3N7NA

Structure of csm1/lrs4 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
163
Chain Sequence
PLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords Monopolin complex subunit CSM1
total genus 53
structure length 163
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3n7nA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n7nA02
3OJAB 3HRNA 4ZKPA 5KTBA 1X79B 1IC2A 5BU8B 3VP8A 5BVZA 3N4XA 3N7NA 2POHA 3BATA 2JEEA 5BU5A 3U59A 4O9BA 1NKNA 3N4RA 4I1LA 4N78D 4GIFA 3U1CA 3VP9A 3BASA 4N3YB 3P8CD 4ZKUA 3U1AA 1WT6A 3N4SA 3C9IA 2FXMA
chains in the Genus database with same CATH superfamily
2CY8A 2R5CB 5G0AA 4ZKPA 1LT9C 2Z9VA 2W8TA 4LC1A 3A9YA 4ZWMA 4NPFX 4PV1B 2JDIH 1GTWA 1YQ3C 1JY2O 4PV1C 3QPGA 1JTHA 2XV5A 3GW6A 2JO1A 2POHA 3K40A 2WSCJ 4DJGA 2BCCJ 1FDIA 1M4NA 3DODA 1SQQG 4TLFA 1LJ2A 1LT9A 2P7JA 4OWFA 1H0CA 1SFCD 1AA0A 2I8DA 5CHXA 2KOGA 2O3JA 3TCMA 4M2KA 2O01J 1FZBA 2CH1A 4WY4A 4A7PA 3BS8A 4HYTB 3VMYA 1P84H 4HJGH 2C9NY 4JBZA 1UU0A 3N4RA 1IX8A 2OYHA 4Y0HA 1GDTA 2EH6A 2A45G 1NU1G 3HE5B 2QA4P 2XNXA 2H89C 1C9CA 3RK2B 1NTZE 3L70J 2JISA 3PA9A 3C9IA 5FT6A 1FAVA 2ZYJA 1JO5A 2YOBA 3K7YA 2C0WA 5CCGC 3WGBA 2E42A 2AY7A 5GTHH 1FS0E 2AEUA 4F5FA 3MP7B 3WMM0 5K8BA 3EWKA 3G0TA 5TISE 2YO3A 3KE3A 1DEEG 1R8EA 4O9BA 3L8AA 2ZUKA 1DFOA 3VP9A 3FQ7A 2VMVA 2CH2A 1BGYD 2V7QJ 2Z5HA 5E3KA 4FL0A 3VMXA 1SQPD 2WK9A 3CC7P 5AW5B 1IVRA 1RQVA 2IPPA 2KIKA 2Q1KA 2KNCA 1JOCA 1DJEA 5EAAA 2Z9XA 2QG4A 3BV0A 5B5EE 3MUDC 2QIWA 1NTKE 1W5CE 2M5AB 3RL0C 3B46A 3HE5A 1O62A 1OVVA 3RBLA 5AX8A 3Q3DA 3ZRQA 2YXRB 2H43A 3NFQA 2BEQD 4MKKA 3G3ZA 3M9BA 2XH1A 1MLZA 4JYCA 1NTKK 2E74B 2W8ZA 3SWKA 1NKZB 1SQPG 2M3EA 2JKVA 2O1JA 1D7RA 4WYAA 1ZW0A 1ASNA 1ASFA 3CLQA 3N0LA 5IWQA 1LWUC 3F89A 3IFMA 2OYHC 3HDOA 1KD1Q 3TGUD 2YIUC 3TGUE 3NUIA 1LTBC 4WB0A 2W6BA 1EC5A 2OKKA 2XU6A 2BYLA 4JEYA 1GDEA 1G7XA 3HVYA 3PAAA 2HOZA 2AY9A 3L71D 1GL2A 2C9LY 2BIEA 3AEFC 5EFSA 4DBCA 4EMYA 1PP9G 3H1KD 1GC4A 3VMAA 2FBWC 1URQC 3PD6B 2J58A 3NX3A 5E79E 4OYTA 4PVFA 4NOGA 1YJ9P 8AATA 4U1TA 2NPSD 2Q3EA 1V72A 2JP3A 1PGPA 2FM1A 1LT9B 5AW3B 1JCDA 2W7FA 3EI5A 4MQQA 4OGQD 3E2ZA 4AH3A 1JMMA 1FBMA 4WYGA 1RE4C 2IBZI 2Q6QA 2FQ6A 3MTUE 1S1CX 3KZIH 4MN4C 3WX9A 1SQPE 4ITXA 1X9VA 5AW6B 3JSVC 3H1HG 2WPSA 2BIGA 4WB0B 2AY4A 4LW4A 4R4LA 2VMYA 1H89A 1D7SA 2G3AA 1XI9A 1QL2A 1M0QA 3VMZA 1AJRA 2LXCB 5M1BA 4ZDOA 1OHWA 3GHGB 1AIAA 1JS6A 3G6EP 3PIUA 1KN7A 3W67A 2H7HA 2HP1A 4M2JA 3M91A 1FE6A 4BXLA 3R2PA 1DX7A 3G71P 3CCJP 3NYTA 1YIZA 4ZM3A 3AE1C 2YRIA 1QIRA 2A06G 1AICA 4W8IA 2D2CD 2EZ2A 2YKYA 3AATA 1KYOE 3L37A 4I7ZB 3MD0A 1LC7A 1SVVA 2VI8A 3M06A 3HD7C 2LXBA 3H9XA 3ZDMA 2XDJA 2KI7B 1NU1J 2R0TA 3ATHA 5APSA 3RL0B 2HORA 2Q3IA 2MKVA 3AENA 1KB9H 5CBOA 2HG5D 3H1IJ 1ZR2A 3K5BA 2VMZA 1JY3O 5KLVE 2HOYA 1ZV8A 1W2EA 2NPSC 2VRSA 2P2UA 1KQLA 4F5LA 1BE3G 2FXMA 2IDBA 3TSIA 2R5BA 3HT4A 1AHFA 3ZZKA 2XZRA 1EQ7A 1ZP0C 3E2FA 1AAMA 1KV4A 1TASA 5HHYA 2AEFA 3RBFA 3CBFA 2KYVA 2Y9ZA 3H1LD 1L2PA 2BCCG 1KYOD 5AVRB 1Q81Q 1N7LA 1NAYA 3DR4A 2HZPA 3L44A 1SQXG 1NTZD 1RQUA 2DGMA 1SF2A 3VTPC 4GE7A 3LIDA 1OXZA 3RK3C 2WT7A 1VJOA 7AATA 4N78E 2LR2A 2QVAA 4WYEA 1N7SD 1IX6A 4JEVA 3QN6A 1O61A 3N5MA 1V2EA 4IX8A 3HD7D 2DW3A 4WYCA 4L0OA 4W80A 3KZIE 3AENB 1GL2B 1OFCX 4JF0A 5AVSB 2WSFJ 4H13B 1BKGA 2E7JA 3A0HH 4ZAHA 1CI6A 3GZDA 3NTJA 2Z61A 4ZM4A 1DGEA 2WB6A 3BCCJ 1QJ3A 1GW3A 3SFDC 4M2MA 5DJTB 2W7DA 1JY2N 1G2CA 1AKBA 1G4VA 3CAIA 1JNMA 1D2FA 1SQXJ 4WY4B 3CWBE 3M9HA 1AY8A 4BHDA 5B66E 1PMMA 3P1TA 4IY7A 4JPZB 3U1AA 4WXGA 3VOMA 1ZLLA 3WUUA 3FDBA 1AMQA 1TATA 1BE3J 2AY8A 3CQ6A 3W1JA 3AE3C 4IOIH 3D71A 2ZYDA 2WVRA 3M9QA 2VMPA 4BA4A 5AW7B 3BWNA 4OTLA 3WKSA 1NKNA 3FWLA 3DU4A 3GZCA 3B8XA 3AOVA 2WZ7A 1IO4A 4DOJA 4WXFA 4NPEA 4BMKA 4W1XA 1MZ9A 5DX5A 2KXPB 1JG8A 1MV8A 3OAKA 3Q5SA 4U3FJ 1SQBG 2V7QH 4NPDA 2D2CC 2OQXA 4ZSYA 3L70D 1JM0A 1OIPA 1YJZA 5BVZA 1G2CB 4GE9A 4I1LA 4PD4D 1I41A 2F8JA 1H0TB 2R5EA 3HQTA 1TOIA 5AVZB 4GOEA 2H8PD 1AVYA 1KYOI 1LTIC 2C7TA 1J1DB 3AV7A 3F0HA 5AW9B 2O1KA 3OA7A 3WCOA 4JF1A 1UIIA 3GBXA 3SSUA 1AMAA 4PIWA 3H1JE 1MFZA 3EZSA 2YMYA 1NO4A 1T3UA 2D65A 2AY3A 1X22A 3ITKA 1PP9D 1YIYA 1N7SC 1DIPA 3D6KA 1CW5A 2P1JA 2HODA 1L0ND 1MDOA 3NNKA 3II0A 1QL1A 2Y0EA 3F5HA 1HH0A 1M0OA 4AZKA 1GU5A 1AJSA 1EJIA 2OYIB 4QMAA 3PTZA 2RFVA 4W1WA 3EZ1A 1K05A 1BCCE 2FNIA 1USEA 3M0DC 1PMOA 3H1HE 2R2NA 5BU5A 3NYUA 3BCCE 1L0LE 4D6TG 2E76D 3GLMA 1KAFA 1VQPP 3PD6A 3A3YB 1RF0A 1SQVK 3CXHE 1ZMEC 2W8WA 3VK4A 2R44A 2VLHA 3A2AA 1N86A 3KGWA 1LGHB 1AFOA 5KKZB 3NUBA 2Z20A 1Q86Q 1PFIA 2B89A 1U57A 2Q7CA 2D66A 1ARSA 2Z1YA 4L75A 2GSAA 1JMBA 2N1TC 2DOUA 3EI6A 2KZIA 2E75D 4GODA 5AW1B 4EDFA 2ZSLA 4A6TA 2AY6A 3BC8A 4ADDA 3H1JJ 4ZSWA 1KILC 1ZR4A 4ZLVA 3R9AA 5JAYA 1NHLA 1FZAA 2X5DA 3H1ID 1CSBA 2YCPA 1MDXA 4H63Q 2M0BA 3QGUA 2W90A 2M5AA 3GG2A 1EDLA 1KILA 4IFFA 1J1EC 1JTHB 1SZUA 2R3CA 2OYIC 2H88C 3MAUA 2VGZA 1LTJB 4W5KA 5J8QA 1YJYA 2QSIA 4F5MA 3DXVA 2GUSA 3JC22 4XEWA 1WYVB 1YOOA 1N73A 1RF1B 2VGUA 3DC1A 1IFJA 1S06A 4IYOA 4I2LC 5KAIH 1GCKA 4BRYA 1VQ8P 3ZZJA 2UWJE 2HYNA 2W6JH 1ELUA 1LW4A 1K8AQ 4CBSA 1Q90D 1B9IA 1KL1A 2N1TD 3HTKB 2E5YA 2AXTH 1BJWA 4OT8A 2QLRA 2OTKE 1E5FA 3OKSA 1DJUA 1D7MA 1VQ6P 2AY5A 5M4DA 1R5LA 3WY7A 2GMUA 3CWBG 1FJKA 1KL2A 1IK9A 1B5OA 2GUVA 3CX5H 3L74G 2FN6A 1FOSF 4BWNA 1NAFA 4PD4I 5G2PA 1I43A 2CANA 1OW7A 1NOHA 2W7MA 2P10A 1Y4IA 1KB9E 1GK6A 3BRVB 5KAIE 1JB0J 2BCCD 4RIZA 2HR3A 1EDJA 1KQSO 2ORDA 4GDYA 3V2PA 3F6TA 1NTZG 1XTCC 2FYUJ 4A6UA 3CC4P 3O6QA 2GQNA 2AATA 2CK3H 2IBZE 4K35A 3GF3A 3GWPA 2WMMA 5E4ZA 1H1CA 2ZC0A 3VK3A 5AW4B 1FJPA 1YHQP 4MKJA 3HTKA 2EPJA 2GB3A 2NRGA 1ARIA 3E1RA 2Z1ZA 2QJKC 3JWAA 1MLYA 1SQQE 3C1LA 4WLHA 1W2BO 1QLED 3TATA 1S09A 2OTJP 4LGDE 3HMUA 3H1KE 2D5YA 2W27A 2WSSH 1RE4A 3MAFA 1LKCA 3FXEA 3K28A 1ORDA 4ITGA 4MSOA 1RE3A 4U3FG 1P3WA 2ZY2A 1X0MA 3P7KA 3V6IA 3EQ2A 4AO4A 5AVQB 4HB1A 1LW5A 5M49A 4Q6RA 1ASMA 1SQVJ 1JY3N 3FXDA 2K37A 4GKGA 2YKVA 4JEWA 3L71G 2YMKA 1PZQA 2ZXXA 3PGYA 2W7JA 5AW2B 1MUUA 2QJYC 3H6PA 1B8GA 1O4SA 4MQRA 3H1JG 2CB1A 4HH2A 1UIXA 4R8DA 4PJ0H 2C81A 1HWTC 1BDCA 4DT0A 3FVXA 1QGNA 3EUCA 3VK2A 4F5KA 1BCCG 1ASCA 1GBNA 2JJHA 1GU4A 1X28A 2CTZA 5F9SA 3GHGC 5CCGA 1IK7A 3BWNC 1PIXA 3I16A 1PPJG 4RJYA 1M32A 4ZASA 2O01N 5G2QA 3WU2H 3AEMA 3FRKA 1W7LA 3TNUA 1AVOA 1D7VA 3B5NC 1LTAC 3AEDC 2A06E 1CQ7A 2I1JA 2IFNA 4Y0DA 3A9XA 2O0RA 2WK8A 2YNYA 1FZGA 4UB6E 3FQAA 2K3RA 4AZJA 1BGYE 3KQGA 1SFCB 3FKDA 2RMZA 2AY1A 5DJ9A 1URQD 1AKAA 1MFTA 4H0LC 1KILD 4RO0A 1ASAA 3L74J 2WKAA 4AOAA 3H1LJ 4CXRA 4H13C 1W7MA 2KLVA 2Z9WA 4E1OA 4RITA 1T6AA 1B9HA 1NTKJ 4K05A 4I6MC 1WRGA 1Z7DA 2QMAA 3BCAA 2ZT9D 4XJOA 3HUSC 3EIBA 2QJYB 2WK7A 1PFFA 4IW7A 1SFCC 1ZRTE 2JJLA 2VMTA 1AIBA 2E7UA 4LNMA 4GRXA 3HRNA 3IHJA 1M0PA 1KMKA 3PDBB 2VGWA 4RKCA 1L0NG 3QM2A 5KLIB 1FC2C 3FVUA 3USSA 1KILE 2QM7A 2E7IA 5TISH 3H1IG 4XA4A 3B71A 2FFDA 3P8CD 3TDKA 1NU1E 2FYUE 1Y9BA 1VQLP 1ARGA 3GJUA 4K2MA 1S9KD 2AXTE 3L75D 3AEGC 4GT1A 2W7HA 3DXWA 2OYOA 2Q5UA 3AEBC 1SQBJ 3CX5D 4A0HA 3RK3D 1VQKP 3AOWA 3MAFB 5B66H 2B87B 3B5NB 1HGVA 3QHXA 2OKJA 3CL3D 3ASBA 4K2IA 1M1KQ 3N4SA 3GSBA 4OH8B 3CXHH 1VF5B 3ELEA 5EUDA 2R32A 3L71E 3O8ZA 3COGA 5DB5A 1T8ZA 3E2YA 3WUTA 1AHGA 2E74D 2W8UA 2R5DA 2CPSA 1FDMA 2K9YA 2CINA 3L4FA 3EI7A 3H1HJ 1GK4A 2PAJA 5KJ7A 3PDBA 4W1VA 2JWAA 2ZJGA 1L4AA 2PRRA 2OYHB 4N3YB 3H7FA 1BS0A 3I55P 1AY4A 3VOPA 2DGKA 2PGDA 4A0GA 1EDIA 4XJPA 3FQ8A 1TPLA 4EU1A 4DQ6A 1SQBE 3HLMA 3GHGA 1X79B 2DKJA 5AVUB 1JY2P 4EB7A 3T97B 1ARHA 1NYHA 3USFA 4ZDLA 1EZVG 4A0FA 2Q7WA 3R4YA 3AEEC 1SQQD 5CCHA 1RF1C 2FKWB 2BWPA 3L75G 4IFDK 4H0LD 1KMIZ 1NTKD 1RHZB 4KT0J 1CL1A 2E76C 1LC5A 4PV1D 4MQPA 3TGUJ 4OGQB 1G7WA 3CX5E 2Z5IA 1Z3ZA 3FZ6A 1J1EB 1M6SA 3Q5PA 2TPLA 4M3LA 4U3FD 3L72E 3RK2C 2HOXA 3P8MC 4LC3A 4EYYQ 