUG 3HQTA 1RVYA 4H9PA 4Z66A 3NQUB 1V2DA 2YCTA 1MGVA 3HLMA 4MQQA 1QITA 2ZJGA 3WA9C 3W98B 1C9CA 2ZSLA 4BQ0A 5G49A 3BV0A 1ARGA 1P3WA 2Y2JA 3C1CC 1WYTB 3CBFA 3M5UA 4EFFA 2W7GA 5AY8C 1D2FA 3UTBB 4Y0IA 2D7ZA 1U35C 2NQBA 3WAAB 5KDMA 1ARHA 5J8QA 3USFA 1CZCA 3EI5A 3UTAA 4A6TA 1TZYB 5B31B 4XUJC 1AOIB 1OHYA 3G7QA 3EG5B 4ADDA 2RIQA 4JJND 2EYQA 2HIOD 5B32C 4E3QA 4YM6C 1LKCA 3RCHB 1FG7A 1H1CA 3FZ6A 2Z9UA 1BH9A 3PAAA 1KX3A 1ASCA 3A8UX 3NU7A 1KX4C 5B40D 4UHNA 1CS1A 3IP4C 4U2HA 4FFCA 3VK4A 2AROC 4AH3A 2FQ6A 4GSAA 1P3KB 1P3PD 3NDNA 4WXBA 3REJB 3DYDA 3AYWC 3WA9B 4LD9A 3MGPC 4H63Q 3AZKC 3X1VB 3AZIC 3AZHA 1IX6A 2VMWA 1MAQA 3C1CB 4RM1A 1N1JA 1PMMA 3BB8A 2VMXA 3MAUA 2Z9XA 5EIGB 4YS3B 1GBNA 3DZZA 5E5AB 5AV8C 1OATA 3WTPE 1U35B 2Y2PA 2LY8A 2DGLA 2PYOD 1ID3C 4H9OB 4F4EA 3EI6A 5B0YB 2Y2NA 1P3IC 4NE6A 4WXFA 1AAMA 5AX8A 2XD5A 1BJOA 1RV4A 3AZND 2ZUKA 2IO5B 9AATA 1M1AB 2CV5C 1WSTA 2F8ND 1C0NA
chains in the Genus database with same CATH topology
5BNXB 3VH5A 3LY1A 4PFFA 5DNMD 3RUYA 3KUYC 3MNNB 1P3BD 3AV1A 1MLZA 4G91C 1YNUA 1M7YA 3KXBC 1O61A 2OGAA 2Y2KA 3GZDA 3X1SC 4JJNA 5CPJB 2HIOA 4MQRA 3MC6A 3B6FB 3FZ7A 2WK8A 1LC5A 1GC3A 5CPID 4CXRA 3EZ1A 5B40A 1ID3B 3KGWA 3W1HA 1QJ5A 4RIZA 2JJHA 1VP4A 1X29A 3W98D 4ZBJC 4KHAA 1YJSA 1P3OB 2VI9A 5AV5C 1E5EA 3VH5T 1P3PA 1S0AA 3UTBD 3NQJB 1V72A 3GZCA 5K8BA 1AIBA 3EI8A 4O6ZA 4CVQA 5B1LC 5FT8A 4E1OA 3WAAD 3KWQB 1KMKA 2UWXA 1O4SA 2DGMA 1KX5D 1E5FA 2QA3A 1M18C 3K28A 1CQ7A 2PYOA 1AIAA 2CSTA 4UPKA 1ZLAC 5HDMA 3OP7A 3W97D 3BWNA 3WKJB 5G0AA 2AY6A 2DGKA 3DR4A 1M19C 3EZSA 4M6BA 3UAKA 4WV4B 2C0RA 1AY5A 2WK9A 4W8IA 3AZNA 2E7IA 1VEFA 2X3LA 3MVDB 1EQZC 1P3KD 5TF5A 3REJD 2FNUA 1X2AA 3WA9D 5DNMA 3FVUA 4AOAA 1P3BA 1T3IA 1IX8A 1MDXA 1CZEA 5AV5B 3C1CD 3RELC 1ARTA 1GEWA 4I8AA 4ZDOA 2ZY2A 4IXSA 5AY8D 2YCPA 5B24C 2E7JA 1D7VA 1W2EA 3WKRA 1U35D 2GMUA 1O62A 1LW4A 1AY8A 2J8PA 3HDOA 1AKAA 4Z66B 5B0YD 1LC7A 3W96C 5GT0C 3NQUA 2BI2A 2EPJA 4J8XC 3N7NA 4YM6D 3W98A 5G49B 3B1DA 5HHYA 5BJ3A 1C7GA 2RVQC 1KX4D 1WYTA 3LG0A 4X23C 4E44A 5JRGB 3UTBA 5KTBA 4NFTA 1TOEA 2NQBB 2YRIA 3WAAA 1P3GC 5KDMB 4DQYB 4MY5A 3AYWD 5CPKB 1KX5A 3MGPD 3UTAB 5FT5A 3AZID 5B31A 2VMSA 2Z20A 1P34B 3F6TA 3F0HA 4R5ZA 5GXQB 1KMJA 5B24B 1EQBA 3BCBA 3RCHA 3HT4A 4WU9C 5AV8D 2Y2QA 1C7OA 1ID3D 5GSUC 1AX4A 1P3ID 3DXWA 1MLYA 5EAAA 3LJAC 1P3KA 1W7NA 1IVRA 3FFRA 3GSBA 3REJA 4WYCA 3TCMA 3WA9A 3EIBA 3X1VA 3ZZKA 2CV5D 3ELPA 3C1CA 3KWQD 3LV2A 4J8WB 5AY8A 2F8NK 2ZY5A 1TAFB 1J04A 4YS3A 5EIGA 3N0LA 1S06A 1U35A 4BMKA 2QBTA 2W7IA 2AEUA 3AZGC 3AFAC 2CJGA 5BO0B 5B0YA 3KXBD 4XEWA 1BJOB 3LZ0C 1P3FC 4TMRA 5FT4A 4DBCA 4YM6A 3L44A 3MADA 3X1UC 3W1JA 2W8TA 2NZDC 4H9QB 3MVDD 3MBBA 1KX4A 1GCKA 3C1BB 4NOGA 1B8GA 4XJLA 5GSUB 5BNXA 1X28A 2EO5A 3N4XA 1AKCA 2A1VA 2VGZA 2EGYA 4Q75A 4AO9A 1WKGA 1XEYA 5AV5D 1GC4A 4JEVA 3VH6W 2CJDA 2JJFA 4E77A 4Z5TC 2QB3A 2BYMB 5B33B 4ZUXC 3AV2C 1DJ9A 3AYWA 3MGPA 4XK1A 5B1LD 3AZIA 2F8JA 4JJNB 4H9NB 2GSAA 5CPJA 3B6FA 1M18D 3AEPA 3B8XA 5AV8A 5B40B 5B1MB 4CBRA 4A6UA 4W91A 3NTJA 1ZLAD 1ID3A 4WLJA 3QGUA 5B0ZB 3ZRPA 3B1CA 3PJ0A 3R45B 5AVBC 2EZ2A 4KYOA 4WU8B 4BHDA 3WX9A 1P3PB 4F5MA 2YFVB 3BN1A 3AZFC 2HOXA 5JRGD 3NQJA 2ORDA 4IX8A 3FTBA 1UU0A 2CV5A 1EQZD 3KWQA 4G92C 5GT3B 3HL2A 3ISLA 2Y2IA 1KL1A 2AY4A 1AHXA 3AEMC 2QB2A 1P34D 4W5KA 5BNVB 5B24D 3BCXA 4DRAA 4MSOA 4AWLC 5EUEA 3AOVA 1KL2A 3REKC 1N2TA 3FZ8A 2EH6A 1ELUA 3P1TA 3KGXA 4M2KA 4LW4A 3E2ZB 1SPAA 3WKSA 5GT0D 1YJYA 3MVDA 2F8NB 1P3MC 4ISYA 2VMRA 3H0LC 2CJHA 4Q76A 1EG5A 3K40A 1GDEA 1DKAA 2DOUA 3X1TC 4GDYA 2RVQD 5AV5A 5G2QA 3KSYA 4J8WD 2FNIA 2VIAA 3NUIA 5B1LA 5DB5A 4WZSB 2DR1A 4A0RA 1LW5A 2O1BA 5CPIB 1M18A 1P3AB 3COGA 2GQNA 2X8UA 1ZLAA 3AL0C 4EO5C 1JG8A 4J8LA 3FVXA 5CP6C 5C3IC 1S09A 4WU9D 1W7LA 1ORDA 2ZY3A 2D5YA 2D66A 3C1BD 3AZLC 5GSUD 4Z2MH 3CQ4A 5JRGA 4ZAHA 4UUZB 5D95A 2JG2A 3W1IA 1FC4A 1EQZA 3PA9A 4K2MA 5AVCC 1ELQA 5B33D 1BH8B 1KX5B 3MGSB 2CH2A 2OGEA 4CBSA 5CPKA 1KU5A 2D7YA 1W7MA 4XZQB 1D7UA 8AATA 2VGUA 1P34A 4EB5A 1XI9A 1A7WA 3W97B 5GXQA 3TU4C 4HGAC 3GWPA 5B24A 1CJ0A 4EB7A 5DNNC 1KKPA 2R0TA 4WXGA 5B1MD 3NX3A 4KUDC 3AZGD 5B0ZD 1LS3A 1AAWA 3AFAD 1I43A 3UE8A 4ADEA 1QIRA 4F5HA 4WU8D 2JSSA 4KGCC 3CQ6A 3LZ0D 4H9RB 3REIC 1P3FD 3REHC 5CP6B 5C3IB 1UU2A 4WYDA 3LVJA 4J8VC 4TN4A 5GT3D 1H0CA 1D7RA 2ZYJA 2WKAA 3PD6B 3AZLB 5AY8B 4J8WA 1S32C 1TAFA 3MGQC 4AZKA 1HTAA 1PG8A 1IBJA 4Z5TD 3AV2D 2VI8A 4GEBA 1SZUA 5BO0A 1LC8A 4XUJB 2PB0A 2HUEC 2FKIA 2AY2A 5B32B 3AZMC 4E3RA 5AV6C 4YM6B 1J32A 1I41A 3W99C 3E77A 3VH5W 1ASMA 4H9QA 1GEXA 1KX4B 1BJ4A 3DC1A 3C1BA 2AROB 5GSUA 1B9IA 5AVBD 3NYTA 2WK7A 3K7YA 3Q8NA 2DQNC 7AATA 2YHKA 4JF1A 2BYMA 5B33A 1ASEA 3AZFD 4W1VA 3AYWB 2FJ7C 4JEYA 3MGPB 3AZKB 3ZRRA 3AZIB 2BWPA 4J8UC 1DTYA 2JGTA 3AZEC 3CAIA 4RITA 3DR7A 3AZJC 3GBXA 5F99C 1DJEA 4H9NA 2JISA 1WWSA 4A6RA 2YKUA 5AV8B 3E6GA 1P3AD 1DGEA 1WYVA 3LVKA 4KAMA 5AV9C 3GETA 5B1MA 1G4VA 5M4DA 4IXZA 3AZGA 5B0ZA 3AFAA 3TQXA 1P3IB 3R45A 2NMPA 3TFUA 3REKD 4WU8A 2ZM5A 4GRXA 5G09A 3LZ0A 2YFVA 3A6NC 3FQ8A 2HORA 2CV5B 3P5JB 4AO4A 4ADBA 1TPLA 5GT3A 3ASAA 3MGSD 4WLHA 3KUYB 4DQ6A 1B67A 1I48A 3ASBA 4XZQD 3X1TD 4G91B 3GR9A 4Z5TA 1TATA 3AEJA 2W7FA 1EJIA 2O0RA 1QISA 1I29A 3KXBB 5BNVA 4R8PC 4QLCC 4J8UB 1BW0A 3WTPC 3II0A 3X1SB 1U08A 2VGWA 3E2ZA 2R5EA 2AATA 3EI9A 2GB3A 5M4BA 2F8NA 4Y0DA 1H3OA 2CH1A 4NE5A 4WYFA 3B1EA 3NUBA 5CP6D 1X0MA 4ZBJB 4RJYA 3FCRA 4GE7A 2HP1A 3AZLD 4LNMA 5B2IC 3MKJA 3ZRQA 4U1TA 1JS3A 2CWEA 5B1LB 3RBLA 3H9XA 5E5IA 5AVCD 2BYLA 3RI6A 4WD2A 1BT4A 1M18B 5CPIA 2BI5A 4XUJD 1P3AA 3BC8A 1AMAA 2AY7A 1ZLAB 3HVYA 4N0WA 1KX3C 5B32D 5D5SA 3TU4D 4MKKA 4NE3A 1M19B 3LELC 4QLCB 2VLHA 3FRKA 2YKVA 3REKA 2Z1ZA 2YCNA 3ECDA 1B5OA 4KUDD 2ZC0A 4M2MA 4B98A 1ASBA 1BQDA 3BWOA 2AROD 2BYKB 3R4TA 4WJ3C 4RJ0A 4UUZA 3O62C 1EQZB 1M32A 4LD9C 2D63A 3AZHC 1BH8A 4Z2MG 3MGSA 3AZKD 4WBTA 2Y2OA 4XZQA 3X1TA 1B4XA 4OCAA 4CSRB 3RELB 1QGNA 4K05A 2FN6A 3W97A 4J5UA 1S32D 5FUGB 3EPKA 2BYJA 5EAVA 2AEVA 3KKIA 3MGQD 4WNNB 2AY3A 3QBOA 2VQRA 2YKYA 3E9KA 1GC0A 2DKBA 3NYUA 3UT9C 3H7FA 2Y2LA 1C7NA 3W96B 5GT0B 3G8MA 5B31G 3PPLA 2TPLA 4J8XB 3RBFA 4HF8A 3N5MA 2F2AC 3MEBA 4H9RA 3AZMD 1B5PA 5EFSA 5CP6A 3LELB 3W99D 5JAYA 2GMSA 4K2IA 3EI7A 2BI1A 2W7JA 1TOIA 4X23B 3PD6A 3AV1C 3AZLA 2VGVA 5EUNA 3KUYD 4WB0B 2Z1YA 1TASA 3O62B 2AY8A 2YFWB 2KFPA 3GJUA 2CTZA 1P3GB 1HQ3C 1Q9CA 1ECXA 3MAFB 2VMZA 2HIOC 2C44A 4XUJA 3MC6C 4J8UD 5JA4B 3X1SD 2X5FA 5B32A 4GE9A 4F5JA 3TU4A 3N75A 4ZASA 3EPHA 3HMUA 4WU9B 3WY7A 1Z2CB 2JJGA 4IYOA 4CAYB 4KUDA 2PO3A 2AROA 2G5HC 1M0OA 3LZ1C 4GE4A 3EUCA 3KE3A 3LJAB 2R2NA 1SZKA 1AHGA 4H51A 2FYFA 3A6ND 2QSRA 3AN2C 3AZKA 2V1PA 3E2FA 1QJ3A 1V2EA 2VMQA 3VOMA 1GC2A 1S32A 2CINA 2AY9A 3G0TA 1BJWA 2PYOC 4ZWVA 4ZDPA 3B0CW 1C4KA 3MGQA 