3N7NA

Structure of csm1/lrs4 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
163
Chain Sequence
PLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monopolin complex subunit CSM1
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 53
structure length 163
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3n7nA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n7nA02
3BASA 3OJAB 5BU5A 3N4XA 5BVZA 3N7NA 3HRNA 1IC2A 3U1CA 3N4SA 5BU8B 4I1LA 5KTBA 3VP8A 4GIFA 3U1AA 3C9IA 4ZKUA 2POHA 4ZKPA 3BATA 3U59A 3VP9A 4N3YB 3N4RA 1NKNA 4N78D 1X79B 1WT6A 4O9BA 3P8CD 2JEEA 2FXMA
chains in the Genus database with same CATH superfamily
5APQA 1FG3A 1TOGA 4H0LC 1QLED 2OKJA 3G0TA 5CCGA 3AE4C 4DOJA 3H1KJ 1K9MQ 2WSFJ 1NTKG 4JEZA 1EZVE 1PPJE 1S0AA 3NFQA 2C7TA 1JY3O 3IFMA 4ZMDA 2WPQA 2AY2A 1NTKJ 4IL6H 4GE9A 4OVNF 3PH0A 2I8DA 2WB6A 3TNUB 1A02F 3R2PA 5H2FH 3EI8A 4WYDA 1DEBA 1LW5A 2WT7A 4NPDA 3FD0A 4A0RA 2JJFA 3ISLA 1L0LG 3TGUJ 1B5OA 1AHFA 4W1WA 1KMKA 2E74D 3FKDA 1T3JA 2YNYA 1AQ5A 3KDPB 2FKIA 1N2DC 3B1DA 4PJ0H 3H1KE 4EDFA 1RF1B 1L0LJ 3AENB 2Q1KA 3CCLP 3KZIH 1KB9H 3H32A 3QHXA 1ZODA 2VRSA 3RGUA 4BA4A 2YRRA 3MUDA 4RJYA 4ZSYA 3FGAD 2JP3A 1X9VA 5TISE 1RVYA 1IX8A 3NTJA 4IFDK 1W7LA 4IXZA 2D64A 1OX3A 3TGUE 3M9BA 2KFPA 1P84I 4ZAHA 2V7QJ 3I16A 1EDKA 2K1AA 3RQ1A 4O9BA 2VGZA 3OJAB 5AW9B 2N1TB 3LWSA 2O1JA 5L8RJ 1ASCA 3DRDA 3NXSA 1AJSA 2QJKB 2ZVOB 4MKJA 2M5AB 1HH0A 3EZ1A 2R5EA 1GC4A 2OYHB 4EYYQ 2WQYC 1LTJB 1SQXG 2W6BA 2JEEA 4PD4I 3PLNA 1KL1A 2R3CA 3C8VA 2QB3A 1ASAA 2N9YB 3P6KA 1LJ2A 2NZ2A 1GEWA 1SQXJ 2QSRA 2ORDA 1SVVA 4ZLVA 2EH6A 1NTZG 3S9OA 2ZJSE 5APSA 4OMAA 3CWBJ 4H0LD 4H13C 4RJ0A 1URQB 3L72G 1YTZI 3GWPA 2I1KA 3BWNA 4AYCA 3VMXA 3ZZJA 2H89C 1LGHB 1QL2A 3L72J 3P32A 1IC2A 1QVGO 5AW8B 2OTLP 3TSIA 1TOIA 2X5DA 2KI7B 1RH5B 5EFSA 3B4SA 4Y0IA 2QBTA 2CTZA 4P7YA 2HLOA 3BB8A 2QIWA 3A9ZA 3CWBE 4F5GA 3P8CE 2DGKA 3W1IA 2ZYAA 4WY4A 2YKYA 3HE5A 2R32A 3H25A 1AHGA 1SQQG 2E42A 1FZBA 1KB9I 4JQ0D 2D2CC 2VMVA 1C7NA 1ZMEC 2WKAA 1URQD 1ZW0A 1SLQA 1H0CA 1MDXA 3PP5A 5B66H 2O7CA 1KQGB 2BWOA 3MZWB 3QI6A 4AH3A 1AVYA 2VMSA 5J8QA 2LXBA 4PV1C 3TFUA 1DFOA 1Z3ZA 1ASLA 1N2TA 2ZT9C 2C9NY 1RE4C 4I8AA 3L37A 5K5GB 5CCHA 1EDJA 3BC8A 3AEGC 3VK3A 1FBMA 1TOJA 2NPSA 2DKJA 3MADA 1JY3P 1IK7A 5APYA 1J1DB 1MLYA 2HYNA 1NAFA 3MHVA 1ASMA 3ATHA 3A2BA 3H7FA 2FYUG 2DGLA 2AXTE 1UIXA 2B87B 2X3LA 1ASBA 4XJPA 3L75E 3V5BA 1S72P 2E75B 2DW3A 1A02J 3VAXA 1NKZB 3AEBC 1E5FA 2BIEA 1VF5C 3CLQA 3NU8A 2W6AA 3V4WA 4A0FA 2HFED 4N78E 1VQOP 3AECC 3MTUE 5TJHA 2OARA 1AIAA 4H13D 3A9YA 3BRTB 1CJ0A 5G4JA 5BU8B 1OIPA 4C7NA 3FQAA 3KYQA 1AV1A 2HUFA 1EZVI 1VQLP 3L75D 1GMJA 1BQDA 3AE9C 1H0TB 2WPVB 2HOXA 3AEOA 1J32A 4WB0B 1LW4A 2VI8A 2VMWA 1H8AA 2VIBA 1NHLA 4N78D 2EYQA 2YMYA 1W5CE 4IX8A 3MC6A 4LW2A 1W23A 5BVZA 4OGQC 3S1KA 1CI6B 1YYCA 1WYUB 3G8MA 4UHNA 1UKJA 3FVSA 2HG5D 3GW6A 2O01H 1IFPA 1I48A 2VGTA 2YKPA 3H1LG 4BXLA 3AEPA 1BQAA 3FCRA 2E7JA 4ITXA 1X8YA 1IK9A 4U7JA 1CS1A 2Q6QA 2XDJA 2A1VA 3VK4A 2KIKA 1LT9B 1AMAA 5GTHH 1XI9A 2BCCD 2YOBA 2BIGA 2YKOA 2HZPA 1RQVA 1OMIA 2K3RA 1WKGA 1HJ0A 1FZCB 2ZAEB 2Z5HA 4AO4A 1K05A 1OXPA 1BGYG 2CFBA 2CPBA 1SQPJ 2G6WA 2JJEA 1YAAA 2N9BA 1J04A 1M32A 3AEEC 1ZOBA 3A0BE 3TATA 3NDNA 2VMRA 1SFCC 1GDEA 3V2PA 1LTSC 3PHLA 1B8GA 2OATA 3GHGB 3BWNC 4ZASA 2WPSA 2HOYA 2HUIA 1D7SA 1AMSA 4MY5A 3AEJA 1X0TA 4DQ6A 1ARHA 1ZRTE 4O6ZA 3FVXA 2C0XA 2GUSA 2Q3EA 1SS1A 1PV3A 4C7RA 3TF5A 1NAYA 4H51A 1OWAA 2AXTH 1QJ3A 3AOVA 3G4SP 2PB0A 3FDBA 1SQPE 2AEUA 5DJ9A 1GL2D 1R8EA 1VQ7P 2AY3A 1M1JA 3EQ2A 3TNUA 1PP9G 4U3FG 4W5KA 3DC1A 1VQKP 1NYHA 2YXRB 4WY4C 3V6IA 3N5MA 2QE7H 1KILB 3KXDA 2QSIA 1EXIA 1UU1A 2E7UA 4OTLA 3LVJA 1D7VA 2Z1ZA 1PGOA 1S9KE 3UE8A 1RF1A 3AENA 2H88C 4I7ZC 3WY7A 1FG7A 3P7KA 1BDCA 2D63A 1C7OA 3CCRP 4L74A 4MSOA 4GDOA 1GK4A 2CJDA 5M4BA 2KSEA 2OYOA 3L70J 2IBZG 2BASA 2DOUA 1VQ6P 2ZXEB 2GB3A 2W8TA 3GF3A 1BS0A 2IPPA 3DU4A 3JWAA 2ZSLA 1S9KD 1NTME 2KZJA 3L71J 1OXZA 4HB1A 1GC3A 1JMMA 2O1BA 1IJDB 2ZC0A 5E4ZA 3AE3C 1O62A 1NVOA 3NRAA 9AATA 3L4FA 2QEXP 2N1TA 1LT1A 1MFZA 3E1IA 1OW6A 2WPRA 3AE1C 2A06G 4U1TA 1SQPK 3HE4A 1VL2A 1VPCA 3L70E 4RM1A 2YIUB 1N7LA 3N75A 1MDZA 2CJHA 1NTMD 4K3AA 4ZDLA 2YO2A 1CQ8A 2R5BA 3IR9A 1LTJA 3RI6A 1Y47A 3L71E 5D5SA 5EUEA 2HUUA 4PD4E 1NU1D 4KYOA 3A0BH 3ZZKA 3M0DA 1VQNP 