4PJ0E 1AMRA 3BCBA 1IFPA 3O6QB 2QB2A 3CCUP 2YKXA 1GC0A 5DJUB 1QGKB 3IF4A 2FXPA 2D61A 2CJGA 4H44B 2IZ1A 3CMEP 3E2ZB 1PPJD 3MHVA 1N31A 1H8AA 2FYFA 3B1DA 1FOSE 3CCRP 2NZ2A 3N7NA 4PFNA 3M5UA 2GMSA 3Q5RA 2WITA 2VMSA 1NWQA 3KGXA 4GSAA 2YCTA 3I5CA 3L72J 1VQOP 2OGEA 3NYSA 4BA5A 1T3JA 3LV2A 3CCVP 1AQ5A 1WT6A 2JGTA 1PGQA 1BT4A 1BJOB 1YAAA 2CJDA 3V2RA 4DCKA 4HVKA 1M7LA 3RCHB 1YBKA 3KPEA 2QM8A 2QRXA 1X8YA 1M1JA 1KFNA 2PB2A 3E7KA 4A00A 4JEZA 3RL0D 1T2KC 3U1CA 5APVA 1MAQA 4WBAA 4D6TD 5EQCA 1QISA 1CQ6A 2RN0A 1RV4A 2A45H 2QJPC 4XFJA 2ZY3A 2HUFA 3L74D 5CCHC 1XTGB 1GZLA 2A06D 1ASLA 2XNDH 2NMPA 2QJKB 2BKWA 1G1IA 2KNCB 2X8UA 1SZKA 3N4XA 5EUEA 3KHUA 3FX0A 2IX7C 2VIAA 3RQ1A 3WLXA 1VQ4P 5FT5A 1NVOA 1QITA 1ZXGA 4WB4A 1SQVE 3FFRA 2R3SA 5AVWB 3RUYA 3F9TA 4K2BA 4F5JA 3L75J 3L73J 4OCAA 1PGOA 4Y28J 4R5ZA 4TMRA 5M4BA 1AMSA 4UQVA 1HJ0A 1KFMA 5APWA 1V2FA 1VPCA 1OXOA 5G4JA 1PP9J 3S1KA 3A0BH 4IXZA 1SQQJ 3WUVA 3BASA 3NXSA 4YPCA 4H13D 1Q7YQ 1DGDA 2ZFCA 4D6TE 3HE4B 1BGYJ 1CL2A 3PDXA 2ZVNB 3L36A 1P84E 3CXHI 5E79H 4LNJA 3OP7A 2W8JA 5BJ4A 5C6UA 2VI9A 4GDOA 3VN0A 4WY4D 1BQDA 1SZSA 5EAVA 2W6AA 2HPCB 1IFDA 1S5LH 1L0NK 4OC9A 2WPRA 3RK2D 2WSCH 1DH3A 2CPBA 2D7YA 2YIUB 2VMXA 2ZSMA 4H51A 5GTHE 3I5TA 2YCNA 3V2QA 1HGZA 1TARA 1LS3A 1C0NA 4OMAA 4W7ZA 3L35A 5M46A 3AE5C 5KLVK 2YKQA 4WVZA 3N75A 2JJEA 1CQ8A 1NTME 2J5UA 2KP8A 2V1PA 3CCLP 3DYDA 1DEBA 4WBTA 3H32A 3PHLA 1J2JB 1TU3F 4AQRD 1S4XA 1IC2A 1FDOA 3JTXA 1GEYA 1KMJA 2O7CA 1GEWA 1T2KD 2P58A 3D70A 1QX8A 1BE3D 3EI8A 4WYFA 1OVUA 1DKAA 1JY3P 3ASAA 1HBWA 3UE8A 1L0NJ 3PJ0A 2YKPA 3AE7C 3RGUA 2VLFA 1UKJA 5KJ7C 4OBVA 3LIEA 2IZ0A 2WPVB 1Z56A 1PGJA 1IFMA 1L4AD 1C7NA 1M8OB 1QEXA 2WSEJ 3H1KG 1LWUB 2K88A 1H0TA 4WD2A 1VP4A 3GZDC 1GW4A 1LP1A 3CPWO 3FDDA 2W7IA 3H1LG 2N9BA 2K9JA 3GF7A 2R5CA 3E9KA 1SQXD 4CVQA 1KQGB 2RH0A 4MY5A 3D6YA 1D7UA 1Y47A 3H32B 3MADA 1FZEA 1RVYA 3PLNA 2W7GA 1CZEA 4ZKUA 1R5SA 3BWOA 2E76B 4KXKA 2AEMA 2NPSB 3L73G 2VMOA 1TOEA 5APYA 3VYIA 3CCMP 3WU2E 3JW9A 1IAYA 2OGAA 1EZVI 1RF0C 1N7SB 2M8RA 3BRTB 3QBOA 3II6A 3HD7B 3OW2O 1BSHA 1SQBK 1AQTA 4ZWVA 2HPCA 4B86A 1P84D 1GL2D 3LW5J 3L75E 4J8LA 2BI5A 3L74E 3FGAD 1KB9I 1SQPJ 1DD3A 2FYUD 1OXPA 1BCCJ 2ZY5A 3ABVC 1LTJC 1CI6B 4U2HA 3A5TA 3T32A 3QH9A 3V5BA 1SQPK 2MJZA 4XE5B 4XJMA 2DGLA 1JUNA 1TOKA 4UB6H 1Q82Q 3A9ZA 4XQ2A 1BJ4A 4I7ZC 1VQNP 2BI3A 3LVKA 3TYYA 2OARA 1M7YA 1WYTB 2JG2A 2IBZG 3BATA 2DKBA 2JR8A 4F5HA 3D6ZA 3ELPA 1SQVD 5F8VA 1U08A 2D2CB 1HVVA 3BCCD 1GEXA 4XK1A 1IFIA 2AXCA 3H1HD 2SPZA 1CZQA 4Q76A 1C4KA 3RCHA 2QA3A 1SQXE 3IN6A 3GMAA 3V4WA 2YKOA 2OATA 2QEXP 1L0NE 3SWFA 4OGQC 5KLVD 2M3BA 4U3FE 1ELQA 3C8VA 1SQXK 1WKGA 3E1IA 4ADEA 2A1VA 2BIAA 3CCSP 1ZN5A 4N6JA 5BU8B 2IFMA 1WYTA 2IYOA 4WYDA 2XKMA 4JYBA 1YTZI 4W7YA 1MAPA 1HTLC 1X2AA 1N73B 1GD2E 2VGVA 1WSTA 3KYQA 2L5GB 3L72G 4L74A 3TGUG 2FXOA 1LT1A 3LVJA 1E79H 2I1KA 3FZ7A 2QB3A 3W1HA 4EIJA 5CCGD 3S4RA 2BHXA 2PB0A 3A2BA 5CJ0A 2K9JB 4CXQA 2C44A 3NDNA 2FYNB 4F5IA 1GMJA 4IXOA 3A8UX 1S72P 5AVXB 2KUBA 3LY1A 2AEJA 3AE2C 4J5UA 1ASGA 1VF5C 2V4HA 2FYUK 1AAWA 2XBNA 2Y0CA 1OW6A 3JCUH 3BVHA 2GA1A 4AYCA 2ZYAA 1AV1A 4IXSA 1YJWP 4YXWH 1ARTA 1AHYA 3TQXA 2ZT9C 2ZJSE 3ZRRA 2WPQA 3FFHA 3AEJC 1LTGC 3A0HE 1S5LE 3FD0A 1ASBA 5EUNA 3MC6C 3MUDA 3PPLA 4ZMDA 1KKPA 2KK7A 5CCHD 2D63A 4IL6H 1S08A 4PD4H 1DTYA 1MKMA 4N0WA 3FVSA 1L4AC 3AEMC 4R2NA 3HL2A 3H25A 1OZHA 2Z9UA 3PP5A 3TNUB 1K73Q 3RK3E 5HXXA 3MEBA 1SQBD 3A0BE 3EFGA 2OQQA 3H1KJ 3CQ4A 3FZ8A 4Q31A 1S9KE 1BJOA 1X0TA 1NU1D 5HDMA 1J1DC 2X3LA 3CCEP 1KKJA 2W7LA 1OATA 4OBUA 4AUWA 2ZYGA 4RJTA 4UOYA 1DD4A 4HKZH 2N1TA 1I29A 4A6RA 1XEYA 3AELA 2E75B 3FCRA 2VGSA 3GR9A 3R4TA 1CJ0A 3E77A 2ZXEB 1S3JA 1USDA 5APQA 3QWOC 1T3IA 3MGNA 3SWYA 2G8YA 2E74C 2C0RA 3EFFK 3I56P 3P32A 2K1AA 2ZP7A 1NTZK 5G09A 2EO5A 1WYVA 4YXDC 3PH0A 4BQ0A 3HBXA 2PO3A 4FFCA 3CD6P 2HP2A 1WYUA 1U7JA 5GTIE 4EI2A 4IYOB 5BJ3A 2QBTA 1KORA 3P8CE 4ADCA 4K3AA 1AJSB 2WT7B 2WWWA 2N1TB 1URQB 1IAXA 4LNLA 1MDZA 3AEAC 4A72A 3Q2YA 1K04A 2Y0DA 5G4IA 4GE4A 2EGYA 2W8VA 2QE7H 2N9YB 1ZRTD 1P84I 3VAXA 1LTSC 3RBXA 4O6ZA 2KSJA 3NMDA 3IAOA 3BN1A 1RE3C 1RVUA 4TT3H 1RV3A 1BGYG 2O1BA 1M1JB 4ATPA 2BI1A 1S0AA 1N8RQ 2A45I 1SFFA 3AE8C 2QJPB 1YQ4C 1RH5B 1PPJE 2HUIA 4RM1A 1U7MA 3HD7A 1AX4A 1FC4A 1WYUB 4RAEA 1K9MQ 2D7ZA 5KJ7D 1M56D 1VQ9P 4F4EA 3LG0A 4KAMA 3AEJA 3I4JA 3ISLA 4DZOA 1FG3A 2FFDC 3RI6A 3L72D 1FZCC 1PG8A 5CBNA 4F5GA 1ZOBA 1JS3A 4L76A 5KLVJ 1B5PA 1WKHA 4WP0A 2YXQB 1ASEA 3FWNA 3BCXA 3RK3B 5TJHA 1VL2A 4B98A 4E77A 4OVNF 3G4SP 3DRDA 3B5ND 3NU7A 4RLGA 5D5SA 4E3QA 1JCCA 2VMNA 3S9OA 3GETA 4TN4A 3BB8A 4Q75A 1FZCB 1OW8A 2AEVA 1KYOH 3CMAP 5TF5A 2KZJA 4A0RA 2OYIA 4RESB 2ZVOB 5AVTB 1IJDB 3TF5A 1LTJA 5AW0B 2WSFH 1VEFA 2VMQA 4YTPC 2ITAA 3P6KA 1EXJA 4W91A 1L0LG 2IBZD 3JCUE 3MBBA 1YNUA 1OWAA 1GD9A 4ISYA 1SQVG 2OGUA 1EDKA 1OMIA 5CJ4A 1LWUA 1N2DC 2KS1B 4ASWA 1LP1B 3V4QA 1RY3A 2BCCE 1HUCA 3Q8NA 2FYUG 1KB9D 2IYPA 3KKIA 2VIBA 3VP8A 2VMRA 4WWIA 3G8MA 4R4MA 4LLHA 1QVGO 2RKLA 3WZFA 1OVRA 1KC8Q 3RL0g 5KKZC 4C46A 4IL6E 1J04A 4R5FA 1JF9A 2VYCA 2FFDB 1NGMB 4JF7A 2HUUA 1LTTC 1FZCA 3IR9A 5APXA 1J32A 5AW8B 1FU1A 1BE3E 4WLJA 1URQA 4KYOA 1VQ5P 4L73A 2BWOA 1DJ9A 5K5GB 3FTBA 2CSTA 1S07A 3L70E 1NTZJ 1S5LX 3CWBJ 1NTMK 2KFPA 1BW0A 1N7SA 4UB8H 1AHXA 2B87A 3B5NA 3CI9A 1JEKA 4B9BA 2W7KA 1B4XA 5AVVB 1FG7A 3LWSA 1N73C 2D64A 1S2EA 1BDDA 3NTNA 1A02J 1AKCA 2CFBA 2EZ1A 3G9RA 1GC3A 2G7JA 2BASA 1KILB 4IFMA 2WTYA 2CJHA 1CZCA 3MZWB 4HF8A 2YKUA 1G4XA 2B88A 3DR7A 3JWBA 4C7NB 2BI2A 3CCQP 4BRYB 3Q1MA 2FYNC 1PV3A 4P7YA 4ASVA 1NJIQ 2BWNA 4ADBA 1SQQK 3H1IE 1AY5A 1SS1A 1LNQA 1WMKA 1NTMJ 1CS1A 1BJNA 1ECXA 2ZY4A 2Q9IA 5AVYB 3TK1A 5FT4A 2VMWA 2J59M 1IX7A 1EG5A 1L0LJ 5DJ1A 3M0AA 2HLOA 5B5EH 1YTZT 1YITP 4H44C 1W7NA 1W3UA 4XAUA 4CPGA 3AE4C 3HE4A 3SFEC 1YJSA 1N2TA 1QJ5A 4PFFA 1ZODA 1AJYA 1VQ7P 4JEXA 2AY2A 2NPSA 2JJFA 2FNUA 2JJGA 1YJNP 4E3RA 4ATQA 2VMUA 2BEZF 1VDFA 4ZDPA 1LK9A 2G6WA 5I92A 3EI9A 2YO2A 3WGCA 3UWCA 1RF1A 1LC8A 2EYQA 1H88A 1EXIA 3LVLB 3B1EA 1Y8AA 4RKUJ 1N8PA 3TFTA 3ACZA 1NTMG 4UHNA 5KLVG 3WKRA 2GM4A 1ASDA 4XJLA 1L0LD 2Y9YA 2JWDA 1SPAA 3H1LE 5KLIC 5KTBA 2E5TA 3RBZA 5GTIH 2C0XA 4D6TJ 1IJIA 4UB8E 1QZ9A 1C7OA 1BCCD 2HFED 2KB7P 1ZC9A 4QGRA 4U7JA 1YIJP 4GIFA 1M90Q 4Y0IA 2O01H 4ZNCA 3L73E 1NH4A 5APUA 1OHYA 2E75C 2ZAEB 1C7GA 3ECDA 3OJAB 1TOJA 1EZVE 5E5IA 3W68A 1GC2A 3PRJA 4CBRA 2W83C 1IFNA 1BQAA 4AO9A 3CXHD 4RJ0A 3U59A 1NTKG 2ZT9B 3T97A 2BYJA 3HUSB 4I8AA 4P3MA 1ZOYC 1I48A 4WY4C 5C39A 1GL2C 3VP6A 4GEBA 3UAKA 2KS1A 3CX5I 4LW2A 4H0LB 2E43A 4UHOA 4IL6X 2KLUA 2Z4EA 2E54A 1KTMA 4RKDA 1UU2A 1SLQA 1TOGA 2FKIA 4C7NA 3B1CA 1O69A 1Q2NA 1FZFA 5L8RJ 3FSLA 3PJSK 2B9BA 4GOFA 5CMZA 1SP4A 1NTMD 3DZZA 1PP9E 1QVFO 1HF9A 3WCNA 2HODB 3AE9C 4EB5A 4Z1MH 2QSRA 3EIAA 3E6GA 2PP6A 3MC6A 2X5FA 5EIGA 3CQ5A 5KAFE 1E5EA 5H2FE 4H44D 1MGVA 3UIAA 3H1JD 5APTA 5FT8A 1YI2P 4KJMA 2VGTA 1AHEA 2PFXA 1G1JA 1PL5A 3B8EB 2P67A 2LKMA 3AE6C 4WXBA 2WSEH 1A02F 3G7QA 1L0LK 1UU1A 1VF5D 2DR1A 1IZNB 3HUSA 1OHVA 4PD4E 1X29A 3W1IA 1VQMP 3AECC 1V2DA 3B4SA 3KXDA 3CWBD 1SFCA 4Y99B 2FY8A 3L70G 3TFUA 3AEPA 3ZRPA 4Y99C 1W23A 3LVMA 3CC2P 1EZVD 3L71J 1L4AB 2YHKA 1BSNA 1M1JC 2L91A 5D95A 1SVFA 1KQFB 1YYCA 1OX3A 4EOTA 3L73D 9AATA 5KAFH 4DGTA 1KZUB 4KHXA 3MIWA 5H2FH 1NU1K 3BCCG 3MKJA 2YRRA 4UHMA 5EIGB 2BI9A 1E5WA 2WQYC 1EQBA 2FYZA 4EFFA 3AEOA 5EFWB 1IBJA 1M57D 4JQ0D 2JEEA 4C7RA 2KSEA 4N78D 3V2NA 1HJBA 1M0NA 3M0DA 1IUGA 3QI6A 3A7OA 3NRAA 3NU8A 3LW5H 2V0YA 3JZLA 3KDPB 2OTLP 2W7EA
chains in the Genus database with same CATH topology
