3N7NA

Structure of csm1/lrs4 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
163
Chain Sequence
PLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords Monopolin complex subunit CSM1
total genus 53
structure length 163
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3n7nA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n7nA02
4N3YB 1WT6A 3OJAB 4O9BA 4GIFA 5BU5A 3U1CA 2FXMA 3N4XA 5BVZA 3HRNA 3N4SA 3U1AA 4ZKPA 1IC2A 3BATA 4I1LA 4N78D 3U59A 2JEEA 3VP9A 3BASA 3N4RA 3VP8A 5BU8B 5KTBA 2POHA 1X79B 3N7NA 3C9IA 4ZKUA 3P8CD 1NKNA
chains in the Genus database with same CATH superfamily
3LVJA 5C39A 4JF1A 1DFOA 4IXOA 1CS1A 2CTZA 4IL6H 1KMKA 1JM0A 2BYLA 2AY3A 1T2KC 2R44A 2K9JB 1L0LD 3FVSA 3NYTA 1RF1A 3QM2A 4F5JA 2ZVOB 2WVRA 3R9AA 1KILC 1MDXA 4NPDA 2HFED 2W7IA 1K04A 5J8QA 2NPSA 2QLRA 3MAFB 2BWPA 5KLVJ 3D71A 4JYBA 4EDFA 1TOJA 3LVLB 3F89A 4BRYB 5KJ7D 2M3BA 3CCMP 2R5DA 2E75B 1KILD 3O6QB 2EH6A 4WY4C 2WZ7A 3CXHH 4WBAA 4W80A 4KT0J 2QM8A 4XJOA 4PD4I 4RO0A 3R4YA 1HBWA 1CQ7A 3COGA 1B5PA 3L70J 4W1VA 1VJOA 2J59M 1OVVA 3ASAA 1OVRA 3V2RA 5AVUB 3JCUE 1FZAA 1LW4A 3JC22 1NGMB 1GTWA 1EC5A 2DGLA 1MUUA 2JR8A 1GC0A 3H1LJ 3L71E 2FXOA 2V7QJ 1PP9G 1ELUA 1IX8A 2FYUE 2YIUB 3PP5A 1C7GA 2D7YA 2ZYDA 5KLVE 1JY2O 1XI9A 4ZLVA 5APXA 5HHYA 2QM7A 2VMNA 3D6KA 5KAIE 1FOSF 3BV0A 1SZUA 3L44A 4CXQA 1T3JA 2VGZA 3Q8NA 4GE7A 3ZDMA 4B98A 1MDZA 2Z20A 1FG3A 1LS3A 1S08A 4ZNCA 4BQ0A 2HP1A 3H1KJ 3CCJP 1GDEA 3SFDC 4WB0A 4XEWA 5B66H 2N1TD 4P7YA 3RK3B 4GKGA 2CJHA 1NVOA 3V4WA 4Q75A 3I5CA 4NPFX 1GL2B 2VMQA 2CPBA 2R2NA 3WZFA 1WKHA 3FWNA 2CPSA 3IFMA 3FKDA 4A0GA 5BJ3A 2BIEA 2HORA 3GG2A 2ZAEB 2GUVA 2W7FA 2P67A 2OTJP 3HUSA 3P1TA 2PB0A 2WSEJ 3EFFK 2FYNB 2IBZI 2XDJA 1GCKA 2VMVA 4UHMA 2MKVA 3VMYA 3OKSA 4A72A 2BI2A 1LKCA 5G09A 1O69A 1JOCA 2BIAA 3QPGA 3BCCD 3BWNC 5AW7B 3KE3A 1ZP0C 3K5BA 3VAXA 1ASFA 1JMBA 3AE3C 1WMKA 2IYPA 5H2FE 2IFNA 3S9OA 2KFPA 2XNDH 4HKZH 3PA9A 5I92A 3AEEC 2W8WA 5CCHA 3TF5A 4EMYA 3EIBA 2BASA 3H1HE 1BE3D 4RIZA 3VOPA 5DJUB 2ZUKA 3ZRRA 4BA5A 1B9IA 3FXEA 2ZVNB 1ZR2A 1CZCA 5B66E 1BS0A 1KV4A 2G6WA 1N2DC 2WK9A 3CCQP 1RHZB 2K3RA 2CJDA 3TATA 3N4SA 4QGRA 3H1HG 1ZOYC 4W1WA 1AY5A 2M3EA 3DRDA 2FNIA 2KLVA 3CL3D 4L73A 1WYUB 4H0LB 3VP9A 1LP1A 2W27A 2VI9A 3TSIA 2E7IA 2QIWA 1D2FA 1FZEA 2OKJA 1LTIC 1YI2P 2W7EA 3AV7A 3CD6P 1NU1G 1L0ND 2YO3A 2XNXA 3QN6A 4C7NA 4H44B 3I16A 3W68A 4LNMA 1R5LA 3IN6A 2BKWA 1L0LJ 1ASLA 3CC4P 4GE4A 4WD2A 2O3JA 4F5KA 1IBJA 1ZV8A 5AVQB 3L74D 4W7ZA 1V2DA 1YJSA 2VMZA 5IWQA 2W8UA 4DOJA 3IAOA 4Q76A 4UB6E 4KJMA 3H1JD 1KILB 1IAYA 1CZQA 5BVZA 2R0TA 1KB9E 1W3UA 1SQVE 2ZY2A 2VLFA 2AXTH 1S09A 1VQ6P 2OATA 5CBNA 1W2BO 1G7XA 3P8CE 2ZY3A 4IYOB 3L75J 4M2KA 1VQ8P 1M4NA 2P7JA 3B5NB 3CX5D 1BQDA 3WKSA 3W67A 2EZ2A 4Q6RA 1AHEA 1BT4A 4Y99B 4TMRA 3RL0g 4FL0A 3IR9A 5CMZA 1FZCC 4AH3A 2QJYB 1N7SB 1PL5A 2NPSD 4U7JA 3V4QA 3AE4C 1E5EA 1O61A 2P58A 2D7ZA 2YMYA 2BEZF 3RGUA 3D6ZA 5KAFE 3PAAA 3I5TA 1IK9A 3L75E 3ZRQA 1KMIZ 3L73G 1H0TB 3G8MA 1CL2A 2D64A 1PV3A 3FGAD 1O4SA 1Q81Q 1S06A 4ZSYA 4H44D 2VMSA 4PD4H 3MAUA 2E76C 5AW8B 1N8RQ 1SQXE 2LKMA 3CQ6A 1AKBA 2QBTA 2KS1A 2VMPA 1WYTA 3BCAA 4K3AA 5EIGB 3QBOA 1PG8A 5F8VA 1L2PA 3GHGB 2W83C 3Q5SA 3MP7B 5B5EH 3VYIA 2RH0A 2FNUA 4GDYA 2PB2A 2OKKA 1JY2P 1S1CX 1BSNA 4K2IA 2Z5IA 4JF7A 3M5UA 3E7KA 1Y4IA 1AJSA 1QX8A 1URQB 3N5MA 1DJUA 1RY3A 1QL2A 4IW7A 4WYAA 3AE5C 2ZYAA 1LTJC 1LT9A 4R4LA 1SQPK 1WYTB 2YCNA 3WCOA 3A0BH 2VGSA 3A0BE 2FYNC 4WXGA 2WPQA 1M1JB 4Z1MH 5CCHC 1NHLA 3G9RA 2RKLA 4DT0A 3WUVA 1DGDA 4U3FJ 3UE8A 2FXMA 2KB7P 3GF3A 3M9HA 4CPGA 3E2ZA 5EUDA 1BKGA 2H88C 3L70E 1LWUC 1ARIA 1BQAA 1N2TA 4ADDA 5HXXA 4MSOA 4EB5A 1UU0A 5DJTB 1ZXGA 2HUIA 2YKUA 5M4DA 1V2EA 3H25A 1J1DB 3JWBA 1SFCC 3VP6A 2NPSB 1M8OB 2W7HA 1M6SA 1NTZD 1SQQG 1OATA 3PTZA 3WX9A 3H1IJ 1IFJA 1HJ0A 4D6TD 3V5BA 3PDBA 4D6TG 1XTGB 1AY8A 4JPZB 2PO3A 3LW5H 2ZYGA 3V2QA 1YHQP 3G7QA 2E7JA 3E1RA 3K7YA 1GK4A 1PFIA 4AZJA 2JO1A 3ELEA 3NTNA 4E1OA 1O62A 4R2NA 1KL2A 1L0NG 2O1JA 1PPJG 3ZRPA 2UWJE 3BRVB 4EFFA 1BGYE 2ZT9B 5APQA 2IZ1A 2V1PA 1SQXD 3GZCA 2OYOA 1GK6A 3VMXA 1H88A 3BASA 5APUA 2IBZE 1GD2E 2XKMA 5KLIC 2X8UA 4H13B 1L0NE 2VGWA 1YQ3C 1H1CA 1U7JA 1YJNP 3NNKA 4H44C 4DJGA 3TYYA 4OGQB 2QJKB 2WSCH 1GW4A 1SQXG 3ISLA 3W1JA 2WQYC 1M0PA 2QSRA 3FWLA 1EDIA 3CLQA 2E75D 4DZOA 1DX7A 5AW1B 2WKAA 2EO5A 2I8DA 4EU1A 1JCDA 2Z1YA 1ASNA 3NYSA 3TDKA 4Y0HA 4MN4C 1YIYA 2VMTA 1VP4A 2CB1A 4YTPC 1T6AA 1JY2N 5APSA 2L91A 3B5NC 4W91A 2N1TA 1GL2A 2KP8A 4IFFA 2WSFJ 1DEEG 1SP4A 2IBZD 2WMMA 4OYTA 4GODA 3RUYA 1W7MA 1VQPP 1VQ4P 3L74J 2FYUJ 1FZCB 2YRIA 1M57D 4U2HA 3R2PA 3B5ND 5DX5A 5HDMA 2YMKA 2WT7B 1LK9A 3MTUE 1OX3A 4JYCA 1RVUA 2EZ1A 1QZ9A 4IXZA 1USEA 3HVYA 3KQGA 1D7UA 3C9IA 1GC2A 1XEYA 3LV2A 2AATA 3NYUA 1SQBG 5K5GB 1NTKD 3GW6A 3LW5J 3G71P 4MQPA 2R5BA 1G1JA 3Q3DA 1KTMA 2B87A 4L75A 3ITKA 5C6UA 1HGZA 1G7WA 1KKPA 4OC9A 1M1JC 3RQ1A 1OMIA 3AEJC 2QA3A 3L37A 3MUDC 3S4RA 1WYVA 1NTKG 2AEFA 3GR9A 3GZDA 2DGMA 3RCHB 1J04A 4P3MA 5AVYB 1UU2A 1RVYA 4M2MA 1CSBA 4PIWA 1BCCJ 2KIKA 4UHNA 3FX0A 4ZWVA 2C81A 3L73E 3FQ7A 3AE2C 1VF5C 3L70D 4K05A 5KJ7C 1C9CA 1YITP 3OW2O 1NWQA 4ZDLA 4ATQA 1ASAA 2OYHB 2KZJA 3QI6A 5EAVA 3DR7A 1NTZG 2W7MA 1WYUA 2WSEH 3H1JG 1UIXA 1FS0E 2BCCE 5CBOA 5KTBA 3CCUP 1JNMA 3KPEA 1X2AA 2KSJA 3L71D 1BE3E 3CMAP 1NTMD 1BGYG 1YNUA 4RITA 4CXRA 3HTKB 1EQ7A 3BCCJ 2Q7WA 2FKWB 4HJGH 1QJ5A 4C7RA 2W7LA 2OYHC 1M7LA 3S1KA 1VQKP 3MEBA 3FVUA 1T3IA 1GEXA 1E5WA 3L35A 4IOIH 3B46A 2PFXA 1FZBA 3P7KA 3CC7P 4A0RA 3EIAA 1XTCC 3MAFA 4RJ0A 2YXQB 3HDOA 3FSLA 4XA4A 2YHKA 3G4SP 1M56D 1SFCB 4PVFA 3SSUA 4M2JA 3FRKA 1NAFA 2A45H 4LNLA 4W1XA 3HLMA 1LWUB 2QB2A 3NU7A 3A9ZA 1URQC 3HTKA 1KD1Q 1OVUA 1LP1B 2Y9YA 1KB9H 3GJUA 1D7VA 3DXWA 5APTA 2H43A 2Z9VA 1AICA 2WPRA 2YKVA 4LLHA 4OVNF 1Y8AA 1Q86Q 3N0LA 3AE7C 1D7MA 1W7LA 2D63A 4UHOA 3L71G 3MC6C 2G7JA 2C9LY 4A6RA 1AY4A 1SQQJ 2EYQA 3JCUH 1FOSE 1SZKA 4H13C 4L76A 4GDOA 1DH3A 2E76D 4D6TJ 3B71A 3CPWO 4EOTA 3CCVP 4DQ6A 2WSCJ 4H63Q 4J5UA 1SQQE 1YOOA 3OP7A 1AMAA 3MD0A 1FE6A 1SF2A 3E2YA 1LC5A 4PV1C 2QA4P 1S4XA 1SVVA 1T2KD 3BC8A 4TLFA 3EZ1A 4A0HA 2FFDC 1NU1K 1SQBE 1ZW0A 1HGVA 1SQBK 3A2AA 4JEWA 2ZC0A 2RFVA 1BJ4A 1NTME 2GMUA 4MQRA 4W7YA 3BN1A 1AAWA 2O01J 4YXDC 1VQ5P 1RV3A 3FTBA 2GSAA 1AVOA 2BCCD 2IPPA 3M0DC 4WY4A 3PPLA 4GEBA 2RN0A 1SQXK 4OH8B 1KZUB 3RL0B 4PFFA 1WKGA 1OW7A 1NTMG 3MKJA 4PFNA 1N73C 4R5FA 4ASVA 2E5TA 2OGAA 1NOHA 3B1CA 2B87B 4AUWA 1BSHA 1FU1A 2X5DA 1PMMA 3WU2H 5M49A 1YAAA 2VYCA 4K2MA 3IHJA 4N6JA 3F9TA 3EI7A 2CANA 1H89A 2W6JH 1U57A 5KAFH 3KXDA 1EZVG 1PP9E 4ADBA 1AIAA 3CXHE 4WXFA 1IJIA 3CCRP 1NTMK 2RMZA 3Q5RA 1B4XA 3AE9C 2D65A 2DOUA 3L8AA 1M1JA 3BWNA 3DYDA 3WMM0 1SQVD 2EPJA 1B5OA 1SQPJ 2FM1A 3U1CA 3PGYA 1Q90D 4BA4A 4AZKA 3JWAA 1QLED 1FDMA 2ZFCA 3HE4B 2LXBA 3KKIA 3QWOC 1VQ9P 2AEMA 1DIPA 4ZM3A 2FBWC 3G6EP 2R5CA 1AMQA 3H32B 3AOVA 1G1IA 1FAVA 3VK4A 3I55P 3N4RA 2J5UA 4E3QA 5KJ7A 4JF0A 3HUSC 1IK7A 1ZLLA 2H89C 3QH9A 1V72A 1GW3A 1HTLC 1SPAA 3H1HD 1URQD 3MGNA 1YJWP 5DB5A 1LW5A 3FZ6A 3ELPA 5FT6A 2VRSA 2K9YA 1P84I 2P2UA 1T8ZA 3CI9A 1BW0A 3ASBA 3CC2P 1AAMA 4MKJA 5BU8B 1LJ2A 5AVTB 3VMZA 1LGHB 2O01H 1TARA 3V2NA 3G0TA 1RQUA 2DW3A 2V7QH 3CCEP 1BCCE 3HD7C 5B5EE 3HE5A 1CW5A 4OBUA 4ZKPA 2V4HA 3FDDA 1KQGB 5E5IA 4JBZA 2FQ6A 2XBNA 2VMRA 1HWTC 5G2QA 4GT1A 2E75C 1KQFB 4XJLA 1NTZJ 1IFPA 3KHUA 3E1IA 3H1JJ 4GOEA 3HD7D 3A0HH 4Q31A 2XZRA 1AKCA 3H1LG 3K28A 4ZMDA 3RK2D 2BI1A 3AECC 1JS3A 3HD7B 1VEFA 2X5FA 1LTTC 3Q5PA 2R32A 4WYFA 1AIBA 2JJFA 2KZIA 2JISA 4PV1B 5KAIH 4ISYA 2K9JA 3HE5B 3M06A 2VMYA 3B8EB 1AHYA 3USFA 3ATHA 3I4JA 3BCBA 2AY6A 1FG7A 3H1KG 1OFCX 3CWBD 5AW2B 3AEMA 2C7TA 1AJYA 5AW0B 3NU8A 1S72P 2KNCB 3L72E 3F6TA 5CHXA 3BVHA 1FJKA 5K8BA 1NTZE 1M0NA 2QVAA 3BCXA 3O6QA 1KN7A 1ZMEC 4OWFA 