3H1IG 5KLVD 3CPWO 1SFCD 3ZDMA 1OVVA 2WITA 3MAFA 3RK2B 1GEYA 1TATA 3QGUA 3EIBA 2ZYGA 1FZAA 1B9IA 3H1IJ 3M9QA 2HP2A 4NOGA 1GBNA 2BI9A 2AY4A 3F9TA 4RJTA 3L8AA 4PD4D 3LG0A 1BJ4A 1FC4A 2C0WA 3HD7C 1G4XA 2VI9A 1IZNB 1FJPA 3H1HE 4TT3H 3AE8C 1EDLA 1V2EA 3T97B 5AW4B 1AAMA 1SP4A 2ZJGA 2D65A 1YJWP 3PAAA 3RBXA 1WYTB 2AY6A 1LC5A 1RHZB 5KAIE 3LY1A 4I2LC 1XTGB 1VQ4P 4WXFA 3L73J 3H1HD 1PG8A 1YJZA 2KOGA 2BYLA 3WGBA 2H7HA 2HODB 4BHDA 1PMOA 1FC2C 1L4AA 2HPCB 2G3AA 2FNIA 4DJGA 3USSA 4KXKA 2JJGA 5AVYB 2KP8A 1LTAC 3PTZA 1O61A 1FU1A 5AVXB 3II0A 1N7SA 1Q86Q 3AEJC 1AKBA 2FXPA 2X5FA 3L73E 1K73Q 1MDOA 4M2MA 4Y0HA 1JY2P 2JR8A 4E1OA 2W27A 3CI9A 4WYGA 3L74J 2ZYDA 1KFNA 3BASA 3WCNA 3N4XA 4FL0A 2M3EA 1M1JC 4FFCA 2E76C 3H1JD 1FDIA 1YJNP 1MAQA 2RMZA 1FS0E 4PD4H 3L73D 3VP9A 3BCCJ 3WMM0 3EFGA 4AO9A 2IX7C 4EIJA 1AIBA 5APTA 3W68A 3HUSC 4YXDC 1S1CX 2OYIA 4MN4C 1TOKA 3GJUA 3L74E 1KAFA 1RF1C 3E2ZB 4W1VA 2CH1A 4L73A 2FYZA 4ZDOA 2JO1A 3WLXA 2O1KA 2WZ7A 3O6QA 3I55P 4EOTA 3RK3B 1AHEA 3CBFA 4GDYA 1JS3A 1ARIA 2Z9XA 4Q76A 1H0TA 1E5WA 2D61A 1G1IA 2YKUA 3V4QA 3A0HE 5CBNA 3BCCE 1L2PA 1BE3G 1LWUB 1H89A 1AX4A 2W8JA 5FT8A 2VMOA 3AEMA 1CI6A 5APWA 1KQLA 4LGDE 4OBVA 5APUA 1BW0A 1BE3J 1LC8A 3MKJA 3FRKA 3RK3E 2N1TC 1YBKA 3Q2YA 1N73B 5KAIH 1EZVD 3B5NC 1PPJD 4H44B 2G8YA 5KAFE 2RN0A 2FYFA 1EXJA 2QJKC 1RVUA 4CXRA 2VMYA 4HH2A 3W67A 2KK7A 3AEDC 4NPFX 1W3UA 4W8IA 2GSAA 1T2KC 1D7MA 1NTKE 1LTJC 1UIIA 2YO3A 4GT1A 1QITA 3GF7A 5KKZB 3RK3D 1GEXA 1FZCA 1YOOA 3BATA 2WSEJ 2GUVA 3H1KD 4H0LB 1I43A 2F8JA 1M7YA 4ZDPA 2KS1A 3MBBA 3M91A 5M4DA 2E43A 3MGNA 2JWAA 1M0PA 2Z9VA 1OZHA 5KJ7A 4WXGA 1L0LE 1BSNA 1NTKD 2A45G 3GHGA 3AATA 1M90Q 4RAEA 2XU6A 4AUWA 4GKGA 2AY5A 1Q7YQ 4ZSWA 1MUUA 3ACZA 3HMUA 1ECXA 4EB5A 2VGWA 3VMYA 4H44D 3TGUD 1B9HA 3EIAA 4ZM3A 1CSBA 2KXPB 3IF4A 2IFNA 4GOFA 2LR2A 3II6A 1GD2E 1YQ4C 3V2RA 3AE6C 1L0LD 1EDIA 3WU2E 2HP1A 1B5PA 4F5LA 5D95A 1KILA 1AA0A 4EMYA 2R5CB 4CBRA 3RL0C 1KN7A 1NTKK 2QJPB 2XH1A 5F8VA 1JCCA 2R3SA 3OAKA 2OGAA 1NTZJ 1BT4A 4D6TG 3VN0A 2DKBA 2Z4EA 3A0HH 1Q81Q 1L4AC 2KSJA 2FN6A 1ARGA 2QRXA 4OCAA 1H1CA 1J1EB 4HYTB 4D6TJ 3ELEA 5F9SA 4IYOA 1M6SA 2CANA 1SQXE 1L0LK 3DZZA 3UIAA 4OYTA 1VQMP 2BI2A 1N7SC 2P67A 1L0NG 2EO5A 3NU7A 2AEMA 3E2YA 1RV4A 3K28A 2WSFH 4L75A 2SPZA 3K5BA 1L0NJ 2D7ZA 5AVSB 3L72E 3R4YA 1P3WA 1ZR2A 4I6MC 3VMAA 7AATA 3KGWA 5FT5A 1S2EA 1SQXD 4XJMA 4N3YB 2AEVA 3TCMA 1SQQJ 2BEZF 3CQ5A 5TISH 2RFVA 1WT6A 3CWBD 3P8CD 4IY7A 1YJYA 2CINA 2GMUA 4W7ZA 1HBWA 3CL3D 5AW6B 3C1LA 4F5KA 3WGCA 1S4XA 4H13B 2OYIC 3PDBB 5BJ3A 1IAXA 2O0RA 1E79H 3PA9A 1LKCA 3L72D 2YRIA 5M49A 1IUGA 3BVHA 4GODA 1TOEA 4L0OA 5CCGC 3NNKA 1JY2N 1S5LE 1BDDA 4MKKA 2ZYJA 4NPEA 3PPLA 3LVLB 1SQQE 1NO4A 1IBJA 3CCVP 3FFHA 2Y0DA 3CMAP 5EAVA 3USFA 3DXVA 1SQXK 3QBOA 2OGUA 1RV3A 5BJ4A 3BCXA 2K88A 3FVUA 2V1PA 1JTHA 1KFMA 1SQBG 4ASVA 2HR3A 2V7QH 3HTKB 1HJBA 3WU2H 1C0NA 2FYUJ 4RO0A 2D66A 3K40A 1NTZK 2J58A 2E54A 1FAVA 5DJUB 1BJOA 1W2BO 1SQBJ 2P2UA 3Q3DA 1QEXA 1AY8A 1CQ7A 1WYTA 4R4MA 2XNDH 5APXA 3RL0D 5EQCA 2BCCG 2R2NA 5AVZB 3NX3A 3FXDA 3MUDC 1CW5A 1NOHA 2VMTA 3LVMA 5KLIC 1YI2P 1M4NA 3CCQP 1GTWA 2C0RA 2W8VA 3WX9A 2ZT9B 2FYUE 1GCKA 2WK7A 2KYVA 4ADEA 4LW4A 3HBXA 2FYNC 4DCKA 1YQ3C 2H8PD 1G7WA 2YKVA 1SF2A 1IFNA 5KJ7C 2JISA 1Y4IA 1JF9A 3B71A 1C7GA 3HL2A 3PJSK 1SQQK 2WWWA 4ZKPA 4ADDA 3JZLA 1AVOA 2OTJP 3N4RA 1HVVA 1DD3A 3D71A 5AVUB 1WSTA 2W83C 2D2CD 4IXOA 3D6ZA 1GL2B 1OHWA 3H1LJ 1IFJA 2K9JA 1VF5B 2DGMA 5AW7B 1CQ6A 2FFDA 4K05A 2X8UA 2W6JH 5EAAA 1ASEA 4A00A 3BCAA 2B9BA 3G7QA 3E1RA 4PV1D 3TK1A 1VJOA 1TARA 4K2BA 1ARTA 2KNCB 2VGUA 2P7JA 2ZT9D 3JWBA 3PRJA 3M5UA 2ZUKA 5CHXA 3NMDA 3V2QA 1BGYJ 4N6JA 1S5LH 4ZM4A 4CXQA 5CCGD 1MLZA 2BI3A 1IFIA 3I4JA 3H1LE 3RCHB 2FYUK 3TDKA 2W7IA 4YPCA 1BSHA 4BMKA 1R5SA 4OGQB 4WYAA 1KMIZ 1MFTA 2OKKA 3FQ8A 4HVKA 1DKAA 2IYPA 2JJHA 5C6UA 1SVFA 3A9XA 1M56D 2Q7CA 1VF5D 1JO5A 5M46A 1BGYE 2PFXA 3H1LD 1QVFO 2W7HA 1AJSB 1KQFB 1ZRTD 1GC0A 3P8MC 3C9IA 5G2QA 1W7MA 1N73A 4OH8B 1PP9J 4U3FJ 1QGKB 2WSCJ 2A45I 3L36A 1OW7A 4IW7A 1KQSO 3E7KA 3VYIA 1FE6A 1SQPD 1M0OA 2ZY3A 1HWTC 4UB8E 2OTKE 1SQVG 3FQ7A 2VMPA 1YHQP 2W7EA 1OW8A 1BGYD 4HF8A 1IVRA 1SQVJ 1NU1G 1DJUA 2G7JA 1SFCB 1C4KA 2JG2A 1XTCC 3LW5J 1KL2A 3PD6B 4OGQD 5KLVG 1S09A 1N8PA 5CCHC 1PP9E 2QVAA 4U3FE 4OBUA 4C46A 1NH4A 1MAPA 2FXMA 2Q5UA 5I92A 