1WYVB 3UWCA 3H0RC 1GD9A 4FL0A 3QM2A 3JTXA 5BT1C 4OMAA 3AZGB 4RLGA 3QPGA 3AFAB 3A2BA 1ASNA 1UU1A 4HVKA 1M19D 1P3IA 3D6KA 1F66C 4QLCD 2CY8A 3AZNC 4OC9A 2BWNA 3LZ0B 1JS6A 1ZODA 1P3FB 1M6SA 4A72A 5C6UA 3FSLA 1W3UA 3X1UB 2BHXA 3W99A 2NZDB 4ITXA 3B0DC 5DNMC 3TATA 1P3BC 3H0MC 4W1WA 2CFBA 3KUYA 1MAPA 3DU4A 5BJ4A 3E2YA 2QMAA 3FQ7A 3RELD 2W8WA 4Z5TB 1G4XA 3AV2B 4ZUXB 1AMQA 2CANA 5B2ID 3KXBA 4XAUA 4J8UA 3X1SA 3F9TA 3A9XA 4QGRA 2QLRA 4WYEA 5M46A 3W96D 2VGTA 2OATA 3B46A 4JEWA 1V2FA 3LWSA 4Q6RA 2YRRA 1H3OB 3W98C 1LK9A 4J8XD 3A9YA 5AVBB 1JFIA 3LELD 3PDBB 3PGYA 3AATA 3VK3A 3UTBC 5F8VA 4X23D 2F8NH 3AZFB 3PIUA 3WAAC 2D61A 1UKJA 1M0PA 2ZP7A 3O62D 3PDXA 4G92B 1P3GD 2JCHA 1TZYC 5B31C 2JJEA 1AOIC 4R5FA 4A0HA 3VP6A 2BIAA 4UHMA 1Z3ZA 3L8AA 3FKDA 1M19A 4AWLB 2E7UA 4QLCA 4XJMA 3REKB 2W7LA 4IW7A 2BI3A 3UT9D 4A0GA 5G4IA 3I4JA 2BYKA 2VGSA 1P3KC 3ATHA 5DX5A 2Z9WA 3REJC 1AJSA 2BG1A 2FFFB 2G5IC 3LJAD 1O69A 1P3MB 3HBXA 3X1VC 1DGDA 1SF2A 2W8UA 2HOZA 4ZM4A 3BS8A 2ZSMA 3ACZA 1YJZA 3X1TB 4PFNA 4LW2A 4CSRA 3RELA 4F5FA 4YS3C 5HXXA 5E5AC 1S07A 3AV1D 5FUGA 1ASGA 5B2IA 4IY7A 4Y0HA 4WNNA 5B0YC 1HQ3D 4UOYA 3MGRC 3W96A 5GT0A 2AY5A 1ARSA 2JE5A 1WYUA 4F5KA 4J8XA 3NYSA 2IO5C 4EO5B 1M1AC 2OKKA 3AELA 3EPLA 3X1UD 1AICA 1DJUA 3JWAA 4LNLA 3LELA 2G7JA 2NZDD 2VMYA 2XD1A 3MNNC 4X23A 4OBUA 1RVUA 3LZ1D 2Z9VA 5G2PA 2W7HA 4WB0A 2W7KA 3O62A 2YFWA 5AVCB 2DF4C 1P3GA 4ZUXD 1TARA 3MAFA 3AN2D 2VMPA 2C81A 5CPJC 3N4SA 1WWIA 5JA4A 3B6FC 3VAXA 3TU4B 4HGAB 4RAEA 5DNNB 4H9SC 1OXPA 3CQ5A 4WU9A 4JF0A 1AJRA 4IYOB 1P3LC 4KUDB 4CAYA 5BT1D 3UT9A 2W8VA 1MDOA 3MGRB 1P3OC 1S08A 3AENB 3DXVA 2D65A 5EUDA 1F66D 4ADCA 1AHFA 3NNKA 4KGCB 1FG3A 3LJAA 3JW9A 4DGTA 3REIB 3REHB 3KWQC 4E45A 3BCAA 4ZWMA 4J8VB 4M2JA 1S32B 1AY4A 2WB6A 2CB1A 2E54A 4IXOA 5BS7C 3MGQB 1Z7DA 1CQ6A 4RKCA 2O7CA 3JZLA 3WKJC 1HQ3A 1SZSA 2D64A 4KXKA 2DKJA 1ARIA 3N4RA 1CL2A 4DRBA 5B2JC 4JEXA 2W7EA 2HUEB 1BQAA 3WZFA 5EQCA 5G4JA 2OKJA 3AZMB 1P3FA 4ZSYA 5AV6B 3MVDC 5DJ1A 3FFHA 3X1UA 3A1KA 3W99B 4F5GA 1AHEA 2NZDA 4B9BA 4LC3A 1YAAA 1P3LB 1P3MD 1OHWA 3LZ1A 4WYAA 3V9RB 4ZLVA 1YIZA 1G7WA 3B6GC 3AV2A 4ZUXA 3ELEA 2FJ7B 3AN2A 1B6WA 3AZEB 3AZJB 4Z66C 5F99B 1D7SA 1TZYD 5B31D 4EU1A 3AEOA 1JF9A 1AOID 4R2NA 1IJIA 1ZC9A 2Y2GA 1ASAA 5IWQA 1BS0A 5AV9B 3QN6A 1GEYA 2EZ1A 3WCNA 5DJ9A 2BWOA 3IHJA 4ZM3A 3QI6A 5B2JB 1JFIB 2W8JA 5AVBA 1TOJA 3FD0A 1F66A 3PDBA 4UHOA 5JRGC 3AOWA 4OBVA 1AKBA 3AZFA 2NQBC 2R5CB 3A6NB 2VLFA 2C7TA 1N8PA 3WCOA 1F1EA 5CPKC 2F8NG 3UTAC 2XBNA 3FDDA 3X1VD 2V0YA 1P34C 1TOKA 2L5AA 3AEMA 2FM1A 4WYGA 5GXQC 3I16A 3B6GB 4YS3D 5E5AD 4MQPA 4XQ2A 4R8PB 5DNND 3AV7A 3WTPB 2XH1A 4H9PB 3I5TA 4XJOA 1TOGA 3EIAA 3MGRD 1SVVA 2W7MA 3DRDA 1AJSB 4KGCD 5E3KA 2VYCA 3P6KA 3REID 1P3MA 1M1AD 3REHD 2VMOA 5M49A 1BKGA 3FDBA 4J8WC 4BA5A 2BI9A 4J8VD 4XJPA 3MNND 5B2IB 5CHLB 3EPJA 2PB2A 2Y2MA 4P7YA 4UQVA 3T32A 1TZYA 2Y2HA 1AOIA 4ATQA 1WKHA 5CPJD 1WYUB 3WLXA 3B6FD 3FVSA 1BH9B 1KX3B 1M0NA 5AV6D 1M0QA 2YKXA 1PZRA 1VJOA 2BIEA 3C1BC 4PVFA 2BIGA 1P3LD 3OKSA 1BFMA 1P3OD 1N31A 5B33C 3LVMA 4LD9B 5AVCA 4P3MA 2HOYA 5E4ZA 3AZHB 4K2BA 4F5LA 2FJ7D 3A9ZA 3GZDC 1ASDA 3LVLB 1N1JB 4JJNC 3AZED 1BJNA 3AZJD 5F99D 1IAYA 5E5AA 3QHXA 5B40C 5B1MC 5DNNA 3A1IA 3NU8A 4H9OA 4LNJA 5B0ZC 5AV9D 4BA4A 1ULYA 3WKJD 4CXQA 4OTLA 3UT9B 3R9AA 4A0FA 4WU8C 1CL1A 3MGRA 1PFFA 5B2JD 3AENA 1P3PC 2BKWA 3DODA 1B9HA 4KGCA 1OXOA 4R8DA 4Q31A 3REIA 2HUUA 5B32G 1M1AA 3REHA 4A00A 2Z61A 5GT3C 1IUGA 4WP0A 4J8VA 1MDZA 4MKJA 2HUFA 3MNNA 3AV1B 2W7DA 5F9SA 2HUIA 1DFOA 3AEJC 2VMUA 3BWNC 1OHVA 1R4VA 1HQ3B 3B6GD 3VH6A 2RFVA 4R8PD 2HIOB 1KKJA 3WTPD 1M4NA 4Z66D 3AZMA 1RV3A 5AV6A 1ASFA 4H9SA 3WGBA 2OQXA 4RKDA 1P3LA 1G7XA 4KHAB 3NRAA 3RQ1A 4ITGA 1P3OA 3LZ1B 3V9RA 4ZDLA 1SFFA 2HP2A 4OT8A 2NQBD 2FJ7A 1YOOA 1CQ8A 2X5DA 3AN2B 2AY1A 4ZSWA 3AZEA 3ZZJA 3VH6T 5CPKD 3AZJA 5CPIC 1W23A 3UTAD 5F99A 1ZOBA 1P3AC 1AMRA 2VMTA 3JWBA 2PYOB 1Y4IA 5BS7A 5GXQD 2YOBA 4AZJA 5AV9A 3WKJA 1KX3D 2VMNA 3VK2A 1IAXA 5I92A 2W8SA 3B0BA 5B2JA 3B0CT 1F66B 3AZNB 3TFTA 5FT6A 4ATPA 1AMSA 4PIWA 4EMYA 2G6WA 4W1XA 2R5CA 3A6NA 1PMOA 1YIYA 1ASLA 3B0DB 1KX5C 4JEZA 4LD9D 3MGSC 5DNMB 1T3UA 2Q7WA 1P3BB 3AZHD 4OYTA 4L0OA 4XZQC 1QZ9A 2VMVA 3W97C 1IX7A 3FQAA 3B6GA 3WGCA 2HZPA 2VIBA 4R8PA 2ZY4A 4F5IA 3WTPA 1AHYA 3KFUG 3HQTA 1RVYA 4H9PA 4Z66A 3NQUB 1V2DA 2YCTA 1MGVA 3HLMA 4MQQA 1QITA 2ZJGA 3WA9C 3W98B 1C9CA 2ZSLA 4BQ0A 5G49A 3BV0A 1ARGA 1P3WA 2Y2JA 3C1CC 1WYTB 3CBFA 3M5UA 4EFFA 2W7GA 5AY8C 1D2FA 3UTBB 4Y0IA 2D7ZA 1U35C 2NQBA 3WAAB 5KDMA 1ARHA 5J8QA 3USFA 1CZCA 3EI5A 3UTAA 4A6TA 1TZYB 5B31B 4XUJC 1AOIB 1OHYA 3G7QA 3EG5B 4ADDA 2RIQA 4JJND 2EYQA 2HIOD 5B32C 4E3QA 4YM6C 1LKCA 3RCHB 1FG7A 1H1CA 3FZ6A 2Z9UA 1BH9A 3PAAA 1KX3A 1ASCA 3A8UX 3NU7A 1KX4C 5B40D 4UHNA 1CS1A 3IP4C 4U2HA 4FFCA 3VK4A 2AROC 4AH3A 2FQ6A 4GSAA 1P3KB 1P3PD 3NDNA 4WXBA 3REJB 3DYDA 3AYWC 3WA9B 4LD9A 3MGPC 4H63Q 3AZKC 3X1VB 3AZIC 3AZHA 1IX6A 2VMWA 1MAQA 3C1CB 4RM1A 1N1JA 1PMMA 3BB8A 2VMXA 3MAUA 2Z9XA 5EIGB 4YS3B 1GBNA 3DZZA 5E5AB 5AV8C 1OATA 3WTPE 1U35B 2Y2PA 2LY8A 2DGLA 2PYOD 1ID3C 4H9OB 4F4EA 3EI6A 5B0YB 2Y2NA 1P3IC 4NE6A 4WXFA 1AAMA 5AX8A 2XD5A 1BJOA 1RV4A 3AZND 2ZUKA 2IO5B 9AATA 1M1AB 2CV5C 1WSTA 2F8ND 1C0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZK A;  4XQ2 A;  1AHG A;  3COG A;  3LY1 A;  4PFF A;  3AV7 A;  3RUY A;  4H51 A;  2FYF A;  2GQN A;  2X8U A;  2XH1 A;  3I5T A;  2V1P A;  1JG8 A;  3E2F A;  1MLZ A;  1QJ3 A;  3FVX A;  4XJO A;  1YNU A;  1S09 A;  1TOG A;  1V2E A;  3EIA A;  1M7Y A;  1SVV A;  2W7M A;  1W7L A;  1ORD A;  2VMQ A;  3DRD A;  1GC2 A;  3VOM A;  2ZY3 A;  1AJS B;  2CIN A;  2AY9 A;  2D5Y A;  2D66 A;  1BJW A;  1O61 A;  2OGA A;  4ZWV A;  4ZDP A;  1C4K A;  1WYV B;  2VYC A;  5E3K A;  3P6K A;  3GZD A;  3UWC A;  1GD9 A;  3CQ4 A;  4FL0 A;  3QM2 A;  4MQR A;  3JTX A;  3MC6 A;  4ZAH A;  2VMO A;  5D95 A;  5M49 A;  1BKG A;  2JG2 A;  2WK8 A;  1LC5 A;  1FC4 A;  1GC3 A;  4OMA A;  3FDB A;  3PA9 A;  3QPG A;  3A2B A;  4K2M A;  1ASN A;  1UU1 A;  4HVK A;  1ELQ A;  4BA5 A;  2BI9 A;  4CXR A;  3EZ1 A;  4XJP A;  3D6K A;  2CH2 A;  2OGE A;  2CY8 A;  4CBS A;  2D7Y A;  4OC9 A;  2BWN A;  3KGW A;  1QJ5 A;  1W7M A;  1JS6 A;  1ZOD A;  1VP4 A;  2JJH A;  1X29 A;  1M6S A;  4A72 A;  5C6U A;  1D7U A;  3FSL A;  8AAT A;  2VGU A;  1W3U A;  4EB5 A;  2PB2 A;  1XI9 A;  1YJS A;  2VI9 A;  2BHX A;  4P7Y A;  4UQV A;  1E5E A;  4ITX A;  3T32 A;  1CJ0 A;  4EB7 A;  1KKP A;  1S0A A;  2R0T A;  4WXG A;  3TAT A;  4ATQ A;  1WKH A;  1V72 A;  3GZC A;  4W1W A;  1WYU B;  3NX3 A;  1AIB A;  3EI8 A;  4O6Z A;  4CVQ A;  5K8B A;  2CFB A;  3WLX A;  5FT8 A;  4E1O A;  3FVS A;  1KMK A;  1LS3 A;  1AAW A;  1I43 A;  1M0N A;  1MAP A;  3DU4 A;  3E2Y A;  5BJ4 