2CY8A 2R5CB 5G0AA 4ZKPA 1LT9C 2Z9VA 2W8TA 4LC1A 3A9YA 4ZWMA 1GTWA 1JY2O 3QPGA 2XV5A 1JTHA 2POHA 3K40A 1M4NA 3DODA 1LT9A 2P7JA 1H0CA 1SFCD 5CHXA 2KOGA 3TCMA 4M2KA 1FZBA 2CH1A 4WY4A 3BS8A 4HYTB 3VMYA 2C9NY 1UU0A 3N4RA 1IX8A 2OYHA 4Y0HA 1GDTA 2EH6A 2A45G 3HE5B 2XNXA 1C9CA 3RK2B 2JISA 3PA9A 3C9IA 5FT6A 1FAVA 2ZYJA 1JO5A 2YOBA 3K7YA 2C0WA 5CCGC 3WGBA 2E42A 2AY7A 2AEUA 4F5FA 3WMM0 5K8BA 3G0TA 2YO3A 3KE3A 4O9BA 3L8AA 2ZUKA 1DFOA 3VP9A 3FQ7A 2VMVA 2CH2A 2Z5HA 5E3KA 4FL0A 3VMXA 2WK9A 5AW5B 1IVRA 2IPPA 1DJEA 5EAAA 1JOCA 2Z9XA 3BV0A 3RL0C 3B46A 3HE5A 1O62A 3RBLA 5AX8A 3ZRQA 2H43A 3NFQA 4MKKA 3G3ZA 3M9BA 2XH1A 1MLZA 4JYCA 1NTKK 1NKZB 2O1JA 1D7RA 4WYAA 1ASNA 1ASFA 3CLQA 3N0LA 5IWQA 1LWUC 3IFMA 2OYHC 3HDOA 3NUIA 1LTBC 4WB0A 2W6BA 2OKKA 2XU6A 2BYLA 4JEYA 1GDEA 1G7XA 3HVYA 3PAAA 2HOZA 2AY9A 2C9LY 1GL2A 2BIEA 5EFSA 4DBCA 4EMYA 1GC4A 1URQC 3PD6B 2J58A 3NX3A 4OYTA 4PVFA 4NOGA 8AATA 4U1TA 2NPSD 1V72A 2FM1A 1LT9B 5AW3B 1JCDA 2W7FA 3EI5A 4MQQA 3E2ZA 4AH3A 1JMMA 1FBMA 4WYGA 1RE4C 2FQ6A 3MTUE 3WX9A 4ITXA 1X9VA 5AW6B 2WPSA 2BIGA 4WB0B 2AY4A 4LW4A 2VMYA 1H89A 1D7SA 1XI9A 1QL2A 1M0QA 3VMZA 1AJRA 4ZDOA 1OHWA 3GHGB 1AIAA 1JS6A 3PIUA 2H7HA 2HP1A 4M2JA 3M91A 3R2PA 1DX7A 3NYTA 1YIZA 4ZM3A 2YRIA 1QIRA 1AICA 4W8IA 2YKYA 2EZ2A 3AATA 3L37A 1LC7A 3MD0A 1SVVA 2VI8A 3M06A 3HD7C 3H9XA 2XDJA 2R0TA 3ATHA 5APSA 3RL0B 2HORA 2Q3IA 3AENA 2HG5D 1ZR2A 2VMZA 1JY3O 2HOYA 1ZV8A 1W2EA 2NPSC 2VRSA 2P2UA 1KQLA 4F5LA 2FXMA 3TSIA 2R5BA 3HT4A 1AHFA 3ZZKA 2XZRA 1EQ7A 3E2FA 1AAMA 1TASA 5HHYA 3RBFA 3CBFA 2KYVA 5AVRB 1N7LA 3DR4A 2HZPA 3L44A 2DGMA 1SF2A 3VTPC 4GE7A 3LIDA 1OXZA 3RK3C 2WT7A 1VJOA 7AATA 4N78E 4WYEA 1N7SD 1IX6A 4JEVA 3QN6A 1O61A 3N5MA 1V2EA 4IX8A 3HD7D 4WYCA 4L0OA 4W80A 3AENB 1GL2B 4JF0A 5AVSB 1BKGA 2E7JA 4ZAHA 1CI6A 3GZDA 3NTJA 2Z61A 4ZM4A 1DGEA 2WB6A 1QJ3A 1GW3A 4M2MA 2W7DA 1JY2N 1G2CA 1AKBA 1G4VA 3CAIA 1JNMA 1D2FA 4WY4B 3M9HA 1AY8A 4BHDA 1PMMA 3P1TA 4IY7A 3U1AA 4WXGA 3VOMA 1ZLLA 3FDBA 1AMQA 1TATA 2AY8A 3CQ6A 3W1JA 3M9QA 2VMPA 4BA4A 5AW7B 3BWNA 4OTLA 3WKSA 1NKNA 3DU4A 3GZCA 3B8XA 3AOVA 2WZ7A 1IO4A 4DOJA 4WXFA 4BMKA 4W1XA 1MZ9A 5DX5A 1JG8A 1MV8A 3OAKA 2OQXA 4ZSYA 1YJZA 5BVZA 1G2CB 4GE9A 4I1LA 1I41A 2F8JA 2R5EA 3HQTA 1TOIA 5AVZB 2H8PD 1LTIC 2C7TA 3AV7A 1J1DB 3F0HA 5AW9B 2O1KA 3OA7A 3WCOA 4JF1A 3GBXA 1AMAA 4PIWA 1MFZA 3EZSA 2YMYA 1NO4A 1T3UA 2D65A 2AY3A 1YIYA 1N7SC 3D6KA 1CW5A 2P1JA 2HODA 1MDOA 3NNKA 3II0A 1QL1A 1M0OA 1HH0A 4AZKA 1GU5A 1AJSA 1EJIA 2OYIB 2RFVA 4W1WA 3EZ1A 2FNIA 3M0DC 1PMOA 2R2NA 5BU5A 3NYUA 3PD6A 3A3YB 1RF0A 1SQVK 3VK4A 2W8WA 2VLHA 3A2AA 1N86A 3KGWA 1LGHB 1AFOA 3NUBA 2Z20A 1PFIA 2Q7CA 2D66A 1ARSA 2Z1YA 2GSAA 2N1TC 2DOUA 3EI6A 5AW1B 4ADDA 2ZSLA 4A6TA 2AY6A 3BC8A 4ZSWA 1KILC 1ZR4A 4ZLVA 3R9AA 5JAYA 1NHLA 1FZAA 2X5DA 1CSBA 2YCPA 1MDXA 4H63Q 3QGUA 1KILA 4IFFA 1J1EC 1JTHB 1SZUA 2R3CA 2OYIC 3MAUA 2VGZA 1LTJB 4W5KA 5J8QA 1YJYA 4F5MA 3DXVA 2GUSA 4XEWA 1WYVB 1YOOA 1N73A 1RF1B 2VGUA 3DC1A 1IFJA 1S06A 4IYOA 4I2LC 1GCKA 3ZZJA 2HYNA 1ELUA 1LW4A 4CBSA 1B9IA 1KL1A 2N1TD 3HTKB 1BJWA 4OT8A 2QLRA 1E5FA 3OKSA 1DJUA 5M4DA 2AY5A 3WY7A 2GMUA 1FJKA 1KL2A 1IK9A 1B5OA 2GUVA 2FN6A 1FOSF 1NAFA 5G2PA 1I43A 2CANA 1NOHA 2W7MA 1Y4IA 1GK6A 3BRVB 4RIZA 2ORDA 4GDYA 3V2PA 3F6TA 1XTCC 4A6UA 2GQNA 2AATA 3GWPA 5E4ZA 1H1CA 2ZC0A 3VK3A 5AW4B 1FJPA 4MKJA 3HTKA 2EPJA 2GB3A 1ARIA 2Z1ZA 3JWAA 1MLYA 4WLHA 3TATA 1S09A 3HMUA 4LGDE 2D5YA 2W27A 1RE4A 3MAFA 1LKCA 3K28A 1ORDA 4ITGA 4MSOA 1RE3A 1P3WA 2ZY2A 1X0MA 3P7KA 3EQ2A 4AO4A 5AVQB 1LW5A 5M49A 4Q6RA 1ASMA 1JY3N 4GKGA 2YKVA 4JEWA 3PGYA 2W7JA 5AW2B 1MUUA 3H6PA 1B8GA 1O4SA 4MQRA 2CB1A 4HH2A 4R8DA 2C81A 1HWTC 3FVXA 1QGNA 3EUCA 3VK2A 4F5KA 1ASCA 1GBNA 2JJHA 1GU4A 1X28A 2CTZA 5F9SA 3GHGC 5CCGA 3BWNC 3I16A 4RJYA 1M32A 4ZASA 5G2QA 3AEMA 3FRKA 1W7LA 3TNUA 1D7VA 3B5NC 1LTAC 1CQ7A 2I1JA 2IFNA 4Y0DA 3A9XA 2O0RA 2WK8A 2YNYA 1FZGA 3FQAA 4AZJA 3KQGA 1SFCB 3FKDA 2AY1A 5DJ9A 1URQD 1AKAA 1KILD 1ASAA 2WKAA 4AOAA 4CXRA 1W7MA 2KLVA 2Z9WA 4E1OA 4RITA 1B9HA 4K05A 4I6MC 1WRGA 1Z7DA 2QMAA 3BCAA 4XJOA 3HUSC 3EIBA 2WK7A 1PFFA 4IW7A 1SFCC 2VMTA 2JJLA 1AIBA 2E7UA 4LNMA 4GRXA 3HRNA 3IHJA 1M0PA 1KMKA 3PDBB 2VGWA 4RKCA 3QM2A 3FVUA 2QM7A 2E7IA 4XA4A 2FFDA 3P8CD 1ARGA 3GJUA 4K2MA 1S9KD 4GT1A 2W7HA 3DXWA 2Q5UA 4A0HA 3RK3D 3AOWA 3MAFB 3B5NB 1HGVA 3QHXA 2OKJA 3CL3D 3ASBA 4K2IA 3N4SA 3GSBA 4OH8B 3ELEA 5EUDA 2R32A 3O8ZA 3COGA 5DB5A 1T8ZA 3E2YA 1AHGA 2W8UA 2R5DA 2CPSA 1FDMA 2CINA 3L4FA 3EI7A 1GK4A 2PAJA 5KJ7A 3PDBA 4W1VA 2ZJGA 1L4AA 2OYHB 4N3YB 3H7FA 1BS0A 1AY4A 3VOPA 2DGKA 4A0GA 4XJPA 3FQ8A 1TPLA 4EU1A 4DQ6A 3HLMA 3GHGA 1X79B 2DKJA 5AVUB 1JY2P 4EB7A 1ARHA 3USFA 4ZDLA 4A0FA 2Q7WA 5CCHA 1RF1C 2FKWB 2BWPA 4IFDK 1CL1A 1LC5A 4MQPA 1G7WA 2Z5IA 1Z3ZA 3FZ6A 1J1EB 1M6SA 2TPLA 4M3LA 3RK2C 2HOXA 3P8MC 4LC3A 3BCBA 1AMRA 2QB2A 2YKXA 1GC0A 2D61A 2CJGA 3E2ZB 1N31A 1H8AA 2FYFA 3B1DA 1FOSE 3N7NA 4PFNA 3M5UA 2GMSA 2WITA 2VMSA 1NWQA 3KGXA 4GSAA 2YCTA 3I5CA 2OGEA 3NYSA 4BA5A 1T3JA 3LV2A 1AQ5A 2JGTA 1WT6A 1BT4A 1BJOB 1YAAA 2CJDA 3V2RA 4HVKA 1M7LA 3RCHB 3KPEA 2QM8A 1X8YA 1M1JA 1KFNA 2PB2A 4A00A 4JEZA 3RL0D 1T2KC 3U1CA 5APVA 1MAQA 4WBAA 5EQCA 1QISA 1CQ6A 1RV4A 2A45H 2ZY3A 2HUFA 5CCHC 1XTGB 1GZLA 1ASLA 2NMPA 2BKWA 1G1IA 2X8UA 1SZKA 3N4XA 5EUEA 2IX7C 2VIAA 3RQ1A 3WLXA 5FT5A 1QITA 4WB4A 3FFRA 5AVWB 3RUYA 3F9TA 4K2BA 4F5JA 4OCAA 4R5ZA 4TMRA 5M4BA 1AMSA 4UQVA 1KFMA 5APWA 1V2FA 1VPCA 1OXOA 5G4JA 4IXZA 3BASA 3NXSA 1DGDA 2ZFCA 3HE4B 1CL2A 3PDXA 3L36A 4LNJA 3OP7A 2W8JA 5BJ4A 5C6UA 2VI9A 3VN0A 4WY4D 1BQDA 1SZSA 5EAVA 2W6AA 2HPCB 1IFDA 1L0NK 4OC9A 2WPRA 3RK2D 2WSCH 1DH3A 2CPBA 2D7YA 2VMXA 2ZSMA 4H51A 3I5TA 2YCNA 3V2QA 1HGZA 1TARA 1LS3A 1C0NA 4OMAA 4W7ZA 3L35A 5M46A 5KLVK 2YKQA 3N75A 2JJEA 1CQ8A 2KP8A 2V1PA 3DYDA 1DEBA 4WBTA 3H32A 1J2JB 4AQRD 1IC2A 3JTXA 1GEYA 1KMJA 2O7CA 1GEWA 1T2KD 3EI8A 4WYFA 1DKAA 1JY3P 3ASAA 1HBWA 3UE8A 3PJ0A 2YKPA 2VLFA 1UKJA 5KJ7C 4OBVA 3LIEA 1Z56A 1IFMA 1L4AD 1C7NA 1LWUB 4WD2A 1VP4A 3GZDC 1GW4A 3FDDA 2W7IA 2N9BA 2R5CA 3E9KA 4CVQA 4MY5A 1D7UA 3H32B 3MADA 1FZEA 1RVYA 2W7GA 1CZEA 4ZKUA 3BWOA 4KXKA 2NPSB 2VMOA 1TOEA 5APYA 3VYIA 3JW9A 1IAYA 2OGAA 1RF0C 2M8RA 1N7SB 3BRTB 3QBOA 3II6A 3HD7B 1SQBK 4ZWVA 2HPCA 4B86A 1GL2D 4J8LA 2BI5A 1OXPA 2ZY5A 1LTJC 1CI6B 4U2HA 3A5TA 3T32A 3V5BA 1SQPK 2MJZA 4XE5B 4XJMA 2DGLA 1JUNA 1TOKA 3A9ZA 4XQ2A 1BJ4A 2BI3A 3LVKA 3TYYA 2OARA 1M7YA 1WYTB 2JG2A 3BATA 2DKBA 4F5HA 3ELPA 5F8VA 1U08A 1HVVA 1GEXA 4XK1A 1IFIA 1CZQA 4Q76A 1C4KA 3RCHA 2QA3A 3V4WA 2YKOA 2OATA 3SWFA 2M3BA 1ELQA 1SQXK 1WKGA 3E1IA 4ADEA 2A1VA 2BIAA 1ZN5A 4N6JA 5BU8B 2IFMA 1WYTA 4WYDA 2XKMA 4JYBA 1YTZI 4W7YA 1MAPA 1HTLC 1X2AA 1N73B 1GD2E 2VGVA 1WSTA 3KYQA 2L5GB 3LVJA 2I1KA 3FZ7A 2QB3A 3W1HA 4EIJA 5CCGD 2BHXA 2PB0A 3A2BA 5CJ0A 4CXQA 2C44A 3NDNA 4F5IA 4IXOA 3A8UX 5AVXB 3LY1A 4J5UA 1ASGA 2FYUK 1AAWA 2XBNA 3BVHA 4AYCA 4IXSA 1ARTA 1AHYA 3TQXA 3ZRRA 2WPQA 3FFHA 3AEJC 1LTGC 3FD0A 1ASBA 5EUNA 3MC6C 3MUDA 3PPLA 1KKPA 5CCHD 2D63A 1S08A 1DTYA 4N0WA 3FVSA 1L4AC 3AEMC 4R2NA 3HL2A 2Z9UA 3PP5A 3TNUB 5HXXA 3MEBA 3EFGA 3CQ4A 3FZ8A 4Q31A 1S9KE 1BJOA 5HDMA 1J1DC 2X3LA 1KKJA 2W7LA 1OATA 4OBUA 4AUWA 4UOYA 2N1TA 1I29A 4A6RA 1XEYA 3AELA 3FCRA 2VGSA 3GR9A 3R4TA 1CJ0A 3E77A 2ZXEB 5APQA 1T3IA 3MGNA 3SWYA 2C0RA 3P32A 2ZP7A 1NTZK 5G09A 2EO5A 1WYVA 4BQ0A 3HBXA 2PO3A 4FFCA 2HP2A 1WYUA 4IYOB 5BJ3A 2QBTA 3P8CE 4ADCA 1AJSB 2WT7B 2WWWA 2N1TB 1URQB 1IAXA 4LNLA 1MDZA 4A72A 5G4IA 4GE4A 2EGYA 2W8VA 3VAXA 1LTSC 4O6ZA 2KSJA 3NMDA 3BN1A 1RE3C 1RVUA 1RV3A 2O1BA 1M1JB 4ATPA 2BI1A 1S0AA 2A45I 1SFFA 2HUIA 4RM1A 3HD7A 1AX4A 1FC4A 1WYUB 4RAEA 2D7ZA 5KJ7D 4F4EA 3LG0A 4KAMA 3AEJA 3I4JA 3ISLA 4DZOA 1FG3A 2FFDC 3RI6A 1FZCC 1PG8A 4F5GA 1ZOBA 1JS3A 1B5PA 1WKHA 4WP0A 1ASEA 3BCXA 3RK3B 4B98A 4E77A 3DRDA 3B5ND 3NU7A 4RLGA 5D5SA 4E3QA 1JCCA 2VMNA 3GETA 4TN4A 3BB8A 4Q75A 1FZCB 2AEVA 5TF5A 4A0RA 2OYIA 4RESB 5AVTB 1IJDB 1LTJA 5AW0B 2WSFH 1VEFA 2VMQA 3P6KA 4W91A 3MBBA 1YNUA 1OWAA 1GD9A 4ISYA 