4BWNA 2NPSC 2OQQA 3RK2C 2GQNA 3ASAA 2VLFA 1LK9A 1AHYA 1RE3A 4WLHA 1AY4A 3B8EB 3A3YB 5CJ4A 2B89A 4YXWH 2M5AA 4WY4B 1DEEG 2OYHA 3HE5B 1VQ5P 2WMMA 3LV2A 4KJMA 2EPJA 3M0AA 2IBZE 1KZUB 3L35A 1AMQA 4Q6RA 4KHXA 2VMXA 4HJGH 1GU5A 3AEAC 1CZCA 3FWLA 3L70D 3H1HG 3R4TA 2R5CA 1URQA 4WVZA 1IFDA 1T3IA 4W80A 1JCDA 1JY3N 1HGZA 3JTXA 3LIEA 4PFNA 1Z56A 2IBZD 3L71D 2NRGA 1KC8Q 2A06E 3D6KA 2MKVA 3Q8NA 3KKIA 2ZSMA 1N86A 4WD2A 4Q75A 3Q5PA 1MKMA 1FOSF 3MC6C 4W91A 1AKAA 5M1BA 1YIYA 3GZDA 2XV5A 2RKLA 2IYOA 4GRXA 2Z20A 1W2EA 3RBFA 4GEBA 3JC22 2BWPA 1X0MA 2C44A 3AOWA 4MQQA 1ZN5A 3PJ0A 1DGDA 3TYYA 4WY4D 1DIPA 4A7PA 3NYUA 3QPGA 3NUIA 1OFCX 1IX7A 1BCCG 3M06A 2BIAA 3EI6A 3H1IE 1RQUA 1AKCA 2QJYC 2VMNA 4Y99C 3WZFA 2FKWB 1AJRA 4E3QA 2W7GA 1CL1A 1DJ9A 4EFFA 3OW2O 2FFDC 1BCCJ 3KGXA 1U08A 1JUNA 4QMAA 3H1JG 1Q90D 2AEJA 2CK3H 1VQ8P 5CBOA 2GM4A 1ORDA 3JSVC 3GBXA 4B98A 2YCNA 2E74C 2JKVA 1G2CB 3L44A 1D2FA 1EG5A 1PFIA 2WSSH 3H1ID 4YTPC 1NWQA 1DH3A 1M1KQ 3PDBA 3VP6A 5CCHD 3QM2A 1VQ9P 3CMEP 4GE7A 3FDDA 3CCMP 3ECDA 3B8XA 3SWFA 4R5FA 1AAWA 3SWKA 3B1EA 1E5EA 2E5YA 4XE5B 3HD7B 2LXCB 2W8UA 1Y9BA 3WUVA 2HOZA 1AHXA 1GW4A 5EIGB 1PZQA 1YIZA 2QLRA 2W7JA 1LC7A 2BKWA 1HGVA 1G7XA 2B87A 2Y0CA 3HTKA 1CZQA 2YKQA 2E7IA 2QM8A 1G1JA 1XEYA 3DR4A 1EZVG 4RKDA 3VOPA 1PPJG 3JW9A 1KYOI 2D7YA 3CCEP 2ZVNB 1W7NA 2L91A 4JF0A 3CXHE 3G3ZA 4JEVA 1UU2A 4HKZH 3SFEC 1OATA 1QL1A 1FJKA 3Q5RA 5E5IA 3AELA 4WLJA 3ITKA 1LS3A 1N8RQ 4CVQA 3QN6A 4DGTA 3FWNA 3FSLA 1KD1Q 4WB0A 4JF7A 2PP6A 3F0HA 3FZ8A 3H1KG 3HD7D 1RE4A 4JBZA 3PDXA 4A6RA 5BU5A 3L74D 1ZOYC 3CXHD 3OKSA 3WKSA 1KORA 1HUCA 1WYUA 2CPSA 4ITGA 4BA5A 1PIXA 3H6PA 2KLUA 4CBSA 3IAOA 4TN4A 1WMKA 3U59A 1RE3C 3DYDA 1ELUA 1T8ZA 3K7YA 1DD4A 3TGUG 1Q82Q 5HXXA 1M1JB 1LTGC 2IFMA 4OWFA 3BCCD 1LT9A 1LTBC 4IL6X 2XBNA 2E76B 4ZWMA 1GL2A 2OYHC 3N4SA 2CB1A 3UWCA 1OHYA 3HLMA 1DJEA 4B9BA 1I29A 4ZWVA 4JYBA 1WYVB 8AATA 2WVRA 4AZKA 2V0YA 3HUSB 1OHVA 2J59M 4W1XA 1BE3E 4ADBA 3M0DC 4R5ZA 1ASFA 1ZR4A 2Y9YA 3GZCA 2KNCA 2CY8A 3LVKA 1LP1B 3BV0A 4GSAA 3HQTA 1QGNA 1URQC 4WYFA 3SWYA 1YJSA 1M57D 3GG2A 1JNMA 2QJPC 2FM1A 1EC5A 2V4HA 3MD0A 5B66E 2P10A 1SFFA 3RCHA 3M9HA 5AVRB 1YITP 2PAJA 2WK9A 3KHUA 4BRYB 4Z1MH 1WKHA 1I41A 1BE3D 2Z61A 2FQ6A 3GZDC 3GETA 3CQ4A 1J1EC 1V72A 3BRVB 4B86A 1CZEA 3BN1A 1BJWA 3GR9A 2R0TA 3Q5SA 2IBZI 1AFOA 2W90A 2E76D 3I5TA 4XJLA 2ZFCA 3B5NB 1BKGA 1S06A 3HE4B 1JEKA 5HHYA 3MIWA 1M8OB 3N0LA 2M3BA 1TU3F 5AW3B 3CXHH 4JEYA 1VP4A 3VTPC 2W7LA 1FZEA 1K04A 4ZNCA 3GMAA 1SZKA 2O3JA 5FT6A 1PGQA 1FOSE 4JEWA 1QISA 1KV4A 2KB7P 3CWBG 2W7KA 3ZRPA 2B88A 3E9KA 4TMRA 2I1JA 4JPZB 4XAUA 2QA3A 2KZIA 4OT8A 4L76A 3MAFB 3CCSP 5JAYA 1SFCA 3I56P 1JG8A 2O01J 1DTYA 3PD6A 1D7UA 3A5TA 1JB0J 4LC1A 1OVUA 4DT0A 1AICA 4WYEA 2N1TD 3FZ7A 4ASWA 1Q2NA 1K8AQ 1X28A 2PGDA 3OP7A 2M0BA 3B5ND 5KAFH 2ZY2A 4K2MA 3HT4A 1NTZE 3NYSA 4LLHA 2IDBA 2YCTA 1J1DC 1GD9A 5K8BA 4MQRA 2JGTA 3R9AA 4P3MA 2PRRA 1T2KD 1FDMA 4D6TE 4DZOA 2E75C 4WBAA 3GSBA 1S08A 4A0GA 2BWNA 4E77A 4KAMA 1NGMB 3RBZA 1USEA 1NTZD 4EB7A 3E77A 3RL0B 1GU4A 3FTBA 3S4RA 5KTBA 2JJLA 4RIZA 4EU1A 3VOMA 3CX5E 1IJIA 1L0NE 5GTHE 1T6AA 2UWJE 3ASBA 5IWQA 4N0WA 3L75G 2ZP7A 4D6TD 1MZ9A 1YJ9P 1Z7DA 1L4AB 5AX8A 3RUYA 2YXQB 4GE4A 1YTZT 4PIWA 1ELQA 4XFJA 3SFDC 2W7MA 3L75J 5AVVB 3E2FA 1MGVA 4Y28J 5DJ1A 4F5MA 2WSEH 4I1LA 4UOYA 1N7SB 1T3UA 3B1CA 5GTIE 2H43A 1QX8A 1J2JB 3MEBA 3CX5D 3TQXA 3U1AA 3AEMC 1L0ND 3BS8A 3UAKA 1RF0A 2K9YA 2BI5A 5HDMA 3AE5C 4R8DA 3T97A 1GZLA 4KT0J 1AJYA 4IXSA 5E3KA 1KKJA 3F89A 3PIUA 2YMKA 3IN6A 1PMMA 3JCUE 5DX5A 3CXHI 1SQQD 1SZSA 2D2CB 4WXBA 4IFMA 3AV7A 1LT9C 2A45H 3MAUA 1S07A 4RITA 1VQPP 2W7DA 1GL2C 4ISYA 3VP8A 3RBLA 3ZRRA 4R4LA 3A8UX 4UHMA 2HODA 2O01N 1L4AD 4PV1B 2OYIB 2BCCJ 4RKCA 1FZCC 4RESB 1ZLLA 4F5IA 2MJZA 3G71P 1U7JA 1G2CA 2HPCA 2NMPA 4CPGA 1TPLA 1L0NK 1SPAA 1BJNA 3U1CA 1SQBE 3EFFK 3O6QB 3NTNA 1N7SD 1ZP0C 3BWOA 1JOCA 3FXEA 2AY1A 3GHGC 4UB6E 1AY5A 1GDTA 2TPLA 4BQ0A 2AEFA 3QWOC 2FXOA 3D70A 2VLHA 2WK8A 2FYUD 3G6EP 2J5UA 4LC3A 2AY9A 1M7LA 3HD7A 2W8WA 2JDIH 2BCCE 5AW0B 4ATPA 5B5EE 4WWIA 1SQBD 1ASGA 4LNLA 2WT7B 2VMUA 5EIGA 1C9CA 2E75D 4GOEA 1FZFA 2Q3IA 3COGA 5AVWB 5CJ0A 1LTIC 2AY8A 3AEFC 5EFWB 3NYTA 4A6UA 1KILC 4AZJA 4K35A 1FZGA 3B46A 5AW5B 3CX5H 3H32B 2FNUA 3F6TA 1GC2A 2R5DA 3EWKA 2EGYA 1EQ7A 1KYOE 5E79E 1SQPG 4M2KA 