A;  1O4S A;  1M0Q A;  2QMA A;  3UE8 A;  4ADE A;  3FQ7 A;  2W8W A;  1QIR A;  1E5F A;  1G4X A;  1AMQ A;  2CAN A;  2YKX A;  3CQ6 A;  1VJO A;  2QA3 A;  2BIE A;  4F5H A;  4PVF A;  2BIG A;  3K28 A;  1CQ7 A;  3OKS A;  4XAU A;  1AIA A;  2CST A;  5HDM A;  3OP7 A;  1N31 A;  3BWN A;  3F9T A;  1UU2 A;  2AY6 A;  5G0A A;  3DR4 A;  4WYD A;  3A9X A;  3LVJ A;  4QGR A;  4TN4 A;  2QLR A;  3LVM A;  4WYE A;  5M46 A;  1H0C A;  1D7R A;  2ZYJ A;  2WKA A;  3PD6 B;  2VGT A;  3EZS A;  2OAT A;  3UAK A;  3B46 A;  2HOY A;  1V2F A;  2C0R A;  3LWS A;  4JEW A;  4P3M A;  4Q6R A;  5E4Z A;  4F5L A;  4K2B A;  2YRR A;  3A9Z A;  1LK9 A;  1AY5 A;  2WK9 A;  3GZD C;  4AZK A;  4W8I A;  1ASD A;  3LVL B;  1PG8 A;  2E7I A;  1VEF A;  1IBJ A;  3A9Y A;  1BJN A;  2VI8 A;  3PDB B;  1IAY A;  4GEB A;  3PGY A;  5TF5 A;  1SZU A;  3AAT A;  1LC8 A;  3VK3 A;  2FNU A;  5F8V A;  1X2A A;  2PB0 A;  3QHX A;  3FVU A;  3NU8 A;  2AY2 A;  3PIU A;  4AOA A;  2D61 A;  4LNJ A;  4BA4 A;  1UKJ A;  1T3I A;  4CXQ A;  1IX8 A;  1MDX A;  4E3R A;  4OTL A;  1CZE A;  1J32 A;  1M0P A;  2ZP7 A;  1ART A;  1GEW A;  1I41 A;  4I8A A;  3R9A A;  3PDX A;  4A0F A;  4ZDO A;  1PFF A;  1CL1 A;  2ZY2 A;  3E77 A;  4IXS A;  1ASM A;  2YCP A;  3AEN A;  2BKW A;  1GEX A;  2E7J A;  1D7V A;  2JJE A;  3DOD A;  1B9H A;  1BJ4 A;  4R5F A;  3DC1 A;  3WKR A;  1OXO A;  4R8D A;  2GMU A;  4A0H A;  4Q31 A;  2HUU A;  1O62 A;  1LW4 A;  2BIA A;  1AY8 A;  1B9I A;  3NYT A;  2WK7 A;  3HDO A;  3K7Y A;  4A00 A;  1AKA A;  4UHM A;  2Z61 A;  3Q8N A;  7AAT A;  2YHK A;  1IUG A;  1Z3Z A;  1LC7 A;  4WP0 A;  4JF1 A;  3L8A A;  3FKD A;  1ASE A;  1MDZ A;  4MKJ A;  4W1V A;  2BI2 A;  2E7U A;  2EPJ A;  2HUF A;  4JEY A;  4XJM A;  2W7D A;  5F9S A;  2W7L A;  4IW7 A;  3ZRR A;  2BWP A;  2BI3 A;  2HUI A;  1DTY A;  2JGT A;  3CAI A;  1DFO A;  3AEJ C;  3B1D A;  5G4I A;  5HHY A;  3DR7 A;  2VMU A;  4A0G A;  3I4J A;  3BWN C;  2VGS A;  3GBX A;  1OHV A;  1DJE A;  3ATH A;  5BJ3 A;  5DX5 A;  1C7G A;  2Z9W A;  1WYT A;  4A6R A;  1AJS A;  2YKU A;  3LG0 A;  1O69 A;  2RFV A;  3E6G A;  1DGE A;  1WYV A;  3LVK A;  4KAM A;  1DGD A;  1SF2 A;  2W8U A;  2HOZ A;  1KKJ A;  3GET A;  1M4N A;  1G4V A;  1TOE A;  4ZM4 A;  3BS8 A;  5M4D A;  2YRI A;  4IXZ A;  2ZSM A;  3ACZ A;  1YJZ A;  3TQX A;  1RV3 A;  4PFN A;  4LW2 A;  4MY5 A;  4F5F A;  2NMP A;  3TFU A;  1ASF A;  5HXX A;  1S07 A;  4GRX A;  5FT5 A;  3WGB A;  5G09 A;  1ASG A;  4IY7 A;  2OQX A;  2VMS A;  4RKD A;  2Z20 A;  4Y0H A;  1G7X A;  3F6T A;  3F0H A;  3FQ8 A;  3NRA A;  4ITG A;  4R5Z A;  3RQ1 A;  2HOR A;  1KMJ A;  4UOY A;  1EQB A;  4AO4 A;  3BCB A;  3RCH A;  4ZDL A;  4ADB A;  1TPL A;  1SFF A;  3ASA A;  2HP2 A;  1C7O A;  2AY5 A;  1ARS A;  1WYU A;  4OT8 A;  4WLH A;  4DQ6 A;  4F5K A;  1YOO A;  1CQ8 A;  2X5D A;  1I48 A;  3NYS A;  2AY1 A;  1AX4 A;  3ASB A;  4ZSW A;  3DXW A;  3GR9 A;  1MLY A;  3AEL A;  3ZZJ A;  5EAA A;  1AIC A;  1TAT A;  1DJU A;  2W7F A;  3AEJ A;  3JWA A;  4LNL A;  1EJI A;  1W23 A;  2O0R A;  1QIS A;  1W7N A;  1I29 A;  1ZOB A;  1AMR A;  1IVR A;  2VMT A;  3FFR A;  3GSB A;  3JWB A;  4WYC A;  3TCM A;  2VMY A;  1BW0 A;  1Y4I A;  3II0 A;  3EIB A;  1RVU A;  2YOB A;  2Z9V A;  5G2P A;  2W7H A;  3ZZK A;  1U08 A;  4AZJ A;  3ELP A;  4WB0 A;  2W7K A;  2VMN A;  3VK2 A;  1IAX A;  2VGW A;  2R5E A;  3E2Z A;  5I92 A;  3LV2 A;  2AAT A;  3EI9 A;  2GB3 A;  5M4B A;  2ZY5 A;  4Y0D A;  1J04 A;  5EIG A;  3N0L A;  1S06 A;  1TAR A;  2CH1 A;  3MAF A;  2VMP A;  5FT6 A;  4ATP A;  3TFT A;  1AMS A;  2C81 A;  4PIW A;  4WYF A;  4BMK A;  4EMY A;  2G6W A;  3B1E A;  3NUB A;  2QBT A;  4W1X A;  2W7I A;  1X0M A;  2R5C A;  4RJY A;  3FCR A;  2CJG A;  4GE7 A;  3VAX A;  1YIY A;  2HP1 A;  1ASL A;  4XEW A;  4RAE A;  4JEZ A;  1BJO B;  1OXP A;  3CQ5 A;  4JF0 A;  2Q7W A;  4LNM A;  1AJR A;  3MKJ A;  3ZRQ A;  4IYO B;  4OYT A;  4TMR A;  4L0O A;  4U1T A;  1JS3 A;  5FT4 A;  4DBC A;  1QZ9 A;  3RBL A;  2VMV A;  3L44 A;  2W8V A;  3MAD A;  1MDO A;  1S08 A;  2W8T A;  5E5I A;  1IX7 A;  2BYL A;  3AEN B;  3FQA A;  3DXV A;  2D65 A;  3MBB A;  5EUD A;  4ADC A;  1AHF A;  3NNK A;  3RI6 A;  4WD2 A;  1GCK A;  3WGC A;  1BT4 A;  1FG3 A;  4NOG A;  1B8G A;  2BI5 A;  2HZP A;  3JW9 A;  4XJL A;  4DGT A;  2VIB A;  3BC8 A;  1X28 A;  2ZY4 A;  2EO5 A;  1AKC A;  4F5I A;  1AMA A;  2AY7 A;  2VGZ A;  2EGY A;  4Q75 A;  1AHY A;  1WKG A;  4N0W A;  3HQT A;  4AO9 A;  1RVY A;  3BCA A;  5D5S A;  4ZWM A;  1GC4 A;  4JEV A;  4E77 A;  2CJD A;  2JJF A;  4MKK A;  2QB3 A;  1DJ9 A;  1V2D A;  2YCT A;  2VLH A;  3FRK A;  2YKV A;  4M2J A;  4XK1 A;  2Z1Z A;  1AY4 A;  1MGV A;  2CB1 A;  3HLM A;  4MQQ A;  2YCN A;  3ECD A;  1B5O A;  1QIT A;  2ZJG A;  1C9C A;  2ZC0 A;  2E54 A;  2ZSL A;  1Z7D A;  4IXO A;  4M2M A;  1ASB A;  1CQ6 A;  4RKC A;  1BQD A;  4B98 A;  4BQ0 A;  2F8J A;  3BWO A;  2O7C A;  3BV0 A;  3R4T A;  1ARG A;  1P3W A;  2GSA A;  1WYT B;  3CBF A;  1SZS A;  2D64 A;  3M5U A;  2DKJ A;  4KXK A;  4EFF A;  1ARI A;  1M32 A;  1CL2 A;  2W7G A;  3AEP A;  1D2F A;  3B8X A;  4JEX A;  2D63 A;  4Y0I A;  2W7E A;  4CBR A;  4A6U A;  4W91 A;  2D7Z A;  3NTJ A;  1BQA A;  3WZF A;  4WLJ A;  5EQC A;  4WBT A;  5G4J A;  3QGU A;  4ZSY A;  3B1C A;  3ZRP A;  3PJ0 A;  1B4X A;  4OCA A;  1QGN A;  5DJ1 A;  1ARH A;  5J8Q A;  3USF A;  3FFH A;  2FN6 A;  2EZ2 A;  4KYO A;  4F5G A;  4BHD A;  3WX9 A;  1CZC A;  3EI5 A;  4J5U A;  1AHE A;  4A6T A;  2BYJ A;  5EAV A;  4B9B A;  4F5M A;  4LC3 A;  1YAA A;  3KKI A;  3BN1 A;  2HOX A;  1OHY A;  3G7Q A;  2AY3 A;  3QBO A;  4ADD A;  1OHW A;  2YKY A;  3E9K A;  4IX8 A;  1GC0 A;  2ORD A;  4E3Q A;  2DKB A;  3FTB A;  3NYU A;  4WYA A;  1LKC A;  1UU0 A;  3RCH B;  3H7F A;  1FG7 A;  1H1C A;  1C7N A;  2Z9U A;  3PAA A;  4ZLV A;  1YIZ A;  1ASC A;  3HL2 A;  3A8U X;  3ISL A;  1G7W A;  1KL1 A;  3NU7 A;  3G8M A;  4UHN A;  3ELE A;  3PPL A;  2AY4 A;  1AHX A;  1CS1 A;  2TPL A;  3AEM C;  4U2H A;  4FFC A;  3RBF A;  4HF8 A;  3N5M A;  3VK4 A;  3MEB A;  2QB2 A;  1B5P A;  5EFS A;  4AH3 A;  2FQ6 A;  4GSA A;  1D7S A;  5JAY A;  2GMS A;  4K2I A;  4W5K A;  3BCX A;  3NDN A;  3EI7 A;  4WXB A;  4EU1 A;  2BI1 A;  3AEO A;  2W7J A;  4MSO A;  1JF9 A;  4R2N A;  1TOI A;  5EUE A;  3AOV A;  1IJI A;  3DYD A;  1KL2 A;  1ZC9 A;  3PD6 A;  1N2T A;  1ASA A;  2VGV A;  1BS0 A;  5IWQ A;  3QN6 A;  2EH6 A;  5EUN A;  1GEY A;  2EZ1 A;  1IX6 A;  2VMW A;  5DJ9 A;  1MAQ A;  1ELU A;  3P1T A;  4WB0 B;  2Z1Y A;  2BWO A;  3KGX A;  4M2K A;  4LW4 A;  1TAS A;  2AY8 A;  3E2Z B;  3IHJ A;  1SPA A;  4ZM3 A;  3QI6 A;  3WKS A;  3GJU A;  2CTZ A;  3BB8 A;  2VMX A;  1YJY A;  3MAU A;  2W8J A;  2Z9X A;  1TOJ A;  1ECX A;  5EIG B;  3PDB A;  1GBN A;  3DZZ A;  3MAF B;  4UHO A;  4ISY A;  1OAT A;  2VMZ A;  2C44 A;  2VMR A;  3AOW A;  3MC6 C;  2CJH A;  4Q76 A;  1AKB A;  1EG5 A;  2R5C B;  4F4E A;  3K40 A;  2X5F A;  2VLF A;  1GDE A;  3EI6 A;  1DKA A;  2C7T A;  2DOU A;  4GDY A;  1N8P A;  4GE9 A;  4F5J A;  3N75 A;  4WXF A;  5G2Q A;  4ZAS A;  1AAM A;  3HMU A;  5AX8 A;  1BJO A;  2XBN A;  3WY7 A;  3FDD A;  2JJG A;  2V0Y A;  2FNI A;  2VIA A;  3NUI A;  4IYO A;  1RV4 A;  1TOK A;  2PO3 A;  3AEM A;  5DB5 A;  2FM1 A;  4WYG A;  2ZUK A;  2DR1 A;  1M0O A;  9AAT A;  4A0R A;  4GE4 A;  3EUC A;  1WST A;  1LW5 A;  2O1B A;  1C0N A;  3KE3 A;  4MQP A;  2R2N A; 