3L72J 4GRXA 2E74D 1BJWA 4OGQD 5CCHD 3CQ5A 3RI6A 1OIPA 2E74B 2XV5A 3F0HA 3HMUA 2QSIA 2AY1A 1Z7DA 4WWIA 2D2CB 2FN6A 3QGUA 2HOZA 4IX8A 2KNCA 1SQVK 3PD6A 2BHXA 3EI9A 2A45G 4C46A 1VDFA 3A9XA 3GWPA 2Y0DA 1KORA 5EUEA 5G0AA 3OAKA 3MBBA 4WYGA 4KAMA 3JZLA 4PJ0H 1AJSB 1L0LE 1WRGA 3T97A 4F5IA 1N7LA 2YCTA 1GZLA 1S5LX 3WUTA 3MADA 3WGBA 3PJ0A 3RCHA 4DBCA 2ZXXA 1NJIQ 4Y28J 1X28A 4LW4A 1DJEA 3H1HJ 4OT8A 1KILE 2HG5D 4HB1A 1EDJA 1D7SA 3E9KA 2ZXEB 2QJPC 4EIJA 2FKIA 1YYCA 2JG2A 1EG5A 1SVFA 2JJHA 3W1IA 3KGXA 3LVKA 1ZODA 3A8UX 3AEBC 4H0LC 4OMAA 4BRYA 4WXBA 1LT9C 3T97B 3VP8A 1ARTA 1MFZA 1TOKA 1NU1J 3NUBA 1L4AB 2HZPA 3FDBA 5AVVB 1OW6A 1IX7A 3PHLA 2Z5HA 1M90Q 1IFMA 2BWNA 2OQXA 1RF0A 4H0LD 2MJZA 1M32A 2VMWA 1LWUA 5GTHH 2DKBA 3PJSK 3AATA 4I1LA 2O7CA 3SFEC 2VLHA 3RK2C 4A0FA 5EFWB 1ASBA 4UB6H 1RE4C 1AVYA 5AW4B 4WLJA 3TK1A 3EI6A 1KYOI 1ASEA 1KL1A 2YRRA 1LTJA 2JJEA 4I7ZB 2KYVA 1NU1E 1SQPG 2VIAA 2Z61A 2O1KA 4KXKA 3E77A 1AHGA 1L4AA 1OXZA 2GMSA 3VN0A 2PP6A 1X8YA 1I43A 3GBXA 4EB7A 3Q1MA 3M91A 2JEEA 1EXIA 4KHXA 3HD7A 3CQ4A 5KKZB 4AYCA 3C1LA 3P8CD 1NKNA 3PH0A 2OGUA 4ZM4A 1ZOBA 1UU1A 2C0XA 3TFTA 7AATA 5KLVG 5E79H 1N7SC 4WVZA 3BS8A 3FQAA 1KFNA 1LTJB 1FDOA 2CINA 4E77A 2LR2A 1L0LK 2Y0CA 8AATA 2CK3H 1AMRA 1W23A 4BWNA 3FCRA 3LY1A 2QMAA 1JS6A 2CSTA 1N7SD 2NRGA 1C7NA 5GTIH 4UB8H 4A6TA 3TGUJ 1OXOA 1AMSA 4XJMA 4MKKA 2CFBA 1E79H 3A7OA 2W8TA 1ZRTE 2A06D 5M4BA 3DZZA 4HVKA 1K05A 2YKXA 2GA1A 5CJ0A 1KILA 2AEVA 1RV4A 2JJLA 1SQQD 1IFNA 5CCGA 1U7MA 5G4IA 5D5SA 5DJ9A 4WY4D 3MIWA 1JTHB 3T32A 2K88A 1DGEA 1WSTA 3FFHA 3FFRA 4N0WA 3RK3E 3CCSP 1G2CA 5AW3B 2CJGA 2IDBA 3PD6B 3A3YB 2Q3IA 2EGYA 2A45I 2E76B 4H51A 4U1TA 1NTZK 3RK3D 5TF5A 2WT7A 4AO9A 2G8YA 1IFDA 3B5NA 1GL2C 2Y0EA 3PDXA 1J2JB 3TNUA 5AW6B 1B9HA 3GHGA 3H1IE 1AHXA 4U3FD 4O6ZA 2IYOA 4CBRA 1S0AA 4IY7A 1CI6B 3DODA 2I1JA 3RK3C 1GU5A 3KZIE 2KI7B 2OARA 1JTHA 3MZWB 4R5ZA 1FC4A 2HODB 2DR1A 1G2CB 1SQPE 1IO4A 1BJOB 1MAPA 2ZP7A 4LW2A 4E3RA 1YJYA 4J8LA 1X79B 4U3FG 3C8VA 4A7PA 1QVFO 1RF1C 1OWAA 4WBTA 2AXTE 1EZVI 1I48A 3L75D 3RBZA 1VQMP 1VPCA 2JWDA 4LNJA 2ZSMA 2N1TC 1X0MA 1J1DC 1P84H 2FYUK 3I56P 3NDNA 1QEXA 1EQBA 2NPSC 3U1AA 2HYNA 2ITAA 5D95A 4CVQA 1OW8A 2AEJA 3H1JE 3ACZA 3TFUA 1KQLA 1DKAA 2KOGA 1B8GA 4L0OA 4XK1A 4AO4A 2WWWA 1GBNA 1EZVD 2GB3A 3N7NA 2WPSA 1HVVA 4RESB 4JEXA 1KB9I 1AJRA 2QJPB 3WKRA 3CX5E 5F9SA 1OHYA 2OTLP 1R8EA 4EYYQ 3BWOA 2YKPA 3FD0A 4I2LC 2IX7C 3ABVC 3NTJA 5JAYA 1GMJA 2QEXP 1PMOA 1YJZA 5EAAA 3CAIA 5L8RJ 2JWAA 3L73D 3PRJA 1CQ6A 1Z3ZA 3P8MC 3AEDC 3JTXA 1SS1A 2B9BA 4ZKUA 4UB8E 1OXPA 2FYUD 1MAQA 1PPJD 2VMUA 3L4FA 2W6AA 1KB9D 3L72D 5BU5A 3V2PA 1X9VA 3AENA 2W7DA 5KKZC 3GZDC 2PAJA 4PV1D 4I8AA 2FYFA 1TPLA 2HOYA 5M46A 2R5CB 2E5YA 3L74E 2BI9A 2JDIH 3H1KD 1N8PA 3TQXA 4RJYA 2ORDA 1J1EB 3EQ2A 1GEYA 4BXLA 3CXHD 2C0RA 1ARSA 2HLOA 1KQSO 1SFFA 2DGKA 2ZT9C 4B86A 3FVXA 3OJAB 1T3UA 1VL2A 3AEFC 3N4XA 1AKAA 1SQXJ 2YO2A 2YOBA 3DC1A 2M5AA 1GD9A 4WB4A 1JY3N 1ARHA 3EZSA 1MLZA 5FT8A 1OZHA 3RL0C 1MV8A 2KK7A 1USDA 2XU6A 2WTYA 2VGVA 5AVWB 4OGQC 5BJ4A 4A00A 2C9NY 1BE3G 1NKZB 2Q6QA 1SFCD 3WU2E 2W7JA 4ASWA 3AEJA 1FZGA 2BIGA 3PIUA 3IF4A 5AVXB 4F5GA 2AY2A 1EZVE 3B1EA 3CWBG 5FT4A 3NMDA 5E3KA 2FYUG 2QJYC 1FBMA 1AFOA 3USSA 4XJPA 1SQBD 4WY4B 4WYEA 4W8IA 3UWCA 5TJHA 1N73B 2BWOA 2YCPA 3GSBA 1PGOA 4Y99C 4WYCA 2HR3A 3AEOA 1YTZI 3FZ8A 1KYOH 1A02J 2YNYA 4HF8A 1PIXA 3M9QA 4KYOA 3BCCE 3M9BA 1CL1A 1I41A 2AY5A 2VGUA 2M0BA 1QVGO 4LGDE 3L73J 3A2BA 1NH4A 2W90A 3H1LD 2A1VA 3P32A 3ZZJA 2Z1ZA 1AX4A 4ITGA 4XQ2A 5EQCA 3F5HA 1JY3O 3BB8A 2E54A 1L4AD 1ARGA 1IZNB 4F5MA 3AOWA 3HRNA 3VMAA 1ASGA 1ASMA 1CJ0A 3TGUG 2H8PD 5H2FH 4CBSA 1N73A 3BATA 3HT4A 1SQVG 4ADEA 2BI3A 1BCCG 4YXWH 3HL2A 4OBVA 4PJ0E 2W8VA 2K37A 1IUGA 2CH1A 1PP9D 2W8JA 1TU3F 3AEAC 1KAFA 5G2PA 3O8ZA 3II0A 4LC1A 1U08A 5TISH 1X0TA 3FQ8A 4BHDA 4DGTA 2C44A 4UQVA 1BDDA 1DD4A 4HYTB 2PGDA 2ZY5A 1AV1A 5APVA 1RF1B 3KDPB 3OA7A 1GC4A 1LC8A 3D6YA 5KLVK 5AW5B 1HF9A 1BGYJ 1X29A 3EUCA 5TISE 3VOMA 1VF5B 1EXJA 1K9MQ 2JKVA 1LNQA 3E2ZB 2WK7A 1G4VA 1KC8Q 1ZRTD 2A06E 4WLHA 4FFCA 4M3LA 4TN4A 1Y9BA 1MGVA 3A0HE 4JEYA 1VQOP 2OYIC 3DXVA 1DEBA 1R5SA 1MZ9A 2FFDB 4IFMA 1FZFA 1FDIA 3VK3A 1CZEA 3B1DA 1RE3A 1PZQA 3A5TA 2BCCG 2XH1A 4TT3H 3E2FA 2DKJA 3G3ZA 4N78E 2NZ2A 4RKDA 2AXCA 4ZASA 1SQPD 3N75A 1PGQA 1EDLA 3EWKA 3MHVA 4EI2A 2O01N 2JP3A 1QISA 1JB0J 4C7NB 1MFTA 1H8AA 1YBKA 1GU4A 1UKJA 3H1IG 3CMEP 1KFMA 4U3FE 1KYOE 2K1AA 2X3LA 2R3SA 1Q82Q 3H1LE 2CY8A 3L71J 3M0DA 2GM4A 2VMXA 1ZR4A 3CXHI 1DTYA 4LC3A 2F8JA 2W8ZA 3UIAA 2OTKE 3B8XA 3A9YA 1PGJA 5KLIB 4GE9A 3FZ7A 1VQNP 3LIDA 3WGCA 4WB0B 1YIZA 4OCAA 1CQ8A 1L0NJ 2AY4A 1E5FA 1IX6A 3KZIH 2POHA 1G4XA 1FZCA 3CX5H 3KGWA 2W7GA 2D2CD 2G3AA 4Y0IA 4O9BA 4GIFA 2NMPA 3AE8C 2OGEA 1LTSC 1AHFA 3KYQA 1DJ9A 1JCCA 3DU4A 3EFGA 1YTZT 4K35A 2QJKC 9AATA 1C7OA 1W5CE 1LTAC 1TASA 1P84E 3K40A 1VQ7P 3GMAA 1KYOD 1QL1A 4JEZA 2O1BA 4QMAA 1Z56A 1GEWA 1ORDA 4XAUA 5M1BA 1NTMJ 2JJGA 1JEKA 3WCNA 1YIJP 2WITA 2VGTA 5AVRB 4I7ZC 1QGKB 4F5FA 2KSEA 1WYVB 2KUBA 1H0TA 2YKOA 1IC2A 2IZ0A 2N9YB 1KKJA 1JMMA 2J58A 2Z9XA 2HP2A 1IVRA 3TNUB 1J1EC 1S5LE 1JF9A 5GTIE 1MKMA 2AY9A 1ECXA 1LTGC 2KS1B 1BE3J 1ZC9A 3NRAA 1TOIA 3HBXA 3CBFA 5EIGA 5DJ1A 5FT5A 1HH0A 3L74G 2H7HA 1TATA 2ZJSE 4GSAA 2VI8A 4XE5B 1PPJE 3AEMC 2O0RA 2BEQD 1DD3A 2HOXA 3LIEA 4GOFA 4H13D 1JG8A 4XFJA 4OTLA 3CWBJ 1WT6A 2Z4EA 1W2EA 3HUSB 2QG4A 2Q5UA 1M1KQ 1SQBJ 4RLGA 1D7RA 1QITA 2E7UA 3NFQA 1C4KA 1FC2C 2Q3EA 2PRRA 2QRXA 2SPZA 2HUFA 1M0QA 3H6PA 4ZAHA 1NYHA 3ECDA 4ZWMA 1SFCA 3H1KE 2W6BA 1S3JA 1JO5A 1NTKJ 1CI6A 5AVZB 2D61A 3AEPA 3II6A 4RJTA 1BJNA 3CWBE 1JY3P 1SZSA 3AENB 3CCLP 1X22A 1EDKA 2Q9IA 4PD4D 2HODA 1SQQK 4I6MC 3JSVC 3SWYA 3FXDA 3L70G 2IFMA 4IL6X 1YJ9P 2OYIA 5CCGD 4JEVA 2WPVB 1SQVJ 2R5EA 4IL6E 1MDOA 2FXPA 3RBXA 2JGTA 5G4JA 3LG0A 1RE3C 1IJDB 4ATPA 4ITXA 3AE1C 5E4ZA 4RKUJ 1BCCD 2L5GB 2WSSH 1HJBA 4PD4E 2LXCB 1PP9J 4UOYA 4F4EA 1RF0C 2Z9WA 2ZJGA 3PDBB 1VQLP 3W1HA 4NPEA 1K73Q 2M5AB 1BDCA 3RL0D 3HQTA 1Q2NA 3BCCG 1H0CA 2D2CC 1NTKK 1IAXA 1W7NA 2YKYA 3H1ID 3LVMA 3HE4A 4ZDOA 1YQ4C 5E79E 1VF5D 4HH2A 3BRTB 4RKCA 3TCMA 4L74A 3H32A 2TPLA 3D70A 3WUUA 2YKQA 2QE7H 2OYIB 5EFSA 4A6UA 2KLUA 1AQ5A 2E74C 2R3CA 1IFIA 5GTHE 4K2BA 4ADCA 2GQNA 2D66A 1LC7A 4IFDK 4F5HA 3UAKA 2FY8A 1TOGA 3EI8A 5CJ4A 3SWFA 2QB3A 5KLVD 2BCCJ 2Y9ZA 1A02F 2IBZG 2YIUC 3ZZKA 1MLYA 4DCKA 3GETA 3L36A 4R8DA 4F5LA 1NO4A 3WLXA 1OHWA 3B4SA 1PGPA 2Z9UA 1M0OA 2HUUA 3CX5I 3QHXA 3LWSA 3L72G 1ASDA 1C0NA 4IXSA 4N78D 3NUIA 1NTKE 1Q7YQ 4AQRD 4MQQA 1S9KD 4IYOA 3PLNA 1L4AC 1RQVA 3Q2YA 3JW9A 1I29A 2A06G 4D6TE 2WB6A 3P6KA 3NX3A 3MUDA 2V0YA 2OQQA 1Y47A 2W7KA 5AX8A 4NOGA 3EI5A 1URQA 2M8RA 5AW9B 4AOAA 3RBFA 2N1TB 4BMKA 4JQ0D 2BI5A 3GLMA 4R4MA 1LT1A 3TGUD 1LT9B 1P3WA 2I1KA 1N7SA 1UIIA 1K8AQ 4B9BA 4N3YB 1RH5B 1ELQA 2BYJA 2VMOA 1PFFA 4MY5A 2HPCB 1M7YA 2E42A 1J32A 1GC3A 4W5KA 1QJ3A 2AEUA 2WK8A 4RAEA 2FYZA 3TGUE 1NAYA 1BJOA 2ZYJA 1KMJA 4ZDPA 1AQTA 2P1JA 3GF7A 3RK2B 4Y0DA 1RE4A 2WSFH 3DR4A 3NXSA 1SLQA 1L0NK 1OHVA 3AE6C 2CH2A 2VIBA 4RM1A 2D5YA 3V6IA 5APWA 1HUCA 1LTBC 1QIRA 1N86A 1GDTA 2Q7CA 1L0LG 5CCGC 1S2EA 1QGNA 2FFDA 1JUNA 3RBLA 1ASCA 2YXRB 1S9KE 2HPCA 4WYDA 1P84D 3U59A 1N31A 2ZY4A 1ZN5A 5AVSB 1EJIA 1TOEA 1S5LH 3R4TA 5EUNA 2Q1KA 2ZSLA 3SWKA 2N9BA 1NU1D 4WP0A 1AA0A 2B89A 2C0WA 2KXPB 1S07A 2ZT9D 1BGYD 3AEGC 2GUSA 5APYA 2B88A 1V2FA 3WY7A 2P10A 3GHGC 2OYHA 3VK2A 3E6GA 3H9XA 3H7FA 2AY7A 1GL2D 3MC6A 2AY8A 1FJPA 3L75G 4YPCA 2E43A 4ZSWA 3VTPC 3M0AA 3AELA
chains in the Genus database with same CATH topology