5CJ4A 1LWUA 1N2DC 3V4QA 1RY3A 1HUCA 3Q8NA 3KKIA 2VIBA 3VP8A 2VMRA 3G8MA 4LLHA 3WZFA 4C46A 1J04A 4R5FA 1JF9A 2VYCA 2FFDB 4JF7A 2HUUA 1LTTC 1FZCA 3IR9A 5APXA 1J32A 5AW8B 1FU1A 4WLJA 1URQA 4KYOA 2BWOA 1DJ9A 3FTBA 2CSTA 1S07A 2KFPA 1NTMK 1BW0A 1N7SA 1AHXA 3B5NA 3CI9A 4B9BA 2W7KA 1B4XA 5AVVB 1FG7A 3LWSA 1N73C 2D64A 3NTNA 1A02J 1AKCA 2CFBA 2EZ1A 1GC3A 2G7JA 2BASA 1KILB 4IFMA 2WTYA 2CJHA 1CZCA 4HF8A 2YKUA 1G4XA 3DR7A 3JWBA 4C7NB 2BI2A 4P7YA 2BWNA 4ADBA 1SQQK 1AY5A 1CS1A 1BJNA 1ECXA 2ZY4A 2Q9IA 5AVYB 3TK1A 5FT4A 2VMWA 2J59M 1IX7A 1EG5A 5DJ1A 3M0AA 2HLOA 1YTZT 1W7NA 1W3UA 4XAUA 3HE4A 1YJSA 1N2TA 1QJ5A 4PFFA 1ZODA 4JEXA 2AY2A 2NPSA 2JJFA 2FNUA 2JJGA 4E3RA 4ATQA 2VMUA 1VDFA 4ZDPA 1LK9A 2G6WA 5I92A 3EI9A 2YO2A 3WGCA 3UWCA 1RF1A 1LC8A 2EYQA 1H88A 3LVLB 3B1EA 1N8PA 3TFTA 3ACZA 4UHNA 3WKRA 2GM4A 1ASDA 4XJLA 1SPAA 5KTBA 2C0XA 1IJIA 1QZ9A 1C7OA 2HFED 2KB7P 1ZC9A 4QGRA 4GIFA 4Y0IA 2O01H 1NH4A 5APUA 1OHYA 1C7GA 3ECDA 3OJAB 1TOJA 5E5IA 1GC2A 4CBRA 1IFNA 1BQAA 4AO9A 4RJ0A 3U59A 3T97A 2BYJA 3HUSB 4I8AA 4P3MA 1I48A 4WY4C 1GL2C 3VP6A 4GEBA 3UAKA 4LW2A 2E43A 4UHOA 2Z4EA 2E54A 4RKDA 1UU2A 1SLQA 1TOGA 2FKIA 4C7NA 3B1CA 1O69A 1FZFA 3FSLA 5CMZA 1SP4A 3DZZA 3WCNA 2HODB 4EB5A 3EIAA 2QSRA 3E6GA 2PP6A 3MC6A 2X5FA 5EIGA 3CQ5A 1E5EA 1MGVA 3UIAA 5APTA 5FT8A 2VGTA 1AHEA 1G1JA 3B8EB 2P67A 2LKMA 4WXBA 2WSEH 1A02F 3G7QA 1L0LK 1UU1A 2DR1A 3HUSA 1OHVA 1X29A 3W1IA 1V2DA 1SFCA 4Y99B 3TFUA 3AEPA 3ZRPA 4Y99C 1W23A 3LVMA 1L4AB 2YHKA 1M1JC 5D95A 1SVFA 1YYCA 4EOTA 9AATA 4DGTA 1KZUB 4KHXA 3MIWA 1NU1K 3MKJA 2YRRA 4UHMA 5EIGB 2BI9A 1E5WA 1EQBA 2FYZA 4EFFA 3AEOA 1IBJA 2JEEA 4C7RA 3V2NA 4N78D 1HJBA 1M0NA 3M0DA 1IUGA 3QI6A 3A7OA 3NRAA 3NU8A 3LW5H 2V0YA 3JZLA 3KDPB 2W7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJA B;  3HRN A;  4ZKP A;  5KTB A;  1X79 B;  1IC2 A;  5BU8 B;  3VP8 A;  5BVZ A;  3N4X A;  3N7N A;  2POH A;  3BAT A;  2JEE A;  5BU5 A;  3U59 A;  4O9B A;  1NKN A;  3N4R A;  4I1L A;  4N78 D;  4GIF A;  3U1C A;  3VP9 A;  3BAS A;  4N3Y B;  3P8C D;  4ZKU A;  3U1A A;  1WT6 A;  3N4S A;  3C9I A;  2FXM A; 
#chains in the Genus database with same CATH topology
 2CY8 A;  2R5C B;  5G0A A;  4ZKP A;  1LT9 C;  2Z9V A;  2W8T A;  4LC1 A;  3A9Y A;  4ZWM A;  4NPF X;  4PV1 B;  2JDI H;  1GTW A;  1YQ3 C;  1JY2 O;  4PV1 C;  3QPG A;  1JTH A;  2XV5 A;  3GW6 A;  2JO1 A;  2POH A;  3K40 A;  2WSC J;  4DJG A;  2BCC J;  1FDI A;  1M4N A;  3DOD A;  1SQQ G;  4TLF A;  1LJ2 A;  1LT9 A;  2P7J A;  4OWF A;  1H0C A;  1SFC D;  1AA0 A;  2I8D A;  5CHX A;  2KOG A;  2O3J A;  3TCM A;  4M2K A;  2O01 J;  1FZB A;  2CH1 A;  4WY4 A;  4A7P A;  3BS8 A;  4HYT B;  3VMY A;  1P84 H;  4HJG H;  2C9N Y;  4JBZ A;  1UU0 A;  3N4R A;  1IX8 A;  2OYH A;  4Y0H A;  1GDT A;  2EH6 A;  2A45 G;  1NU1 G;  3HE5 B;  2QA4 P;  2XNX A;  2H89 C;  1C9C A;  3RK2 B;  1NTZ E;  3L70 J;  2JIS A;  3PA9 A;  3C9I A;  5FT6 A;  1FAV A;  2ZYJ A;  1JO5 A;  2YOB A;  3K7Y A;  2C0W A;  5CCG C;  3WGB A;  2E42 A;  2AY7 A;  5GTH H;  1FS0 E;  2AEU A;  4F5F A;  3MP7 B;  3WMM 0;  5K8B A;  3EWK A;  3G0T A;  5TIS E;  2YO3 A;  3KE3 A;  1DEE G;  1R8E A;  4O9B A;  3L8A A;  2ZUK A;  1DFO A;  3VP9 A;  3FQ7 A;  2VMV A;  2CH2 A;  1BGY D;  2V7Q J;  2Z5H A;  5E3K A;  4FL0 A;  3VMX A;  1SQP D;  2WK9 A;  3CC7 P;  5AW5 B;  1IVR A;  1RQV A;  2IPP A;  2KIK A;  2Q1K A;  2KNC A;  1JOC A;  1DJE A;  5EAA A;  2Z9X A;  2QG4 A;  3BV0 A;  5B5E E;  3MUD C;  2QIW A;  1NTK E;  1W5C E;  2M5A B;  3RL0 C;  3B46 A;  3HE5 A;  1O62 A;  1OVV A;  3RBL A;  5AX8 A;  3Q3D A;  3ZRQ A;  2YXR B;  2H43 A;  3NFQ A;  2BEQ D;  4MKK A;  3G3Z A;  3M9B A;  2XH1 A;  1MLZ A;  4JYC A;  1NTK K;  2E74 B;  2W8Z A;  3SWK A;  1NKZ B;  1SQP G;  2M3E A;  2JKV A;  2O1J A;  1D7R A;  4WYA A;  1ZW0 A;  1ASN A;  1ASF A;  3CLQ A;  3N0L A;  5IWQ A;  1LWU C;  3F89 A;  3IFM A;  2OYH C;  3HDO A;  1KD1 Q;  3TGU D;  2YIU C;  3TGU E;  3NUI A;  1LTB C;  4WB0 A;  2W6B A;  1EC5 A;  2OKK A;  2XU6 A;  2BYL A;  4JEY A;  1GDE A;  1G7X A;  3HVY A;  3PAA A;  2HOZ A;  2AY9 A;  3L71 D;  1GL2 A;  2C9L Y;  2BIE A;  3AEF C;  5EFS A;  4DBC A;  4EMY A;  1PP9 G;  3H1K D;  1GC4 A;  3VMA A;  2FBW C;  1URQ C;  3PD6 B;  2J58 A;  3NX3 A;  5E79 E;  4OYT A;  4PVF A;  4NOG A;  1YJ9 P;  8AAT A;  4U1T A;  2NPS D;  2Q3E A;  1V72 A;  2JP3 A;  1PGP A;  2FM1 A;  1LT9 B;  5AW3 B;  1JCD A;  2W7F A;  3EI5 A;  4MQQ A;  4OGQ D;  3E2Z A;  4AH3 A;  1JMM A;  1FBM A;  4WYG A;  1RE4 C;  2IBZ I;  2Q6Q A;  2FQ6 A;  3MTU E;  1S1C X;  3KZI H;  4MN4 C;  3WX9 A;  1SQP E;  4ITX A;  1X9V A;  5AW6 B;  3JSV C;  3H1H G;  2WPS A;  2BIG A;  4WB0 B;  2AY4 A;  4LW4 A;  4R4L A;  2VMY A;  1H89 A;  1D7S A;  2G3A A;  1XI9 A;  1QL2 A;  1M0Q A;  3VMZ A;  1AJR A;  2LXC B;  5M1B A;  4ZDO A;  1OHW A;  3GHG B;  1AIA A;  1JS6 A;  3G6E P;  3PIU A;  1KN7 A;  3W67 A;  2H7H A;  2HP1 A;  4M2J A;  3M91 A;  1FE6 A;  4BXL A;  3R2P A;  1DX7 A;  3G71 P;  3CCJ P;  3NYT A;  1YIZ A;  4ZM3 A;  3AE1 C;  2YRI A;  1QIR A;  2A06 G;  1AIC A;  4W8I A;  2D2C D;  2EZ2 A;  2YKY A;  3AAT A;  1KYO E;  3L37 A;  4I7Z B;  3MD0 A;  1LC7 A;  1SVV A;  2VI8 A;  3M06 A;  3HD7 C;  2LXB A;  3H9X A;  3ZDM A;  2XDJ A;  2KI7 B;  1NU1 J;  2R0T A;  3ATH A;  5APS A;  3RL0 B;  2HOR A;  2Q3I A;  2MKV A;  3AEN A;  1KB9 H;  5CBO A;  2HG5 D;  3H1I J;  1ZR2 A;  3K5B A;  2VMZ A;  1JY3 O;  5KLV E;  2HOY A;  1ZV8 A;  1W2E A;  2NPS C;  2VRS A;  2P2U A;  1KQL A;  4F5L A;  1BE3 G;  2FXM A;  2IDB A;  3TSI A;  2R5B A;  3HT4 A;  1AHF A;  3ZZK A;  2XZR A;  1EQ7 A;  1ZP0 C;  3E2F A;  1AAM A;  1KV4 A;  1TAS A;  5HHY A;  2AEF A;  3RBF A;  3CBF A;  2KYV A;  2Y9Z A;  3H1L D;  1L2P A;  2BCC G;  1KYO D;  5AVR B;  1Q81 Q;  1N7L A;  1NAY A;  3DR4 A;  2HZP A;  3L44 A;  1SQX G;  1NTZ D;  1RQU A;  2DGM A;  1SF2 A;  3VTP C;  4GE7 A;  3LID A;  1OXZ A;  3RK3 C;  2WT7 A;  1VJO A;  7AAT A;  4N78 E;  2LR2 A;  2QVA A;  4WYE A;  1N7S D;  1IX6 A;  4JEV A;  3QN6 A;  1O61 A;  3N5M A;  1V2E A;  4IX8 A;  3HD7 D;  2DW3 A;  4WYC A;  4L0O A;  4W80 A;  3KZI E;  3AEN B;  1GL2 B;  1OFC X;  4JF0 A;  5AVS B;  2WSF J;  4H13 B;  1BKG A;  2E7J A;  3A0H H;  4ZAH A;  1CI6 A;  3GZD A;  3NTJ A;  2Z61 A;  4ZM4 A;  1DGE A;  2WB6 A;  3BCC J;  1QJ3 A;  1GW3 A;  3SFD C;  4M2M A;  5DJT B;  2W7D A;  1JY2 N;  1G2C A;  1AKB A;  1G4V A;  3CAI A;  1JNM A;  1D2F A;  1SQX J;  4WY4 B;  3CWB E;  3M9H A;  1AY8 A;  4BHD A;  5B66 E;  1PMM A;  3P1T A;  4IY7 A;  4JPZ B;  3U1A A;  4WXG A;  3VOM A;  1ZLL A;  3WUU A;  3FDB A;  1AMQ A;  1TAT A;  1BE3 J;  2AY8 A;  3CQ6 A;  3W1J A;  3AE3 C;  4IOI H;  3D71 A;  2ZYD A;  2WVR A;  3M9Q A;  2VMP A;  4BA4 A;  5AW7 B;  3BWN A;  4OTL A;  3WKS A;  1NKN A;  3FWL A;  3DU4 A;  3GZC A;  3B8X A;  3AOV A;  2WZ7 A;  1IO4 A;  4DOJ A;  4WXF A;  4NPE A;  4BMK A;  4W1X A;  1MZ9 A;  5DX5 A;  2KXP B;  1JG8 A;  1MV8 A;  3OAK A;  3Q5S A;  4U3F J;  1SQB G;  2V7Q H;  4NPD A;  2D2C C;  2OQX A;  4ZSY A;  3L70 D;  1JM0 A;  1OIP A;  1YJZ A;  5BVZ A;  1G2C B;  4GE9 A;  4I1L A;  4PD4 D;  1I41 A;  2F8J A;  1H0T B;  2R5E A;  3HQT A;  1TOI A;  5AVZ B;  4GOE A;  2H8P D;  1AVY A;  1KYO I;  1LTI C;  2C7T A;  1J1D B;  3AV7 A;  3F0H A;  5AW9 B;  2O1K A;  3OA7 A;  3WCO A;  4JF1 A;  1UII A;  3GBX A;  3SSU A;  1AMA A;  4PIW A;  3H1J E;  1MFZ A;  3EZS A;  2YMY A;  1NO4 A;  1T3U A;  2D65 A;  2AY3 A;  1X22 A;  3ITK A;  1PP9 D;  1YIY A;  1N7S C;  1DIP A;  3D6K A;  1CW5 A;  2P1J A;  2HOD A;  1L0N D;  1MDO A;  3NNK A;  3II0 A;  1QL1 A;  2Y0E A;  3F5H A;  1HH0 A;  1M0O A;  4AZK A;  1GU5 A;  1AJS A;  1EJI A;  2OYI B;  4QMA A;  3PTZ A;  2RFV A;  4W1W A;  3EZ1 A;  1K05 A;  1BCC E;  2FNI A;  1USE A;  3M0D C;  1PMO A;  3H1H E;  2R2N