#chains in the Genus database with same CATH topology
 5BNX B;  3VH5 A;  3LY1 A;  4PFF A;  5DNM D;  3RUY A;  3KUY C;  3MNN B;  1P3B D;  3AV1 A;  1MLZ A;  4G91 C;  1YNU A;  1M7Y A;  3KXB C;  1O61 A;  2OGA A;  2Y2K A;  3GZD A;  3X1S C;  4JJN A;  5CPJ B;  2HIO A;  4MQR A;  3MC6 A;  3B6F B;  3FZ7 A;  2WK8 A;  1LC5 A;  1GC3 A;  5CPI D;  4CXR A;  3EZ1 A;  5B40 A;  1ID3 B;  3KGW A;  3W1H A;  1QJ5 A;  4RIZ A;  2JJH A;  1VP4 A;  1X29 A;  3W98 D;  4ZBJ C;  4KHA A;  1YJS A;  1P3O B;  2VI9 A;  5AV5 C;  1E5E A;  3VH5 T;  1P3P A;  1S0A A;  3UTB D;  3NQJ B;  1V72 A;  3GZC A;  5K8B A;  1AIB A;  3EI8 A;  4O6Z A;  4CVQ A;  5B1L C;  5FT8 A;  4E1O A;  3WAA D;  3KWQ B;  1KMK A;  2UWX A;  1O4S A;  2DGM A;  1KX5 D;  1E5F A;  2QA3 A;  1M18 C;  3K28 A;  1CQ7 A;  2PYO A;  1AIA A;  2CST A;  4UPK A;  1ZLA C;  5HDM A;  3OP7 A;  3W97 D;  3BWN A;  3WKJ B;  5G0A A;  2AY6 A;  2DGK A;  3DR4 A;  1M19 C;  3EZS A;  4M6B A;  3UAK A;  4WV4 B;  2C0R A;  1AY5 A;  2WK9 A;  4W8I A;  3AZN A;  2E7I A;  1VEF A;  2X3L A;  3MVD B;  1EQZ C;  1P3K D;  5TF5 A;  3REJ D;  2FNU A;  1X2A A;  3WA9 D;  5DNM A;  3FVU A;  4AOA A;  1P3B A;  1T3I A;  1IX8 A;  1MDX A;  1CZE A;  5AV5 B;  3C1C D;  3REL C;  1ART A;  1GEW A;  4I8A A;  4ZDO A;  2ZY2 A;  4IXS A;  5AY8 D;  2YCP A;  5B24 C;  2E7J A;  1D7V A;  1W2E A;  3WKR A;  1U35 D;  2GMU A;  1O62 A;  1LW4 A;  1AY8 A;  2J8P A;  3HDO A;  1AKA A;  4Z66 B;  5B0Y D;  1LC7 A;  3W96 C;  5GT0 C;  3NQU A;  2BI2 A;  2EPJ A;  4J8X C;  3N7N A;  4YM6 D;  3W98 A;  5G49 B;  3B1D A;  5HHY A;  5BJ3 A;  1C7G A;  2RVQ C;  1KX4 D;  1WYT A;  3LG0 A;  4X23 C;  4E44 A;  5JRG B;  3UTB A;  5KTB A;  4NFT A;  1TOE A;  2NQB B;  2YRI A;  3WAA A;  1P3G C;  5KDM B;  4DQY B;  4MY5 A;  3AYW D;  5CPK B;  1KX5 A;  3MGP D;  3UTA B;  5FT5 A;  3AZI D;  5B31 A;  2VMS A;  2Z20 A;  1P34 B;  3F6T A;  3F0H A;  4R5Z A;  5GXQ B;  1KMJ A;  5B24 B;  1EQB A;  3BCB A;  3RCH A;  3HT4 A;  4WU9 C;  5AV8 D;  2Y2Q A;  1C7O A;  1ID3 D;  5GSU C;  1AX4 A;  1P3I D;  3DXW A;  1MLY A;  5EAA A;  3LJA C;  1P3K A;  1W7N A;  1IVR A;  3FFR A;  3GSB A;  3REJ A;  4WYC A;  3TCM A;  3WA9 A;  3EIB A;  3X1V A;  3ZZK A;  2CV5 D;  3ELP A;  3C1C A;  3KWQ D;  3LV2 A;  4J8W B;  5AY8 A;  2F8N K;  2ZY5 A;  1TAF B;  1J04 A;  4YS3 A;  5EIG A;  3N0L A;  1S06 A;  1U35 A;  4BMK A;  2QBT A;  2W7I A;  2AEU A;  3AZG C;  3AFA C;  2CJG A;  5BO0 B;  5B0Y A;  3KXB D;  4XEW A;  1BJO B;  3LZ0 C;  1P3F C;  4TMR A;  5FT4 A;  4DBC A;  4YM6 A;  3L44 A;  3MAD A;  3X1U C;  3W1J A;  2W8T A;  2NZD C;  4H9Q B;  3MVD D;  3MBB A;  1KX4 A;  1GCK A;  3C1B B;  4NOG A;  1B8G A;  4XJL A;  5GSU B;  5BNX A;  1X28 A;  2EO5 A;  3N4X A;  1AKC A;  2A1V A;  2VGZ A;  2EGY A;  4Q75 A;  4AO9 A;  1WKG A;  1XEY A;  5AV5 D;  1GC4 A;  4JEV A;  3VH6 W;  2CJD A;  2JJF A;  4E77 A;  4Z5T C;  2QB3 A;  2BYM B;  5B33 B;  4ZUX C;  3AV2 C;  1DJ9 A;  3AYW A;  3MGP A;  4XK1 A;  5B1L D;  3AZI A;  2F8J A;  4JJN B;  4H9N B;  2GSA A;  5CPJ A;  3B6F A;  1M18 D;  3AEP A;  3B8X A;  5AV8 A;  5B40 B;  5B1M B;  4CBR A;  4A6U A;  4W91 A;  3NTJ A;  1ZLA D;  1ID3 A;  4WLJ A;  3QGU A;  5B0Z B;  3ZRP A;  3B1C A;  3PJ0 A;  3R45 B;  5AVB C;  2EZ2 A;  4KYO A;  4WU8 B;  4BHD A;  3WX9 A;  1P3P B;  4F5M A;  2YFV B;  3BN1 A;  3AZF C;  2HOX A;  5JRG D;  3NQJ A;  2ORD A;  4IX8 A;  3FTB A;  1UU0 A;  2CV5 A;  1EQZ D;  3KWQ A;  4G92 C;  5GT3 B;  3HL2 A;  3ISL A;  2Y2I A;  1KL1 A;  2AY4 A;  1AHX A;  3AEM C;  2QB2 A;  1P34 D;  4W5K A;  5BNV B;  5B24 D;  3BCX A;  4DRA A;  4MSO A;  4AWL C;  5EUE A;  3AOV A;  1KL2 A;  3REK C;  1N2T A;  3FZ8 A;  2EH6 A;  1ELU A;  3P1T A;  3KGX A;  4M2K A;  4LW4 A;  3E2Z B;  1SPA A;  3WKS A;  5GT0 D;  1YJY A;  3MVD A;  2F8N B;  1P3M C;  4ISY A;  2VMR A;  3H0L C;  2CJH A;  4Q76 A;  1EG5 A;  3K40 A;  1GDE A;  1DKA A;  2DOU A;  3X1T C;  4GDY A;  2RVQ D;  5AV5 A;  5G2Q A;  3KSY A;  4J8W D;  2FNI A;  2VIA A;  3NUI A;  5B1L A;  5DB5 A;  4WZS B;  2DR1 A;  4A0R A;  1LW5 A;  2O1B A;  5CPI B;  1M18 A;  1P3A B;  3COG A;  2GQN A;  2X8U A;  1ZLA A;  3AL0 C;  4EO5 C;  1JG8 A;  4J8L A;  3FVX A;  5CP6 C;  5C3I C;  1S09 A;  4WU9 D;  1W7L A;  1ORD A;  2ZY3 A;  2D5Y A;  2D66 A;  3C1B D;  3AZL C;  5GSU D;  4Z2M H;  3CQ4 A;  5JRG A;  4ZAH A;  4UUZ B;  5D95 A;  2JG2 A;  3W1I A;  1FC4 A;  1EQZ A;  3PA9 A;  4K2M A;  5AVC C;  1ELQ A;  5B33 D;  1BH8 B;  1KX5 B;  3MGS B;  2CH2 A;  2OGE A;  4CBS A;  5CPK A;  1KU5 A;  2D7Y A;  1W7M A;  4XZQ B;  1D7U A;  8AAT A;  2VGU A;  1P34 A;  4EB5 A;  1XI9 A;  1A7W A;  3W97 B;  5GXQ A;  3TU4 C;  4HGA C;  3GWP A;  5B24 A;  1CJ0 A;  4EB7 A;  5DNN C;  1KKP A;  2R0T A;  4WXG A;  5B1M D;  3NX3 A;  4KUD C;  3AZG D;  5B0Z D;  1LS3 A;  1AAW A;  3AFA D;  1I43 A;  3UE8 A;  4ADE A;  1QIR A;  4F5H A;  4WU8 D;  2JSS A;  4KGC C;  3CQ6 A;  3LZ0 D;  4H9R B;  3REI C;  1P3F D;  3REH C;  5CP6 B;  5C3I B;  1UU2 A;  4WYD A;  3LVJ A;  4J8V C;  4TN4 A;  5GT3 D;  1H0C A;  1D7R A;  2ZYJ A;  2WKA A;  3PD6 B;  3AZL B;  5AY8 B;  4J8W A;  1S32 C;  1TAF A;  3MGQ C;  4AZK A;  1HTA A;  1PG8 A;  1IBJ A;  4Z5T D;  3AV2 D;  2VI8 A;  4GEB A;  1SZU A;  5BO0 A;  1LC8 A;  4XUJ B;  2PB0 A;  2HUE C;  2FKI A;  2AY2 A;  5B32 B;  3AZM C;  4E3R A;  5AV6 C;  4YM6 B;  1J32 A;  1I41 A;  3W99 C;  3E77 A;  3VH5 W;  1ASM A;  4H9Q A;  1GEX A;  1KX4 B;  1BJ4 A;  3DC1 A;  3C1B A;  2ARO B;  5GSU A;  1B9I A;  5AVB D;  3NYT A;  2WK7 A;  3K7Y A;  3Q8N A;  2DQN C;  7AAT A;  2YHK A;  4JF1 A;  2BYM A;  5B33 A;  1ASE A;  3AZF D;  4W1V A;  3AYW B;  2FJ7 C;  4JEY A;  3MGP B;  3AZK B;  3ZRR A;  3AZI B;  2BWP A;  4J8U C;  1DTY A;  2JGT A;  3AZE C;  3CAI A;  4RIT A;  3DR7 A;  3AZJ C;  3GBX A;  5F99 C;  1DJE A;  4H9N A;  2JIS A;  1WWS A;  4A6R A;  2YKU A;  5AV8 B;  3E6G A;  1P3A D;  1DGE A;  1WYV A;  3LVK A;  4KAM A;  5AV9 C;  3GET A;  5B1M A;  1G4V A;  5M4D A;  4IXZ A;  3AZG A;  5B0Z A;  3AFA A;  3TQX A;  1P3I B;  3R45 A;  2NMP A;  3TFU A;  3REK D;  4WU8 A;  2ZM5 A;  4GRX A;  5G09 A;  3LZ0 A;  2YFV A;  3A6N C;  3FQ8 A;  2HOR A;  2CV5 B;  3P5J