3LVJA 4JF1A 1DFOA 4IXOA 1CS1A 2CTZA 1KMKA 2BYLA 2AY3A 1T2KC 3FVSA 3NYTA 1RF1A 3QM2A 4F5JA 3R9AA 1KILC 1MDXA 2W7IA 2HFED 5J8QA 2NPSA 2QLRA 3MAFB 2BWPA 4JYBA 1TOJA 3LVLB 5KJ7D 2M3BA 2R5DA 1KILD 2EH6A 4WY4C 2WZ7A 4WBAA 4W80A 2QM8A 4XJOA 1HBWA 1CQ7A 3COGA 1B5PA 4W1VA 1VJOA 2J59M 3ASAA 3V2RA 5AVUB 1FZAA 1LW4A 1GTWA 2DGLA 1MUUA 1GC0A 1ELUA 1IX8A 3PP5A 1C7GA 2D7YA 1XI9A 1JY2O 4ZLVA 5APXA 5HHYA 2QM7A 2VMNA 3D6KA 1FOSF 3BV0A 1SZUA 3L44A 4CXQA 1T3JA 2VGZA 3Q8NA 4GE7A 4B98A 1MDZA 2Z20A 1FG3A 1LS3A 1S08A 4BQ0A 2HP1A 1GDEA 4WB0A 4XEWA 2N1TD 4P7YA 3RK3B 4GKGA 2CJHA 3V4WA 4Q75A 3I5CA 2VMQA 1GL2B 2CPBA 2R2NA 3WZFA 1WKHA 2CPSA 3IFMA 3FKDA 4A0GA 5BJ3A 2BIEA 2HORA 2GUVA 2W7FA 2P67A 3HUSA 3P1TA 2PB0A 2XDJA 1GCKA 2VMVA 4UHMA 3VMYA 3OKSA 4A72A 2BI2A 1LKCA 5G09A 1O69A 1JOCA 2BIAA 3QPGA 3BWNC 5AW7B 3KE3A 3VAXA 1ASFA 2IFNA 2KFPA 3PA9A 5I92A 2W8WA 5CCHA 4EMYA 3EIBA 2BASA 4RIZA 3VOPA 2ZUKA 3ZRRA 4BA5A 1B9IA 1ZR2A 1CZCA 1BS0A 2G6WA 1N2DC 2WK9A 2CJDA 3TATA 3N4SA 4QGRA 4W1WA 1AY5A 3DRDA 2FNIA 2KLVA 3CL3D 1WYUB 3VP9A 2W27A 2VI9A 3TSIA 2E7IA 1D2FA 1FZEA 2OKJA 1LTIC 2W7EA 3AV7A 2YO3A 2XNXA 3QN6A 4C7NA 3I16A 4LNMA 2BKWA 1ASLA 4GE4A 4WD2A 4F5KA 1IBJA 1ZV8A 5AVQB 4W7ZA 1V2DA 1YJSA 2VMZA 5IWQA 2W8UA 4DOJA 4Q76A 1KILB 1IAYA 1CZQA 5BVZA 2R0TA 1W3UA 2ZY2A 2VLFA 1S09A 2OATA 1G7XA 3P8CE 2ZY3A 4IYOB 4M2KA 1M4NA 2P7JA 3B5NB 1BQDA 3WKSA 2EZ2A 4Q6RA 1AHEA 1BT4A 4Y99B 4TMRA 4FL0A 3IR9A 5CMZA 1FZCC 4AH3A 1N7SB 2NPSD 3V4QA 1E5EA 1O61A 2D7ZA 2YMYA 3PAAA 3I5TA 1IK9A 3ZRQA 3G8MA 1CL2A 2D64A 1O4SA 1S06A 4ZSYA 2VMSA 3MAUA 5AW8B 2LKMA 3CQ6A 1AKBA 2QBTA 2VMPA 1WYTA 3BCAA 5EIGB 3QBOA 1PG8A 5F8VA 3GHGB 3VYIA 2FNUA 4GDYA 2PB2A 2OKKA 1JY2P 4K2IA 2Z5IA 4JF7A 3M5UA 1Y4IA 1AJSA 1URQB 3N5MA 1DJUA 1RY3A 1QL2A 4IW7A 4WYAA 1LTJC 1LT9A 2YCNA 1SQPK 1WYTB 3WCOA 2VGSA 4WXGA 2WPQA 1M1JB 5CCHC 1NHLA 1DGDA 3UE8A 2FXMA 2KB7P 3M9HA 3E2ZA 5EUDA 1BKGA 1ARIA 1LWUC 1BQAA 1N2TA 4ADDA 5HXXA 4MSOA 4EB5A 1UU0A 2HUIA 2YKUA 5M4DA 1V2EA 1J1DB 3JWBA 1SFCC 3VP6A 2NPSB 2W7HA 1M6SA 1OATA 3WX9A 1IFJA 3V5BA 3PDBA 1XTGB 1AY8A 2PO3A 3LW5H 3V2QA 3G7QA 2E7JA 3K7YA 1GK4A 1PFIA 4AZJA 3ELEA 3NTNA 4E1OA 1O62A 4R2NA 1KL2A 2O1JA 3ZRPA 3BRVB 4EFFA 5APQA 2V1PA 3GZCA 1GK6A 3VMXA 1H88A 3BASA 5APUA 1GD2E 2XKMA 2X8UA 2VGWA 1H1CA 3NNKA 3TYYA 2WSCH 1GW4A 3ISLA 3W1JA 1M0PA 2QSRA 3CLQA 4DZOA 1DX7A 5AW1B 2WKAA 2EO5A 4EU1A 1JCDA 2Z1YA 1ASNA 3NYSA 4Y0HA 1YIYA 2VMTA 1VP4A 2CB1A 1JY2N 5APSA 3B5NC 4W91A 2N1TA 1GL2A 2KP8A 4IFFA 1SP4A 4OYTA 3RUYA 1W7MA 1FZCB 2YRIA 4U2HA 3R2PA 3B5ND 5DX5A 5HDMA 2WT7B 1LK9A 3MTUE 4JYCA 1RVUA 2EZ1A 1QZ9A 4IXZA 3HVYA 3KQGA 1D7UA 3C9IA 1GC2A 1XEYA 3LV2A 2AATA 3NYUA 4MQPA 2R5BA 1G1JA 5C6UA 1HGZA 1G7WA 1KKPA 4OC9A 1M1JC 3RQ1A 3AEJC 2QA3A 3L37A 1WYVA 3GR9A 3GZDA 2DGMA 3RCHB 1J04A 4P3MA 5AVYB 1UU2A 1RVYA 4M2MA 1CSBA 4PIWA 4UHNA 4ZWVA 2C81A 3FQ7A 4K05A 5KJ7C 1C9CA 1NWQA 4ZDLA 4ATQA 1ASAA 2OYHB 3QI6A 5EAVA 3DR7A 2W7MA 1WYUA 2WSEH 5KTBA 1JNMA 3KPEA 1X2AA 2KSJA 1YNUA 4RITA 4CXRA 3HTKB 1EQ7A 2Q7WA 2FKWB 1QJ5A 4C7RA 2W7LA 2OYHC 1M7LA 3MEBA 3FVUA 1T3IA 1GEXA 1E5WA 3L35A 3B46A 1FZBA 3P7KA 4A0RA 3EIAA 1XTCC 3MAFA 4RJ0A 3HDOA 3FSLA 4XA4A 2YHKA 1SFCB 4PVFA 4M2JA 3FRKA 1NAFA 2A45H 4LNLA 4W1XA 3HLMA 1LWUB 2QB2A 3NU7A 3A9ZA 1URQC 3HTKA 3GJUA 1D7VA 3DXWA 5APTA 2H43A 2Z9VA 1AICA 2WPRA 2YKVA 4LLHA 3N0LA 1W7LA 2D63A 4UHOA 3MC6C 2G7JA 2C9LY 4A6RA 1AY4A 2EYQA 1FOSE 1SZKA 1DH3A 4EOTA 4DQ6A 4H63Q 4J5UA 1YOOA 3OP7A 1AMAA 3MD0A 1SF2A 3E2YA 1LC5A 1SVVA 1T2KD 3BC8A 3EZ1A 4A0HA 2FFDC 1NU1K 1HGVA 1SQBK 3A2AA 4JEWA 2ZC0A 2RFVA 1BJ4A 4MQRA 2GMUA 4W7YA 3BN1A 1AAWA 1RV3A 3FTBA 2GSAA 4WY4A 2IPPA 3M0DC 3PPLA 4GEBA 1SQXK 4OH8B 1KZUB 3RL0B 4PFFA 1WKGA 3MKJA 4PFNA 1N73C 4R5FA 2OGAA 1NOHA 3B1CA 4AUWA 1FU1A 2X5DA 1PMMA 5M49A 1YAAA 2VYCA 4K2MA 3IHJA 4N6JA 3F9TA 3EI7A 2CANA 1H89A 4ADBA 1AIAA 4WXFA 1IJIA 1NTMK 1B4XA 2D65A 2DOUA 3L8AA 1M1JA 3BWNA 3DYDA 3WMM0 2EPJA 1B5OA 2FM1A 3U1CA 3PGYA 4BA4A 4AZKA 3JWAA 1FDMA 2ZFCA 3HE4B 3KKIA 4ZM3A 2R5CA 1AMQA 3H32B 3AOVA 1G1IA 1FAVA 3VK4A 3N4RA 4E3QA 5KJ7A 4JF0A 3HUSC 1ZLLA 1V72A 1GW3A 1HTLC 1SPAA 1URQD 3MGNA 5DB5A 1LW5A 3FZ6A 3ELPA 5FT6A 2VRSA 2P2UA 1T8ZA 3CI9A 1BW0A 3ASBA 1AAMA 4MKJA 5BU8B 5AVTB 3VMZA 1LGHB 2O01H 1TARA 3V2NA 3G0TA 3HD7C 3HE5A 1CW5A 4OBUA 4ZKPA 3FDDA 5E5IA 2FQ6A 2XBNA 2VMRA 1HWTC 5G2QA 4GT1A 4XJLA 3E1IA 3HD7D 4Q31A 2XZRA 1AKCA 3K28A 3RK2D 2BI1A 1JS3A 3HD7B 1VEFA 2X5FA 1LTTC 2R32A 4WYFA 1AIBA 2JJFA 2JISA 4ISYA 3HE5B 3M06A 2VMYA 3B8EB 1AHYA 3USFA 3ATHA 3I4JA 3BCBA 2AY6A 1FG7A 5AW2B 3AEMA 2C7TA 5AW0B 3NU8A 3F6TA 5CHXA 3BVHA 1FJKA 5K8BA 1M0NA 3BCXA 4GRXA 1BJWA 5CCHD 3CQ5A 3RI6A 2XV5A 3F0HA 3HMUA 2AY1A 1Z7DA 2FN6A 3QGUA 2HOZA 4IX8A 1SQVK 3PD6A 2BHXA 3EI9A 2A45G 4C46A 1VDFA 3A9XA 3GWPA 5EUEA 5G0AA 3OAKA 3MBBA 4WYGA 4KAMA 3JZLA 1AJSB 1WRGA 3T97A 4F5IA 1N7LA 2YCTA 1GZLA 3MADA 3WGBA 3PJ0A 3RCHA 4DBCA 1X28A 4LW4A 1DJEA 4OT8A 2HG5D 1D7SA 3E9KA 2ZXEB 4EIJA 2FKIA 1YYCA 2JG2A 1EG5A 1SVFA 2JJHA 3W1IA 3KGXA 3LVKA 1ZODA 3A8UX 4OMAA 4WXBA 1LT9C 3VP8A 1ARTA 1MFZA 1TOKA 3NUBA 1L4AB 2HZPA 3FDBA 5AVVB 1IX7A 2Z5HA 2BWNA 1IFMA 2OQXA 1RF0A 2MJZA 1M32A 2VMWA 1LWUA 2DKBA 3AATA 4I1LA 2O7CA 2VLHA 3RK2C 4A0FA 1ASBA 1RE4C 5AW4B 4WLJA 3TK1A 3EI6A 1ASEA 1KL1A 2YRRA 1LTJA 2JJEA 2KYVA 2VIAA 2Z61A 2O1KA 4KXKA 3E77A 1AHGA 1L4AA 1OXZA 2GMSA 3VN0A 2PP6A 1X8YA 1I43A 3GBXA 4EB7A 3M91A 2JEEA 4KHXA 3HD7A 3CQ4A 4AYCA 3P8CD 1NKNA 4ZM4A 1ZOBA 1UU1A 2C0XA 3TFTA 7AATA 1N7SC 3BS8A 3FQAA 1KFNA 1LTJB 2CINA 4E77A 1L0LK 8AATA 1AMRA 1W23A 3FCRA 3LY1A 2QMAA 1JS6A 2CSTA 1N7SD 1C7NA 4A6TA 1OXOA 1AMSA 4XJMA 4MKKA 2CFBA 3A7OA 2W8TA 5M4BA 3DZZA 4HVKA 2YKXA 5CJ0A 1KILA 2AEVA 1RV4A 2JJLA 1IFNA 5CCGA 5G4IA 5DJ9A 5D5SA 4WY4D 3MIWA 1JTHB 3T32A 1DGEA 1WSTA 3FFHA 3FFRA 4N0WA 1G2CA 5AW3B 2CJGA 3PD6B 3A3YB 2Q3IA 2EGYA 2A45I 4H51A 4U1TA 1NTZK 3RK3D 5TF5A 2WT7A 4AO9A 1IFDA 3B5NA 1GL2C 3PDXA 1J2JB 3TNUA 5AW6B 1B9HA 3GHGA 1AHXA 4O6ZA 4CBRA 1S0AA 4IY7A 1CI6B 3DODA 2I1JA 3RK3C 1GU5A 2OARA 1JTHA 4R5ZA 1FC4A 2HODB 2DR1A 1G2CB 1MAPA 1IO4A 1BJOB 2ZP7A 4LW2A 4E3RA 1YJYA 4J8LA 1X79B 1RF1C 1OWAA 4WBTA 1I48A 1VPCA 4LNJA 2ZSMA 2N1TC 1X0MA 1J1DC 2FYUK 3NDNA 1EQBA 2NPSC 3U1AA 2HYNA 5D95A 4CVQA 3ACZA 3TFUA 1KQLA 1DKAA 2KOGA 1B8GA 4L0OA 4XK1A 4AO4A 2WWWA 1GBNA 2GB3A 3N7NA 2WPSA 1HVVA 4RESB 4JEXA 1AJRA 3WKRA 5F9SA 1OHYA 3BWOA 2YKPA 3FD0A 4I2LC 2IX7C 3NTJA 5JAYA 1PMOA 1YJZA 5EAAA 3CAIA 1CQ6A 1Z3ZA 3P8MC 3JTXA 4ZKUA 1OXPA 1MAQA 2VMUA 3L4FA 2W6AA 5BU5A 3V2PA 1X9VA 3AENA 2W7DA 3GZDC 2PAJA 4I8AA 2FYFA 1TPLA 2HOYA 5M46A 2R5CB 2BI9A 1N8PA 3TQXA 4RJYA 2ORDA 1J1EB 3EQ2A 1GEYA 2C0RA 1ARSA 2HLOA 1SFFA 2DGKA 4B86A 3FVXA 3OJAB 1T3UA 3N4XA 1AKAA 2YO2A 2YOBA 3DC1A 1GD9A 4WB4A 1JY3N 1ARHA 3EZSA 1MLZA 5FT8A 3RL0C 1MV8A 2XU6A 2WTYA 2VGVA 5AVWB 5BJ4A 4A00A 2C9NY 1NKZB 1SFCD 2W7JA 3AEJA 1FZGA 2BIGA 3PIUA 5AVXB 4F5GA 2AY2A 3B1EA 5FT4A 3NMDA 5E3KA 4XJPA 1FBMA 1AFOA 4WYEA 4WY4B 4W8IA 3UWCA 1N73B 2BWOA 2YCPA 3GSBA 4Y99C 4WYCA 3AEOA 1YTZI 3FZ8A 1A02J 2YNYA 4HF8A 3M9QA 4KYOA 3M9BA 1CL1A 1I41A 2AY5A 2VGUA 4LGDE 3A2BA 1NH4A 2A1VA 3P32A 3ZZJA 2Z1ZA 1AX4A 4ITGA 4XQ2A 5EQCA 1JY3O 3BB8A 2E54A 1L4AD 1ARGA 4F5MA 3AOWA 3HRNA 1ASGA 1ASMA 1CJ0A 2H8PD 4CBSA 1N73A 3BATA 3HT4A 4ADEA 2BI3A 3HL2A 4OBVA 2W8VA 1IUGA 2CH1A 2W8JA 5G2PA 3O8ZA 3II0A 4LC1A 1U08A 3FQ8A 4BHDA 4DGTA 2C44A 4UQVA 4HYTB 2ZY5A 5APVA 1RF1B 3KDPB 3OA7A 1GC4A 1LC8A 5KLVK 5AW5B 1X29A 3EUCA 3VOMA 3E2ZB 2WK7A 1G4VA 4WLHA 4FFCA 4M3LA 4TN4A 1MGVA 4JEYA 2OYIC 3DXVA 1DEBA 1MZ9A 2FFDB 4IFMA 1FZFA 3VK3A 1CZEA 3B1DA 1RE3A 3A5TA 2XH1A 3E2FA 2DKJA 3G3ZA 4N78E 4RKDA 4ZASA 3N75A 1QISA 4C7NB 1H8AA 1GU4A 1UKJA 1KFMA 2X3LA 2CY8A 3M0DA 2VMXA 2GM4A 1ZR4A 1DTYA 4LC3A 2F8JA 3UIAA 3B8XA 3A9YA 4GE9A 3FZ7A 3LIDA 3WGCA 4WB0B 1YIZA 4OCAA 1CQ8A 2AY4A 1E5FA 1IX6A 2POHA 1G4XA 1FZCA 3KGWA 2W7GA 4Y0IA 4O9BA 4GIFA 2NMPA 2OGEA 1LTSC 1AHFA 3KYQA 1DJ9A 1JCCA 3DU4A 3EFGA 1YTZT 9AATA 1C7OA 1LTAC 1TASA 3K40A 1QL1A 