4R2NA 5KLIB 4PVFA 3E2ZA 5AW2B 3EI7A 1H88A 3CD6P 1N31A 3ZRQA 4W7YA 5APVA 1O69A 5EUNA 1O4SA 2FYNB 2KS1B 1JS6A 4LNJA 1SQBK 1MV8A 5GTIH 4IOIH 2YKXA 1KTMA 1VEFA 2VMZA 2KLVA 2CH2A 1LWUA 2ZY4A 1S5LX 1KYOD 3N7NA 1FDOA 1ARSA 4AQRD 1YIJP 2LKMA 4WYCA 3JCUH 4WP0A 1UU0A 1LNQA 4ZKUA 1ASDA 4WBTA 5FT4A 1JY2O 2POHA 3ELPA 3Q1MA 4F5JA 4JYCA 3KQGA 2AXCA 2YIUC 4JF1A 1NTMG 3QH9A 1LTTC 1JM0A 4OC9A 3TFTA 1WYVA 1NTMJ 5AVTB 3EI9A 3HVYA 4K2IA 3HUSA 5TF5A 4H63Q 3E6GA 3KE3A 4TLFA 2EZ2A 2XZRA 3L70G 4Q31A 5KJ7D 3VMZA 1LP1A 4UB6H 1NU1J 1QIRA 2IZ0A 3GLMA 5G0AA 2QMAA 1KKPA 2C81A 1S3JA 4M2JA 5KLVJ 3CC2P 1PL5A 1KILE 1QZ9A 3L71G 2Z9UA 3P1TA 1D7RA 5G2PA 4IYOB 2FY8A 5B5EH 5EUDA 4Y0DA 4BRYA 2QB2A 1AMRA 4XJOA 4JEXA 1SQVE 2L5GB 2VMQA 4M3LA 1P84E 4UQVA 1RF0C 1IAYA 1PP9D 4U3FD 3OA7A 1M0QA 1U7MA 2K37A 4AOAA 1NU1E 3CC4P 3B5NA 3AE2C 1KILD 2Y9ZA 2VGVA 3I5CA 1GW3A 2Q9IA 3CX5I 1JMBA 5KLVE 4F4EA 1OVRA 3BCBA 3H9XA 1KYOH 4I7ZB 2P58A 4IFFA 5E79H 1TASA 4J5UA 1PFFA 4DBCA 2Y0EA 3ABVC 1SQVD 4RKUJ 4A0HA 2R44A 3LIDA 1P84D 1X79B 4PFFA 2KUBA 1SZUA 3FZ6A 4ADCA 3A2AA 4F5FA 3O8ZA 3H1HJ 5DB5A 3WUTA 2XNXA 3WKRA 2CJGA 3DODA 3RL0g 4XEWA 2QA4P 3PGYA 3FFRA 2NPSB 2Z5IA 1DX7A 1V2FA 4ATQA 1GK6A 1ASNA 1OXOA 2W8ZA 3V2NA 1HTLC 2ITAA 3VK2A 4F5HA 3DXWA 3CQ6A 3CC7P 5G09A 4WB4A 3HRNA 2A06D 2ZXXA 2E5TA 4UHOA 1X22A 1M0NA 1JTHB 1ZC9A 1NTMK 2YCPA 1KMJA 1SQVK 3W1HA 2GA1A 2D5YA 2XKMA 4UB8H 2Z9WA 4IL6E 5CMZA 3CCUP 1RY3A 2BI1A 4MQPA 2JWDA 3G9RA 1PGJA 3NUBA 1BJOB 1NKNA 3FX0A 5H2FE 1NU1K 3L73G 1IX6A 5KLVK 1R5LA 2BEQD 2QM7A 1WRGA 2IZ1A 2YHKA 3H1JJ 4PJ0E 5DJTB 4C7NB 2OGEA 2AY7A 3IHJA 1EJIA 2WSCH 3KZIE 2DR1A 2Z1YA 2HORA 3D6YA 1V2DA 1KB9E 2PB2A 2NPSD 5G4IA 3RK2D 2VYCA 3MP7B 1QJ5A 2GMSA 1U57A 1ZXGA 1BCCE 4RLGA 3WCOA 1NJIQ 3RK3C 1X29A 1PGPA 2VGSA 3CCJP 4LNMA 2WTYA 3EI5A 1EQBA 3W1JA 3WUUA 5C39A 2OQXA 3EUCA 2W7FA 1P84H 2AATA 3L74G 3LW5H 2BYJA 1LWUC 3H1JE 4E3RA 1USDA 4XQ2A 4GIFA 3DR7A 2ZY5A 4J8LA 1KB9D 1Y8AA 1B4XA 2EZ1A 2CSTA 3T32A 3SSUA 1ZV8A 1X2AA 2VIAA 1G4VA 1IO4A 4U2HA 4EI2A 1BCCD 4XK1A 2QJYB 2P1JA 1N73C 1YNUA 4Y99B 3A7OA 2K9JB 2C9LY 2Q7WA 4H44C 1AQTA 1VDFA 1HF9A 5AVQB 5AW1B 2FFDB 2FBWC 3F5HA 3AE7C 3BCCG 3HDOA 1DGEA 4A72A 1IFMA 2E74B 4A6TA 4QGRA 2BHXA 2RH0A 3CAIA 2QG4A 5KKZC 3KPEA 2PO3A 2M8RA 4XA4A 3EZSA 1CL2A
chains in the Genus database with same CATH topology
5APQA 1FG3A 1TOGA 2OKJA 3G0TA 5CCGA 4DOJA 4JEZA 1S0AA 3NFQA 2C7TA 1JY3O 3IFMA 2WPQA 2AY2A 4GE9A 2WB6A 3TNUB 1A02F 3R2PA 3EI8A 4WYDA 1DEBA 1LW5A 2WT7A 3FD0A 4A0RA 2JJFA 3ISLA 1B5OA 1AHFA 4W1WA 1KMKA 3FKDA 1T3JA 2YNYA 1AQ5A 3KDPB 2FKIA 1N2DC 3B1DA 1RF1B 3AENB 3H32A 3QHXA 1ZODA 2VRSA 4BA4A 2YRRA 3MUDA 4RJYA 4ZSYA 1X9VA 1RVYA 1IX8A 3NTJA 4IFDK 1W7LA 4IXZA 2D64A 3M9BA 2KFPA 4ZAHA 3I16A 3RQ1A 4O9BA 2VGZA 3OJAB 5AW9B 2N1TB 3LWSA 2O1JA 1ASCA 3DRDA 3NXSA 1AJSA 4MKJA 1HH0A 3EZ1A 2R5EA 1GC4A 2OYHB 1LTJB 2W6BA 2JEEA 1KL1A 2R3CA 2QB3A 1ASAA 3P6KA 1GEWA 2QSRA 2ORDA 1SVVA 4ZLVA 2EH6A 5APSA 4OMAA 4RJ0A 1URQB 1YTZI 3GWPA 2I1KA 3BWNA 4AYCA 3VMXA 3ZZJA 1LGHB 1QL2A 3P32A 1IC2A 5AW8B 3TSIA 1TOIA 2X5DA 5EFSA 4Y0IA 2QBTA 2CTZA 4P7YA 2HLOA 3BB8A 3A9ZA 4F5GA 3P8CE 2DGKA 3W1IA 4WY4A 2YKYA 3HE5A 2R32A 1AHGA 2E42A 1FZBA 2VMVA 1C7NA 2WKAA 1URQD 1SLQA 1H0CA 1MDXA 3PP5A 2O7CA 2BWOA 3QI6A 4AH3A 2VMSA 5J8QA 3TFUA 1DFOA 1Z3ZA 1ASLA 1N2TA 2C9NY 1RE4C 4I8AA 3L37A 5CCHA 3BC8A 3VK3A 1FBMA 1TOJA 2NPSA 2DKJA 3MADA 1JY3P 5APYA 1J1DB 1MLYA 2HYNA 1NAFA 1ASMA 3ATHA 3H7FA 3A2BA 2DGLA 2X3LA 1ASBA 4XJPA 3V5BA 1A02J 3VAXA 1NKZB 1E5FA 2BIEA 3CLQA 3NU8A 2W6AA 3V4WA 4A0FA 2HFED 4N78E 3MTUE 2OARA 1AIAA 3A9YA 3BRTB 1CJ0A 5G4JA 5BU8B 4C7NA 3FQAA 3KYQA 2HUFA 1BQDA 2HOXA 3AEOA 1J32A 4WB0B 1LW4A 2VI8A 2VMWA 1H8AA 2VIBA 1NHLA 4N78D 2EYQA 2YMYA 4IX8A 3MC6A 4LW2A 1W23A 5BVZA 1CI6B 1YYCA 1WYUB 3G8MA 4UHNA 1UKJA 3FVSA 2HG5D 2O01H 1I48A 2VGTA 2YKPA 3AEPA 1BQAA 3FCRA 2E7JA 4ITXA 1X8YA 1IK9A 1CS1A 2XDJA 2A1VA 3VK4A 1LT9B 1AMAA 1XI9A 2YOBA 2BIGA 2YKOA 2HZPA 1WKGA 1FZCB 2Z5HA 4AO4A 1OXPA 2CFBA 2CPBA 2G6WA 2JJEA 1YAAA 2N9BA 1J04A 1M32A 1ZOBA 3TATA 3NDNA 2VMRA 1SFCC 1GDEA 3V2PA 1LTSC 3BWNC 1B8GA 2OATA 3GHGB 4ZASA 2WPSA 2HOYA 2HUIA 1D7SA 1AMSA 4MY5A 3AEJA 4DQ6A 1ARHA 4O6ZA 3FVXA 2C0XA 2GUSA 4C7RA 4H51A 1OWAA 1QJ3A 3AOVA 2PB0A 3FDBA 2AEUA 5DJ9A 1GL2D 2AY3A 1M1JA 3EQ2A 3TNUA 4W5KA 3DC1A 