B;  4AO4 A;  4ADB A;  1TPL A;  5GT3 A;  3ASA A;  3MGS D;  4WLH A;  3KUY B;  4DQ6 A;  1B67 A;  1I48 A;  3ASB A;  4XZQ D;  3X1T D;  4G91 B;  3GR9 A;  4Z5T A;  1TAT A;  3AEJ A;  2W7F A;  1EJI A;  2O0R A;  1QIS A;  1I29 A;  3KXB B;  5BNV A;  4R8P C;  4QLC C;  4J8U B;  1BW0 A;  3WTP C;  3II0 A;  3X1S B;  1U08 A;  2VGW A;  3E2Z A;  2R5E A;  2AAT A;  3EI9 A;  2GB3 A;  5M4B A;  2F8N A;  4Y0D A;  1H3O A;  2CH1 A;  4NE5 A;  4WYF A;  3B1E A;  3NUB A;  5CP6 D;  1X0M A;  4ZBJ B;  4RJY A;  3FCR A;  4GE7 A;  2HP1 A;  3AZL D;  4LNM A;  5B2I C;  3MKJ A;  3ZRQ A;  4U1T A;  1JS3 A;  2CWE A;  5B1L B;  3RBL A;  3H9X A;  5E5I A;  5AVC D;  2BYL A;  3RI6 A;  4WD2 A;  1BT4 A;  1M18 B;  5CPI A;  2BI5 A;  4XUJ D;  1P3A A;  3BC8 A;  1AMA A;  2AY7 A;  1ZLA B;  3HVY A;  4N0W A;  1KX3 C;  5B32 D;  5D5S A;  3TU4 D;  4MKK A;  4NE3 A;  1M19 B;  3LEL C;  4QLC B;  2VLH A;  3FRK A;  2YKV A;  3REK A;  2Z1Z A;  2YCN A;  3ECD A;  1B5O A;  4KUD D;  2ZC0 A;  4M2M A;  4B98 A;  1ASB A;  1BQD A;  3BWO A;  2ARO D;  2BYK B;  3R4T A;  4WJ3 C;  4RJ0 A;  4UUZ A;  3O62 C;  1EQZ B;  1M32 A;  4LD9 C;  2D63 A;  3AZH C;  1BH8 A;  4Z2M G;  3MGS A;  3AZK D;  4WBT A;  2Y2O A;  4XZQ A;  3X1T A;  1B4X A;  4OCA A;  4CSR B;  3REL B;  1QGN A;  4K05 A;  2FN6 A;  3W97 A;  4J5U A;  1S32 D;  5FUG B;  3EPK A;  2BYJ A;  5EAV A;  2AEV A;  3KKI A;  3MGQ D;  4WNN B;  2AY3 A;  3QBO A;  2VQR A;  2YKY A;  3E9K A;  1GC0 A;  2DKB A;  3NYU A;  3UT9 C;  3H7F A;  2Y2L A;  1C7N A;  3W96 B;  5GT0 B;  3G8M A;  5B31 G;  3PPL A;  2TPL A;  4J8X B;  3RBF A;  4HF8 A;  3N5M A;  2F2A C;  3MEB A;  4H9R A;  3AZM D;  1B5P A;  5EFS A;  5CP6 A;  3LEL B;  3W99 D;  5JAY A;  2GMS A;  4K2I A;  3EI7 A;  2BI1 A;  2W7J A;  1TOI A;  4X23 B;  3PD6 A;  3AV1 C;  3AZL A;  2VGV A;  5EUN A;  3KUY D;  4WB0 B;  2Z1Y A;  1TAS A;  3O62 B;  2AY8 A;  2YFW B;  2KFP A;  3GJU A;  2CTZ A;  1P3G B;  1HQ3 C;  1Q9C A;  1ECX A;  3MAF B;  2VMZ A;  2HIO C;  2C44 A;  4XUJ A;  3MC6 C;  4J8U D;  5JA4 B;  3X1S D;  2X5F A;  5B32 A;  4GE9 A;  4F5J A;  3TU4 A;  3N75 A;  4ZAS A;  3EPH A;  3HMU A;  4WU9 B;  3WY7 A;  1Z2C B;  2JJG A;  4IYO A;  4CAY B;  4KUD A;  2PO3 A;  2ARO A;  2G5H C;  1M0O A;  3LZ1 C;  4GE4 A;  3EUC A;  3KE3 A;  3LJA B;  2R2N A;  1SZK A;  1AHG A;  4H51 A;  2FYF A;  3A6N D;  2QSR A;  3AN2 C;  3AZK A;  2V1P A;  3E2F A;  1QJ3 A;  1V2E A;  2VMQ A;  3VOM A;  1GC2 A;  1S32 A;  2CIN A;  2AY9 A;  3G0T A;  1BJW A;  2PYO C;  4ZWV A;  4ZDP A;  3B0C W;  1C4K A;  3MGQ A;  1WYV B;  3UWC A;  3H0R C;  1GD9 A;  4FL0 A;  3QM2 A;  3JTX A;  5BT1 C;  4OMA A;  3AZG B;  4RLG A;  3QPG A;  3AFA B;  3A2B A;  1ASN A;  1UU1 A;  4HVK A;  1M19 D;  1P3I A;  3D6K A;  1F66 C;  4QLC D;  2CY8 A;  3AZN C;  4OC9 A;  2BWN A;  3LZ0 B;  1JS6 A;  1ZOD A;  1P3F B;  1M6S A;  4A72 A;  5C6U A;  3FSL A;  1W3U A;  3X1U B;  2BHX A;  3W99 A;  2NZD B;  4ITX A;  3B0D C;  5DNM C;  3TAT A;  1P3B C;  3H0M C;  4W1W A;  2CFB A;  3KUY A;  1MAP A;  3DU4 A;  5BJ4 A;  3E2Y A;  2QMA A;  3FQ7 A;  3REL D;  2W8W A;  4Z5T B;  1G4X A;  3AV2 B;  4ZUX B;  1AMQ A;  2CAN A;  5B2I D;  3KXB A;  4XAU A;  4J8U A;  3X1S A;  3F9T A;  3A9X A;  4QGR A;  2QLR A;  4WYE A;  5M46 A;  3W96 D;  2VGT A;  2OAT A;  3B46 A;  4JEW A;  1V2F A;  3LWS A;  4Q6R A;  2YRR A;  1H3O B;  3W98 C;  1LK9 A;  4J8X D;  3A9Y A;  5AVB B;  1JFI A;  3LEL D;  3PDB B;  3PGY A;  3AAT A;  3VK3 A;  3UTB C;  5F8V A;  4X23 D;  2F8N H;  3AZF B;  3PIU A;  3WAA C;  2D61 A;  1UKJ A;  1M0P A;  2ZP7 A;  3O62 D;  3PDX A;  4G92 B;  1P3G D;  2JCH A;  1TZY C;  5B31 C;  2JJE A;  1AOI C;  4R5F A;  4A0H A;  3VP6 A;  2BIA A;  4UHM A;  1Z3Z A;  3L8A A;  3FKD A;  1M19 A;  4AWL B;  2E7U A;  4QLC A;  4XJM A;  3REK B;  2W7L A;  4IW7 A;  2BI3 A;  3UT9 D;  4A0G A;  5G4I A;  3I4J A;  2BYK A;  2VGS A;  1P3K C;  3ATH A;  5DX5 A;  2Z9W A;  3REJ C;  1AJS A;  2BG1 A;  2FFF B;  2G5I C;  3LJA D;  1O69 A;  1P3M B;  3HBX A;  3X1V C;  1DGD A;  1SF2 A;  2W8U A;  2HOZ A;  4ZM4 A;  3BS8 A;  2ZSM A;  3ACZ A;  1YJZ A;  3X1T B;  4PFN A;  4LW2 A;  4CSR A;  3REL A;  4F5F A;  4YS3 C;  5HXX A;  5E5A C;  1S07 A;  3AV1 D;  5FUG A;  1ASG A;  5B2I A;  4IY7 A;  4Y0H A;  4WNN A;  5B0Y C;  1HQ3 D;  4UOY A;  3MGR C;  3W96 A;  5GT0 A;  2AY5 A;  1ARS A;  2JE5 A;  1KAF A;  1WYU A;  4F5K A;  4J8X A;  3NYS A;  2IO5 C;  4EO5 B;  1M1A C;  2OKK A;  3AEL A;  3EPL A;  3X1U D;  1AIC A;  1DJU A;  3JWA A;  4LNL A;  3LEL A;  2G7J A;  2NZD D;  2VMY A;  2XD1 A;  3MNN C;  4X23 A;  4OBU A;  1RVU A;  3LZ1 D;  2Z9V A;  5G2P A;  2W7H A;  4WB0 A;  2W7K A;  3O62 A;  2YFW A;  5AVC B;  2DF4 C;  1P3G A;  4ZUX D;  1TAR A;  3MAF A;  3AN2 D;  2VMP A;  2C81 A;  5CPJ C;  3N4S A;  1WWI A;  5JA4 A;  3B6F C;  3VAX A;  3TU4 B;  4HGA B;  4RAE A;  5DNN B;  4H9S C;  1OXP A;  3CQ5 A;  4WU9 A;  4JF0 A;  1AJR A;  4IYO B;  1P3L C;  4KUD B;  4CAY A;  5BT1 D;  3UT9 A;  2W8V A;  1MDO A;  3MGR B;  1P3O C;  1S08 A;  3AEN B;  3DXV A;  2D65 A;  5EUD A;  1F66 D;  4ADC A;  1AHF A;  3NNK A;  4KGC B;  1FG3 A;  3LJA A;  3JW9 A;  4DGT A;  3REI B;  3REH B;  3KWQ C;  4E45 A;  3BCA A;  4ZWM A;  4J8V B;  4M2J A;  1S32 B;  1AY4 A;  2WB6 A;  2CB1 A;  2E54 A;  4IXO A;  5BS7 C;  3MGQ B;  1Z7D A;  1CQ6 A;  4RKC A;  2O7C A;  3JZL A;  3WKJ C;  1HQ3 A;  1SZS A;  2D64 A;  4KXK A;  2DKJ A;  1ARI A;  3N4R A;  1CL2 A;  4DRB A;  5B2J C;  4JEX A;  2W7E A;  2HUE B;  1BQA A;  3WZF A;  5EQC A;  5G4J A;  2OKJ A;  3AZM B;  1P3F A;  4ZSY A;  5AV6 B;  3MVD C;  5DJ1 A;  3FFH A;  3X1U A;  3A1K A;  3W99 B;  4F5G A;  1AHE A;  2NZD A;  4B9B A;  4LC3 A;  1YAA A;  1P3L B;  1P3M D;  1OHW A;  3LZ1 A;  4WYA A;  3V9R B;  4ZLV A;  1YIZ A;  1G7W A;  3B6G C;  3AV2 A;  4ZUX A;  3ELE A;  2FJ7 B;  3AN2 A;  1B6W A;  3AZE B;  3AZJ B;  4Z66 C;  5F99 B;  1D7S A;  1TZY D;  5B31 D;  4EU1 A;  3AEO A;  1JF9 A;  1AOI D;  4R2N A;  1IJI A;  1ZC9 A;  2Y2G A;  1ASA A;  5IWQ A;  1BS0 A;  5AV9 B;  3QN6 A;  1GEY A;  2EZ1 A;  3WCN A;  5DJ9 A;  2BWO A;  3IHJ A;  4ZM3 A;  3QI6 A;  5B2J B;  1JFI B;  2W8J A;  5AVB A;  1TOJ A;  3FD0 A;  1F66 A;  3PDB A;  4UHO A;  5JRG C;  3AOW A;  4OBV A;  1AKB A;  3AZF A;  2NQB C;  2R5C B;  3A6N B;  2VLF A;  2C7T A;  1N8P A;  3WCO A;  1F1E A;  5CPK C;  2F8N G;  3UTA C;  2XBN A;  3FDD A;  3X1V D;  2V0Y A;  1P34 C;  1TOK A;  2L5A A;  3AEM A;  2FM1 A;  4WYG A;  5GXQ C;  3I16 A;  3B6G B;  4YS3 D;  5E5A D;  4MQP A;  4XQ2 A;  4R8P B;  5DNN D;  3AV7 A;  3WTP B;  2XH1 A;  4H9P B;  3I5T A;  4XJO A;  1TOG A;  3EIA A;  3MGR D;  1SVV A;  2W7M A;  3DRD A;  1AJS B;  4KGC D;  5E3K A;  2VYC A;  3P6K A;  3REI D;  1P3M A;  1M1A D;  3REH D;  2VMO A;  5M49 A;  1BKG A;  