A;  5BU5 A;  3NYU A;  3BCC E;  1L0L E;  4D6T G;  2E76 D;  3GLM A;  1KAF A;  1VQP P;  3PD6 A;  3A3Y B;  1RF0 A;  1SQV K;  3CXH E;  1ZME C;  2W8W A;  3VK4 A;  2R44 A;  2VLH A;  3A2A A;  1N86 A;  3KGW A;  1LGH B;  1AFO A;  5KKZ B;  3NUB A;  2Z20 A;  1Q86 Q;  1PFI A;  2B89 A;  1U57 A;  2Q7C A;  2D66 A;  1ARS A;  2Z1Y A;  4L75 A;  2GSA A;  1JMB A;  2N1T C;  2DOU A;  3EI6 A;  2KZI A;  2E75 D;  4GOD A;  5AW1 B;  4EDF A;  2ZSL A;  4A6T A;  2AY6 A;  3BC8 A;  4ADD A;  3H1J J;  4ZSW A;  1KIL C;  1ZR4 A;  4ZLV A;  3R9A A;  5JAY A;  1NHL A;  1FZA A;  2X5D A;  3H1I D;  1CSB A;  2YCP A;  1MDX A;  4H63 Q;  2M0B A;  3QGU A;  2W90 A;  2M5A A;  3GG2 A;  1EDL A;  1KIL A;  4IFF A;  1J1E C;  1JTH B;  1SZU A;  2R3C A;  2OYI C;  2H88 C;  3MAU A;  2VGZ A;  1LTJ B;  4W5K A;  5J8Q A;  1YJY A;  2QSI A;  4F5M A;  3DXV A;  2GUS A;  3JC2 2;  4XEW A;  1WYV B;  1YOO A;  1N73 A;  1RF1 B;  2VGU A;  3DC1 A;  1IFJ A;  1S06 A;  4IYO A;  4I2L C;  5KAI H;  1GCK A;  4BRY A;  1VQ8 P;  3ZZJ A;  2UWJ E;  2HYN A;  2W6J H;  1ELU A;  1LW4 A;  1K8A Q;  4CBS A;  1Q90 D;  1B9I A;  1KL1 A;  2N1T D;  3HTK B;  2E5Y A;  2AXT H;  1BJW A;  4OT8 A;  2QLR A;  2OTK E;  1E5F A;  3OKS A;  1DJU A;  1D7M A;  1VQ6 P;  2AY5 A;  5M4D A;  1R5L A;  3WY7 A;  2GMU A;  3CWB G;  1FJK A;  1KL2 A;  1IK9 A;  1B5O A;  2GUV A;  3CX5 H;  3L74 G;  2FN6 A;  1FOS F;  4BWN A;  1NAF A;  4PD4 I;  5G2P A;  1I43 A;  2CAN A;  1OW7 A;  1NOH A;  2W7M A;  2P10 A;  1Y4I A;  1KB9 E;  1GK6 A;  3BRV B;  5KAI E;  1JB0 J;  2BCC D;  4RIZ A;  2HR3 A;  1EDJ A;  1KQS O;  2ORD A;  4GDY A;  3V2P A;  3F6T A;  1NTZ G;  1XTC C;  2FYU J;  4A6U A;  3CC4 P;  3O6Q A;  2GQN A;  2AAT A;  2CK3 H;  2IBZ E;  4K35 A;  3GF3 A;  3GWP A;  2WMM A;  5E4Z A;  1H1C A;  2ZC0 A;  3VK3 A;  5AW4 B;  1FJP A;  1YHQ P;  4MKJ A;  3HTK A;  2EPJ A;  2GB3 A;  2NRG A;  1ARI A;  3E1R A;  2Z1Z A;  2QJK C;  3JWA A;  1MLY A;  1SQQ E;  3C1L A;  4WLH A;  1W2B O;  1QLE D;  3TAT A;  1S09 A;  2OTJ P;  4LGD E;  3HMU A;  3H1K E;  2D5Y A;  2W27 A;  2WSS H;  1RE4 A;  3MAF A;  1LKC A;  3FXE A;  3K28 A;  1ORD A;  4ITG A;  4MSO A;  1RE3 A;  4U3F G;  1P3W A;  2ZY2 A;  1X0M A;  3P7K A;  3V6I A;  3EQ2 A;  4AO4 A;  5AVQ B;  4HB1 A;  1LW5 A;  5M49 A;  4Q6R A;  1ASM A;  1SQV J;  1JY3 N;  3FXD A;  2K37 A;  4GKG A;  2YKV A;  4JEW A;  3L71 G;  2YMK A;  1PZQ A;  2ZXX A;  3PGY A;  2W7J A;  5AW2 B;  1MUU A;  2QJY C;  3H6P A;  1B8G A;  1O4S A;  4MQR A;  3H1J G;  2CB1 A;  4HH2 A;  1UIX A;  4R8D A;  4PJ0 H;  2C81 A;  1HWT C;  1BDC A;  4DT0 A;  3FVX A;  1QGN A;  3EUC A;  3VK2 A;  4F5K A;  1BCC G;  1ASC A;  1GBN A;  2JJH A;  1GU4 A;  1X28 A;  2CTZ A;  5F9S A;  3GHG C;  5CCG A;  1IK7 A;  3BWN C;  1PIX A;  3I16 A;  1PPJ G;  4RJY A;  1M32 A;  4ZAS A;  2O01 N;  5G2Q A;  3WU2 H;  3AEM A;  3FRK A;  1W7L A;  3TNU A;  1AVO A;  1D7V A;  3B5N C;  1LTA C;  3AED C;  2A06 E;  1CQ7 A;  2I1J A;  2IFN A;  4Y0D A;  3A9X A;  2O0R A;  2WK8 A;  2YNY A;  1FZG A;  4UB6 E;  3FQA A;  2K3R A;  4AZJ A;  1BGY E;  3KQG A;  1SFC B;  3FKD A;  2RMZ A;  2AY1 A;  5DJ9 A;  1URQ D;  1AKA A;  1MFT A;  4H0L C;  1KIL D;  4RO0 A;  1ASA A;  3L74 J;  2WKA A;  4AOA A;  3H1L J;  4CXR A;  4H13 C;  1W7M A;  2KLV A;  2Z9W A;  4E1O A;  4RIT A;  1T6A A;  1B9H A;  1NTK J;  4K05 A;  4I6M C;  1WRG A;  1Z7D A;  2QMA A;  3BCA A;  2ZT9 D;  4XJO A;  3HUS C;  3EIB A;  2QJY B;  2WK7 A;  1PFF A;  4IW7 A;  1SFC C;  1ZRT E;  2JJL A;  2VMT A;  1AIB A;  2E7U A;  4LNM A;  4GRX A;  3HRN A;  3IHJ A;  1M0P A;  1KMK A;  3PDB B;  2VGW A;  4RKC A;  1L0N G;  3QM2 A;  5KLI B;  1FC2 C;  3FVU A;  3USS A;  1KIL E;  2QM7 A;  2E7I A;  5TIS H;  3H1I G;  4XA4 A;  3B71 A;  2FFD A;  3P8C D;  3TDK A;  1NU1 E;  2FYU E;  1Y9B A;  1VQL P;  1ARG A;  3GJU A;  4K2M A;  1S9K D;  2AXT E;  3L75 D;  3AEG C;  4GT1 A;  2W7H A;  3DXW A;  2OYO A;  2Q5U A;  3AEB C;  1SQB J;  3CX5 D;  4A0H A;  3RK3 D;  1VQK P;  3AOW A;  3MAF B;  5B66 H;  2B87 B;  3B5N B;  1HGV A;  3QHX A;  2OKJ A;  3CL3 D;  3ASB A;  4K2I A;  1M1K Q;  3N4S A;  3GSB A;  4OH8 B;  3CXH H;  1VF5 B;  3ELE A;  5EUD A;  2R32 A;  3L71 E;  3O8Z A;  3COG A;  5DB5 A;  1T8Z A;  3E2Y A;  3WUT A;  1AHG A;  2E74 D;  2W8U A;  2R5D A;  2CPS A;  1FDM A;  2K9Y A;  2CIN A;  3L4F A;  3EI7 A;  3H1H J;  1GK4 A;  2PAJ A;  5KJ7 A;  3PDB A;  4W1V A;  2JWA A;  2ZJG A;  1L4A A;  2PRR A;  2OYH B;  4N3Y B;  3H7F A;  1BS0 A;  3I55 P;  1AY4 A;  3VOP A;  2DGK A;  2PGD A;  4A0G A;  1EDI A;  4XJP A;  3FQ8 A;  1TPL A;  4EU1 A;  4DQ6 A;  1SQB E;  3HLM A;  3GHG A;  1X79 B;  2DKJ A;  5AVU B;  1JY2 P;  4EB7 A;  3T97 B;  1ARH A;  1NYH A;  3USF A;  4ZDL A;  1EZV G;  4A0F A;  2Q7W A;  3R4Y A;  3AEE C;  1SQQ D;  5CCH A;  1RF1 C;  2FKW B;  2BWP A;  3L75 G;  4IFD K;  4H0L D;  1KMI Z;  1NTK D;  1RHZ B;  4KT0 J;  1CL1 A;  2E76 C;  1LC5 A;  4PV1 D;  4MQP A;  3TGU J;  4OGQ B;  1G7W A;  3CX5 E;  2Z5I A;  1Z3Z A;  3FZ6 A;  1J1E B;  1M6S A;  3Q5P A;  2TPL A;  4M3L A;  4U3F D;  3L72 E;  3RK2 C;  2HOX A;  3P8M C;  4LC3 A;  4EYY Q;  4PJ0 E;  1AMR A;  3BCB A;  1IFP A;  3O6Q B;  2QB2 A;  3CCU P;  2YKX A;  1GC0 A;  5DJU B;  1QGK B;  3IF4 A;  2FXP A;  2D61 A;  2CJG A;  4H44 B;  2IZ1 A;  3CME P;  3E2Z B;  1PPJ D;  3MHV A;  1N31 A;  1H8A A;  2FYF A;  3B1D A;  1FOS E;  3CCR P;  2NZ2 A;  3N7N A;  4PFN A;  3M5U A;  2GMS A;  3Q5R A;  2WIT A;  2VMS A;  1NWQ A;  3KGX A;  4GSA A;  2YCT A;  3I5C A;  3L72 J;  1VQO P;  2OGE A;  3NYS A;  4BA5 A;  1T3J A;  3LV2 A;  3CCV P;  1AQ5 A;  1WT6 A;  2JGT A;  1PGQ A;  1BT4 A;  1BJO B;  1YAA A;  2CJD A;  3V2R A;  4DCK A;  4HVK A;  1M7L A;  3RCH B;  1YBK A;  3KPE A;  2QM8 A;  2QRX A;  1X8Y A;  1M1J A;  1KFN A;  2PB2 A;  3E7K A;  4A00 A;  4JEZ A;  3RL0 D;  1T2K C;  3U1C A;  5APV A;  1MAQ A;  4WBA A;  4D6T D;  5EQC A;  1QIS A;  1CQ6 A;  2RN0 A;  1RV4 A;  2A45 H;  2QJP C;  4XFJ A;  2ZY3 A;  2HUF A;  3L74 D;  5CCH C;  1XTG B;  1GZL A;  2A06 D;  1ASL A;  2XND H;  2NMP A;  2QJK B;  2BKW A;  1G1I A;  2KNC B;  2X8U A;  1SZK A;  3N4X A;  5EUE A;  3KHU A;  3FX0 A;  2IX7 C;  2VIA A;  3RQ1 A;  3WLX A;  1VQ4 P;  5FT5 A;  1NVO A;  1QIT A;  1ZXG A;  4WB4 A;  1SQV E;  3FFR A;  2R3S A;  5AVW B;  3RUY A;  3F9T A;  4K2B A;  4F5J A;  3L75 J;  3L73 J;  4OCA A;  1PGO A;  4Y28 J;  4R5Z A;  4TMR A;  5M4B A;  1AMS A;  4UQV A;  1HJ0 A;  1KFM A;  5APW A;  1V2F A;  1VPC A;  1OXO A;  5G4J A;  1PP9 J;  3S1K A;  3A0B H;  4IXZ A;  1SQQ J;  3WUV A;  3BAS A;  3NXS A;  4YPC A;  4H13 D;  1Q7Y Q;  1DGD A;  2ZFC A;  4D6T E;  3HE4 B;  1BGY J;  1CL2 A;  3PDX A;  2ZVN B;  3L36 A;  1P84 E;  3CXH I;  5E79 H;  4LNJ A;  3OP7 A;  2W8J A;  5BJ4 A;  5C6U A;  2VI9 A;  4GDO A;  3VN0 A;  4WY4 D;  1BQD A;  1SZS A;  5EAV A;  2W6A A;  2HPC B;  1IFD A;  1S5L H;  1L0N K;  4OC9 A;  2WPR A;  3RK2 D;  2WSC H;  1DH3 A;  2CPB A;  2D7Y A;  2YIU B;  2VMX A;  2ZSM A;  4H51 A;  5GTH E;  3I5T A;  2YCN A;  3V2Q A;  1HGZ A;  1TAR A;  1LS3 A;  1C0N A;  4OMA A;  4W7Z A;  3L35 A;  5M46 A;  3AE5 C;  5KLV K;  2YKQ A;  4WVZ A;  3N75 A;  2JJE A;  1CQ8 A;  1NTM E;  2J5U A;  2KP8 A;  2V1P A;  3CCL P;  3DYD A;  1DEB A;  4WBT A;  3H32 A;  3PHL A;  1J2J B;  1TU3 F;  4AQR D;  1S4X A;  1IC2 A;  1FDO A;  3JTX A;  1GEY A;  1KMJ A;  2O7C A;  1GEW A;  1T2K D;  2P58 A;  3D70 A;  1QX8 A;  1BE3 D;  3EI8 A;  4WYF A;  1OVU A;  1DKA A;  1JY3 P;  3ASA A;  1HBW A;  3UE8 A;  1L0N J;  3PJ0 A;  2YKP A;  3AE7 C;  3RGU A;  2VLF A;  1UKJ A;  5KJ7 C;  4OBV A;  3LIE A;  2IZ0 A;  2WPV B;  1Z56 A;  1PGJ A;  1IFM A;  1L4A D;  1C7N A;  1M8O B;  1QEX A;  2WSE J;  3H1K G;  1LWU B;  2K88 A;  1H0T A;  4WD2 A;  1VP4 A;  3GZD C;  1GW4 A;  1LP1 A;  3CPW O;  3FDD A;  2W7I