4WY4C 3N5MA 1KILB 1UU1A 2E7UA 4OTLA 3LVJA 1D7VA 2Z1ZA 1CL2A 1S9KE 3UE8A 1RF1A 3AENA 3WY7A 1FG7A 3P7KA 2D63A 1C7OA 4MSOA 1GK4A 2CJDA 5M4BA 2BASA 2DOUA 2ZXEB 2GB3A 2W8TA 1BS0A 2IPPA 3DU4A 3JWAA 2ZSLA 1S9KD 1OXZA 1GC3A 1JMMA 2O1BA 1IJDB 2ZC0A 5E4ZA 1O62A 3NRAA 9AATA 3L4FA 2N1TA 1MFZA 3E1IA 2WPRA 4U1TA 1SQPK 3HE4A 1VPCA 4RM1A 1N7LA 3N75A 1MDZA 4ZDLA 2YO2A 1CQ8A 3IR9A 2R5BA 1LTJA 3RI6A 5D5SA 5EUEA 2HUUA 4KYOA 3ZZKA 3M0DA 1SFCD 2WITA 3MAFA 3RK2B 1GEYA 1TATA 3QGUA 3EIBA 1FZAA 1B9IA 3M9QA 2HP2A 4NOGA 1GBNA 2BI9A 2AY4A 3F9TA 3L8AA 3LG0A 1BJ4A 1FC4A 2C0WA 3HD7C 1G4XA 2VI9A 1FJPA 1V2EA 5AW4B 1AAMA 1SP4A 2ZJGA 2D65A 3PAAA 1WYTB 2AY6A 1LC5A 3LY1A 4I2LC 1XTGB 4WXFA 1PG8A 1YJZA 2KOGA 2BYLA 3WGBA 2H7HA 2HODB 4BHDA 1PMOA 1L4AA 2HPCB 2FNIA 4KXKA 2JJGA 5AVYB 2KP8A 1LTAC 1O61A 1FU1A 5AVXB 3II0A 1N7SA 3AEJC 1AKBA 2X5FA 4M2MA 1MDOA 4Y0HA 1JY2P 4E1OA 2W27A 3CI9A 4WYGA 1KFNA 3BASA 3WCNA 3N4XA 4FL0A 1M1JC 4FFCA 1MAQA 3VP9A 3WMM0 3EFGA 4AO9A 2IX7C 4EIJA 1AIBA 5APTA 3HUSC 2OYIA 1TOKA 3GJUA 1RF1C 3E2ZB 4W1VA 2CH1A 2FYZA 4ZDOA 3WLXA 2O1KA 2WZ7A 4EOTA 3RK3B 1AHEA 3CBFA 4GDYA 1JS3A 1ARIA 2Z9XA 4Q76A 1E5WA 2D61A 1G1IA 2YKUA 3V4QA 1LWUB 1H89A 1AX4A 2W8JA 5FT8A 2VMOA 3AEMA 1CI6A 5APWA 1KQLA 4LGDE 4OBVA 5APUA 1BW0A 1LC8A 3MKJA 3FRKA 2N1TC 1N73B 3B5NC 2FYFA 1RVUA 4CXRA 2VMYA 4HH2A 1W3UA 4W8IA 2GSAA 1T2KC 1LTJC 2YO3A 4GT1A 1QITA 3RK3D 1GEXA 1FZCA 1YOOA 3BATA 2GUVA 1I43A 2F8JA 1M7YA 4ZDPA 3MBBA 3M91A 5M4DA 2E43A 3MGNA 2Z9VA 1M0PA 5KJ7A 4WXGA 2A45G 3GHGA 3AATA 4RAEA 2XU6A 4AUWA 4GKGA 2AY5A 4ZSWA 1MUUA 3ACZA 3HMUA 1ECXA 4EB5A 2VGWA 3VMYA 1B9HA 3EIAA 4ZM3A 1CSBA 2IFNA 3II6A 1GD2E 3V2RA 2HP1A 1B5PA 4F5LA 5D95A 1KILA 4EMYA 2R5CB 4CBRA 3RL0C 1NTKK 2XH1A 5F8VA 1JCCA 3OAKA 2OGAA 1BT4A 3VN0A 2DKBA 2Z4EA 1L4AC 2KSJA 2FN6A 1ARGA 4OCAA 1H1CA 1J1EB 4HYTB 3ELEA 5F9SA 4IYOA 1M6SA 2CANA 3DZZA 1L0LK 3UIAA 4OYTA 2BI2A 1N7SC 2P67A 2EO5A 3NU7A 3E2YA 1RV4A 3K28A 2WSFH 2D7ZA 5AVSB 1P3WA 1ZR2A 4I6MC 7AATA 3KGWA 5FT5A 4XJMA 4N3YB 2AEVA 3TCMA 3CQ5A 2RFVA 1WT6A 3P8CD 4IY7A 1YJYA 2CINA 2GMUA 4W7ZA 1HBWA 3CL3D 5AW6B 4F5KA 3WGCA 2OYIC 3PDBB 5BJ3A 1IAXA 2O0RA 3PA9A 1LKCA 2YRIA 5M49A 1IUGA 3BVHA 1TOEA 4L0OA 5CCGC 3NNKA 1JY2N 4MKKA 2ZYJA 3PPLA 3LVLB 1NO4A 1IBJA 3FFHA 5EAVA 3USFA 3DXVA 1SQXK 3QBOA 1RV3A 5BJ4A 3BCXA 3FVUA 2V1PA 1JTHA 1KFMA 3HTKB 1HJBA 1C0NA 2D66A 3K40A 1NTZK 2J58A 2E54A 1FAVA 1BJOA 2P2UA 1AY8A 1CQ7A 1WYTA 5APXA 3RL0D 5EQCA 2R2NA 3NX3A 5AVZB 2VMTA 1CW5A 1NOHA 3LVMA 1M4NA 1GTWA 2C0RA 2W8VA 3WX9A 1GCKA 2WK7A 2KYVA 4ADEA 4LW4A 3HBXA 2H8PD 1G7WA 2YKVA 1SF2A 1IFNA 5KJ7C 2JISA 1Y4IA 1JF9A 3HL2A 1C7GA 1SQQK 2WWWA 4ZKPA 4ADDA 3JZLA 3N4RA 1HVVA 5AVUB 1WSTA 4IXOA 1GL2B 1OHWA 1IFJA 2DGMA 5AW7B 1CQ6A 2FFDA 4K05A 2X8UA 5EAAA 1ASEA 4A00A 3BCAA 3G7QA 3TK1A 1VJOA 1TARA 4K2BA 1ARTA 2VGUA 3JWBA 2P7JA 3M5UA 2ZUKA 5CHXA 3NMDA 3V2QA 4N6JA 4ZM4A 4CXQA 5CCGD 1MLZA 2BI3A 1IFIA 3I4JA 3RCHB 2FYUK 2W7IA 4BMKA 4WYAA 2OKKA 3FQ8A 4HVKA 1DKAA 2JJHA 5C6UA 1SVFA 3A9XA 2Q7CA 1JO5A 5M46A 2W7HA 1AJSB 1GC0A 3P8MC 3C9IA 5G2QA 1W7MA 4OH8B 1N73A 2A45I 3L36A 4IW7A 3VYIA 1M0OA 2ZY3A 1HWTC 3FQ7A 2VMPA 2W7EA 4HF8A 1IVRA 1DJUA 2G7JA 1SFCB 1C4KA 2JG2A 1XTCC 1KL2A 3PD6B 1S09A 1N8PA 5CCHC 4OBUA 4C46A 1NH4A 1MAPA 2FXMA 2Q5UA 5I92A 2NPSC 3RK2C 2GQNA 3ASAA 2VLFA 1LK9A 1AHYA 1RE3A 4WLHA 1AY4A 3B8EB 3A3YB 5CJ4A 4WY4B 2OYHA 3HE5B 3LV2A 2EPJA 3M0AA 1KZUB 3L35A 1AMQA 4Q6RA 4KHXA 2VMXA 1GU5A 1CZCA 3R4TA 2R5CA 1URQA 1IFDA 1T3IA 4W80A 1JCDA 1JY3N 1HGZA 3JTXA 3LIEA 4PFNA 1Z56A 3D6KA 3Q8NA 3KKIA 2ZSMA 1N86A 4WD2A 4Q75A 1FOSF 3MC6C 4W91A 1AKAA 1YIYA 3GZDA 2XV5A 4GRXA 2Z20A 1W2EA 3RBFA 4GEBA 2BWPA 1X0MA 2C44A 3AOWA 4MQQA 1ZN5A 3PJ0A 1DGDA 3TYYA 4WY4D 3NYUA 3QPGA 3NUIA 1IX7A 3M06A 2BIAA 3EI6A 1AKCA 2VMNA 4Y99C 3WZFA 2FKWB 1AJRA 4E3QA 2W7GA 1CL1A 1DJ9A 4EFFA 2FFDC 3KGXA 1U08A 1JUNA 1ORDA 2GM4A 3GBXA 4B98A 2YCNA 1G2CB 3L44A 1D2FA 1EG5A 1PFIA 1NWQA 1DH3A 3PDBA 3VP6A 5CCHD 3QM2A 4GE7A 3FDDA 3ECDA 3B8XA 3SWFA 4R5FA 1AAWA 3B1EA 1E5EA 4XE5B 3HD7B 2W8UA 2HOZA 1AHXA 1GW4A 5EIGB 1YIZA 2QLRA 2W7JA 1LC7A 2BKWA 1HGVA 1G7XA 3HTKA 1CZQA 2YKQA 2E7IA 2QM8A 1G1JA 1XEYA 3DR4A 4RKDA 3VOPA 3JW9A 2D7YA 1W7NA 4JF0A 3G3ZA 4JEVA 1UU2A 1OATA 1QL1A 1FJKA 5E5IA 3AELA 4WLJA 1LS3A 4CVQA 3QN6A 4DGTA 3FSLA 4WB0A 4JF7A 2PP6A 3F0HA 