4JEZA 2O1BA 1Z56A 1GEWA 1ORDA 4XAUA 2JJGA 3WCNA 2WITA 2VGTA 5AVRB 4F5FA 1WYVB 2YKOA 1IC2A 1KKJA 1JMMA 2J58A 2Z9XA 2HP2A 1IVRA 3TNUB 1J1EC 1JF9A 2AY9A 1ECXA 1LTGC 1ZC9A 3NRAA 1TOIA 3HBXA 3CBFA 5EIGA 5DJ1A 5FT5A 1HH0A 2H7HA 1TATA 4GSAA 2VI8A 4XE5B 3AEMC 2O0RA 2HOXA 3LIEA 1JG8A 4OTLA 1WT6A 2Z4EA 1W2EA 3HUSB 2Q5UA 4RLGA 1D7RA 1QITA 2E7UA 3NFQA 1C4KA 2HUFA 1M0QA 3H6PA 4ZAHA 3ECDA 4ZWMA 1SFCA 2W6BA 1JO5A 1CI6A 5AVZB 2D61A 3AEPA 3II6A 1BJNA 1SZSA 1JY3P 3AENB 2Q9IA 2HODA 1SQQK 4I6MC 3SWYA 2IFMA 2OYIA 5CCGD 4JEVA 2R5EA 1MDOA 2JGTA 5G4JA 3LG0A 1RE3C 1IJDB 4ATPA 4ITXA 5E4ZA 2L5GB 1HJBA 4UOYA 4F4EA 1RF0C 2Z9WA 2ZJGA 3PDBB 3W1HA 3RL0D 3HQTA 1H0CA 1NTKK 1IAXA 1W7NA 2YKYA 3LVMA 3HE4A 4ZDOA 4HH2A 3BRTB 4RKCA 3TCMA 3H32A 2TPLA 2YKQA 2OYIB 5EFSA 4A6UA 1AQ5A 2R3CA 1IFIA 4K2BA 4ADCA 2GQNA 2D66A 1LC7A 4IFDK 4F5HA 3UAKA 1TOGA 3EI8A 5CJ4A 3SWFA 2QB3A 1A02F 3ZZKA 1MLYA 3GETA 3L36A 4R8DA 4F5LA 1NO4A 3WLXA 1OHWA 2Z9UA 1M0OA 2HUUA 3QHXA 3LWSA 1C0NA 1ASDA 4IXSA 4N78D 3NUIA 4AQRD 4MQQA 1S9KD 4IYOA 1L4AC 3JW9A 1I29A 2WB6A 3P6KA 3NX3A 3MUDA 2V0YA 2W7KA 5AX8A 4NOGA 3EI5A 1URQA 2M8RA 5AW9B 4AOAA 3RBFA 2N1TB 4BMKA 2BI5A 1LT9B 1P3WA 2I1KA 1N7SA 4B9BA 4N3YB 1ELQA 2BYJA 2VMOA 1PFFA 4MY5A 2HPCB 1M7YA 2E42A 1J32A 1GC3A 4W5KA 1QJ3A 2AEUA 2WK8A 4RAEA 2FYZA 1BJOA 2ZYJA 1KMJA 4ZDPA 2P1JA 3RK2B 4Y0DA 1RE4A 2WSFH 3DR4A 3NXSA 1SLQA 1L0NK 1OHVA 2CH2A 2VIBA 4RM1A 2D5YA 5APWA 1HUCA 1LTBC 1QIRA 1N86A 1GDTA 2Q7CA 5CCGC 1QGNA 2FFDA 1JUNA 3RBLA 1ASCA 1S9KE 2HPCA 4WYDA 3U59A 1N31A 2ZY4A 1ZN5A 5AVSB 1EJIA 1TOEA 3R4TA 5EUNA 2ZSLA 2N9BA 4WP0A 2C0WA 1S07A 2GUSA 5APYA 1V2FA 3WY7A 3GHGC 2OYHA 3VK2A 3E6GA 3H9XA 3H7FA 2AY7A 1GL2D 3MC6A 2AY8A 1FJPA 2E43A 4ZSWA 3VTPC 3M0AA 3AELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3Y B;  1WT6 A;  3OJA B;  4O9B A;  4GIF A;  5BU5 A;  3U1C A;  2FXM A;  3N4X A;  5BVZ A;  3HRN A;  3N4S A;  3U1A A;  4ZKP A;  1IC2 A;  3BAT A;  4I1L A;  4N78 D;  3U59 A;  2JEE A;  3VP9 A;  3BAS A;  3N4R A;  3VP8 A;  5BU8 B;  5KTB A;  2POH A;  1X79 B;  3N7N A;  3C9I A;  4ZKU A;  3P8C D;  1NKN A; 
#chains in the Genus database with same CATH topology
 3LVJ A;  5C39 A;  4JF1 A;  1DFO A;  4IXO A;  1CS1 A;  2CTZ A;  4IL6 H;  1KMK A;  1JM0 A;  2BYL A;  2AY3 A;  1T2K C;  2R44 A;  2K9J B;  1L0L D;  3FVS A;  3NYT A;  1RF1 A;  3QM2 A;  4F5J A;  2ZVO B;  2WVR A;  3R9A A;  1KIL C;  1MDX A;  4NPD A;  2HFE D;  2W7I A;  1K04 A;  5J8Q A;  2NPS A;  2QLR A;  3MAF B;  2BWP A;  5KLV J;  3D71 A;  4JYB A;  4EDF A;  1TOJ A;  3LVL B;  3F89 A;  4BRY B;  5KJ7 D;  2M3B A;  3CCM P;  2R5D A;  2E75 B;  1KIL D;  3O6Q B;  2EH6 A;  4WY4 C;  2WZ7 A;  3CXH H;  4WBA A;  4W80 A;  4KT0 J;  2QM8 A;  4XJO A;  4PD4 I;  4RO0 A;  3R4Y A;  1HBW A;  1CQ7 A;  3COG A;  1B5P A;  3L70 J;  4W1V A;  1VJO A;  2J59 M;  1OVV A;  3ASA A;  1OVR A;  3V2R A;  5AVU B;  3JCU E;  1FZA A;  1LW4 A;  3JC2 2;  1NGM B;  1GTW A;  1EC5 A;  2DGL A;  1MUU A;  2JR8 A;  1GC0 A;  3H1L J;  3L71 E;  2FXO A;  2V7Q J;  1PP9 G;  1ELU A;  1IX8 A;  2FYU E;  2YIU B;  3PP5 A;  1C7G A;  2D7Y A;  2ZYD A;  5KLV E;  1JY2 O;  1XI9 A;  4ZLV A;  5APX A;  5HHY A;  2QM7 A;  2VMN A;  3D6K A;  5KAI E;  1FOS F;  3BV0 A;  1SZU A;  3L44 A;  4CXQ A;  1T3J A;  2VGZ A;  3Q8N A;  4GE7 A;  3ZDM A;  4B98 A;  1MDZ A;  2Z20 A;  1FG3 A;  1LS3 A;  1S08 A;  4ZNC A;  4BQ0 A;  2HP1 A;  3H1K J;  3CCJ P;  1GDE A;  3SFD C;  4WB0 A;  4XEW A;  5B66 H;  2N1T D;  4P7Y A;  3RK3 B;  4GKG A;  2CJH A;  1NVO A;  3V4W A;  4Q75 A;  3I5C A;  4NPF X;  1GL2 B;  2VMQ A;  2CPB A;  2R2N A;  3WZF A;  1WKH A;  3FWN A;  2CPS A;  3IFM A;  3FKD A;  4A0G A;  5BJ3 A;  2BIE A;  2HOR A;  3GG2 A;  2ZAE B;  2GUV A;  2W7F A;  2P67 A;  2OTJ P;  3HUS A;  3P1T A;  2PB0 A;  2WSE J;  3EFF K;  2FYN B;  2IBZ I;  2XDJ A;  1GCK A;  2VMV A;  4UHM A;  2MKV A;  3VMY A;  3OKS A;  4A72 A;  2BI2 A;  1LKC A;  5G09 A;  1O69 A;  1JOC A;  2BIA A;  3QPG A;  3BCC D;  3BWN C;  5AW7 B;  3KE3 A;  1ZP0 C;  3K5B A;  3VAX A;  1ASF A;  1JMB A;  3AE3 C;  1WMK A;  2IYP A;  5H2F E;  2IFN A;  3S9O A;  2KFP A;  2XND H;  4HKZ H;  3PA9 A;  5I92 A;  3AEE C;  2W8W A;  5CCH A;  3TF5 A;  4EMY A;  3EIB A;  2BAS A;  3H1H E;  1BE3 D;  4RIZ A;  3VOP A;  5DJU B;  2ZUK A;  3ZRR A;  4BA5 A;  1B9I A;  3FXE A;  2ZVN B;  1ZR2 A;  1CZC A;  5B66 E;  1BS0 A;  1KV4 A;  2G6W A;  1N2D C;  2WK9 A;  3CCQ P;  1RHZ B;  2K3R A;  2CJD A;  3TAT A;  3N4S A;  4QGR A;  3H1H G;  1ZOY C;  4W1W A;  1AY5 A;  2M3E A;  3DRD A;  2FNI A;  2KLV A;  3CL3 D;  4L73 A;  1WYU B;  4H0L B;  3VP9 A;  1LP1 A;  2W27 A;  2VI9 A;  3TSI A;  2E7I A;  2QIW A;  1D2F A;  1FZE A;  2OKJ A;  1LTI C;  1YI2 P;  2W7E A;  3AV7 A;  3CD6 P;  1NU1 G;  1L0N D;  2YO3 A;  2XNX A;  3QN6 A;  4C7N A;  4H44 B;  3I16 A;  3W68 A;  4LNM A;  1R5L A;  3IN6 A;  2BKW A;  1L0L J;  1ASL A;  3CC4 P;  4GE4 A;  4WD2 A;  2O3J A;  4F5K A;  1IBJ A;  1ZV8 A;  5AVQ B;  3L74 D;  4W7Z A;  1V2D A;  1YJS A;  2VMZ A;  5IWQ A;  2W8U A;  4DOJ A;  3IAO A;  4Q76 A;  4UB6 E;  4KJM A;  3H1J D;  1KIL B;  1IAY A;  1CZQ A;  5BVZ A;  2R0T A;  1KB9 E;  1W3U A;  1SQV E;  2ZY2 A;  2VLF A;  2AXT H;  1S09 A;  1VQ6 P;  2OAT A;  5CBN A;  1W2B O;  1G7X A;  3P8C E;  2ZY3 A;  4IYO B;  3L75 J;  4M2K A;  1VQ8 P;  1M4N A;  2P7J A;  3B5N B;  3CX5 D;  1BQD A;  3WKS A;  3W67 A;  2EZ2 A;  4Q6R A;  1AHE A;  1BT4 A;  4Y99 B;  4TMR A;  3RL0 g;  4FL0 A;  3IR9 A;  5CMZ A;  1FZC C;  4AH3 A;  2QJY B;  1N7S B;  1PL5 A;  2NPS D;  4U7J A;  3V4Q A;  3AE4 C;  1E5E A;  1O61 A;  2P58 A;  2D7Z A;  2YMY A;  2BEZ F;  3RGU A;  3D6Z A;  5KAF E;  3PAA A;  3I5T A;  1IK9 A;  3L75 E;  3ZRQ A;  1KMI Z;  3L73 G;  1H0T B;  3G8M A;  1CL2 A;  2D64 A;  1PV3 A;  3FGA D;  1O4S A;  1Q81 Q;  1S06 A;  4ZSY A;  4H44 D;  2VMS A;  4PD4 H;  3MAU A;  2E76 C;  5AW8 B;  1N8R Q;  1SQX E;  2LKM A;  3CQ6 A;  1AKB A;  2QBT A;  2KS1 A;  2VMP A;  1WYT A;  3BCA A;  4K3A A;  5EIG B;  3QBO A;  1PG8 A;  5F8V A;  1L2P A;  3GHG B;  2W83 C;  3Q5S A;  3MP7 B;  5B5E H;  3VYI A;  2RH0 A;  2FNU A;  4GDY A;  2PB2 A;  2OKK A;  1JY2 P;  1S1C X;  1BSN A;  4K2I A;  2Z5I A;  4JF7 A;  3M5U A;  3E7K A;  1Y4I A;  1AJS A;  1QX8 A;  1URQ B;  3N5M A;  1DJU A;  1RY3 A;  1QL2 A;  4IW7 A;  4WYA A;  3AE5 C;  2ZYA A;  1LTJ C;  1LT9 A;  4R4L A;  1SQP K;  1WYT B;  2YCN A;  3WCO A;  3A0B H;  2VGS A;  3A0B E;  2FYN C;  4WXG A;  2WPQ A;  1M1J B;  4Z1M H;  5CCH C;  1NHL A;  3G9R A;  2RKL A;  4DT0 A;  3WUV A;  1DGD A;  4U3F J;  3UE8 A;  2FXM A;  2KB7 P;  3GF3 A;  3M9H A;  4CPG A;  3E2Z A;  5EUD A;  1BKG A;  2H88 C;  3L70 E;  1LWU C;  1ARI A;  1BQA A;  1N2T A;  4ADD A;  5HXX A;  4MSO A;  4EB5 A;  1UU0 A;  5DJT B;  1ZXG A;  2HUI A;  2YKU A;  5M4D A;  1V2E A;  3H25 A;  1J1D B;  3JWB A;  1SFC C;  3VP6 A;  2NPS B;  1M8O B;  2W7H A;  1M6S A;  1NTZ D;  1SQQ G;  1OAT A;  3PTZ A;  3WX9 A;  3H1I J;  1IFJ A;  1HJ0 A;  4D6T D;  3V5B A;  3PDB A;  4D6T G;  1XTG B;  1AY8 A;  4JPZ B;  2PO3 A;  3LW5 H;  2ZYG A;  3V2Q A;  1YHQ P;  3G7Q A;  2E7J A;  3E1R A;  3K7Y A;  1GK4 A;  1PFI A;  4AZJ A;  2JO1 A;  3ELE A;  3NTN A;  4E1O A;  1O62 A;  4R2N A;  1KL2 A;  1L0N G;  2O1J A;  1PPJ G;  3ZRP A;  2UWJ E;  3BRV B;  4EFF A;  1BGY E;  2ZT9 B;  5APQ A;  2IZ1 A;  2V1P A;  1SQX D;  3GZC A;  2OYO A;  1GK6 A;  3VMX A;  1H88 A;  3BAS A;  5APU A;  2IBZ E;  1GD2 E;  2XKM A;  5KLI C;  2X8U A;  4H13 B;  1L0N E;  2VGW A;  1YQ3 C;  1H1C A;  1U7J A;  1YJN P;  3NNK A;  4H44 C;  4DJG A;  3TYY A;  4OGQ B;  2QJK B;  2WSC H;  1GW4 A;  1SQX G;  3ISL A;  3W1J A;  2WQY C;  1M0P A;  2QSR A;  3FWL A;  1EDI A;  3CLQ A;  2E75 D;  4DZO A;  1DX7 A;  5AW1 B;  2WKA A;  2EO5 A;  2I8D A;  4EU1 A;  1JCD