A;  3H1L G;  2N9B A;  2K9J A;  3GF7 A;  2R5C A;  3E9K A;  1SQX D;  4CVQ A;  1KQG B;  2RH0 A;  4MY5 A;  3D6Y A;  1D7U A;  1Y47 A;  3H32 B;  3MAD A;  1FZE A;  1RVY A;  3PLN A;  2W7G A;  1CZE A;  4ZKU A;  1R5S A;  3BWO A;  2E76 B;  4KXK A;  2AEM A;  2NPS B;  3L73 G;  2VMO A;  1TOE A;  5APY A;  3VYI A;  3CCM P;  3WU2 E;  3JW9 A;  1IAY A;  2OGA A;  1EZV I;  1RF0 C;  1N7S B;  2M8R A;  3BRT B;  3QBO A;  3II6 A;  3HD7 B;  3OW2 O;  1BSH A;  1SQB K;  1AQT A;  4ZWV A;  2HPC A;  4B86 A;  1P84 D;  1GL2 D;  3LW5 J;  3L75 E;  4J8L A;  2BI5 A;  3L74 E;  3FGA D;  1KB9 I;  1SQP J;  1DD3 A;  2FYU D;  1OXP A;  1BCC J;  2ZY5 A;  3ABV C;  1LTJ C;  1CI6 B;  4U2H A;  3A5T A;  3T32 A;  3QH9 A;  3V5B A;  1SQP K;  2MJZ A;  4XE5 B;  4XJM A;  2DGL A;  1JUN A;  1TOK A;  4UB6 H;  1Q82 Q;  3A9Z A;  4XQ2 A;  1BJ4 A;  4I7Z C;  1VQN P;  2BI3 A;  3LVK A;  3TYY A;  2OAR A;  1M7Y A;  1WYT B;  2JG2 A;  2IBZ G;  3BAT A;  2DKB A;  2JR8 A;  4F5H A;  3D6Z A;  3ELP A;  1SQV D;  5F8V A;  1U08 A;  2D2C B;  1HVV A;  3BCC D;  1GEX A;  4XK1 A;  1IFI A;  2AXC A;  3H1H D;  2SPZ A;  1CZQ A;  4Q76 A;  1C4K A;  3RCH A;  2QA3 A;  1SQX E;  3IN6 A;  3GMA A;  3V4W A;  2YKO A;  2OAT A;  2QEX P;  1L0N E;  3SWF A;  4OGQ C;  5KLV D;  2M3B A;  4U3F E;  1ELQ A;  3C8V A;  1SQX K;  1WKG A;  3E1I A;  4ADE A;  2A1V A;  2BIA A;  3CCS P;  1ZN5 A;  4N6J A;  5BU8 B;  2IFM A;  1WYT A;  2IYO A;  4WYD A;  2XKM A;  4JYB A;  1YTZ I;  4W7Y A;  1MAP A;  1HTL C;  1X2A A;  1N73 B;  1GD2 E;  2VGV A;  1WST A;  3KYQ A;  2L5G B;  3L72 G;  4L74 A;  3TGU G;  2FXO A;  1LT1 A;  3LVJ A;  1E79 H;  2I1K A;  3FZ7 A;  2QB3 A;  3W1H A;  4EIJ A;  5CCG D;  3S4R A;  2BHX A;  2PB0 A;  3A2B A;  5CJ0 A;  2K9J B;  4CXQ A;  2C44 A;  3NDN A;  2FYN B;  4F5I A;  1GMJ A;  4IXO A;  3A8U X;  1S72 P;  5AVX B;  2KUB A;  3LY1 A;  2AEJ A;  3AE2 C;  4J5U A;  1ASG A;  1VF5 C;  2V4H A;  2FYU K;  1AAW A;  2XBN A;  2Y0C A;  1OW6 A;  3JCU H;  3BVH A;  2GA1 A;  4AYC A;  2ZYA A;  1AV1 A;  4IXS A;  1YJW P;  4YXW H;  1ART A;  1AHY A;  3TQX A;  2ZT9 C;  2ZJS E;  3ZRR A;  2WPQ A;  3FFH A;  3AEJ C;  1LTG C;  3A0H E;  1S5L E;  3FD0 A;  1ASB A;  5EUN A;  3MC6 C;  3MUD A;  3PPL A;  4ZMD A;  1KKP A;  2KK7 A;  5CCH D;  2D63 A;  4IL6 H;  1S08 A;  4PD4 H;  1DTY A;  1MKM A;  4N0W A;  3FVS A;  1L4A C;  3AEM C;  4R2N A;  3HL2 A;  3H25 A;  1OZH A;  2Z9U A;  3PP5 A;  3TNU B;  1K73 Q;  3RK3 E;  5HXX A;  3MEB A;  1SQB D;  3A0B E;  3EFG A;  2OQQ A;  3H1K J;  3CQ4 A;  3FZ8 A;  4Q31 A;  1S9K E;  1BJO A;  1X0T A;  1NU1 D;  5HDM A;  1J1D C;  2X3L A;  3CCE P;  1KKJ A;  2W7L A;  1OAT A;  4OBU A;  4AUW A;  2ZYG A;  4RJT A;  4UOY A;  1DD4 A;  4HKZ H;  2N1T A;  1I29 A;  4A6R A;  1XEY A;  3AEL A;  2E75 B;  3FCR A;  2VGS A;  3GR9 A;  3R4T A;  1CJ0 A;  3E77 A;  2ZXE B;  1S3J A;  1USD A;  5APQ A;  3QWO C;  1T3I A;  3MGN A;  3SWY A;  2G8Y A;  2E74 C;  2C0R A;  3EFF K;  3I56 P;  3P32 A;  2K1A A;  2ZP7 A;  1NTZ K;  5G09 A;  2EO5 A;  1WYV A;  4YXD C;  3PH0 A;  4BQ0 A;  3HBX A;  2PO3 A;  4FFC A;  3CD6 P;  2HP2 A;  1WYU A;  1U7J A;  5GTI E;  4EI2 A;  4IYO B;  5BJ3 A;  2QBT A;  1KOR A;  3P8C E;  4ADC A;  4K3A A;  1AJS B;  2WT7 B;  2WWW A;  2N1T B;  1URQ B;  1IAX A;  4LNL A;  1MDZ A;  3AEA C;  4A72 A;  3Q2Y A;  1K04 A;  2Y0D A;  5G4I A;  4GE4 A;  2EGY A;  2W8V A;  2QE7 H;  2N9Y B;  1ZRT D;  1P84 I;  3VAX A;  1LTS C;  3RBX A;  4O6Z A;  2KSJ A;  3NMD A;  3IAO A;  3BN1 A;  1RE3 C;  1RVU A;  4TT3 H;  1RV3 A;  1BGY G;  2O1B A;  1M1J B;  4ATP A;  2BI1 A;  1S0A A;  1N8R Q;  2A45 I;  1SFF A;  3AE8 C;  2QJP B;  1YQ4 C;  1RH5 B;  1PPJ E;  2HUI A;  4RM1 A;  1U7M A;  3HD7 A;  1AX4 A;  1FC4 A;  1WYU B;  4RAE A;  1K9M Q;  2D7Z A;  5KJ7 D;  1M56 D;  1VQ9 P;  4F4E A;  3LG0 A;  4KAM A;  3AEJ A;  3I4J A;  3ISL A;  4DZO A;  1FG3 A;  2FFD C;  3RI6 A;  3L72 D;  1FZC C;  1PG8 A;  5CBN A;  4F5G A;  1ZOB A;  1JS3 A;  4L76 A;  5KLV J;  1B5P A;  1WKH A;  4WP0 A;  2YXQ B;  1ASE A;  3FWN A;  3BCX A;  3RK3 B;  5TJH A;  1VL2 A;  4B98 A;  4E77 A;  4OVN F;  3G4S P;  3DRD A;  3B5N D;  3NU7 A;  4RLG A;  5D5S A;  4E3Q A;  1JCC A;  2VMN A;  3S9O A;  3GET A;  4TN4 A;  3BB8 A;  4Q75 A;  1FZC B;  1OW8 A;  2AEV A;  1KYO H;  3CMA P;  5TF5 A;  2KZJ A;  4A0R A;  2OYI A;  4RES B;  2ZVO B;  5AVT B;  1IJD B;  3TF5 A;  1LTJ A;  5AW0 B;  2WSF H;  1VEF A;  2VMQ A;  4YTP C;  2ITA A;  3P6K A;  1EXJ A;  4W91 A;  1L0L G;  2IBZ D;  3JCU E;  3MBB A;  1YNU A;  1OWA A;  1GD9 A;  4ISY A;  1SQV G;  2OGU A;  1EDK A;  1OMI A;  5CJ4 A;  1LWU A;  1N2D C;  2KS1 B;  4ASW A;  1LP1 B;  3V4Q A;  1RY3 A;  2BCC E;  1HUC A;  3Q8N A;  2FYU G;  1KB9 D;  2IYP A;  3KKI A;  2VIB A;  3VP8 A;  2VMR A;  4WWI A;  3G8M A;  4R4M A;  4LLH A;  1QVG O;  2RKL A;  3WZF A;  1OVR A;  1KC8 Q;  3RL0 g;  5KKZ C;  4C46 A;  4IL6 E;  1J04 A;  4R5F A;  1JF9 A;  2VYC A;  2FFD B;  1NGM B;  4JF7 A;  2HUU A;  1LTT C;  1FZC A;  3IR9 A;  5APX A;  1J32 A;  5AW8 B;  1FU1 A;  1BE3 E;  4WLJ A;  1URQ A;  4KYO A;  1VQ5 P;  4L73 A;  2BWO A;  1DJ9 A;  5K5G B;  3FTB A;  2CST A;  1S07 A;  3L70 E;  1NTZ J;  1S5L X;  3CWB J;  1NTM K;  2KFP A;  1BW0 A;  1N7S A;  4UB8 H;  1AHX A;  2B87 A;  3B5N A;  3CI9 A;  1JEK A;  4B9B A;  2W7K A;  1B4X A;  5AVV B;  1FG7 A;  3LWS A;  1N73 C;  2D64 A;  1S2E A;  1BDD A;  3NTN A;  1A02 J;  1AKC A;  2CFB A;  2EZ1 A;  3G9R A;  1GC3 A;  2G7J A;  2BAS A;  1KIL B;  4IFM A;  2WTY A;  2CJH A;  1CZC A;  3MZW B;  4HF8 A;  2YKU A;  1G4X A;  2B88 A;  3DR7 A;  3JWB A;  4C7N B;  2BI2 A;  3CCQ P;  4BRY B;  3Q1M A;  2FYN C;  1PV3 A;  4P7Y A;  4ASV A;  1NJI Q;  2BWN A;  4ADB A;  1SQQ K;  3H1I E;  1AY5 A;  1SS1 A;  1LNQ A;  1WMK A;  1NTM J;  1CS1 A;  1BJN A;  1ECX A;  2ZY4 A;  2Q9I A;  5AVY B;  3TK1 A;  5FT4 A;  2VMW A;  2J59 M;  1IX7 A;  1EG5 A;  1L0L J;  5DJ1 A;  3M0A A;  2HLO A;  5B5E H;  1YTZ T;  1YIT P;  4H44 C;  1W7N A;  1W3U A;  4XAU A;  4CPG A;  3AE4 C;  3HE4 A;  3SFE C;  1YJS A;  1N2T A;  1QJ5 A;  4PFF A;  1ZOD A;  1AJY A;  1VQ7 P;  4JEX A;  2AY2 A;  2NPS A;  2JJF A;  2FNU A;  2JJG A;  1YJN P;  4E3R A;  4ATQ A;  2VMU A;  2BEZ F;  1VDF A;  4ZDP A;  1LK9 A;  2G6W A;  5I92 A;  3EI9 A;  2YO2 A;  3WGC A;  3UWC A;  1RF1 A;  1LC8 A;  2EYQ A;  1H88 A;  1EXI A;  3LVL B;  3B1E A;  1Y8A A;  4RKU J;  1N8P A;  3TFT A;  3ACZ A;  1NTM G;  4UHN A;  5KLV G;  3WKR A;  2GM4 A;  1ASD A;  4XJL A;  1L0L D;  2Y9Y A;  2JWD A;  1SPA A;  3H1L E;  5KLI C;  5KTB A;  2E5T A;  3RBZ A;  5GTI H;  2C0X A;  4D6T J;  1IJI A;  4UB8 E;  1QZ9 A;  1C7O A;  1BCC D;  2HFE D;  2KB7 P;  1ZC9 A;  4QGR A;  4U7J A;  1YIJ P;  4GIF A;  1M90 Q;  4Y0I A;  2O01 H;  4ZNC A;  3L73 E;  1NH4 A;  5APU A;  1OHY A;  2E75 C;  2ZAE B;  1C7G A;  3ECD A;  3OJA B;  1TOJ A;  1EZV E;  5E5I A;  3W68 A;  1GC2 A;  3PRJ A;  4CBR A;  2W83 C;  1IFN A;  1BQA A;  4AO9 A;  3CXH D;  4RJ0 A;  3U59 A;  1NTK G;  2ZT9 B;  3T97 A;  2BYJ A;  3HUS B;  4I8A A;  4P3M A;  1ZOY C;  1I48 A;  4WY4 C;  5C39 A;  1GL2 C;  3VP6 A;  4GEB A;  3UAK A;  2KS1 A;  3CX5 I;  4LW2 A;  4H0L B;  2E43 A;  4UHO A;  4IL6 X;  2KLU A;  2Z4E A;  2E54 A;  1KTM A;  4RKD A;  1UU2 A;  1SLQ A;  1TOG A;  2FKI A;  4C7N A;  3B1C A;  1O69 A;  1Q2N A;  1FZF A;  5L8R J;  3FSL A;  3PJS K;  2B9B A;  4GOF A;  5CMZ A;  1SP4 A;  1NTM D;  3DZZ A;  1PP9 E;  1QVF O;  1HF9 A;  3WCN A;  2HOD B;  3AE9 C;  4EB5 A;  4Z1M H;  2QSR A;  3EIA A;  3E6G A;  2PP6 A;  3MC6 A;  2X5F A;  5EIG A;  3CQ5 A;  5KAF E;  1E5E A;  5H2F E;  4H44 D;  1MGV A;  3UIA A;  3H1J D;  5APT A;  5FT8 A;  1YI2 P;  4KJM A;  2VGT A;  1AHE A;  2PFX A;  1G1J A;  1PL5 A;  3B8E B;  2P67 A;  2LKM A;  3AE6 C;  4WXB A;  2WSE H;  1A02 F;  3G7Q A;  1L0L K;  1UU1 A;  1VF5 D;  2DR1 A;  1IZN B;  3HUS A;  1OHV A;  4PD4 E;  1X29 A;  3W1I A;  1VQM P;  3AEC C;  1V2D A;  3B4S A;  3KXD A;  3CWB D;  1SFC A;  4Y99 B;  2FY8 A;  3L70 G;  3TFU A;  3AEP A;  3ZRP A;  4Y99 C;  1W23 A;  3LVM A;  3CC2 P;  1EZV D;  3L71 J;  1L4A B;  2YHK A;  1BSN A;  1M1J C;  2L91 A;  5D95 A;  1SVF A;  1KQF B;  1YYC A;  1OX3 A;  4EOT A;  3L73 D;  9AAT A;  5KAF H;  4DGT A;  1KZU B;  4KHX A;  3MIW A;  5H2F H;  1NU1 K;  3BCC G;  3MKJ A;  2YRR A;  4UHM A;  5EIG B;  2BI9 A;  1E5W A;  2WQY C;  1EQB A;  2FYZ A;  4EFF A;  3AEO A;  5EFW B;  1IBJ A;  1M57 D;  4JQ0 D;  2JEE A;  4C7R A;  2KSE A;  4N78 D;  3V2N A;  1HJB A;  1M0N A;  3M0D A;  1IUG A;  3QI6 A;  3A7O A;  3NRA A;  3NU8 A;  3LW5 H;  2V0Y A;  3JZL A;  3KDP B;  2OTL P;  2W7E A; 