3FZ8A 3HD7D 1RE4A 3PDXA 4A6RA 5BU5A 3OKSA 3WKSA 1HUCA 1WYUA 2CPSA 4ITGA 4BA5A 3H6PA 4CBSA 4TN4A 3U59A 1RE3C 3DYDA 1ELUA 1T8ZA 3K7YA 5HXXA 1M1JB 1LTGC 2IFMA 1LT9A 1LTBC 2XBNA 4ZWMA 1GL2A 2OYHC 3N4SA 2CB1A 3UWCA 1OHYA 3HLMA 1DJEA 4B9BA 1I29A 4ZWVA 4JYBA 1WYVB 8AATA 4AZKA 2V0YA 3HUSB 1OHVA 2J59M 4W1XA 4ADBA 3M0DC 4R5ZA 1ASFA 1ZR4A 3GZCA 2CY8A 3LVKA 3BV0A 4GSAA 3HQTA 1QGNA 1URQC 4WYFA 3SWYA 1YJSA 1JNMA 2FM1A 3MD0A 1SFFA 3RCHA 3M9HA 5AVRB 2PAJA 2WK9A 1WKHA 1I41A 2Z61A 2FQ6A 3GZDC 3GETA 3CQ4A 1J1EC 1V72A 3BN1A 3BRVB 3GR9A 4B86A 1BJWA 1CZEA 2R0TA 1AFOA 3I5TA 4XJLA 2ZFCA 3B5NB 1BKGA 1S06A 3HE4B 5HHYA 3MIWA 3N0LA 2M3BA 5AW3B 4JEYA 1VP4A 3VTPC 2W7LA 1FZEA 1SZKA 5FT6A 1FOSE 4JEWA 1QISA 2KB7P 2W7KA 3ZRPA 3E9KA 4TMRA 2I1JA 4XAUA 2QA3A 4OT8A 3MAFB 5JAYA 1SFCA 1JG8A 1DTYA 3PD6A 1D7UA 3A5TA 4LC1A 1AICA 4WYEA 2N1TD 3FZ7A 1X28A 3OP7A 3B5ND 2ZY2A 4K2MA 3HT4A 3NYSA 4LLHA 2YCTA 1J1DC 1GD9A 5K8BA 4MQRA 2JGTA 3R9AA 4P3MA 1T2KD 1FDMA 4DZOA 4WBAA 3GSBA 1S08A 4A0GA 2BWNA 4E77A 4KAMA 4EB7A 3E77A 3RL0B 1GU4A 3FTBA 5KTBA 2JJLA 4RIZA 4EU1A 3VOMA 1IJIA 3ASBA 5IWQA 4N0WA 2ZP7A 1MZ9A 1Z7DA 1L4AB 5AX8A 3RUYA 4GE4A 1YTZT 4PIWA 1ELQA 2W7MA 5AVVB 3E2FA 1MGVA 5DJ1A 4F5MA 2WSEH 4I1LA 4UOYA 1N7SB 1T3UA 3B1CA 2H43A 1J2JB 3MEBA 3TQXA 3U1AA 3AEMC 3BS8A 3UAKA 1RF0A 2BI5A 5HDMA 4R8DA 3T97A 1GZLA 4IXSA 5E3KA 1KKJA 3PIUA 1PMMA 5DX5A 1SZSA 4WXBA 4IFMA 3AV7A 1LT9C 2A45H 3MAUA 1S07A 4RITA 2W7DA 1GL2C 4ISYA 3VP8A 3RBLA 3ZRRA 3A8UX 4UHMA 2HODA 1L4AD 2OYIB 4RKCA 1FZCC 4RESB 1ZLLA 4F5IA 2MJZA 1G2CA 2HPCA 2NMPA 1TPLA 1L0NK 1SPAA 1BJNA 3U1CA 3NTNA 1N7SD 3BWOA 1JOCA 2AY1A 3GHGC 1AY5A 1GDTA 2TPLA 4BQ0A 2VLHA 2WK8A 4LC3A 2AY9A 1M7LA 3HD7A 2W8WA 5AW0B 4ATPA 1ASGA 4LNLA 2WT7B 2VMUA 5EIGA 1C9CA 1FZFA 2Q3IA 3COGA 5AVWB 5CJ0A 1LTIC 2AY8A 3NYTA 4A6UA 1KILC 4AZJA 1FZGA 3B46A 5AW5B 2FNUA 3H32B 3F6TA 1GC2A 2R5DA 2EGYA 1EQ7A 4M2KA 4R2NA 4PVFA 3E2ZA 5AW2B 3EI7A 1H88A 1N31A 3ZRQA 4W7YA 5APVA 1O69A 5EUNA 1O4SA 1JS6A 4LNJA 1SQBK 1MV8A 2YKXA 1VEFA 2VMZA 2KLVA 2CH2A 1LWUA 2ZY4A 3N7NA 1ARSA 4AQRD 2LKMA 4WYCA 4WP0A 1UU0A 4ZKUA 1ASDA 4WBTA 5FT4A 1JY2O 2POHA 3ELPA 4F5JA 4JYCA 3KQGA 4JF1A 1LTTC 4OC9A 3TFTA 1WYVA 3EI9A 5AVTB 3HVYA 4K2IA 5TF5A 3HUSA 4H63Q 3E6GA 3KE3A 2EZ2A 2XZRA 4Q31A 5KJ7D 3VMZA 1QIRA 5G0AA 2QMAA 1KKPA 2C81A 4M2JA 1QZ9A 2Z9UA 3P1TA 1D7RA 5G2PA 4IYOB 5EUDA 4Y0DA 2QB2A 1AMRA 4XJOA 4JEXA 2L5GB 2VMQA 4M3LA 4UQVA 1RF0C 1IAYA 3OA7A 1M0QA 4AOAA 3B5NA 1KILD 2VGVA 3I5CA 1GW3A 2Q9IA 4F4EA 3BCBA 3H9XA 4IFFA 1TASA 4J5UA 1PFFA 4DBCA 4A0HA 3LIDA 1X79B 4PFFA 1SZUA 3FZ6A 4ADCA 3A2AA 4F5FA 3O8ZA 5DB5A 2XNXA 3WKRA 2CJGA 3DODA 4XEWA 3PGYA 3FFRA 2NPSB 2Z5IA 1DX7A 1V2FA 4ATQA 1GK6A 1ASNA 1OXOA 3V2NA 1HTLC 3VK2A 4F5HA 3DXWA 3CQ6A 5G09A 4WB4A 3HRNA 4UHOA 1ZC9A 1M0NA 1JTHB 2YCPA 1NTMK 1KMJA 1SQVK 3W1HA 2D5YA 2XKMA 2Z9WA 5CMZA 1RY3A 2BI1A 4MQPA 3NUBA 1BJOB 1NKNA 1NU1K 1IX6A 5KLVK 2QM7A 1WRGA 2YHKA 4C7NB 2OGEA 3IHJA 2AY7A 1EJIA 2WSCH 2Z1YA 2DR1A 2HORA 1V2DA 2PB2A 2NPSD 5G4IA 3RK2D 2VYCA 1QJ5A 2GMSA 4RLGA 3WCOA 3RK3C 1X29A 2VGSA 4LNMA 2WTYA 3EI5A 1EQBA 3W1JA 2OQXA 3EUCA 2W7FA 2AATA 3LW5H 2BYJA 1LWUC 4E3RA 4XQ2A 4GIFA 3DR7A 2ZY5A 4J8LA 1B4XA 3T32A 2EZ1A 2CSTA 1ZV8A 1X2AA 2VIAA 1G4VA 1IO4A 4U2HA 4XK1A 2P1JA 1N73C 1YNUA 4Y99B 3A7OA 2C9LY 2Q7WA 1VDFA 5AVQB 5AW1B 2FFDB 3HDOA 1DGEA 4A72A 1IFMA 4A6TA 4QGRA 2BHXA 3CAIA 3KPEA 2PO3A 2M8RA 4XA4A 3EZSA 2CJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAS A;  3OJA B;  5BU5 A;  3N4X A;  5BVZ A;  3N7N A;  3HRN A;  1IC2 A;  3U1C A;  3N4S A;  5BU8 B;  4I1L A;  5KTB A;  3VP8 A;  4GIF A;  3U1A A;  3C9I A;  4ZKU A;  2POH A;  4ZKP A;  3BAT A;  3U59 A;  3VP9 A;  4N3Y B;  3N4R A;  1NKN A;  4N78 D;  1X79 B;  1WT6 A;  4O9B A;  3P8C D;  2JEE A;  2FXM A; 
#chains in the Genus database with same CATH topology