A;  2Z1Y A;  1ASN A;  3NYS A;  3TDK A;  4Y0H A;  4MN4 C;  1YIY A;  2VMT A;  1VP4 A;  2CB1 A;  4YTP C;  1T6A A;  1JY2 N;  5APS A;  2L91 A;  3B5N C;  4W91 A;  2N1T A;  1GL2 A;  2KP8 A;  4IFF A;  2WSF J;  1DEE G;  1SP4 A;  2IBZ D;  2WMM A;  4OYT A;  4GOD A;  3RUY A;  1W7M A;  1VQP P;  1VQ4 P;  3L74 J;  2FYU J;  1FZC B;  2YRI A;  1M57 D;  4U2H A;  3R2P A;  3B5N D;  5DX5 A;  5HDM A;  2YMK A;  2WT7 B;  1LK9 A;  3MTU E;  1OX3 A;  4JYC A;  1RVU A;  2EZ1 A;  1QZ9 A;  4IXZ A;  1USE A;  3HVY A;  3KQG A;  1D7U A;  3C9I A;  1GC2 A;  1XEY A;  3LV2 A;  2AAT A;  3NYU A;  1SQB G;  5K5G B;  1NTK D;  3GW6 A;  3LW5 J;  3G71 P;  4MQP A;  2R5B A;  1G1J A;  3Q3D A;  1KTM A;  2B87 A;  4L75 A;  3ITK A;  5C6U A;  1HGZ A;  1G7W A;  1KKP A;  4OC9 A;  1M1J C;  3RQ1 A;  1OMI A;  3AEJ C;  2QA3 A;  3L37 A;  3MUD C;  3S4R A;  1WYV A;  1NTK G;  2AEF A;  3GR9 A;  3GZD A;  2DGM A;  3RCH B;  1J04 A;  4P3M A;  5AVY B;  1UU2 A;  1RVY A;  4M2M A;  1CSB A;  4PIW A;  1BCC J;  2KIK A;  4UHN A;  3FX0 A;  4ZWV A;  2C81 A;  3L73 E;  3FQ7 A;  3AE2 C;  1VF5 C;  3L70 D;  4K05 A;  5KJ7 C;  1C9C A;  1YIT P;  3OW2 O;  1NWQ A;  4ZDL A;  4ATQ A;  1ASA A;  2OYH B;  2KZJ A;  3QI6 A;  5EAV A;  3DR7 A;  1NTZ G;  2W7M A;  1WYU A;  2WSE H;  3H1J G;  1UIX A;  1FS0 E;  2BCC E;  5CBO A;  5KTB A;  3CCU P;  1JNM A;  3KPE A;  1X2A A;  2KSJ A;  3L71 D;  1BE3 E;  3CMA P;  1NTM D;  1BGY G;  1YNU A;  4RIT A;  4CXR A;  3HTK B;  1EQ7 A;  3BCC J;  2Q7W A;  2FKW B;  4HJG H;  1QJ5 A;  4C7R A;  2W7L A;  2OYH C;  1M7L A;  3S1K A;  1VQK P;  3MEB A;  3FVU A;  1T3I A;  1GEX A;  1E5W A;  3L35 A;  4IOI H;  3B46 A;  2PFX A;  1FZB A;  3P7K A;  3CC7 P;  4A0R A;  3EIA A;  1XTC C;  3MAF A;  4RJ0 A;  2YXQ B;  3HDO A;  3FSL A;  4XA4 A;  2YHK A;  3G4S P;  1M56 D;  1SFC B;  4PVF A;  3SSU A;  4M2J A;  3FRK A;  1NAF A;  2A45 H;  4LNL A;  4W1X A;  3HLM A;  1LWU B;  2QB2 A;  3NU7 A;  3A9Z A;  1URQ C;  3HTK A;  1KD1 Q;  1OVU A;  1LP1 B;  2Y9Y A;  1KB9 H;  3GJU A;  1D7V A;  3DXW A;  5APT A;  2H43 A;  2Z9V A;  1AIC A;  2WPR A;  2YKV A;  4LLH A;  4OVN F;  1Y8A A;  1Q86 Q;  3N0L A;  3AE7 C;  1D7M A;  1W7L A;  2D63 A;  4UHO A;  3L71 G;  3MC6 C;  2G7J A;  2C9L Y;  4A6R A;  1AY4 A;  1SQQ J;  2EYQ A;  3JCU H;  1FOS E;  1SZK A;  4H13 C;  4L76 A;  4GDO A;  1DH3 A;  2E76 D;  4D6T J;  3B71 A;  3CPW O;  4EOT A;  3CCV P;  4DQ6 A;  2WSC J;  4H63 Q;  4J5U A;  1SQQ E;  1YOO A;  3OP7 A;  1AMA A;  3MD0 A;  1FE6 A;  1SF2 A;  3E2Y A;  1LC5 A;  4PV1 C;  2QA4 P;  1S4X A;  1SVV A;  1T2K D;  3BC8 A;  4TLF A;  3EZ1 A;  4A0H A;  2FFD C;  1NU1 K;  1SQB E;  1ZW0 A;  1HGV A;  1SQB K;  3A2A A;  4JEW A;  2ZC0 A;  2RFV A;  1BJ4 A;  1NTM E;  2GMU A;  4MQR A;  4W7Y A;  3BN1 A;  1AAW A;  2O01 J;  4YXD C;  1VQ5 P;  1RV3 A;  3FTB A;  2GSA A;  1AVO A;  2BCC D;  2IPP A;  3M0D C;  4WY4 A;  3PPL A;  4GEB A;  2RN0 A;  1SQX K;  4OH8 B;  1KZU B;  3RL0 B;  4PFF A;  1WKG A;  1OW7 A;  1NTM G;  3MKJ A;  4PFN A;  1N73 C;  4R5F A;  4ASV A;  2E5T A;  2OGA A;  1NOH A;  3B1C A;  2B87 B;  4AUW A;  1BSH A;  1FU1 A;  2X5D A;  1PMM A;  3WU2 H;  5M49 A;  1YAA A;  2VYC A;  4K2M A;  3IHJ A;  4N6J A;  3F9T A;  3EI7 A;  2CAN A;  1H89 A;  2W6J H;  1U57 A;  5KAF H;  3KXD A;  1EZV G;  1PP9 E;  4ADB A;  1AIA A;  3CXH E;  4WXF A;  1IJI A;  3CCR P;  1NTM K;  2RMZ A;  3Q5R A;  1B4X A;  3AE9 C;  2D65 A;  2DOU A;  3L8A A;  1M1J A;  3BWN A;  3DYD A;  3WMM 0;  1SQV D;  2EPJ A;  1B5O A;  1SQP J;  2FM1 A;  3U1C A;  3PGY A;  1Q90 D;  4BA4 A;  4AZK A;  3JWA A;  1QLE D;  1FDM A;  2ZFC A;  3HE4 B;  2LXB A;  3KKI A;  3QWO C;  1VQ9 P;  2AEM A;  1DIP A;  4ZM3 A;  2FBW C;  3G6E P;  2R5C A;  1AMQ A;  3H32 B;  3AOV A;  1G1I A;  1FAV A;  3VK4 A;  3I55 P;  3N4R A;  2J5U A;  4E3Q A;  5KJ7 A;  4JF0 A;  3HUS C;  1IK7 A;  1ZLL A;  2H89 C;  3QH9 A;  1V72 A;  1GW3 A;  1HTL C;  1SPA A;  3H1H D;  1URQ D;  3MGN A;  1YJW P;  5DB5 A;  1LW5 A;  3FZ6 A;  3ELP A;  5FT6 A;  2VRS A;  2K9Y A;  1P84 I;  2P2U A;  1T8Z A;  3CI9 A;  1BW0 A;  3ASB A;  3CC2 P;  1AAM A;  4MKJ A;  5BU8 B;  1LJ2 A;  5AVT B;  3VMZ A;  1LGH B;  2O01 H;  1TAR A;  3V2N A;  3G0T A;  1RQU A;  2DW3 A;  2V7Q H;  3CCE P;  1BCC E;  3HD7 C;  5B5E E;  3HE5 A;  1CW5 A;  4OBU A;  4ZKP A;  2V4H A;  3FDD A;  1KQG B;  5E5I A;  4JBZ A;  2FQ6 A;  2XBN A;  2VMR A;  1HWT C;  5G2Q A;  4GT1 A;  2E75 C;  1KQF B;  4XJL A;  1NTZ J;  1IFP A;  3KHU A;  3E1I A;  3H1J J;  4GOE A;  3HD7 D;  3A0H H;  4Q31 A;  2XZR A;  1AKC A;  3H1L G;  3K28 A;  4ZMD A;  3RK2 D;  2BI1 A;  3AEC C;  1JS3 A;  3HD7 B;  1VEF A;  2X5F A;  1LTT C;  3Q5P A;  2R32 A;  4WYF A;  1AIB A;  2JJF A;  2KZI A;  2JIS A;  4PV1 B;  5KAI H;  4ISY A;  2K9J A;  3HE5 B;  3M06 A;  2VMY A;  3B8E B;  1AHY A;  3USF A;  3ATH A;  3I4J A;  3BCB A;  2AY6 A;  1FG7 A;  3H1K G;  1OFC X;  3CWB D;  5AW2 B;  3AEM A;  2C7T A;  1AJY A;  5AW0 B;  3NU8 A;  1S72 P;  2KNC B;  3L72 E;  3F6T A;  5CHX A;  3BVH A;  1FJK A;  5K8B A;  1NTZ E;  1M0N A;  2QVA A;  3BCX A;  3O6Q A;  1KN7 A;  1ZME C;  4OWF A;  3L72 J;  4GRX A;  2E74 D;  1BJW A;  4OGQ D;  5CCH D;  3CQ5 A;  3RI6 A;  1OIP A;  2E74 B;  2XV5 A;  3F0H A;  3HMU A;  2QSI A;  2AY1 A;  1Z7D A;  4WWI A;  2D2C B;  2FN6 A;  3QGU A;  2HOZ A;  4IX8 A;  2KNC A;  1SQV K;  3PD6 A;  2BHX A;  3EI9 A;  2A45 G;  4C46 A;  1VDF A;  3A9X A;  3GWP A;  2Y0D A;  1KOR A;  5EUE A;  5G0A A;  3OAK A;  3MBB A;  4WYG A;  4KAM A;  3JZL A;  4PJ0 H;  1AJS B;  1L0L E;  1WRG A;  3T97 A;  4F5I A;  1N7L A;  2YCT A;  1GZL A;  1S5L X;  3WUT A;  3MAD A;  3WGB A;  3PJ0 A;  3RCH A;  4DBC A;  2ZXX A;  1NJI Q;  4Y28 J;  1X28 A;  4LW4 A;  1DJE A;  3H1H J;  4OT8 A;  1KIL E;  2HG5 D;  4HB1 A;  1EDJ A;  1D7S A;  3E9K A;  2ZXE B;  2QJP C;  4EIJ A;  2FKI A;  1YYC A;  2JG2 A;  1EG5 A;  1SVF A;  2JJH A;  3W1I A;  3KGX A;  3LVK A;  1ZOD A;  3A8U X;  3AEB C;  4H0L C;  4OMA A;  4BRY A;  4WXB A;  1LT9 C;  3T97 B;  3VP8 A;  1ART A;  1MFZ A;  1TOK A;  1NU1 J;  3NUB A;  1L4A B;  2HZP A;  3FDB A;  5AVV B;  1OW6 A;  1IX7 A;  3PHL A;  2Z5H A;  1M90 Q;  1IFM A;  2BWN A;  2OQX A;  1RF0 A;  4H0L D;  2MJZ A;  1M32 A;  2VMW A;  1LWU A;  5GTH H;  2DKB A;  3PJS K;  3AAT A;  4I1L A;  2O7C A;  3SFE C;  2VLH A;  3RK2 C;  4A0F A;  5EFW B;  1ASB A;  4UB6 H;  1RE4 C;  1AVY A;  5AW4 B;  4WLJ A;  3TK1 A;  3EI6 A;  1KYO I;  1ASE A;  1KL1 A;  2YRR A;  1LTJ A;  2JJE A;  4I7Z B;  2KYV A;  1NU1 E;  1SQP G;  2VIA A;  2Z61 A;  2O1K A;  4KXK A;  3E77 A;  1AHG A;  1L4A A;  1OXZ A;  2GMS A;  3VN0 A;  2PP6 A;  1X8Y A;  1I43 A;  3GBX A;  4EB7 A;  3Q1M A;  3M91 A;  2JEE A;  1EXI A;  4KHX A;  3HD7 A;  3CQ4 A;  5KKZ B;  4AYC A;  3C1L A;  3P8C D;  1NKN A;  3PH0 A;  2OGU A;  4ZM4 A;  1ZOB A;  1UU1 A;  2C0X A;  3TFT A;  7AAT A;  5KLV G;  5E79 H;  1N7S C;  4WVZ A;  3BS8 A;  3FQA A;  1KFN A;  1LTJ B;  1FDO A;  2CIN A;  4E77 A;  2LR2 A;  1L0L K;  2Y0C A;  8AAT A;  2CK3 H;  1AMR A;  1W23 A;  4BWN A;  3FCR A;  3LY1 A;  2QMA A;  1JS6 A;  2CST A;  1N7S D;  2NRG A;  1C7N A;  5GTI H;  4UB8 H;  4A6T A;  3TGU J;  1OXO A;  1AMS A;  4XJM A;  4MKK A;  2CFB A;  1E79 H;  3A7O A;  2W8T A;  1ZRT E;  2A06 D;  5M4B A;  3DZZ A;  4HVK A;  1K05 A;  2YKX A;  2GA1 A;  5CJ0 A;  1KIL A;  2AEV A;  1RV4 A;  2JJL A;  1SQQ D;  1IFN A;  5CCG A;  1U7M A;  5G4I A;  5D5S A;  5DJ9 A;  4WY4 D;  3MIW A;  1JTH B;  3T32 A;  2K88 A;  1DGE A;  1WST A;  3FFH A;  3FFR A;  4N0W A;  3RK3 E;  3CCS P;  1G2C A;  5AW3 B;  2CJG A;  2IDB A;  3PD6 B;  3A3Y B;  2Q3I A;  2EGY A;  2A45 I;  2E76 B;  4H51 A;  4U1T A;  1NTZ K;  3RK3 D;  5TF5 A;  2WT7 A;  4AO9 A;  2G8Y A;  1IFD A;  3B5N A;  1GL2 C;  2Y0E A;  3PDX A;  1J2J B;  3TNU A;  5AW6 B;  1B9H