#chains in the Genus database with same CATH homology
 2CY8 A;  2R5C B;  5G0A A;  4ZKP A;  1LT9 C;  2Z9V A;  2W8T A;  4LC1 A;  3A9Y A;  4ZWM A;  1GTW A;  1JY2 O;  3QPG A;  2XV5 A;  1JTH A;  2POH A;  3K40 A;  1M4N A;  3DOD A;  1LT9 A;  2P7J A;  1H0C A;  1SFC D;  5CHX A;  2KOG A;  3TCM A;  4M2K A;  1FZB A;  2CH1 A;  4WY4 A;  3BS8 A;  4HYT B;  3VMY A;  2C9N Y;  1UU0 A;  3N4R A;  1IX8 A;  2OYH A;  4Y0H A;  1GDT A;  2EH6 A;  2A45 G;  3HE5 B;  2XNX A;  1C9C A;  3RK2 B;  2JIS A;  3PA9 A;  3C9I A;  5FT6 A;  1FAV A;  2ZYJ A;  1JO5 A;  2YOB A;  3K7Y A;  2C0W A;  5CCG C;  3WGB A;  2E42 A;  2AY7 A;  2AEU A;  4F5F A;  3WMM 0;  5K8B A;  3G0T A;  2YO3 A;  3KE3 A;  4O9B A;  3L8A A;  2ZUK A;  1DFO A;  3VP9 A;  3FQ7 A;  2VMV A;  2CH2 A;  2Z5H A;  5E3K A;  4FL0 A;  3VMX A;  2WK9 A;  5AW5 B;  1IVR A;  2IPP A;  1DJE A;  5EAA A;  1JOC A;  2Z9X A;  3BV0 A;  3RL0 C;  3B46 A;  3HE5 A;  1O62 A;  3RBL A;  5AX8 A;  3ZRQ A;  2H43 A;  3NFQ A;  4MKK A;  3G3Z A;  3M9B A;  2XH1 A;  1MLZ A;  4JYC A;  1NTK K;  1NKZ B;  2O1J A;  1D7R A;  4WYA A;  1ASN A;  1ASF A;  3CLQ A;  3N0L A;  5IWQ A;  1LWU C;  3IFM A;  2OYH C;  3HDO A;  3NUI A;  1LTB C;  4WB0 A;  2W6B A;  2OKK A;  2XU6 A;  2BYL A;  4JEY A;  1GDE A;  1G7X A;  3HVY A;  3PAA A;  2HOZ A;  2AY9 A;  2C9L Y;  1GL2 A;  2BIE A;  5EFS A;  4DBC A;  4EMY A;  1GC4 A;  1URQ C;  3PD6 B;  2J58 A;  3NX3 A;  4OYT A;  4PVF A;  4NOG A;  8AAT A;  4U1T A;  2NPS D;  1V72 A;  2FM1 A;  1LT9 B;  5AW3 B;  1JCD A;  2W7F A;  3EI5 A;  4MQQ A;  3E2Z A;  4AH3 A;  1JMM A;  1FBM A;  4WYG A;  1RE4 C;  2FQ6 A;  3MTU E;  3WX9 A;  4ITX A;  1X9V A;  5AW6 B;  2WPS A;  2BIG A;  4WB0 B;  2AY4 A;  4LW4 A;  2VMY A;  1H89 A;  1D7S A;  1XI9 A;  1QL2 A;  1M0Q A;  3VMZ A;  1AJR A;  4ZDO A;  1OHW A;  3GHG B;  1AIA A;  1JS6 A;  3PIU A;  2H7H A;  2HP1 A;  4M2J A;  3M91 A;  3R2P A;  1DX7 A;  3NYT A;  1YIZ A;  4ZM3 A;  2YRI A;  1QIR A;  1AIC A;  4W8I A;  2YKY A;  2EZ2 A;  3AAT A;  3L37 A;  1LC7 A;  3MD0 A;  1SVV A;  2VI8 A;  3M06 A;  3HD7 C;  3H9X A;  2XDJ A;  2R0T A;  3ATH A;  5APS A;  3RL0 B;  2HOR A;  2Q3I A;  3AEN A;  2HG5 D;  1ZR2 A;  2VMZ A;  1JY3 O;  2HOY A;  1ZV8 A;  1W2E A;  2NPS C;  2VRS A;  2P2U A;  1KQL A;  4F5L A;  2FXM A;  3TSI A;  2R5B A;  3HT4 A;  1AHF A;  3ZZK A;  2XZR A;  1EQ7 A;  3E2F A;  1AAM A;  1TAS A;  5HHY A;  3RBF A;  3CBF A;  2KYV A;  5AVR B;  1N7L A;  3DR4 A;  2HZP A;  3L44 A;  2DGM A;  1SF2 A;  3VTP C;  4GE7 A;  3LID A;  1OXZ A;  3RK3 C;  2WT7 A;  1VJO A;  7AAT A;  4N78 E;  4WYE A;  1N7S D;  1IX6 A;  4JEV A;  3QN6 A;  1O61 A;  3N5M A;  1V2E A;  4IX8 A;  3HD7 D;  4WYC A;  4L0O A;  4W80 A;  3AEN B;  1GL2 B;  4JF0 A;  5AVS B;  1BKG A;  2E7J A;  4ZAH A;  1CI6 A;  3GZD A;  3NTJ A;  2Z61 A;  4ZM4 A;  1DGE A;  2WB6 A;  1QJ3 A;  1GW3 A;  4M2M A;  2W7D A;  1JY2 N;  1G2C A;  1AKB A;  1G4V A;  3CAI A;  1JNM A;  1D2F A;  4WY4 B;  3M9H A;  1AY8 A;  4BHD A;  1PMM A;  3P1T A;  4IY7 A;  3U1A A;  4WXG A;  3VOM A;  1ZLL A;  3FDB A;  1AMQ A;  1TAT A;  2AY8 A;  3CQ6 A;  3W1J A;  3M9Q A;  2VMP A;  4BA4 A;  5AW7 B;  3BWN A;  4OTL A;  3WKS A;  1NKN A;  3DU4 A;  3GZC A;  3B8X A;  3AOV A;  2WZ7 A;  1IO4 A;  4DOJ A;  4WXF A;  4BMK A;  4W1X A;  1MZ9 A;  5DX5 A;  1JG8 A;  1MV8 A;  3OAK A;  2OQX A;  4ZSY A;  1YJZ A;  5BVZ A;  1G2C B;  4GE9 A;  4I1L A;  1I41 A;  2F8J A;  2R5E A;  3HQT A;  1TOI A;  5AVZ B;  2H8P D;  1LTI C;  2C7T A;  3AV7 A;  1J1D B;  3F0H A;  5AW9 B;  2O1K A;  3OA7 A;  3WCO A;  4JF1 A;  3GBX A;  1AMA A;  4PIW A;  1MFZ A;  3EZS A;  2YMY A;  1NO4 A;  1T3U A;  2D65 A;  2AY3 A;  1YIY A;  1N7S C;  3D6K A;  1CW5 A;  2P1J A;  2HOD A;  1MDO A;  3NNK A;  3II0 A;  1QL1 A;  1M0O A;  1HH0 A;  4AZK A;  1GU5 A;  1AJS A;  1EJI A;  2OYI B;  2RFV A;  4W1W A;  3EZ1 A;  2FNI A;  3M0D C;  1PMO A;  2R2N A;  5BU5 A;  3NYU A;  3PD6 A;  3A3Y B;  1RF0 A;  1SQV K;  3VK4 A;  2W8W A;  2VLH A;  3A2A A;  1N86 A;  3KGW A;  1LGH B;  1AFO A;  3NUB A;  2Z20 A;  1PFI A;  2Q7C A;  2D66 A;  1ARS A;  2Z1Y A;  2GSA A;  2N1T C;  2DOU A;  3EI6 A;  5AW1 B;  4ADD A;  2ZSL A;  4A6T A;  2AY6 A;  3BC8 A;  4ZSW A;  1KIL C;  1ZR4 A;  4ZLV A;  3R9A A;  5JAY A;  1NHL A;  1FZA A;  2X5D A;  1CSB A;  2YCP A;  1MDX A;  4H63 Q;  3QGU A;  1KIL A;  4IFF A;  1J1E C;  1JTH B;  1SZU A;  2R3C A;  2OYI C;  3MAU A;  2VGZ A;  1LTJ B;  4W5K A;  5J8Q A;  1YJY A;  4F5M A;  3DXV A;  2GUS A;  4XEW A;  1WYV B;  1YOO A;  1N73 A;  1RF1 B;  2VGU A;  3DC1 A;  1IFJ A;  1S06 A;  4IYO A;  4I2L C;  1GCK A;  3ZZJ A;  2HYN A;  1ELU A;  1LW4 A;  4CBS A;  1B9I A;  1KL1 A;  2N1T D;  3HTK B;  1BJW A;  4OT8 A;  2QLR A;  1E5F A;  3OKS A;  1DJU A;  5M4D A;  2AY5 A;  3WY7 A;  2GMU A;  1FJK A;  1KL2 A;  1IK9 A;  1B5O A;  2GUV A;  2FN6 A;  1FOS F;  1NAF A;  5G2P A;  1I43 A;  2CAN A;  1NOH A;  2W7M A;  1Y4I A;  1GK6 A;  3BRV B;  4RIZ A;  2ORD A;  4GDY A;  3V2P A;  3F6T A;  1XTC C;  4A6U A;  2GQN A;  2AAT A;  3GWP A;  5E4Z A;  1H1C A;  2ZC0 A;  3VK3 A;  5AW4 B;  1FJP A;  4MKJ A;  3HTK A;  2EPJ A;  2GB3 A;  1ARI A;  2Z1Z A;  3JWA A;  1MLY A;  4WLH A;  3TAT A;  1S09 A;  3HMU A;  4LGD E;  2D5Y A;  2W27 A;  1RE4 A;  3MAF A;  1LKC A;  3K28 A;  1ORD A;  4ITG A;  4MSO A;  1RE3 A;  1P3W A;  2ZY2 A;  1X0M A;  3P7K A;  3EQ2 A;  4AO4 A;  5AVQ B;  1LW5 A;  5M49 A;  4Q6R A;  1ASM A;  1JY3 N;  4GKG A;  2YKV A;  4JEW A;  3PGY A;  2W7J A;  5AW2 B;  1MUU A;  3H6P A;  1B8G A;  1O4S A;  4MQR A;  2CB1 A;  4HH2 A;  4R8D A;  2C81 A;  1HWT C;  3FVX A;  1QGN A;  3EUC A;  3VK2 A;  4F5K A;  1ASC A;  1GBN A;  2JJH A;  1GU4 A;  1X28 A;  2CTZ A;  5F9S A;  3GHG C;  5CCG A;  3BWN C;  3I16 A;  4RJY A;  1M32 A;  4ZAS A;  5G2Q A;  3AEM A;  3FRK A;  1W7L A;  3TNU A;  1D7V A;  3B5N C;  1LTA C;  1CQ7 A;  2I1J A;  2IFN A;  4Y0D A;  3A9X A;  2O0R A;  2WK8 A;  2YNY A;  1FZG A;  3FQA A;  4AZJ A;  3KQG A;  1SFC B;  3FKD A;  2AY1 A;  5DJ9 A;  1URQ D;  1AKA A;  1KIL D;  1ASA A;  2WKA A;  4AOA A;  4CXR A;  1W7M A;  2KLV A;  2Z9W A;  4E1O A;  4RIT A;  1B9H A;  4K05 A;  4I6M C;  1WRG A;  1Z7D A;  2QMA A;  3BCA A;  4XJO A;  3HUS C;  3EIB A;  2WK7 A;  1PFF A;  4IW7 A;  1SFC C;  2VMT A;  2JJL A;  1AIB A;  2E7U A;  4LNM A;  4GRX A;  3HRN A;  3IHJ A;  1M0P A;  1KMK A;  3PDB B;  2VGW A;  4RKC A;  3QM2 A;  3FVU A;  2QM7 A;  2E7I A;  4XA4 A;  2FFD A;  3P8C D;  1ARG A;  3GJU A;  4K2M A;  1S9K D;  4GT1 A;  2W7H A;  3DXW A;  2Q5U A;  4A0H A;  3RK3 D;  3AOW A;  3MAF B;  3B5N B;  1HGV A;  3QHX A;  2OKJ A;  3CL3 D;  3ASB A;  4K2I A;  3N4S A;  3GSB A;  4OH8 B;  3ELE A;  5EUD A;  2R32 A;  3O8Z A;  3COG A;  5DB5 A;  1T8Z A;  3E2Y A;  1AHG A;  2W8U A;  2R5D A;  2CPS A;  1FDM A;  2CIN A;  3L4F A;  3EI7 A;  1GK4 A;  2PAJ A;  5KJ7 A;  3PDB A;  4W1V A;  2ZJG A;  1L4A A;  2OYH B;  4N3Y B;  3H7F A;  1BS0 A;  1AY4 A;  3VOP A;  2DGK A;  4A0G A;  4XJP A;  3FQ8 A;  1TPL