 5APQ A;  1FG3 A;  1TOG A;  4H0L C;  1QLE D;  2OKJ A;  3G0T A;  5CCG A;  3AE4 C;  4DOJ A;  3H1K J;  1K9M Q;  2WSF J;  1NTK G;  4JEZ A;  1EZV E;  1PPJ E;  1S0A A;  3NFQ A;  2C7T A;  1JY3 O;  3IFM A;  4ZMD A;  2WPQ A;  2AY2 A;  1NTK J;  4IL6 H;  4GE9 A;  4OVN F;  3PH0 A;  2I8D A;  2WB6 A;  3TNU B;  1A02 F;  3R2P A;  5H2F H;  3EI8 A;  4WYD A;  1DEB A;  1LW5 A;  2WT7 A;  4NPD A;  3FD0 A;  4A0R A;  2JJF A;  3ISL A;  1L0L G;  3TGU J;  1B5O A;  1AHF A;  4W1W A;  1KMK A;  2E74 D;  3FKD A;  1T3J A;  2YNY A;  1AQ5 A;  3KDP B;  2FKI A;  1N2D C;  3B1D A;  4PJ0 H;  3H1K E;  4EDF A;  1RF1 B;  1L0L J;  3AEN B;  2Q1K A;  3CCL P;  3KZI H;  1KB9 H;  3H32 A;  3QHX A;  1ZOD A;  2VRS A;  3RGU A;  4BA4 A;  2YRR A;  3MUD A;  4RJY A;  4ZSY A;  3FGA D;  2JP3 A;  1X9V A;  5TIS E;  1RVY A;  1IX8 A;  3NTJ A;  4IFD K;  1W7L A;  4IXZ A;  2D64 A;  1OX3 A;  3TGU E;  3M9B A;  2KFP A;  1P84 I;  4ZAH A;  2V7Q J;  3I16 A;  1EDK A;  2K1A A;  3RQ1 A;  4O9B A;  2VGZ A;  3OJA B;  5AW9 B;  2N1T B;  3LWS A;  2O1J A;  5L8R J;  1ASC A;  3DRD A;  3NXS A;  1AJS A;  2QJK B;  2ZVO B;  4MKJ A;  2M5A B;  1HH0 A;  3EZ1 A;  2R5E A;  1GC4 A;  2OYH B;  4EYY Q;  2WQY C;  1LTJ B;  1SQX G;  2W6B A;  2JEE A;  4PD4 I;  3PLN A;  1KL1 A;  2R3C A;  3C8V A;  2QB3 A;  1ASA A;  2N9Y B;  3P6K A;  1LJ2 A;  2NZ2 A;  1GEW A;  1SQX J;  2QSR A;  2ORD A;  1SVV A;  4ZLV A;  2EH6 A;  1NTZ G;  3S9O A;  2ZJS E;  5APS A;  4OMA A;  3CWB J;  4H0L D;  4H13 C;  4RJ0 A;  1URQ B;  3L72 G;  1YTZ I;  3GWP A;  2I1K A;  3BWN A;  4AYC A;  3VMX A;  3ZZJ A;  2H89 C;  1LGH B;  1QL2 A;  3L72 J;  3P32 A;  1IC2 A;  1QVG O;  5AW8 B;  2OTL P;  3TSI A;  1TOI A;  2X5D A;  2KI7 B;  1RH5 B;  5EFS A;  3B4S A;  4Y0I A;  2QBT A;  2CTZ A;  4P7Y A;  2HLO A;  3BB8 A;  2QIW A;  3A9Z A;  3CWB E;  4F5G A;  3P8C E;  2DGK A;  3W1I A;  2ZYA A;  4WY4 A;  2YKY A;  3HE5 A;  2R32 A;  3H25 A;  1AHG A;  1SQQ G;  2E42 A;  1FZB A;  1KB9 I;  4JQ0 D;  2D2C C;  2VMV A;  1C7N A;  1ZME C;  2WKA A;  1URQ D;  1ZW0 A;  1SLQ A;  1H0C A;  1MDX A;  3PP5 A;  5B66 H;  2O7C A;  1KQG B;  2BWO A;  3MZW B;  3QI6 A;  4AH3 A;  1AVY A;  2VMS A;  5J8Q A;  2LXB A;  4PV1 C;  3TFU A;  1DFO A;  1Z3Z A;  1ASL A;  1N2T A;  2ZT9 C;  2C9N Y;  1RE4 C;  4I8A A;  3L37 A;  5K5G B;  5CCH A;  1EDJ A;  3BC8 A;  3AEG C;  3VK3 A;  1FBM A;  1TOJ A;  2NPS A;  2DKJ A;  3MAD A;  1JY3 P;  1IK7 A;  5APY A;  1J1D B;  1MLY A;  2HYN A;  1NAF A;  3MHV A;  1ASM A;  3ATH A;  3A2B A;  3H7F A;  2FYU G;  2DGL A;  2AXT E;  1UIX A;  2B87 B;  2X3L A;  1ASB A;  4XJP A;  3L75 E;  3V5B A;  1S72 P;  2E75 B;  2DW3 A;  1A02 J;  3VAX A;  1NKZ B;  3AEB C;  1E5F A;  2BIE A;  1VF5 C;  3CLQ A;  3NU8 A;  2W6A A;  3V4W A;  4A0F A;  2HFE D;  4N78 E;  1VQO P;  3AEC C;  3MTU E;  5TJH A;  2OAR A;  1AIA A;  4H13 D;  3A9Y A;  3BRT B;  1CJ0 A;  5G4J A;  5BU8 B;  1OIP A;  4C7N A;  3FQA A;  3KYQ A;  1AV1 A;  2HUF A;  1EZV I;  1VQL P;  3L75 D;  1GMJ A;  1BQD A;  3AE9 C;  1H0T B;  2WPV B;  2HOX A;  3AEO A;  1J32 A;  4WB0 B;  1LW4 A;  2VI8 A;  2VMW A;  1H8A A;  2VIB A;  1NHL A;  4N78 D;  2EYQ A;  2YMY A;  1W5C E;  4IX8 A;  3MC6 A;  4LW2 A;  1W23 A;  5BVZ A;  4OGQ C;  3S1K A;  1CI6 B;  1YYC A;  1WYU B;  3G8M A;  4UHN A;  1UKJ A;  3FVS A;  2HG5 D;  3GW6 A;  2O01 H;  1IFP A;  1I48 A;  2VGT A;  2YKP A;  3H1L G;  4BXL A;  3AEP A;  1BQA A;  3FCR A;  2E7J A;  4ITX A;  1X8Y A;  1IK9 A;  4U7J A;  1CS1 A;  2Q6Q A;  2XDJ A;  2A1V A;  3VK4 A;  2KIK A;  1LT9 B;  1AMA A;  5GTH H;  1XI9 A;  2BCC D;  2YOB A;  2BIG A;  2YKO A;  2HZP A;  1RQV A;  1OMI A;  2K3R A;  1WKG A;  1HJ0 A;  1FZC B;  2ZAE B;  2Z5H A;  4AO4 A;  1K05 A;  1OXP A;  1BGY G;  2CFB A;  2CPB A;  1SQP J;  2G6W A;  2JJE A;  1YAA A;  2N9B A;  1J04 A;  1M32 A;  3AEE C;  1ZOB A;  3A0B E;  3TAT A;  3NDN A;  2VMR A;  1SFC C;  1GDE A;  3V2P A;  1LTS C;  3PHL A;  1B8G A;  2OAT A;  3GHG B;  3BWN C;  4ZAS A;  2WPS A;  2HOY A;  2HUI A;  1D7S A;  1AMS A;  4MY5 A;  3AEJ A;  1X0T A;  4DQ6 A;  1ARH A;  1ZRT E;  4O6Z A;  3FVX A;  2C0X A;  2GUS A;  2Q3E A;  1SS1 A;  1PV3 A;  4C7R A;  3TF5 A;  1NAY A;  4H51 A;  1OWA A;  2AXT H;  1QJ3 A;  3AOV A;  3G4S P;  2PB0 A;  3FDB A;  1SQP E;  2AEU A;  5DJ9 A;  1GL2 D;  1R8E A;  1VQ7 P;  2AY3 A;  1M1J A;  3EQ2 A;  3TNU A;  1PP9 G;  4U3F G;  4W5K A;  3DC1 A;  1VQK P;  1NYH A;  2YXR B;  4WY4 C;  3V6I A;  3N5M A;  2QE7 H;  1KIL B;  3KXD A;  2QSI A;  1EXI A;  1UU1 A;  2E7U A;  4OTL A;  3LVJ A;  1D7V A;  2Z1Z A;  1PGO A;  1S9K E;  3UE8 A;  1RF1 A;  3AEN A;  2H88 C;  4I7Z C;  3WY7 A;  1FG7 A;  3P7K A;  1BDC A;  2D63 A;  1C7O A;  3CCR P;  4L74 A;  4MSO A;  4GDO A;  1GK4 A;  2CJD A;  5M4B A;  2KSE A;  2OYO A;  3L70 J;  2IBZ G;  2BAS A;  2DOU A;  