A;  3GHG A;  3H1I E;  1AHX A;  4U3F D;  4O6Z A;  2IYO A;  4CBR A;  1S0A A;  4IY7 A;  1CI6 B;  3DOD A;  2I1J A;  3RK3 C;  1GU5 A;  3KZI E;  2KI7 B;  2OAR A;  1JTH A;  3MZW B;  4R5Z A;  1FC4 A;  2HOD B;  2DR1 A;  1G2C B;  1SQP E;  1IO4 A;  1BJO B;  1MAP A;  2ZP7 A;  4LW2 A;  4E3R A;  1YJY A;  4J8L A;  1X79 B;  4U3F G;  3C8V A;  4A7P A;  1QVF O;  1RF1 C;  1OWA A;  4WBT A;  2AXT E;  1EZV I;  1I48 A;  3L75 D;  3RBZ A;  1VQM P;  1VPC A;  2JWD A;  4LNJ A;  2ZSM A;  2N1T C;  1X0M A;  1J1D C;  1P84 H;  2FYU K;  3I56 P;  3NDN A;  1QEX A;  1EQB A;  2NPS C;  3U1A A;  2HYN A;  2ITA A;  5D95 A;  4CVQ A;  1OW8 A;  2AEJ A;  3H1J E;  3ACZ A;  3TFU A;  1KQL A;  1DKA A;  2KOG A;  1B8G A;  4L0O A;  4XK1 A;  4AO4 A;  2WWW A;  1GBN A;  1EZV D;  2GB3 A;  3N7N A;  2WPS A;  1HVV A;  4RES B;  4JEX A;  1KB9 I;  1AJR A;  2QJP B;  3WKR A;  3CX5 E;  5F9S A;  1OHY A;  2OTL P;  1R8E A;  4EYY Q;  3BWO A;  2YKP A;  3FD0 A;  4I2L C;  2IX7 C;  3ABV C;  3NTJ A;  5JAY A;  1GMJ A;  2QEX P;  1PMO A;  1YJZ A;  5EAA A;  3CAI A;  5L8R J;  2JWA A;  3L73 D;  3PRJ A;  1CQ6 A;  1Z3Z A;  3P8M C;  3AED C;  3JTX A;  1SS1 A;  2B9B A;  4ZKU A;  4UB8 E;  1OXP A;  2FYU D;  1MAQ A;  1PPJ D;  2VMU A;  3L4F A;  2W6A A;  1KB9 D;  3L72 D;  5BU5 A;  3V2P A;  1X9V A;  3AEN A;  2W7D A;  5KKZ C;  3GZD C;  2PAJ A;  4PV1 D;  4I8A A;  2FYF A;  1TPL A;  2HOY A;  5M46 A;  2R5C B;  2E5Y A;  3L74 E;  2BI9 A;  2JDI H;  3H1K D;  1N8P A;  3TQX A;  4RJY A;  2ORD A;  1J1E B;  3EQ2 A;  1GEY A;  4BXL A;  3CXH D;  2C0R A;  1ARS A;  2HLO A;  1KQS O;  1SFF A;  2DGK A;  2ZT9 C;  4B86 A;  3FVX A;  3OJA B;  1T3U A;  1VL2 A;  3AEF C;  3N4X A;  1AKA A;  1SQX J;  2YO2 A;  2YOB A;  3DC1 A;  2M5A A;  1GD9 A;  4WB4 A;  1JY3 N;  1ARH A;  3EZS A;  1MLZ A;  5FT8 A;  1OZH A;  3RL0 C;  1MV8 A;  2KK7 A;  1USD A;  2XU6 A;  2WTY A;  2VGV A;  5AVW B;  4OGQ C;  5BJ4 A;  4A00 A;  2C9N Y;  1BE3 G;  1NKZ B;  2Q6Q A;  1SFC D;  3WU2 E;  2W7J A;  4ASW A;  3AEJ A;  1FZG A;  2BIG A;  3PIU A;  3IF4 A;  5AVX B;  4F5G A;  2AY2 A;  1EZV E;  3B1E A;  3CWB G;  5FT4 A;  3NMD A;  5E3K A;  2FYU G;  2QJY C;  1FBM A;  1AFO A;  3USS A;  4XJP A;  1SQB D;  4WY4 B;  4WYE A;  4W8I A;  3UWC A;  5TJH A;  1N73 B;  2BWO A;  2YCP A;  3GSB A;  1PGO A;  4Y99 C;  4WYC A;  2HR3 A;  3AEO A;  1YTZ I;  3FZ8 A;  1KYO H;  1A02 J;  2YNY A;  4HF8 A;  1PIX A;  3M9Q A;  4KYO A;  3BCC E;  3M9B A;  1CL1 A;  1I41 A;  2AY5 A;  2VGU A;  2M0B A;  1QVG O;  4LGD E;  3L73 J;  3A2B A;  1NH4 A;  2W90 A;  3H1L D;  2A1V A;  3P32 A;  3ZZJ A;  2Z1Z A;  1AX4 A;  4ITG A;  4XQ2 A;  5EQC A;  3F5H A;  1JY3 O;  3BB8 A;  2E54 A;  1L4A D;  1ARG A;  1IZN B;  4F5M A;  3AOW A;  3HRN A;  3VMA A;  1ASG A;  1ASM A;  1CJ0 A;  3TGU G;  2H8P D;  5H2F H;  4CBS A;  1N73 A;  3BAT A;  3HT4 A;  1SQV G;  4ADE A;  2BI3 A;  1BCC G;  4YXW H;  3HL2 A;  4OBV A;  4PJ0 E;  2W8V A;  2K37 A;  1IUG A;  2CH1 A;  1PP9 D;  2W8J A;  1TU3 F;  3AEA C;  1KAF A;  5G2P A;  3O8Z A;  3II0 A;  4LC1 A;  1U08 A;  5TIS H;  1X0T A;  3FQ8 A;  4BHD A;  4DGT A;  2C44 A;  4UQV A;  1BDD A;  1DD4 A;  4HYT B;  2PGD A;  2ZY5 A;  1AV1 A;  5APV A;  1RF1 B;  3KDP B;  3OA7 A;  1GC4 A;  1LC8 A;  3D6Y A;  5KLV K;  5AW5 B;  1HF9 A;  1BGY J;  1X29 A;  3EUC A;  5TIS E;  3VOM A;  1VF5 B;  1EXJ A;  1K9M Q;  2JKV A;  1LNQ A;  3E2Z B;  2WK7 A;  1G4V A;  1KC8 Q;  1ZRT D;  2A06 E;  4WLH A;  4FFC A;  4M3L A;  4TN4 A;  1Y9B A;  1MGV A;  3A0H E;  4JEY A;  1VQO P;  2OYI C;  3DXV A;  1DEB A;  1R5S A;  1MZ9 A;  2FFD B;  4IFM A;  1FZF A;  1FDI A;  3VK3 A;  1CZE A;  3B1D A;  1RE3 A;  1PZQ A;  3A5T A;  2BCC G;  2XH1 A;  4TT3 H;  3E2F A;  2DKJ A;  3G3Z A;  4N78 E;  2NZ2 A;  4RKD A;  2AXC A;  4ZAS A;  1SQP D;  3N75 A;  1PGQ A;  1EDL A;  3EWK A;  3MHV A;  4EI2 A;  2O01 N;  2JP3 A;  1QIS A;  1JB0 J;  4C7N B;  1MFT A;  1H8A A;  1YBK A;  1GU4 A;  1UKJ A;  3H1I G;  3CME P;  1KFM A;  4U3F E;  1KYO E;  2K1A A;  2X3L A;  2R3S A;  1Q82 Q;  3H1L E;  2CY8 A;  3L71 J;  3M0D A;  2GM4 A;  2VMX A;  1ZR4 A;  3CXH I;  1DTY A;  4LC3 A;  2F8J A;  2W8Z A;  3UIA A;  2OTK E;  3B8X A;  3A9Y A;  1PGJ A;  5KLI B;  4GE9 A;  3FZ7 A;  1VQN P;  3LID A;  3WGC A;  4WB0 B;  1YIZ A;  4OCA A;  1CQ8 A;  1L0N J;  2AY4 A;  1E5F A;  1IX6 A;  3KZI H;  2POH A;  1G4X A;  1FZC A;  3CX5 H;  3KGW A;  2W7G A;  2D2C D;  2G3A A;  4Y0I A;  4O9B A;  4GIF A;  2NMP A;  3AE8 C;  2OGE A;  1LTS C;  1AHF A;  3KYQ A;  1DJ9 A;  1JCC A;  3DU4 A;  3EFG A;  1YTZ T;  4K35 A;  2QJK C;  9AAT A;  1C7O A;  1W5C E;  1LTA C;  1TAS A;  1P84 E;  3K40 A;  1VQ7 P;  3GMA A;  1KYO D;  1QL1 A;  4JEZ A;  2O1B A;  4QMA A;  1Z56 A;  1GEW A;  1ORD A;  4XAU A;  5M1B A;  1NTM J;  2JJG A;  1JEK A;  3WCN A;  1YIJ P;  2WIT A;  2VGT A;  5AVR B;  4I7Z C;  1QGK B;  4F5F A;  2KSE A;  1WYV B;  2KUB A;  1H0T A;  2YKO A;  1IC2 A;  2IZ0 A;  2N9Y B;  1KKJ A;  1JMM A;  2J58 A;  2Z9X A;  2HP2 A;  1IVR A;  3TNU B;  1J1E C;  1S5L E;  1JF9 A;  5GTI E;  1MKM A;  2AY9 A;  1ECX A;  1LTG C;  2KS1 B;  1BE3 J;  1ZC9 A;  3NRA A;  1TOI A;  3HBX A;  3CBF A;  5EIG A;  5DJ1 A;  5FT5 A;  1HH0 A;  3L74 G;  2H7H A;  1TAT A;  2ZJS E;  4GSA A;  2VI8 A;  4XE5 B;  1PPJ E;  3AEM C;  2O0R A;  2BEQ D;  1DD3 A;  2HOX A;  3LIE A;  4GOF A;  4H13 D;  1JG8 A;  4XFJ A;  4OTL A;  3CWB J;  1WT6 A;  2Z4E A;  1W2E A;  3HUS B;  2QG4 A;  2Q5U A;  1M1K Q;  1SQB J;  4RLG A;  1D7R A;  1QIT A;  2E7U A;  3NFQ A;  1C4K A;  1FC2 C;  2Q3E A;  2PRR A;  2QRX A;  2SPZ A;  2HUF A;  1M0Q A;  3H6P A;  4ZAH A;  1NYH A;  3ECD A;  4ZWM A;  1SFC A;  3H1K E;  2W6B A;  1S3J A;  1JO5 A;  1NTK J;  1CI6 A;  5AVZ B;  2D61 A;  3AEP A;  3II6 A;  4RJT A;  1BJN A;  3CWB E;  1JY3 P;  1SZS A;  3AEN B;  3CCL P;  1X22 A;  1EDK A;  2Q9I A;  4PD4 D;  2HOD A;  1SQQ K;  4I6M C;  3JSV C;  3SWY A;  3FXD A;  3L70 G;  2IFM A;  4IL6 X;  1YJ9 P;  2OYI A;  5CCG D;  4JEV A;  2WPV B;  1SQV J;  2R5E A;  4IL6 E;  1MDO A;  2FXP A;  3RBX A;  2JGT A;  5G4J A;  3LG0 A;  1RE3 C;  1IJD B;  4ATP A;  4ITX A;  3AE1 C;  5E4Z A;  4RKU J;  1BCC D;  2L5G B;  2WSS H;  1HJB A;  4PD4 E;  2LXC B;  1PP9 J;  4UOY A;  4F4E A;  1RF0 C;  2Z9W A;  2ZJG A;  3PDB B;  1VQL P;  3W1H A;  4NPE A;  1K73 Q;  2M5A B;  1BDC A;  3RL0 D;  3HQT A;  1Q2N A;  3BCC G;  1H0C A;  2D2C C;  1NTK K;  1IAX A;  1W7N A;  2YKY A;  3H1I D;  3LVM A;  3HE4 A;  4ZDO A;  1YQ4 C;  5E79 E;  1VF5 D;  4HH2 A;  3BRT B;  4RKC A;  3TCM A;  4L74 A;  3H32 A;  2TPL A;  3D70 A;  3WUU A;  2YKQ A;  2QE7 H;  2OYI B;  5EFS A;  4A6U A;  2KLU A;  1AQ5 A;  2E74 C;  2R3C A;  1IFI A;  5GTH E;  4K2B A;  4ADC A;  2GQN A;  2D66 A;  1LC7 A;  4IFD K;  4F5H A;  3UAK A;  2FY8 A;  1TOG A;  3EI8 A;  5CJ4 A;  3SWF A;  2QB3 A;  5KLV D;  2BCC J;  2Y9Z A;  1A02 F;  2IBZ G;  2YIU C;  3ZZK A;  1MLY A;  4DCK A;  3GET A;  3L36 A;  4R8D A;  4F5L A;  1NO4 A;  3WLX A;  1OHW A;  3B4S A;  1PGP A;  2Z9U A;  1M0O A;  2HUU A;  3CX5 I;  3QHX A;  3LWS A;  3L72 G;  1ASD A;  1C0N A;  4IXS A;  4N78 D;  3NUI A;  1NTK E;  1Q7Y Q;  4AQR D;  4MQQ A;  1S9K D;  4IYO A;  3PLN A;  1L4A C;  1RQV A;  3Q2Y A;  3JW9 A;  1I29 A;  2A06 G;  4D6T E;  2WB6 A;  3P6K A;  3NX3 A;  3MUD A;  2V0Y A;  2OQQ A;  1Y47 A;  2W7K A;  5AX8 A;  4NOG A;  3EI5 A;  1URQ A;  2M8R A;  5AW9 B;  4AOA A;  3RBF A;  2N1T B;  4BMK A;  4JQ0 D;  2BI5 A;  3GLM A;  4R4M A;  1LT1 A;  3TGU D;  1LT9 B;  1P3W A;  2I1K A;  1N7S A;  1UII A;  1K8A Q;  4B9B A;  4N3Y B;  1RH5 B;  1ELQ A;  2BYJ A;  2VMO A;  1PFF A;  4MY5 A;  2HPC B;  1M7Y A;  2E42 A;  1J32 A;  1GC3 A;  4W5K A;  1QJ3 A;  2AEU A;  2WK8 A;  4RAE A;  2FYZ A;  3TGU E;  1NAY A;  1BJO A;  2ZYJ A;  1KMJ A;  4ZDP A;  1AQT A;  2P1J A;  3GF7 A;  3RK2 B;  4Y0D A;  1RE4 A;  2WSF H;  3DR4 A;  3NXS A;  1SLQ A;  1L0N K;  1OHV A;  3AE6 C;  2CH2 A;  2VIB A;  4RM1 A;  2D5Y A;  3V6I A;  5APW A;  1HUC A;  1LTB C;  1QIR A;  1N86 A;  1GDT A;  2Q7C A;  1L0L G;  5CCG C;  1S2E A;  1QGN A;  2FFD A;  1JUN A;  3RBL A;  1ASC A;  2YXR B;  1S9K E;  2HPC A;  4WYD A;  1P84 D;  3U59 A;  1N31 A;  2ZY4 A;  1ZN5 A;  5AVS B;  1EJI A;  1TOE A;  1S5L H;  3R4T A;  5EUN A;  2Q1K A;  2ZSL A;  3SWK A;  2N9B A;  1NU1 D;  4WP0 A;  1AA0 A;  2B89 A;  2C0W A;  2KXP B;  1S07 A;  2ZT9 D;  1BGY D;  3AEG C;  2GUS A;  5APY A;  2B88 A;  1V2F A;  3WY7 A;  2P10 A;  3GHG C;  2OYH A;  3VK2 A;  3E6G A;  3H9X A;  3H7F A;  2AY7 A;  1GL2 D;  3MC6 A;  2AY8 A;  1FJP A;  3L75 G;  4YPC A;  2E43 A;  4ZSW A;  3VTP C;  3M0A A;  3AEL A; 