3FDB A;  4J8W C;  4BA5 A;  2BI9 A;  4J8V D;  4XJP A;  3MNN D;  5B2I B;  5CHL B;  3EPJ A;  2PB2 A;  2Y2M A;  4P7Y A;  4UQV A;  3T32 A;  1TZY A;  2Y2H A;  1AOI A;  4ATQ A;  1WKH A;  5CPJ D;  1WYU B;  3WLX A;  3B6F D;  3FVS A;  1BH9 B;  1KX3 B;  1M0N A;  5AV6 D;  1M0Q A;  2YKX A;  1PZR A;  1VJO A;  2BIE A;  3C1B C;  4PVF A;  2BIG A;  1P3L D;  3OKS A;  1BFM A;  1P3O D;  1N31 A;  5B33 C;  3LVM A;  4LD9 B;  5AVC A;  4P3M A;  2HOY A;  5E4Z A;  3AZH B;  4K2B A;  4F5L A;  2FJ7 D;  3A9Z A;  3GZD C;  1ASD A;  3LVL B;  1N1J B;  4JJN C;  3AZE D;  1BJN A;  3AZJ D;  5F99 D;  1IAY A;  5E5A A;  3QHX A;  5B40 C;  5B1M C;  5DNN A;  3A1I A;  3NU8 A;  4H9O A;  4LNJ A;  5B0Z C;  5AV9 D;  4BA4 A;  1ULY A;  3WKJ D;  4CXQ A;  4OTL A;  3UT9 B;  3R9A A;  4A0F A;  4WU8 C;  1CL1 A;  3MGR A;  1PFF A;  5B2J D;  3AEN A;  1P3P C;  2BKW A;  3DOD A;  1B9H A;  4KGC A;  1OXO A;  4R8D A;  4Q31 A;  3REI A;  2HUU A;  5B32 G;  1M1A A;  3REH A;  4A00 A;  2Z61 A;  5GT3 C;  1IUG A;  4WP0 A;  4J8V A;  1MDZ A;  4MKJ A;  2HUF A;  3MNN A;  3AV1 B;  2W7D A;  5F9S A;  2HUI A;  1DFO A;  3AEJ C;  2VMU A;  3BWN C;  1OHV A;  1R4V A;  1HQ3 B;  3B6G D;  3VH6 A;  2RFV A;  4R8P D;  2HIO B;  1KKJ A;  3WTP D;  1M4N A;  4Z66 D;  3AZM A;  1RV3 A;  5AV6 A;  1ASF A;  4H9S A;  3WGB A;  2OQX A;  4RKD A;  1P3L A;  1G7X A;  4KHA B;  3NRA A;  3RQ1 A;  4ITG A;  1P3O A;  3LZ1 B;  3V9R A;  4ZDL A;  1SFF A;  2HP2 A;  4OT8 A;  2NQB D;  2FJ7 A;  1YOO A;  1CQ8 A;  2X5D A;  3AN2 B;  2AY1 A;  4ZSW A;  3AZE A;  3ZZJ A;  3VH6 T;  5CPK D;  3AZJ A;  5CPI C;  1W23 A;  3UTA D;  5F99 A;  1ZOB A;  1P3A C;  1AMR A;  2VMT A;  3JWB A;  2PYO B;  1Y4I A;  5BS7 A;  5GXQ D;  2YOB A;  4AZJ A;  5AV9 A;  3WKJ A;  1KX3 D;  2VMN A;  3VK2 A;  1IAX A;  5I92 A;  2W8S A;  3B0B A;  5B2J A;  3B0C T;  1F66 B;  3AZN B;  3TFT A;  5FT6 A;  4ATP A;  1AMS A;  4PIW A;  4EMY A;  2G6W A;  4W1X A;  2R5C A;  3A6N A;  1PMO A;  1YIY A;  1ASL A;  3B0D B;  1KX5 C;  4JEZ A;  4LD9 D;  3MGS C;  5DNM B;  1T3U A;  2Q7W A;  1P3B B;  3AZH D;  4OYT A;  4L0O A;  4XZQ C;  1QZ9 A;  2VMV A;  3W97 C;  1IX7 A;  3FQA A;  3B6G A;  3WGC A;  2HZP A;  2VIB A;  4R8P A;  2ZY4 A;  4F5I A;  3WTP A;  1AHY A;  3KFU G;  3HQT A;  1RVY A;  4H9P A;  4Z66 A;  3NQU B;  1V2D A;  2YCT A;  1MGV A;  3HLM A;  4MQQ A;  1QIT A;  2ZJG A;  3WA9 C;  3W98 B;  1C9C A;  2ZSL A;  4BQ0 A;  5G49 A;  3BV0 A;  1ARG A;  1P3W A;  2Y2J A;  3C1C C;  1WYT B;  3CBF A;  3M5U A;  4EFF A;  2W7G A;  5AY8 C;  1D2F A;  3UTB B;  4Y0I A;  2D7Z A;  1U35 C;  2NQB A;  3WAA B;  5KDM A;  1ARH A;  5J8Q A;  3USF A;  1CZC A;  3EI5 A;  3UTA A;  4A6T A;  1TZY B;  5B31 B;  4XUJ C;  1AOI B;  1OHY A;  3G7Q A;  3EG5 B;  4ADD A;  2RIQ A;  4JJN D;  2EYQ A;  2HIO D;  5B32 C;  4E3Q A;  4YM6 C;  1LKC A;  3RCH B;  1FG7 A;  1H1C A;  3FZ6 A;  2Z9U A;  1BH9 A;  3PAA A;  1KX3 A;  1ASC A;  3A8U X;  3NU7 A;  1KX4 C;  5B40 D;  4UHN A;  1CS1 A;  3IP4 C;  4U2H A;  4FFC A;  3VK4 A;  2ARO C;  4AH3 A;  2FQ6 A;  4GSA A;  1P3K B;  1P3P D;  3NDN A;  4WXB A;  3REJ B;  3DYD A;  3AYW C;  3WA9 B;  4LD9 A;  3MGP C;  4H63 Q;  3AZK C;  3X1V B;  3AZI C;  3AZH A;  1IX6 A;  2VMW A;  1MAQ A;  3C1C B;  4RM1 A;  1N1J A;  1PMM A;  3BB8 A;  2VMX A;  3MAU A;  2Z9X A;  5EIG B;  4YS3 B;  1GBN A;  3DZZ A;  5E5A B;  5AV8 C;  1OAT A;  3WTP E;  1U35 B;  2Y2P A;  2LY8 A;  2DGL A;  2PYO D;  1ID3 C;  4H9O B;  4F4E A;  3EI6 A;  5B0Y B;  2Y2N A;  1P3I C;  4NE6 A;  4WXF A;  1AAM A;  5AX8 A;  2XD5 A;  1BJO A;  1RV4 A;  3AZN D;  2ZUK A;  2IO5 B;  9AAT A;  1M1A B;  2CV5 C;  1WST A;  2F8N D;  1C0N A; 
#chains in the Genus database with same CATH homology
 5BNX B;  3VH5 A;  3LY1 A;  4PFF A;  5DNM D;  3RUY A;  3KUY C;  3MNN B;  1P3B D;  3AV1 A;  1MLZ A;  4G91 C;  1YNU A;  1M7Y A;  3KXB C;  1O61 A;  2OGA A;  2Y2K A;  3GZD A;  3X1S C;  4JJN A;  5CPJ B;  2HIO A;  4MQR A;  3MC6 A;  3B6F B;  3FZ7 A;  2WK8 A;  1LC5 A;  1GC3 A;  5CPI D;  4CXR A;  3EZ1 A;  5B40 A;  1ID3 B;  3KGW A;  3W1H A;  1QJ5 A;  4RIZ A;  2JJH A;  1VP4 A;  1X29 A;  3W98 D;  4ZBJ C;  4KHA A;  1YJS A;  1P3O B;  2VI9 A;  5AV5 C;  1E5E A;  3VH5 T;  1P3P A;  1S0A A;  3UTB D;  3NQJ B;  1V72 A;  3GZC A;  5K8B A;  1AIB A;  3EI8 A;  4O6Z A;  4CVQ A;  5B1L C;  5FT8 A;  4E1O A;  3WAA D;  3KWQ B;  1KMK A;  2UWX A;  1O4S A;  2DGM A;  1KX5 D;  1E5F A;  2QA3 A;  1M18 C;  3K28 A;  1CQ7 A;  2PYO A;  1AIA A;  2CST A;  4UPK A;  1ZLA C;  5HDM A;  3OP7 A;  3W97 D;  3BWN A;  3WKJ B;  5G0A A;  2AY6 A;  2DGK A;  3DR4 A;  1M19 C;  3EZS A;  4M6B A;  3UAK A;  4WV4 B;  2C0R A;  1AY5 A;  2WK9 A;  4W8I A;  3AZN A;  2E7I A;  1VEF A;  2X3L A;  3MVD B;  1EQZ C;  1P3K D;  5TF5 A;  3REJ D;  2FNU A;  1X2A A;  3WA9 D;  5DNM A;  3FVU A;  4AOA A;  1P3B A;  1T3I A;  1IX8 A;  1MDX A;  1CZE A;  5AV5 B;  3C1C D;  3REL C;  1ART A;  1GEW A;  4I8A A;  4ZDO A;  2ZY2 A;  4IXS A;  5AY8 D;  2YCP A;  5B24 C;  2E7J A;  1D7V A;  1W2E A;  3WKR A;  1U35 D;  2GMU A;  1O62 A;  1LW4 A;  1AY8 A;  2J8P A;  3HDO A;  1AKA A;  4Z66 B;  5B0Y D;  1LC7 A;  3W96 C;  5GT0 C;  3NQU A;  2BI2 A;  2EPJ A;  4J8X C;  3N7N A;  4YM6 D;  3W98 A;  5G49 B;  3B1D A;  5HHY A;  5BJ3 A;  1C7G A;  2RVQ C;  1KX4 D;  1WYT A;  3LG0 A;  4X23 C;  4E44 A;  5JRG B;  3UTB A;  5KTB A;  4NFT A;  1TOE A;  2NQB B;  2YRI A;  3WAA A;  1P3G C;  5KDM B;  4DQY B;  4MY5 A;  3AYW D;  5CPK B;  1KX5 A;  3MGP D;  3UTA B;  5FT5 A;  3AZI D;  5B31 A;  2VMS A;  2Z20 A;  1P34 B;  3F6T A;  3F0H A;  4R5Z A;  5GXQ B;  1KMJ A;  5B24 B;  1EQB A;  3BCB A;  3RCH A;  3HT4 A;  4WU9 C;  5AV8 D;  2Y2Q A;  1C7O A;  1ID3 D;  5GSU C;  1AX4 A;  1P3I D;  3DXW A;  1MLY A;  5EAA A;  3LJA C;  1P3K A;  1W7N A;  1IVR A;  3FFR A;  3GSB A;  3REJ A;  4WYC A;  3TCM A;  3WA9 A;  3EIB A;  3X1V A;  3ZZK A;  2CV5 D;  3ELP A;  3C1C A;  3KWQ D;  3LV2 A;  4J8W B;  5AY8 A;  2F8N K;  2ZY5 A;  1TAF B;  1J04 A;  4YS3 A;  5EIG A;  3N0L A;  1S06 A;  1U35 A;  4BMK A;  2QBT A;  2W7I A;  2AEU A;  3AZG C;  3AFA C;  2CJG A;  5BO0 B;  5B0Y A;  3KXB D;  4XEW A;  1BJO B;  3LZ0 C;  1P3F C;  4TMR A;  5FT4 A;  4DBC A;  4YM6 A;  3L44 A;  3MAD A;  3X1U C;  3W1J A;  2W8T A;  2NZD C;  4H9Q B;  3MVD D;  3MBB A;  1KX4 A;  1GCK A;  3C1B B;  4NOG A;  1B8G A;  4XJL A;  5GSU B;  5BNX A;  1X28 A;  2EO5 A;  3N4X A;  1AKC A;  2A1V A;  2VGZ A;  2EGY A;  4Q75 A;  4AO9 A;  1WKG A;  1XEY A;  5AV5 D;  1GC4 A;  4JEV A;  3VH6 W;  2CJD A;  2JJF A;  4E77 A;  4Z5T C;  2QB3 A;  2BYM B;  5B33 B;  4ZUX C;  3AV2 C;  1DJ9 A;  3AYW A;  3MGP A;  4XK1 A;  5B1L D;  3AZI A;  2F8J A;  4JJN B;  4H9N B;  2GSA A;  5CPJ A;  3B6F A;  1M18 D;  3AEP A;  3B8X A;  5AV8 A;  5B40 