A;  4EU1 A;  4DQ6 A;  3HLM A;  3GHG A;  1X79 B;  2DKJ A;  5AVU B;  1JY2 P;  4EB7 A;  1ARH A;  3USF A;  4ZDL A;  4A0F A;  2Q7W A;  5CCH A;  1RF1 C;  2FKW B;  2BWP A;  4IFD K;  1CL1 A;  1LC5 A;  4MQP A;  1G7W A;  2Z5I A;  1Z3Z A;  3FZ6 A;  1J1E B;  1M6S A;  2TPL A;  4M3L A;  3RK2 C;  2HOX A;  3P8M C;  4LC3 A;  3BCB A;  1AMR A;  2QB2 A;  2YKX A;  1GC0 A;  2D61 A;  2CJG A;  3E2Z B;  1N31 A;  1H8A A;  2FYF A;  3B1D A;  1FOS E;  3N7N A;  4PFN A;  3M5U A;  2GMS A;  2WIT A;  2VMS A;  1NWQ A;  3KGX A;  4GSA A;  2YCT A;  3I5C A;  2OGE A;  3NYS A;  4BA5 A;  1T3J A;  3LV2 A;  1AQ5 A;  2JGT A;  1WT6 A;  1BT4 A;  1BJO B;  1YAA A;  2CJD A;  3V2R A;  4HVK A;  1M7L A;  3RCH B;  3KPE A;  2QM8 A;  1X8Y A;  1M1J A;  1KFN A;  2PB2 A;  4A00 A;  4JEZ A;  3RL0 D;  1T2K C;  3U1C A;  5APV A;  1MAQ A;  4WBA A;  5EQC A;  1QIS A;  1CQ6 A;  1RV4 A;  2A45 H;  2ZY3 A;  2HUF A;  5CCH C;  1XTG B;  1GZL A;  1ASL A;  2NMP A;  2BKW A;  1G1I A;  2X8U A;  1SZK A;  3N4X A;  5EUE A;  2IX7 C;  2VIA A;  3RQ1 A;  3WLX A;  5FT5 A;  1QIT A;  4WB4 A;  3FFR A;  5AVW B;  3RUY A;  3F9T A;  4K2B A;  4F5J A;  4OCA A;  4R5Z A;  4TMR A;  5M4B A;  1AMS A;  4UQV A;  1KFM A;  5APW A;  1V2F A;  1VPC A;  1OXO A;  5G4J A;  4IXZ A;  3BAS A;  3NXS A;  1DGD A;  2ZFC A;  3HE4 B;  1CL2 A;  3PDX A;  3L36 A;  4LNJ A;  3OP7 A;  2W8J A;  5BJ4 A;  5C6U A;  2VI9 A;  3VN0 A;  4WY4 D;  1BQD A;  1SZS A;  5EAV A;  2W6A A;  2HPC B;  1IFD A;  1L0N K;  4OC9 A;  2WPR A;  3RK2 D;  2WSC H;  1DH3 A;  2CPB A;  2D7Y A;  2VMX A;  2ZSM A;  4H51 A;  3I5T A;  2YCN A;  3V2Q A;  1HGZ A;  1TAR A;  1LS3 A;  1C0N A;  4OMA A;  4W7Z A;  3L35 A;  5M46 A;  5KLV K;  2YKQ A;  3N75 A;  2JJE A;  1CQ8 A;  2KP8 A;  2V1P A;  3DYD A;  1DEB A;  4WBT A;  3H32 A;  1J2J B;  4AQR D;  1IC2 A;  3JTX A;  1GEY A;  1KMJ A;  2O7C A;  1GEW A;  1T2K D;  3EI8 A;  4WYF A;  1DKA A;  1JY3 P;  3ASA A;  1HBW A;  3UE8 A;  3PJ0 A;  2YKP A;  2VLF A;  1UKJ A;  5KJ7 C;  4OBV A;  3LIE A;  1Z56 A;  1IFM A;  1L4A D;  1C7N A;  1LWU B;  4WD2 A;  1VP4 A;  3GZD C;  1GW4 A;  3FDD A;  2W7I A;  2N9B A;  2R5C A;  3E9K A;  4CVQ A;  4MY5 A;  1D7U A;  3H32 B;  3MAD A;  1FZE A;  1RVY A;  2W7G A;  1CZE A;  4ZKU A;  3BWO A;  4KXK A;  2NPS B;  2VMO A;  1TOE A;  5APY A;  3VYI A;  3JW9 A;  1IAY A;  2OGA A;  1RF0 C;  2M8R A;  1N7S B;  3BRT B;  3QBO A;  3II6 A;  3HD7 B;  1SQB K;  4ZWV A;  2HPC A;  4B86 A;  1GL2 D;  4J8L A;  2BI5 A;  1OXP A;  2ZY5 A;  1LTJ C;  1CI6 B;  4U2H A;  3A5T A;  3T32 A;  3V5B A;  1SQP K;  2MJZ A;  4XE5 B;  4XJM A;  2DGL A;  1JUN A;  1TOK A;  3A9Z A;  4XQ2 A;  1BJ4 A;  2BI3 A;  3LVK A;  3TYY A;  2OAR A;  1M7Y A;  1WYT B;  2JG2 A;  3BAT A;  2DKB A;  4F5H A;  3ELP A;  5F8V A;  1U08 A;  1HVV A;  1GEX A;  4XK1 A;  1IFI A;  1CZQ A;  4Q76 A;  1C4K A;  3RCH A;  2QA3 A;  3V4W A;  2YKO A;  2OAT A;  3SWF A;  2M3B A;  1ELQ A;  1SQX K;  1WKG A;  3E1I A;  4ADE A;  2A1V A;  2BIA A;  1ZN5 A;  4N6J A;  5BU8 B;  2IFM A;  1WYT A;  4WYD A;  2XKM A;  4JYB A;  1YTZ I;  4W7Y A;  1MAP A;  1HTL C;  1X2A A;  1N73 B;  1GD2 E;  2VGV A;  1WST A;  3KYQ A;  2L5G B;  3LVJ A;  2I1K A;  3FZ7 A;  2QB3 A;  3W1H A;  4EIJ A;  5CCG D;  2BHX A;  2PB0 A;  3A2B A;  5CJ0 A;  4CXQ A;  2C44 A;  3NDN A;  4F5I A;  4IXO A;  3A8U X;  5AVX B;  3LY1 A;  4J5U A;  1ASG A;  2FYU K;  1AAW A;  2XBN A;  3BVH A;  4AYC A;  4IXS A;  1ART A;  1AHY A;  3TQX A;  3ZRR A;  2WPQ A;  3FFH A;  3AEJ C;  1LTG C;  3FD0 A;  1ASB A;  5EUN A;  3MC6 C;  3MUD A;  3PPL A;  1KKP A;  5CCH D;  2D63 A;  1S08 A;  1DTY A;  4N0W A;  3FVS A;  1L4A C;  3AEM C;  4R2N A;  3HL2 A;  2Z9U A;  3PP5 A;  3TNU B;  5HXX A;  3MEB A;  3EFG A;  3CQ4 A;  3FZ8 A;  4Q31 A;  1S9K E;  1BJO A;  5HDM A;  1J1D C;  2X3L A;  1KKJ A;  2W7L A;  1OAT A;  4OBU A;  4AUW A;  4UOY A;  2N1T A;  1I29 A;  4A6R A;  1XEY A;  3AEL A;  3FCR A;  2VGS A;  3GR9 A;  3R4T A;  1CJ0 A;  3E77 A;  2ZXE B;  5APQ A;  1T3I A;  3MGN A;  3SWY A;  2C0R A;  3P32 A;  2ZP7 A;  1NTZ K;  5G09 A;  2EO5 A;  1WYV A;  4BQ0 A;  3HBX A;  2PO3 A;  4FFC A;  2HP2 A;  1WYU A;  4IYO B;  5BJ3 A;  2QBT A;  3P8C E;  4ADC A;  1AJS B;  2WT7 B;  2WWW A;  2N1T B;  1URQ B;  1IAX A;  4LNL A;  1MDZ A;  4A72 A;  5G4I A;  4GE4 A;  2EGY A;  2W8V A;  3VAX A;  1LTS C;  4O6Z A;  2KSJ A;  3NMD A;  3BN1 A;  1RE3 C;  1RVU A;  1RV3 A;  2O1B A;  1M1J B;  4ATP A;  2BI1 A;  1S0A A;  2A45 I;  1SFF A;  2HUI A;  4RM1 A;  3HD7 A;  1AX4 A;  1FC4 A;  1WYU B;  4RAE A;  2D7Z A;  5KJ7 D;  4F4E A;  3LG0 A;  4KAM A;  3AEJ A;  3I4J A;  3ISL A;  4DZO A;  1FG3 A;  2FFD C;  3RI6 A;  1FZC C;  1PG8 A;  4F5G A;  1ZOB A;  1JS3 A;  1B5P A;  1WKH A;  4WP0 A;  1ASE A;  3BCX A;  3RK3 B;  4B98 A;  4E77 A;  3DRD A;  3B5N D;  3NU7 A;  4RLG A;  5D5S A;  4E3Q A;  1JCC A;  2VMN A;  3GET A;  4TN4 A;  3BB8 A;  4Q75 A;  1FZC B;  2AEV A;  5TF5 A;  4A0R A;  2OYI A;  4RES B;  5AVT B;  1IJD B;  1LTJ A;  5AW0 B;  2WSF H;  1VEF A;  2VMQ A;  3P6K A;  4W91 A;  3MBB A;  1YNU A;  1OWA A;  1GD9 A;  4ISY A;  5CJ4 A;  1LWU A;  1N2D C;  3V4Q A;  1RY3 A;  1HUC A;  3Q8N A;  3KKI A;  2VIB A;  3VP8 A;  2VMR A;  3G8M A;  4LLH A;  3WZF A;  4C46 A;  1J04 A;  4R5F A;  1JF9 A;  2VYC A;  2FFD B;  4JF7 A;  2HUU A;  1LTT C;  1FZC A;  3IR9 A;  5APX A;  1J32 A;  5AW8 B;  1FU1 A;  4WLJ A;  1URQ A;  4KYO A;  2BWO A;  1DJ9 A;  3FTB A;  2CST A;  1S07 A;  2KFP A;  1NTM K;  1BW0 A;  1N7S A;  1AHX A;  3B5N A;  3CI9 A;  4B9B A;  2W7K A;  1B4X A;  5AVV B;  1FG7 A;  3LWS A;  1N73 C;  2D64 A;  3NTN A;  1A02 J;  1AKC A;  2CFB A;  2EZ1 A;  1GC3 A;  2G7J A;  2BAS A;  1KIL B;  4IFM A;  2WTY A;  2CJH A;  1CZC A;  4HF8 A;  2YKU A;  1G4X A;  3DR7 A;  3JWB A;  4C7N B;  2BI2 A;  4P7Y A;  2BWN A;  4ADB A;  1SQQ K;  1AY5 A;  1CS1 A;  1BJN A;  1ECX A;  2ZY4 A;  2Q9I A;  5AVY B;  3TK1 A;  5FT4 A;  2VMW A;  2J59 M;  1IX7 A;  1EG5 A;  5DJ1 A;  3M0A A;  2HLO A;  1YTZ T;  1W7N A;  1W3U A;  4XAU A;  3HE4 A;  1YJS A;  1N2T A;  1QJ5 A;  4PFF A;  1ZOD A;  4JEX A;  2AY2 A;  2NPS A;  2JJF A;  2FNU A;  2JJG A;  4E3R A;  4ATQ A;  2VMU A;  1VDF A;  4ZDP A;  1LK9 A;  2G6W A;  5I92 A;  3EI9 A;  2YO2 A;  3WGC A;  3UWC A;  1RF1 A;  1LC8 A;  2EYQ A;  1H88 A;  3LVL B;  3B1E A;  1N8P A;  3TFT A;  3ACZ A;  4UHN A;  3WKR A;  2GM4 A;  1ASD A;  4XJL A;  1SPA A;  5KTB A;  2C0X A;  1IJI A;  1QZ9 A;  1C7O A;  2HFE D;  2KB7 P;  1ZC9 A;  4QGR A;  4GIF A;  4Y0I A;  2O01 H;  1NH4 A;  5APU A;  1OHY A;  1C7G A;  3ECD A;  3OJA B;  1TOJ A;  5E5I A;  1GC2 A;  4CBR A;  1IFN A;  1BQA A;  4AO9 A;  4RJ0 A;  3U59 A;  3T97 A;  2BYJ A;  3HUS B;  4I8A A;  4P3M A;  1I48 A;  4WY4 C;  1GL2 C;  3VP6 A;  4GEB A;  3UAK A;  4LW2 A;  2E43 A;  4UHO A;  2Z4E A;  2E54 A;  4RKD A;  1UU2 A;  1SLQ A;  1TOG A;  2FKI A;  4C7N A;  3B1C A;  1O69 A;  1FZF A;  3FSL A;  5CMZ A;  1SP4 A;  3DZZ A;  3WCN A;  2HOD B;  4EB5 A;  3EIA A;  2QSR A;  3E6G A;  2PP6 A;  3MC6 A;  2X5F A;  5EIG A;  3CQ5 A;  1E5E A;  1MGV A;  3UIA A;  5APT A;  5FT8 A;  2VGT A;  1AHE A;  1G1J A;  3B8E B;  2P67 A;  2LKM A;  4WXB A;  2WSE H;  1A02 F;  3G7Q A;  1L0L K;  1UU1 A;  2DR1 A;  3HUS A;  1OHV A;  1X29 A;  3W1I A;  1V2D A;  1SFC A;  4Y99 B;  3TFU A;  3AEP A;  3ZRP A;  4Y99 C;  1W23 A;  3LVM A;  1L4A B;  2YHK A;  1M1J C;  5D95 A;  1SVF A;  1YYC A;  4EOT A;  9AAT A;  4DGT A;  1KZU B;  4KHX A;  3MIW A;  1NU1 K;  3MKJ A;  2YRR A;  4UHM A;  5EIG B;  2BI9 A;  1E5W A;  1EQB A;  2FYZ A;  4EFF A;  3AEO A;  1IBJ A;  2JEE A;  4C7R A;  3V2N A;  4N78 D;  1HJB A;  1M0N A;  3M0D A;  1IUG A;  3QI6 A;  3A7O A;  3NRA A;  3NU8 A;  3LW5 H;  2V0Y A;  3JZL A;  3KDP B;  2W7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...