#chains in the Genus database with same CATH homology
 3LVJ A;  4JF1 A;  1DFO A;  4IXO A;  1CS1 A;  2CTZ A;  1KMK A;  2BYL A;  2AY3 A;  1T2K C;  3FVS A;  3NYT A;  1RF1 A;  3QM2 A;  4F5J A;  3R9A A;  1KIL C;  1MDX A;  2W7I A;  2HFE D;  5J8Q A;  2NPS A;  2QLR A;  3MAF B;  2BWP A;  4JYB A;  1TOJ A;  3LVL B;  5KJ7 D;  2M3B A;  2R5D A;  1KIL D;  2EH6 A;  4WY4 C;  2WZ7 A;  4WBA A;  4W80 A;  2QM8 A;  4XJO A;  1HBW A;  1CQ7 A;  3COG A;  1B5P A;  4W1V A;  1VJO A;  2J59 M;  3ASA A;  3V2R A;  5AVU B;  1FZA A;  1LW4 A;  1GTW A;  2DGL A;  1MUU A;  1GC0 A;  1ELU A;  1IX8 A;  3PP5 A;  1C7G A;  2D7Y A;  1XI9 A;  1JY2 O;  4ZLV A;  5APX A;  5HHY A;  2QM7 A;  2VMN A;  3D6K A;  1FOS F;  3BV0 A;  1SZU A;  3L44 A;  4CXQ A;  1T3J A;  2VGZ A;  3Q8N A;  4GE7 A;  4B98 A;  1MDZ A;  2Z20 A;  1FG3 A;  1LS3 A;  1S08 A;  4BQ0 A;  2HP1 A;  1GDE A;  4WB0 A;  4XEW A;  2N1T D;  4P7Y A;  3RK3 B;  4GKG A;  2CJH A;  3V4W A;  4Q75 A;  3I5C A;  2VMQ A;  1GL2 B;  2CPB A;  2R2N A;  3WZF A;  1WKH A;  2CPS A;  3IFM A;  3FKD A;  4A0G A;  5BJ3 A;  2BIE A;  2HOR A;  2GUV A;  2W7F A;  2P67 A;  3HUS A;  3P1T A;  2PB0 A;  2XDJ A;  1GCK A;  2VMV A;  4UHM A;  3VMY A;  3OKS A;  4A72 A;  2BI2 A;  1LKC A;  5G09 A;  1O69 A;  1JOC A;  2BIA A;  3QPG A;  3BWN C;  5AW7 B;  3KE3 A;  3VAX A;  1ASF A;  2IFN A;  2KFP A;  3PA9 A;  5I92 A;  2W8W A;  5CCH A;  4EMY A;  3EIB A;  2BAS A;  4RIZ A;  3VOP A;  2ZUK A;  3ZRR A;  4BA5 A;  1B9I A;  1ZR2 A;  1CZC A;  1BS0 A;  2G6W A;  1N2D C;  2WK9 A;  2CJD A;  3TAT A;  3N4S A;  4QGR A;  4W1W A;  1AY5 A;  3DRD A;  2FNI A;  2KLV A;  3CL3 D;  1WYU B;  3VP9 A;  2W27 A;  2VI9 A;  3TSI A;  2E7I A;  1D2F A;  1FZE A;  2OKJ A;  1LTI C;  2W7E A;  3AV7 A;  2YO3 A;  2XNX A;  3QN6 A;  4C7N A;  3I16 A;  4LNM A;  2BKW A;  1ASL A;  4GE4 A;  4WD2 A;  4F5K A;  1IBJ A;  1ZV8 A;  5AVQ B;  4W7Z A;  1V2D A;  1YJS A;  2VMZ A;  5IWQ A;  2W8U A;  4DOJ A;  4Q76 A;  1KIL B;  1IAY A;  1CZQ A;  5BVZ A;  2R0T A;  1W3U A;  2ZY2 A;  2VLF A;  1S09 A;  2OAT A;  1G7X A;  3P8C E;  2ZY3 A;  4IYO B;  4M2K A;  1M4N A;  2P7J A;  3B5N B;  1BQD A;  3WKS A;  2EZ2 A;  4Q6R A;  1AHE A;  1BT4 A;  4Y99 B;  4TMR A;  4FL0 A;  3IR9 A;  5CMZ A;  1FZC C;  4AH3 A;  1N7S B;  2NPS D;  3V4Q A;  1E5E A;  1O61 A;  2D7Z A;  2YMY A;  3PAA A;  3I5T A;  1IK9 A;  3ZRQ A;  3G8M A;  1CL2 A;  2D64 A;  1O4S A;  1S06 A;  4ZSY A;  2VMS A;  3MAU A;  5AW8 B;  2LKM A;  3CQ6 A;  1AKB A;  2QBT A;  2VMP A;  1WYT A;  3BCA A;  5EIG B;  3QBO A;  1PG8 A;  5F8V A;  3GHG B;  3VYI A;  2FNU A;  4GDY A;  2PB2 A;  2OKK A;  1JY2 P;  4K2I A;  2Z5I A;  4JF7 A;  3M5U A;  1Y4I A;  1AJS A;  1URQ B;  3N5M A;  1DJU A;  1RY3 A;  1QL2 A;  4IW7 A;  4WYA A;  1LTJ C;  1LT9 A;  2YCN A;  1SQP K;  1WYT B;  3WCO A;  2VGS A;  4WXG A;  2WPQ A;  1M1J B;  5CCH C;  1NHL A;  1DGD A;  3UE8 A;  2FXM A;  2KB7 P;  3M9H A;  3E2Z A;  5EUD A;  1BKG A;  1ARI A;  1LWU C;  1BQA A;  1N2T A;  4ADD A;  5HXX A;  4MSO A;  4EB5 A;  1UU0 A;  2HUI A;  2YKU A;  5M4D A;  1V2E A;  1J1D B;  3JWB A;  1SFC C;  3VP6 A;  2NPS B;  2W7H A;  1M6S A;  1OAT A;  3WX9 A;  1IFJ A;  3V5B A;  3PDB A;  1XTG B;  1AY8 A;  2PO3 A;  3LW5 H;  3V2Q A;  3G7Q A;  2E7J A;  3K7Y A;  1GK4 A;  1PFI A;  4AZJ A;  3ELE A;  3NTN A;  4E1O A;  1O62 A;  4R2N A;  1KL2 A;  2O1J A;  3ZRP A;  3BRV B;  4EFF A;  5APQ A;  2V1P A;  3GZC A;  1GK6 A;  3VMX A;  1H88 A;  3BAS A;  5APU A;  1GD2 E;  2XKM A;  2X8U A;  2VGW A;  1H1C A;  3NNK A;  3TYY A;  2WSC H;  1GW4 A;  3ISL A;  3W1J A;  1M0P A;  2QSR A;  3CLQ A;  4DZO A;  1DX7 A;  5AW1 B;  2WKA A;  2EO5 A;  4EU1 A;  1JCD A;  2Z1Y A;  1ASN A;  3NYS A;  4Y0H A;  1YIY A;  2VMT A;  1VP4 A;  2CB1 A;  1JY2 N;  5APS A;  3B5N C;  4W91 A;  2N1T A;  1GL2 A;  2KP8 A;  4IFF A;  1SP4 A;  4OYT A;  3RUY A;  1W7M A;  1FZC B;  2YRI A;  4U2H A;  3R2P A;  3B5N D;  5DX5 A;  5HDM A;  2WT7 B;  1LK9 A;  3MTU E;  4JYC A;  1RVU A;  2EZ1 A;  1QZ9 A;  4IXZ A;  3HVY A;  3KQG A;  1D7U A;  3C9I A;  1GC2 A;  1XEY A;  3LV2 A;  2AAT A;  3NYU A;  4MQP A;  2R5B A;  1G1J A;  5C6U A;  1HGZ A;  1G7W A;  1KKP A;  4OC9 A;  1M1J C;  3RQ1 A;  3AEJ C;  2QA3 A;  3L37 A;  1WYV A;  3GR9 A;  3GZD A;  2DGM A;  3RCH B;  1J04 A;  4P3M A;  5AVY B;  1UU2 A;  1RVY A;  4M2M A;  1CSB A;  4PIW A;  4UHN A;  4ZWV A;  2C81 A;  3FQ7 A;  4K05 A;  5KJ7 C;  1C9C A;  1NWQ A;  4ZDL A;  4ATQ A;  1ASA A;  2OYH B;  3QI6 A;  5EAV A;  3DR7 A;  2W7M A;  1WYU A;  2WSE H;  5KTB A;  1JNM A;  3KPE A;  1X2A A;  2KSJ A;  1YNU A;  4RIT A;  4CXR A;  3HTK B;  1EQ7 A;  2Q7W A;  2FKW B;  1QJ5 A;  4C7R A;  2W7L A;  2OYH C;  1M7L A;  3MEB A;  3FVU A;  1T3I A;  1GEX A;  1E5W A;  3L35 A;  3B46 A;  1FZB A;  3P7K A;  4A0R A;  3EIA A;  1XTC C;  3MAF A;  4RJ0 A;  3HDO A;  3FSL A;  4XA4 A;  2YHK A;  1SFC B;  4PVF A;  4M2J A;  3FRK A;  1NAF A;  2A45 H;  4LNL A;  4W1X A;  3HLM A;  1LWU B;  2QB2 A;  3NU7 A;  3A9Z A;  1URQ C;  3HTK A;  3GJU A;  1D7V A;  3DXW A;  5APT A;  2H43 A;  2Z9V A;  1AIC A;  2WPR A;  2YKV A;  4LLH A;  3N0L A;  1W7L A;  2D63 A;  4UHO A;  3MC6 C;  2G7J A;  2C9L Y;  4A6R A;  1AY4 A;  2EYQ A;  1FOS E;  1SZK A;  1DH3 A;  4EOT A;  4DQ6 A;  4H63 Q;  4J5U A;  1YOO A;  3OP7 A;  1AMA A;  3MD0 A;  1SF2 A;  3E2Y A;  1LC5 A;  1SVV A;  1T2K D;  3BC8 A;  3EZ1 A;  4A0H A;  2FFD C;  1NU1 K;  1HGV A;  1SQB K;  3A2A A;  4JEW A;  2ZC0 A;  2RFV A;  1BJ4 A;  4MQR A;  2GMU A;  4W7Y A;  3BN1 A;  1AAW A;  1RV3 A;  3FTB A;  2GSA A;  4WY4 A;  2IPP A;  3M0D C;  3PPL A;  4GEB A;  1SQX K;  4OH8 B;  1KZU B;  3RL0 B;  4PFF A;  1WKG A;  3MKJ A;  4PFN A;  1N73 C;  4R5F A;  2OGA A;  1NOH A;  3B1C A;  4AUW A;  1FU1 A;  2X5D A;  1PMM A;  5M49 A;  1YAA A;  2VYC A;  4K2M A;  3IHJ A;  4N6J A;  3F9T A;  3EI7 A;  2CAN A;  1H89 A;  4ADB A;  1AIA A;  4WXF A;  1IJI A;  1NTM K;  1B4X A;  2D65 A;  2DOU A;  3L8A A;  1M1J A;  3BWN A;  3DYD A;  3WMM 0;  2EPJ A;  1B5O A;  2FM1 A;  3U1C A;  3PGY A;  4BA4 A;  4AZK A;  3JWA A;  1FDM A;  2ZFC A;  3HE4 B;  3KKI A;  4ZM3 A;  2R5C A;  1AMQ A;  3H32 B;  3AOV A;  1G1I A;  1FAV A;  3VK4 A;  3N4R A;  4E3Q A;  5KJ7 A;  4JF0 A;  3HUS C;  1ZLL A;  1V72 A;  1GW3 A;  1HTL C;  1SPA A;  1URQ D;  3MGN A;  5DB5 A;  1LW5 A;  3FZ6 A;  3ELP A;  5FT6 A;  2VRS A;  2P2U A;  1T8Z A;  3CI9 A;  1BW0 A;  3ASB A;  1AAM A;  4MKJ A;  5BU8 B;  5AVT B;  3VMZ A;  1LGH B;  2O01 H;  1TAR A;  3V2N A;  3G0T A;  3HD7 C;  3HE5 A;  1CW5 A;  4OBU A;  4ZKP A;  3FDD A;  5E5I A;  2FQ6 A;  2XBN A;  2VMR A;  1HWT C;  5G2Q A;  4GT1 A;  4XJL A;  3E1I A;  3HD7 D;  4Q31 A;  2XZR A;  1AKC A;  3K28 A;  3RK2 D;  2BI1 A;  1JS3 A;  3HD7 B;  1VEF A;  2X5F A;  1LTT C;  2R32 A;  4WYF A;  1AIB A;  2JJF A;  2JIS A;  4ISY A;  3HE5 B;  3M06 A;  2VMY A;  3B8E B;  1AHY A;  3USF A;  3ATH A;  3I4J A;  3BCB A;  2AY6 A;  1FG7 A;  5AW2 B;  3AEM A;  2C7T A;  5AW0 B;  3NU8 A;  3F6T