B;  5B1M B;  4CBR A;  4A6U A;  4W91 A;  3NTJ A;  1ZLA D;  1ID3 A;  4WLJ A;  3QGU A;  5B0Z B;  3ZRP A;  3B1C A;  3PJ0 A;  3R45 B;  5AVB C;  2EZ2 A;  4KYO A;  4WU8 B;  4BHD A;  3WX9 A;  1P3P B;  4F5M A;  2YFV B;  3BN1 A;  3AZF C;  2HOX A;  5JRG D;  3NQJ A;  2ORD A;  4IX8 A;  3FTB A;  1UU0 A;  2CV5 A;  1EQZ D;  3KWQ A;  4G92 C;  5GT3 B;  3HL2 A;  3ISL A;  2Y2I A;  1KL1 A;  2AY4 A;  1AHX A;  3AEM C;  2QB2 A;  1P34 D;  4W5K A;  5BNV B;  5B24 D;  3BCX A;  4DRA A;  4MSO A;  4AWL C;  5EUE A;  3AOV A;  1KL2 A;  3REK C;  1N2T A;  3FZ8 A;  2EH6 A;  1ELU A;  3P1T A;  3KGX A;  4M2K A;  4LW4 A;  3E2Z B;  1SPA A;  3WKS A;  5GT0 D;  1YJY A;  3MVD A;  2F8N B;  1P3M C;  4ISY A;  2VMR A;  3H0L C;  2CJH A;  4Q76 A;  1EG5 A;  3K40 A;  1GDE A;  1DKA A;  2DOU A;  3X1T C;  4GDY A;  2RVQ D;  5AV5 A;  5G2Q A;  3KSY A;  4J8W D;  2FNI A;  2VIA A;  3NUI A;  5B1L A;  5DB5 A;  4WZS B;  2DR1 A;  4A0R A;  1LW5 A;  2O1B A;  5CPI B;  1M18 A;  1P3A B;  3COG A;  2GQN A;  2X8U A;  1ZLA A;  3AL0 C;  4EO5 C;  1JG8 A;  4J8L A;  3FVX A;  5CP6 C;  5C3I C;  1S09 A;  4WU9 D;  1W7L A;  1ORD A;  2ZY3 A;  2D5Y A;  2D66 A;  3C1B D;  3AZL C;  5GSU D;  4Z2M H;  3CQ4 A;  5JRG A;  4ZAH A;  4UUZ B;  5D95 A;  2JG2 A;  3W1I A;  1FC4 A;  1EQZ A;  3PA9 A;  4K2M A;  5AVC C;  1ELQ A;  5B33 D;  1BH8 B;  1KX5 B;  3MGS B;  2CH2 A;  2OGE A;  4CBS A;  5CPK A;  1KU5 A;  2D7Y A;  1W7M A;  4XZQ B;  1D7U A;  8AAT A;  2VGU A;  1P34 A;  4EB5 A;  1XI9 A;  1A7W A;  3W97 B;  5GXQ A;  3TU4 C;  4HGA C;  3GWP A;  5B24 A;  1CJ0 A;  4EB7 A;  5DNN C;  1KKP A;  2R0T A;  4WXG A;  5B1M D;  3NX3 A;  4KUD C;  3AZG D;  5B0Z D;  1LS3 A;  1AAW A;  3AFA D;  1I43 A;  3UE8 A;  4ADE A;  1QIR A;  4F5H A;  4WU8 D;  2JSS A;  4KGC C;  3CQ6 A;  3LZ0 D;  4H9R B;  3REI C;  1P3F D;  3REH C;  5CP6 B;  5C3I B;  1UU2 A;  4WYD A;  3LVJ A;  4J8V C;  4TN4 A;  5GT3 D;  1H0C A;  1D7R A;  2ZYJ A;  2WKA A;  3PD6 B;  3AZL B;  5AY8 B;  4J8W A;  1S32 C;  1TAF A;  3MGQ C;  4AZK A;  1HTA A;  1PG8 A;  1IBJ A;  4Z5T D;  3AV2 D;  2VI8 A;  4GEB A;  1SZU A;  5BO0 A;  1LC8 A;  4XUJ B;  2PB0 A;  2HUE C;  2FKI A;  2AY2 A;  5B32 B;  3AZM C;  4E3R A;  5AV6 C;  4YM6 B;  1J32 A;  1I41 A;  3W99 C;  3E77 A;  3VH5 W;  1ASM A;  4H9Q A;  1GEX A;  1KX4 B;  1BJ4 A;  3DC1 A;  3C1B A;  2ARO B;  5GSU A;  1B9I A;  5AVB D;  3NYT A;  2WK7 A;  3K7Y A;  3Q8N A;  2DQN C;  7AAT A;  2YHK A;  4JF1 A;  2BYM A;  5B33 A;  1ASE A;  3AZF D;  4W1V A;  3AYW B;  2FJ7 C;  4JEY A;  3MGP B;  3AZK B;  3ZRR A;  3AZI B;  2BWP A;  4J8U C;  1DTY A;  2JGT A;  3AZE C;  3CAI A;  4RIT A;  3DR7 A;  3AZJ C;  3GBX A;  5F99 C;  1DJE A;  4H9N A;  2JIS A;  1WWS A;  4A6R A;  2YKU A;  5AV8 B;  3E6G A;  1P3A D;  1DGE A;  1WYV A;  3LVK A;  4KAM A;  5AV9 C;  3GET A;  5B1M A;  1G4V A;  5M4D A;  4IXZ A;  3AZG A;  5B0Z A;  3AFA A;  3TQX A;  1P3I B;  3R45 A;  2NMP A;  3TFU A;  3REK D;  4WU8 A;  2ZM5 A;  4GRX A;  5G09 A;  3LZ0 A;  2YFV A;  3A6N C;  3FQ8 A;  2HOR A;  2CV5 B;  3P5J B;  4AO4 A;  4ADB A;  1TPL A;  5GT3 A;  3ASA A;  3MGS D;  4WLH A;  3KUY B;  4DQ6 A;  1B67 A;  1I48 A;  3ASB A;  4XZQ D;  3X1T D;  4G91 B;  3GR9 A;  4Z5T A;  1TAT A;  3AEJ A;  2W7F A;  1EJI A;  2O0R A;  1QIS A;  1I29 A;  3KXB B;  5BNV A;  4R8P C;  4QLC C;  4J8U B;  1BW0 A;  3WTP C;  3II0 A;  3X1S B;  1U08 A;  2VGW A;  3E2Z A;  2R5E A;  2AAT A;  3EI9 A;  2GB3 A;  5M4B A;  2F8N A;  4Y0D A;  1H3O A;  2CH1 A;  4NE5 A;  4WYF A;  3B1E A;  3NUB A;  5CP6 D;  1X0M A;  4ZBJ B;  4RJY A;  3FCR A;  4GE7 A;  2HP1 A;  3AZL D;  4LNM A;  5B2I C;  3MKJ A;  3ZRQ A;  4U1T A;  1JS3 A;  2CWE A;  5B1L B;  3RBL A;  3H9X A;  5E5I A;  5AVC D;  2BYL A;  3RI6 A;  4WD2 A;  1BT4 A;  1M18 B;  5CPI A;  2BI5 A;  4XUJ D;  1P3A A;  3BC8 A;  1AMA A;  2AY7 A;  1ZLA B;  3HVY A;  4N0W A;  1KX3 C;  5B32 D;  5D5S A;  3TU4 D;  4MKK A;  4NE3 A;  1M19 B;  3LEL C;  4QLC B;  2VLH A;  3FRK A;  2YKV A;  3REK A;  2Z1Z A;  2YCN A;  3ECD A;  1B5O A;  4KUD D;  2ZC0 A;  4M2M A;  4B98 A;  1ASB A;  1BQD A;  3BWO A;  2ARO D;  2BYK B;  3R4T A;  4WJ3 C;  4RJ0 A;  4UUZ A;  3O62 C;  1EQZ B;  1M32 A;  4LD9 C;  2D63 A;  3AZH C;  1BH8 A;  4Z2M G;  3MGS A;  3AZK D;  4WBT A;  2Y2O A;  4XZQ A;  3X1T A;  1B4X A;  4OCA A;  4CSR B;  3REL B;  1QGN A;  4K05 A;  2FN6 A;  3W97 A;  4J5U A;  1S32 D;  5FUG B;  3EPK A;  2BYJ A;  5EAV A;  2AEV A;  3KKI A;  3MGQ D;  4WNN B;  2AY3 A;  3QBO A;  2VQR A;  2YKY A;  3E9K A;  1GC0 A;  2DKB A;  3NYU A;  3UT9 C;  3H7F A;  2Y2L A;  1C7N A;  3W96 B;  5GT0 B;  3G8M A;  5B31 G;  3PPL A;  2TPL A;  4J8X B;  3RBF A;  4HF8 A;  3N5M A;  2F2A C;  3MEB A;  4H9R A;  3AZM D;  1B5P A;  5EFS A;  5CP6 A;  3LEL B;  3W99 D;  5JAY A;  2GMS A;  4K2I A;  3EI7 A;  2BI1 A;  2W7J A;  1TOI A;  4X23 B;  3PD6 A;  3AV1 C;  3AZL A;  2VGV A;  5EUN A;  3KUY D;  4WB0 B;  2Z1Y A;  1TAS A;  3O62 B;  2AY8 A;  2YFW B;  2KFP A;  3GJU A;  2CTZ A;  1P3G B;  1HQ3 C;  1Q9C A;  1ECX A;  3MAF B;  2VMZ A;  2HIO C;  2C44 A;  4XUJ A;  3MC6 C;  4J8U D;  5JA4 B;  3X1S D;  2X5F A;  5B32 A;  4GE9 A;  4F5J A;  3TU4 A;  3N75 A;  4ZAS A;  3EPH A;  3HMU A;  4WU9 B;  3WY7 A;  1Z2C B;  2JJG A;  4IYO A;  4CAY B;  4KUD A;  2PO3 A;  2ARO A;  2G5H C;  1M0O A;  3LZ1 C;  4GE4 A;  3EUC A;  3KE3 A;  3LJA B;  2R2N A;  1SZK A;  1AHG A;  4H51 A;  2FYF A;  3A6N D;  2QSR A;  3AN2 C;  3AZK A;  2V1P A;  3E2F A;  1QJ3 A;  1V2E A;  2VMQ A;  3VOM A;  1GC2 A;  1S32 A;  2CIN A;  2AY9 A;  3G0T A;  1BJW A;  2PYO C;  4ZWV A;  4ZDP A;  3B0C W;  1C4K A;  3MGQ A;  1WYV B;  3UWC A;  3H0R C;  1GD9 A;  4FL0 A;  3QM2 A;  3JTX A;  5BT1 C;  4OMA A;  3AZG B;  4RLG A;  3QPG A;  3AFA B;  3A2B A;  1ASN A;  1UU1 A;  4HVK A;  1M19 D;  1P3I A;  3D6K A;  1F66 C;  4QLC D;  2CY8 A;  3AZN C;  4OC9 A;  2BWN A;  3LZ0 B;  1JS6 A;  1ZOD A;  1P3F B;  1M6S A;  4A72 A;  5C6U A;  3FSL A;  1W3U A;  3X1U B;  2BHX A;  3W99 A;  2NZD B;  4ITX A;  3B0D C;  5DNM C;  3TAT A;  1P3B C;  3H0M C;  4W1W A;  2CFB A;  3KUY A;  1MAP A;  3DU4 A;  5BJ4 A;  3E2Y A;  2QMA A;  3FQ7 A;  3REL D;  2W8W A;  4Z5T B;  1G4X A;  3AV2 B;  4ZUX B;  1AMQ A;  2CAN A;  5B2I D;  3KXB A;  4XAU A;  4J8U A;  3X1S A;  3F9T A;  3A9X A;  4QGR A;  2QLR A;  4WYE A;  5M46 A;  3W96 D;  2VGT A;  2OAT A;  3B46 A;  4JEW A;  1V2F A;  3LWS A;  4Q6R A;  2YRR A;  1H3O B;  3W98 C;  1LK9 A;  4J8X D;  3A9Y A;  5AVB B;  1JFI A;  3LEL D;  3PDB B;  3PGY A;  3AAT A;  3VK3 A;  3UTB C;  5F8V A;  4X23 D;  2F8N H;  3AZF B;  3PIU A;  3WAA C;  2D61 A;  1UKJ A;  1M0P A;  2ZP7 A;  3O62 D;  3PDX A;  4G92 B;  1P3G D;  2JCH A;  1TZY C;  5B31 C;  2JJE A;  1AOI C;  4R5F A;  4A0H A;  3VP6 A;  2BIA A;  4UHM A;  