A;  5CHX A;  3BVH A;  1FJK A;  5K8B A;  1M0N A;  3BCX A;  4GRX A;  1BJW A;  5CCH D;  3CQ5 A;  3RI6 A;  2XV5 A;  3F0H A;  3HMU A;  2AY1 A;  1Z7D A;  2FN6 A;  3QGU A;  2HOZ A;  4IX8 A;  1SQV K;  3PD6 A;  2BHX A;  3EI9 A;  2A45 G;  4C46 A;  1VDF A;  3A9X A;  3GWP A;  5EUE A;  5G0A A;  3OAK A;  3MBB A;  4WYG A;  4KAM A;  3JZL A;  1AJS B;  1WRG A;  3T97 A;  4F5I A;  1N7L A;  2YCT A;  1GZL A;  3MAD A;  3WGB A;  3PJ0 A;  3RCH A;  4DBC A;  1X28 A;  4LW4 A;  1DJE A;  4OT8 A;  2HG5 D;  1D7S A;  3E9K A;  2ZXE B;  4EIJ A;  2FKI A;  1YYC A;  2JG2 A;  1EG5 A;  1SVF A;  2JJH A;  3W1I A;  3KGX A;  3LVK A;  1ZOD A;  3A8U X;  4OMA A;  4WXB A;  1LT9 C;  3VP8 A;  1ART A;  1MFZ A;  1TOK A;  3NUB A;  1L4A B;  2HZP A;  3FDB A;  5AVV B;  1IX7 A;  2Z5H A;  2BWN A;  1IFM A;  2OQX A;  1RF0 A;  2MJZ A;  1M32 A;  2VMW A;  1LWU A;  2DKB A;  3AAT A;  4I1L A;  2O7C A;  2VLH A;  3RK2 C;  4A0F A;  1ASB A;  1RE4 C;  5AW4 B;  4WLJ A;  3TK1 A;  3EI6 A;  1ASE A;  1KL1 A;  2YRR A;  1LTJ A;  2JJE A;  2KYV A;  2VIA A;  2Z61 A;  2O1K A;  4KXK A;  3E77 A;  1AHG A;  1L4A A;  1OXZ A;  2GMS A;  3VN0 A;  2PP6 A;  1X8Y A;  1I43 A;  3GBX A;  4EB7 A;  3M91 A;  2JEE A;  4KHX A;  3HD7 A;  3CQ4 A;  4AYC A;  3P8C D;  1NKN A;  4ZM4 A;  1ZOB A;  1UU1 A;  2C0X A;  3TFT A;  7AAT A;  1N7S C;  3BS8 A;  3FQA A;  1KFN A;  1LTJ B;  2CIN A;  4E77 A;  1L0L K;  8AAT A;  1AMR A;  1W23 A;  3FCR A;  3LY1 A;  2QMA A;  1JS6 A;  2CST A;  1N7S D;  1C7N A;  4A6T A;  1OXO A;  1AMS A;  4XJM A;  4MKK A;  2CFB A;  3A7O A;  2W8T A;  5M4B A;  3DZZ A;  4HVK A;  2YKX A;  5CJ0 A;  1KIL A;  2AEV A;  1RV4 A;  2JJL A;  1IFN A;  5CCG A;  5G4I A;  5DJ9 A;  5D5S A;  4WY4 D;  3MIW A;  1JTH B;  3T32 A;  1DGE A;  1WST A;  3FFH A;  3FFR A;  4N0W A;  1G2C A;  5AW3 B;  2CJG A;  3PD6 B;  3A3Y B;  2Q3I A;  2EGY A;  2A45 I;  4H51 A;  4U1T A;  1NTZ K;  3RK3 D;  5TF5 A;  2WT7 A;  4AO9 A;  1IFD A;  3B5N A;  1GL2 C;  3PDX A;  1J2J B;  3TNU A;  5AW6 B;  1B9H A;  3GHG A;  1AHX A;  4O6Z A;  4CBR A;  1S0A A;  4IY7 A;  1CI6 B;  3DOD A;  2I1J A;  3RK3 C;  1GU5 A;  2OAR A;  1JTH A;  4R5Z A;  1FC4 A;  2HOD B;  2DR1 A;  1G2C B;  1MAP A;  1IO4 A;  1BJO B;  2ZP7 A;  4LW2 A;  4E3R A;  1YJY A;  4J8L A;  1X79 B;  1RF1 C;  1OWA A;  4WBT A;  1I48 A;  1VPC A;  4LNJ A;  2ZSM A;  2N1T C;  1X0M A;  1J1D C;  2FYU K;  3NDN A;  1EQB A;  2NPS C;  3U1A A;  2HYN A;  5D95 A;  4CVQ A;  3ACZ A;  3TFU A;  1KQL A;  1DKA A;  2KOG A;  1B8G A;  4L0O A;  4XK1 A;  4AO4 A;  2WWW A;  1GBN A;  2GB3 A;  3N7N A;  2WPS A;  1HVV A;  4RES B;  4JEX A;  1AJR A;  3WKR A;  5F9S A;  1OHY A;  3BWO A;  2YKP A;  3FD0 A;  4I2L C;  2IX7 C;  3NTJ A;  5JAY A;  1PMO A;  1YJZ A;  5EAA A;  3CAI A;  1CQ6 A;  1Z3Z A;  3P8M C;  3JTX A;  4ZKU A;  1OXP A;  1MAQ A;  2VMU A;  3L4F A;  2W6A A;  5BU5 A;  3V2P A;  1X9V A;  3AEN A;  2W7D A;  3GZD C;  2PAJ A;  4I8A A;  2FYF A;  1TPL A;  2HOY A;  5M46 A;  2R5C B;  2BI9 A;  1N8P A;  3TQX A;  4RJY A;  2ORD A;  1J1E B;  3EQ2 A;  1GEY A;  2C0R A;  1ARS A;  2HLO A;  1SFF A;  2DGK A;  4B86 A;  3FVX A;  3OJA B;  1T3U A;  3N4X A;  1AKA A;  2YO2 A;  2YOB A;  3DC1 A;  1GD9 A;  4WB4 A;  1JY3 N;  1ARH A;  3EZS A;  1MLZ A;  5FT8 A;  3RL0 C;  1MV8 A;  2XU6 A;  2WTY A;  2VGV A;  5AVW B;  5BJ4 A;  4A00 A;  2C9N Y;  1NKZ B;  1SFC D;  2W7J A;  3AEJ A;  1FZG A;  2BIG A;  3PIU A;  5AVX B;  4F5G A;  2AY2 A;  3B1E A;  5FT4 A;  3NMD A;  5E3K A;  4XJP A;  1FBM A;  1AFO A;  4WYE A;  4WY4 B;  4W8I A;  3UWC A;  1N73 B;  2BWO A;  2YCP A;  3GSB A;  4Y99 C;  4WYC A;  3AEO A;  1YTZ I;  3FZ8 A;  1A02 J;  2YNY A;  4HF8 A;  3M9Q A;  4KYO A;  3M9B A;  1CL1 A;  1I41 A;  2AY5 A;  2VGU A;  4LGD E;  3A2B A;  1NH4 A;  2A1V A;  3P32 A;  3ZZJ A;  2Z1Z A;  1AX4 A;  4ITG A;  4XQ2 A;  5EQC A;  1JY3 O;  3BB8 A;  2E54 A;  1L4A D;  1ARG A;  4F5M A;  3AOW A;  3HRN A;  1ASG A;  1ASM A;  1CJ0 A;  2H8P D;  4CBS A;  1N73 A;  3BAT A;  3HT4 A;  4ADE A;  2BI3 A;  3HL2 A;  4OBV A;  2W8V A;  1IUG A;  2CH1 A;  2W8J A;  5G2P A;  3O8Z A;  3II0 A;  4LC1 A;  1U08 A;  3FQ8 A;  4BHD A;  4DGT A;  2C44 A;  4UQV A;  4HYT B;  2ZY5 A;  5APV A;  1RF1 B;  3KDP B;  3OA7 A;  1GC4 A;  1LC8 A;  5KLV K;  5AW5 B;  1X29 A;  3EUC A;  3VOM A;  3E2Z B;  2WK7 A;  1G4V A;  4WLH A;  4FFC A;  4M3L A;  4TN4 A;  1MGV A;  4JEY A;  2OYI C;  3DXV A;  1DEB A;  1MZ9 A;  2FFD B;  4IFM A;  1FZF A;  3VK3 A;  1CZE A;  3B1D A;  1RE3 A;  3A5T A;  2XH1 A;  3E2F A;  2DKJ A;  3G3Z A;  4N78 E;  4RKD A;  4ZAS A;  3N75 A;  1QIS A;  4C7N B;  1H8A A;  1GU4 A;  1UKJ A;  1KFM A;  2X3L A;  2CY8 A;  3M0D A;  2VMX A;  2GM4 A;  1ZR4 A;  1DTY A;  4LC3 A;  2F8J A;  3UIA A;  3B8X A;  3A9Y A;  4GE9 A;  3FZ7 A;  3LID A;  3WGC A;  4WB0 B;  1YIZ A;  4OCA A;  1CQ8 A;  2AY4 A;  1E5F A;  1IX6 A;  2POH A;  1G4X A;  1FZC A;  3KGW A;  2W7G A;  4Y0I A;  4O9B A;  4GIF A;  2NMP A;  2OGE A;  1LTS C;  1AHF A;  3KYQ A;  1DJ9 A;  1JCC A;  3DU4 A;  3EFG A;  1YTZ T;  9AAT A;  1C7O A;  1LTA C;  1TAS A;  3K40 A;  1QL1 A;  4JEZ A;  2O1B A;  1Z56 A;  1GEW A;  1ORD A;  4XAU A;  2JJG A;  3WCN A;  2WIT A;  2VGT A;  5AVR B;  4F5F A;  1WYV B;  2YKO A;  1IC2 A;  1KKJ A;  1JMM A;  2J58 A;  2Z9X A;  2HP2 A;  1IVR A;  3TNU B;  1J1E C;  1JF9 A;  2AY9 A;  1ECX A;  1LTG C;  1ZC9 A;  3NRA A;  1TOI A;  3HBX A;  3CBF A;  5EIG A;  5DJ1 A;  5FT5 A;  1HH0 A;  2H7H A;  1TAT A;  4GSA A;  2VI8 A;  4XE5 B;  3AEM C;  2O0R A;  2HOX A;  3LIE A;  1JG8 A;  4OTL A;  1WT6 A;  2Z4E A;  1W2E A;  3HUS B;  2Q5U A;  4RLG A;  1D7R A;  1QIT A;  2E7U A;  3NFQ A;  1C4K A;  2HUF A;  1M0Q A;  3H6P A;  4ZAH A;  3ECD A;  4ZWM A;  1SFC A;  2W6B A;  1JO5 A;  1CI6 A;  5AVZ B;  2D61 A;  3AEP A;  3II6 A;  1BJN A;  1SZS A;  1JY3 P;  3AEN B;  2Q9I A;  2HOD A;  1SQQ K;  4I6M C;  3SWY A;  2IFM A;  2OYI A;  5CCG D;  4JEV A;  2R5E A;  1MDO A;  2JGT A;  5G4J A;  3LG0 A;  1RE3 C;  1IJD B;  4ATP A;  4ITX A;  5E4Z A;  2L5G B;  1HJB A;  4UOY A;  4F4E A;  1RF0 C;  2Z9W A;  2ZJG A;  3PDB B;  3W1H A;  3RL0 D;  3HQT A;  1H0C A;  1NTK K;  1IAX A;  1W7N A;  2YKY A;  3LVM A;  3HE4 A;  4ZDO A;  4HH2 A;  3BRT B;  4RKC A;  3TCM A;  3H32 A;  2TPL A;  2YKQ A;  2OYI B;  5EFS A;  4A6U A;  1AQ5 A;  2R3C A;  1IFI A;  4K2B A;  4ADC A;  2GQN A;  2D66 A;  1LC7 A;  4IFD K;  4F5H A;  3UAK A;  1TOG A;  3EI8 A;  5CJ4 A;  3SWF A;  2QB3 A;  1A02 F;  3ZZK A;  1MLY A;  3GET A;  3L36 A;  4R8D A;  4F5L A;  1NO4 A;  3WLX A;  1OHW A;  2Z9U A;  1M0O A;  2HUU A;  3QHX A;  3LWS A;  1C0N A;  1ASD A;  4IXS A;  4N78 D;  3NUI A;  4AQR D;  4MQQ A;  1S9K D;  4IYO A;  1L4A C;  3JW9 A;  1I29 A;  2WB6 A;  3P6K A;  3NX3 A;  3MUD A;  2V0Y A;  2W7K A;  5AX8 A;  4NOG A;  3EI5 A;  1URQ A;  2M8R A;  5AW9 B;  4AOA A;  3RBF A;  2N1T B;  4BMK A;  2BI5 A;  1LT9 B;  1P3W A;  2I1K A;  1N7S A;  4B9B A;  4N3Y B;  1ELQ A;  2BYJ A;  2VMO A;  1PFF A;  4MY5 A;  2HPC B;  1M7Y A;  2E42 A;  1J32 A;  1GC3 A;  4W5K A;  1QJ3 A;  2AEU A;  2WK8 A;  4RAE A;  2FYZ A;  1BJO A;  2ZYJ A;  1KMJ A;  4ZDP A;  2P1J A;  3RK2 B;  4Y0D A;  1RE4 A;  2WSF H;  3DR4 A;  3NXS A;  1SLQ A;  1L0N K;  1OHV A;  2CH2 A;  2VIB A;  4RM1 A;  2D5Y A;  5APW A;  1HUC A;  1LTB C;  1QIR A;  1N86 A;  1GDT A;  2Q7C A;  5CCG C;  1QGN A;  2FFD A;  1JUN A;  3RBL A;  1ASC A;  1S9K E;  2HPC A;  4WYD A;  3U59 A;  1N31 A;  2ZY4 A;  1ZN5 A;  5AVS B;  1EJI A;  1TOE A;  3R4T A;  5EUN A;  2ZSL A;  2N9B A;  4WP0 A;  2C0W A;  1S07 A;  2GUS A;  5APY A;  1V2F A;  3WY7 A;  3GHG C;  2OYH A;  3VK2 A;  3E6G A;  3H9X A;  3H7F A;  2AY7 A;  1GL2 D;  3MC6 A;  2AY8 A;  1FJP A;  2E43 A;  4ZSW A;  3VTP C;  3M0A A;  3AEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...