1Z3Z A;  3L8A A;  3FKD A;  1M19 A;  4AWL B;  2E7U A;  4QLC A;  4XJM A;  3REK B;  2W7L A;  4IW7 A;  2BI3 A;  3UT9 D;  4A0G A;  5G4I A;  3I4J A;  2BYK A;  2VGS A;  1P3K C;  3ATH A;  5DX5 A;  2Z9W A;  3REJ C;  1AJS A;  2BG1 A;  2FFF B;  2G5I C;  3LJA D;  1O69 A;  1P3M B;  3HBX A;  3X1V C;  1DGD A;  1SF2 A;  2W8U A;  2HOZ A;  4ZM4 A;  3BS8 A;  2ZSM A;  3ACZ A;  1YJZ A;  3X1T B;  4PFN A;  4LW2 A;  4CSR A;  3REL A;  4F5F A;  4YS3 C;  5HXX A;  5E5A C;  1S07 A;  3AV1 D;  5FUG A;  1ASG A;  5B2I A;  4IY7 A;  4Y0H A;  4WNN A;  5B0Y C;  1HQ3 D;  4UOY A;  3MGR C;  3W96 A;  5GT0 A;  2AY5 A;  1ARS A;  2JE5 A;  1WYU A;  4F5K A;  4J8X A;  3NYS A;  2IO5 C;  4EO5 B;  1M1A C;  2OKK A;  3AEL A;  3EPL A;  3X1U D;  1AIC A;  1DJU A;  3JWA A;  4LNL A;  3LEL A;  2G7J A;  2NZD D;  2VMY A;  2XD1 A;  3MNN C;  4X23 A;  4OBU A;  1RVU A;  3LZ1 D;  2Z9V A;  5G2P A;  2W7H A;  4WB0 A;  2W7K A;  3O62 A;  2YFW A;  5AVC B;  2DF4 C;  1P3G A;  4ZUX D;  1TAR A;  3MAF A;  3AN2 D;  2VMP A;  2C81 A;  5CPJ C;  3N4S A;  1WWI A;  5JA4 A;  3B6F C;  3VAX A;  3TU4 B;  4HGA B;  4RAE A;  5DNN B;  4H9S C;  1OXP A;  3CQ5 A;  4WU9 A;  4JF0 A;  1AJR A;  4IYO B;  1P3L C;  4KUD B;  4CAY A;  5BT1 D;  3UT9 A;  2W8V A;  1MDO A;  3MGR B;  1P3O C;  1S08 A;  3AEN B;  3DXV A;  2D65 A;  5EUD A;  1F66 D;  4ADC A;  1AHF A;  3NNK A;  4KGC B;  1FG3 A;  3LJA A;  3JW9 A;  4DGT A;  3REI B;  3REH B;  3KWQ C;  4E45 A;  3BCA A;  4ZWM A;  4J8V B;  4M2J A;  1S32 B;  1AY4 A;  2WB6 A;  2CB1 A;  2E54 A;  4IXO A;  5BS7 C;  3MGQ B;  1Z7D A;  1CQ6 A;  4RKC A;  2O7C A;  3JZL A;  3WKJ C;  1HQ3 A;  1SZS A;  2D64 A;  4KXK A;  2DKJ A;  1ARI A;  3N4R A;  1CL2 A;  4DRB A;  5B2J C;  4JEX A;  2W7E A;  2HUE B;  1BQA A;  3WZF A;  5EQC A;  5G4J A;  2OKJ A;  3AZM B;  1P3F A;  4ZSY A;  5AV6 B;  3MVD C;  5DJ1 A;  3FFH A;  3X1U A;  3A1K A;  3W99 B;  4F5G A;  1AHE A;  2NZD A;  4B9B A;  4LC3 A;  1YAA A;  1P3L B;  1P3M D;  1OHW A;  3LZ1 A;  4WYA A;  3V9R B;  4ZLV A;  1YIZ A;  1G7W A;  3B6G C;  3AV2 A;  4ZUX A;  3ELE A;  2FJ7 B;  3AN2 A;  1B6W A;  3AZE B;  3AZJ B;  4Z66 C;  5F99 B;  1D7S A;  1TZY D;  5B31 D;  4EU1 A;  3AEO A;  1JF9 A;  1AOI D;  4R2N A;  1IJI A;  1ZC9 A;  2Y2G A;  1ASA A;  5IWQ A;  1BS0 A;  5AV9 B;  3QN6 A;  1GEY A;  2EZ1 A;  3WCN A;  5DJ9 A;  2BWO A;  3IHJ A;  4ZM3 A;  3QI6 A;  5B2J B;  1JFI B;  2W8J A;  5AVB A;  1TOJ A;  3FD0 A;  1F66 A;  3PDB A;  4UHO A;  5JRG C;  3AOW A;  4OBV A;  1AKB A;  3AZF A;  2NQB C;  2R5C B;  3A6N B;  2VLF A;  2C7T A;  1N8P A;  3WCO A;  1F1E A;  5CPK C;  2F8N G;  3UTA C;  2XBN A;  3FDD A;  3X1V D;  2V0Y A;  1P34 C;  1TOK A;  2L5A A;  3AEM A;  2FM1 A;  4WYG A;  5GXQ C;  3I16 A;  3B6G B;  4YS3 D;  5E5A D;  4MQP A;  4XQ2 A;  4R8P B;  5DNN D;  3AV7 A;  3WTP B;  2XH1 A;  4H9P B;  3I5T A;  4XJO A;  1TOG A;  3EIA A;  3MGR D;  1SVV A;  2W7M A;  3DRD A;  1AJS B;  4KGC D;  5E3K A;  2VYC A;  3P6K A;  3REI D;  1P3M A;  1M1A D;  3REH D;  2VMO A;  5M49 A;  1BKG A;  3FDB A;  4J8W C;  4BA5 A;  2BI9 A;  4J8V D;  4XJP A;  3MNN D;  5B2I B;  5CHL B;  3EPJ A;  2PB2 A;  2Y2M A;  4P7Y A;  4UQV A;  3T32 A;  1TZY A;  2Y2H A;  1AOI A;  4ATQ A;  1WKH A;  5CPJ D;  1WYU B;  3WLX A;  3B6F D;  3FVS A;  1BH9 B;  1KX3 B;  1M0N A;  5AV6 D;  1M0Q A;  2YKX A;  1PZR A;  1VJO A;  2BIE A;  3C1B C;  4PVF A;  2BIG A;  1P3L D;  3OKS A;  1BFM A;  1P3O D;  1N31 A;  5B33 C;  3LVM A;  4LD9 B;  5AVC A;  4P3M A;  2HOY A;  5E4Z A;  3AZH B;  4K2B A;  4F5L A;  2FJ7 D;  3A9Z A;  3GZD C;  1ASD A;  3LVL B;  1N1J B;  4JJN C;  3AZE D;  1BJN A;  3AZJ D;  5F99 D;  1IAY A;  5E5A A;  3QHX A;  5B40 C;  5B1M C;  5DNN A;  3A1I A;  3NU8 A;  4H9O A;  4LNJ A;  5B0Z C;  5AV9 D;  4BA4 A;  1ULY A;  3WKJ D;  4CXQ A;  4OTL A;  3UT9 B;  3R9A A;  4A0F A;  4WU8 C;  1CL1 A;  3MGR A;  1PFF A;  5B2J D;  3AEN A;  1P3P C;  2BKW A;  3DOD A;  1B9H A;  4KGC A;  1OXO A;  4R8D A;  4Q31 A;  3REI A;  2HUU A;  5B32 G;  1M1A A;  3REH A;  4A00 A;  2Z61 A;  5GT3 C;  1IUG A;  4WP0 A;  4J8V A;  1MDZ A;  4MKJ A;  2HUF A;  3MNN A;  3AV1 B;  2W7D A;  5F9S A;  2HUI A;  1DFO A;  3AEJ C;  2VMU A;  3BWN C;  1OHV A;  1R4V A;  1HQ3 B;  3B6G D;  3VH6 A;  2RFV A;  4R8P D;  2HIO B;  1KKJ A;  3WTP D;  1M4N A;  4Z66 D;  3AZM A;  1RV3 A;  5AV6 A;  1ASF A;  4H9S A;  3WGB A;  2OQX A;  4RKD A;  1P3L A;  1G7X A;  4KHA B;  3NRA A;  3RQ1 A;  4ITG A;  1P3O A;  3LZ1 B;  3V9R A;  4ZDL A;  1SFF A;  2HP2 A;  4OT8 A;  2NQB D;  2FJ7 A;  1YOO A;  1CQ8 A;  2X5D A;  3AN2 B;  2AY1 A;  4ZSW A;  3AZE A;  3ZZJ A;  3VH6 T;  5CPK D;  3AZJ A;  5CPI C;  1W23 A;  3UTA D;  5F99 A;  1ZOB A;  1P3A C;  1AMR A;  2VMT A;  3JWB A;  2PYO B;  1Y4I A;  5BS7 A;  5GXQ D;  2YOB A;  4AZJ A;  5AV9 A;  3WKJ A;  1KX3 D;  2VMN A;  3VK2 A;  1IAX A;  5I92 A;  2W8S A;  3B0B A;  5B2J A;  3B0C T;  1F66 B;  3AZN B;  3TFT A;  5FT6 A;  4ATP A;  1AMS A;  4PIW A;  4EMY A;  2G6W A;  4W1X A;  2R5C A;  3A6N A;  1PMO A;  1YIY A;  1ASL A;  3B0D B;  1KX5 C;  4JEZ A;  4LD9 D;  3MGS C;  5DNM B;  1T3U A;  2Q7W A;  1P3B B;  3AZH D;  4OYT A;  4L0O A;  4XZQ C;  1QZ9 A;  2VMV A;  3W97 C;  1IX7 A;  3FQA A;  3B6G A;  3WGC A;  2HZP A;  2VIB A;  4R8P A;  2ZY4 A;  4F5I A;  3WTP A;  1AHY A;  3KFU G;  3HQT A;  1RVY A;  4H9P A;  4Z66 A;  3NQU B;  1V2D A;  2YCT A;  1MGV A;  3HLM A;  4MQQ A;  1QIT A;  2ZJG A;  3WA9 C;  3W98 B;  1C9C A;  2ZSL A;  4BQ0 A;  5G49 A;  3BV0 A;  1ARG A;  1P3W A;  2Y2J A;  3C1C C;  1WYT B;  3CBF A;  3M5U A;  4EFF A;  2W7G A;  5AY8 C;  1D2F A;  3UTB B;  4Y0I A;  2D7Z A;  1U35 C;  2NQB A;  3WAA B;  5KDM A;  1ARH A;  5J8Q A;  3USF A;  1CZC A;  3EI5 A;  3UTA A;  4A6T A;  1TZY B;  5B31 B;  4XUJ C;  1AOI B;  1OHY A;  3G7Q A;  3EG5 B;  4ADD A;  2RIQ A;  4JJN D;  2EYQ A;  2HIO D;  5B32 C;  4E3Q A;  4YM6 C;  1LKC A;  3RCH B;  1FG7 A;  1H1C A;  3FZ6 A;  2Z9U A;  1BH9 A;  3PAA A;  1KX3 A;  1ASC A;  3A8U X;  3NU7 A;  1KX4 C;  5B40 D;  4UHN A;  1CS1 A;  3IP4 C;  4U2H A;  4FFC A;  3VK4 A;  2ARO C;  4AH3 A;  2FQ6 A;  4GSA A;  1P3K B;  1P3P D;  3NDN A;  4WXB A;  3REJ B;  3DYD A;  3AYW C;  3WA9 B;  4LD9 A;  3MGP C;  4H63 Q;  3AZK C;  3X1V B;  3AZI C;  3AZH A;  1IX6 A;  2VMW A;  1MAQ A;  3C1C B;  4RM1 A;  1N1J A;  1PMM A;  3BB8 A;  2VMX A;  3MAU A;  2Z9X A;  5EIG B;  4YS3 B;  1GBN A;  3DZZ A;  5E5A B;  5AV8 C;  1OAT A;  3WTP E;  1U35 B;  2Y2P A;  2LY8 A;  2DGL A;  2PYO D;  1ID3 C;  4H9O B;  4F4E A;  3EI6 A;  5B0Y B;  2Y2N A;  1P3I C;  4NE6 A;  4WXF A;  1AAM A;  5AX8 A;  2XD5 A;  1BJO A;  1RV4 A;  3AZN D;  2ZUK A;  2IO5 B;  9AAT A;  1M1A B;  2CV5 C;  1WST A;  2F8N D;  1C0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...