1VQ6 P;  2ZXE B;  2GB3 A;  2W8T A;  3GF3 A;  1BS0 A;  2IPP A;  3DU4 A;  3JWA A;  2ZSL A;  1S9K D;  1NTM E;  2KZJ A;  3L71 J;  1OXZ A;  4HB1 A;  1GC3 A;  1JMM A;  2O1B A;  1IJD B;  2ZC0 A;  5E4Z A;  3AE3 C;  1O62 A;  1NVO A;  3NRA A;  9AAT A;  3L4F A;  2QEX P;  2N1T A;  1LT1 A;  1MFZ A;  3E1I A;  1OW6 A;  2WPR A;  3AE1 C;  2A06 G;  4U1T A;  1SQP K;  3HE4 A;  1VL2 A;  1VPC A;  3L70 E;  4RM1 A;  2YIU B;  1N7L A;  3N75 A;  1MDZ A;  2CJH A;  1NTM D;  4K3A A;  4ZDL A;  2YO2 A;  1CQ8 A;  2R5B A;  3IR9 A;  1LTJ A;  3RI6 A;  1Y47 A;  3L71 E;  5D5S A;  5EUE A;  2HUU A;  4PD4 E;  1NU1 D;  4KYO A;  3A0B H;  3ZZK A;  3M0D A;  1VQN P;  3H1I G;  5KLV D;  3CPW O;  1SFC D;  3ZDM A;  1OVV A;  2WIT A;  3MAF A;  3RK2 B;  1GEY A;  1TAT A;  3QGU A;  3EIB A;  2ZYG A;  1FZA A;  1B9I A;  3H1I J;  3M9Q A;  2HP2 A;  4NOG A;  1GBN A;  2BI9 A;  2AY4 A;  3F9T A;  4RJT A;  3L8A A;  4PD4 D;  3LG0 A;  1BJ4 A;  1FC4 A;  2C0W A;  3HD7 C;  1G4X A;  2VI9 A;  1IZN B;  1FJP A;  3H1H E;  4TT3 H;  3AE8 C;  1EDL A;  1V2E A;  3T97 B;  5AW4 B;  1AAM A;  1SP4 A;  2ZJG A;  2D65 A;  1YJW P;  3PAA A;  3RBX A;  1WYT B;  2AY6 A;  1LC5 A;  1RHZ B;  5KAI E;  3LY1 A;  4I2L C;  1XTG B;  1VQ4 P;  4WXF A;  3L73 J;  3H1H D;  1PG8 A;  1YJZ A;  2KOG A;  2BYL A;  3WGB A;  2H7H A;  2HOD B;  4BHD A;  1PMO A;  1FC2 C;  1L4A A;  2HPC B;  2G3A A;  2FNI A;  4DJG A;  3USS A;  4KXK A;  2JJG A;  5AVY B;  2KP8 A;  1LTA C;  3PTZ A;  1O61 A;  1FU1 A;  5AVX B;  3II0 A;  1N7S A;  1Q86 Q;  3AEJ C;  1AKB A;  2FXP A;  2X5F A;  3L73 E;  1K73 Q;  1MDO A;  4M2M A;  4Y0H A;  1JY2 P;  2JR8 A;  4E1O A;  2W27 A;  3CI9 A;  4WYG A;  3L74 J;  2ZYD A;  1KFN A;  3BAS A;  3WCN A;  3N4X A;  4FL0 A;  2M3E A;  1M1J C;  4FFC A;  2E76 C;  3H1J D;  1FDI A;  1YJN P;  1MAQ A;  2RMZ A;  1FS0 E;  4PD4 H;  3L73 D;  3VP9 A;  3BCC J;  3WMM 0;  3EFG A;  4AO9 A;  2IX7 C;  4EIJ A;  1AIB A;  5APT A;  3W68 A;  3HUS C;  4YXD C;  1S1C X;  2OYI A;  4MN4 C;  1TOK A;  3GJU A;  3L74 E;  1KAF A;  1RF1 C;  3E2Z B;  4W1V A;  2CH1 A;  4L73 A;  2FYZ A;  4ZDO A;  2JO1 A;  3WLX A;  2O1K A;  2WZ7 A;  3O6Q A;  3I55 P;  4EOT A;  3RK3 B;  1AHE A;  3CBF A;  4GDY A;  1JS3 A;  1ARI A;  2Z9X A;  4Q76 A;  1H0T A;  1E5W A;  2D61 A;  1G1I A;  2YKU A;  3V4Q A;  3A0H E;  5CBN A;  3BCC E;  1L2P A;  1BE3 G;  1LWU B;  1H89 A;  1AX4 A;  2W8J A;  5FT8 A;  2VMO A;  3AEM A;  1CI6 A;  5APW A;  1KQL A;  4LGD E;  4OBV A;  5APU A;  1BW0 A;  1BE3 J;  1LC8 A;  3MKJ A;  3FRK A;  3RK3 E;  2N1T C;  1YBK A;  3Q2Y A;  1N73 B;  5KAI H;  1EZV D;  3B5N C;  1PPJ D;  4H44 B;  2G8Y A;  5KAF E;  2RN0 A;  2FYF A;  1EXJ A;  2QJK C;  1RVU A;  4CXR A;  2VMY A;  4HH2 A;  3W67 A;  2KK7 A;  3AED C;  4NPF X;  1W3U A;  4W8I A;  2GSA A;  1T2K C;  1D7M A;  1NTK E;  1LTJ C;  1UII A;  2YO3 A;  4GT1 A;  1QIT A;  3GF7 A;  5KKZ B;  3RK3 D;  1GEX A;  1FZC A;  1YOO A;  3BAT A;  2WSE J;  2GUV A;  3H1K D;  4H0L B;  1I43 A;  2F8J A;  1M7Y A;  4ZDP A;  2KS1 A;  3MBB A;  3M91 A;  5M4D A;  2E43 A;  3MGN A;  2JWA A;  1M0P A;  2Z9V A;  1OZH A;  5KJ7 A;  4WXG A;  1L0L E;  1BSN A;  1NTK D;  2A45 G;  3GHG A;  3AAT A;  1M90 Q;  4RAE A;  2XU6 A;  4AUW A;  4GKG A;  2AY5 A;  1Q7Y Q;  4ZSW A;  1MUU A;  3ACZ A;  3HMU A;  1ECX A;  4EB5 A;  2VGW A;  3VMY A;  4H44 D;  3TGU D;  1B9H A;  3EIA A;  4ZM3 A;  1CSB A;  2KXP B;  3IF4 A;  2IFN A;  4GOF A;  2LR2 A;  3II6 A;  1GD2 E;  1YQ4 C;  3V2R A;  3AE6 C;  1L0L D;  1EDI A;  3WU2 E;  2HP1 A;  1B5P A;  4F5L A;  5D95 A;  1KIL A;  1AA0 A;  4EMY A;  2R5C B;  4CBR A;  3RL0 C;  1KN7 A;  1NTK K;  2QJP B;  2XH1 A;  5F8V A;  1JCC A;  2R3S A;  3OAK A;  2OGA A;  1NTZ J;  1BT4 A;  4D6T G;  3VN0 A;  2DKB A;  2Z4E A;  3A0H H;  1Q81 Q;  1L4A C;  2KSJ A;  2FN6 A;  1ARG A;  2QRX A;  4OCA A;  1H1C A;  1J1E B;  4HYT B;  4D6T J;  3ELE A;  5F9S A;  4IYO A;  1M6S A;  2CAN A;  1SQX E;  1L0L K;  3DZZ A;  3UIA A;  4OYT A;  1VQM P;  2BI2 A;  1N7S C;  2P67 A;  1L0N G;  2EO5 A;  3NU7 A;  2AEM A;  3E2Y A;  1RV4 A;  3K28 A;  2WSF H;  4L75 A;  2SPZ A;  3K5B A;  1L0N J;  2D7Z A;  5AVS B;  3L72 E;  3R4Y A;  1P3W A;  1ZR2 A;  4I6M C;  3VMA A;  7AAT A;  3KGW A;  5FT5 A;  1S2E A;  1SQX D;  4XJM A;  4N3Y B;  2AEV A;  3TCM A;  1SQQ J;  2BEZ F;  3CQ5 A;  5TIS H;  2RFV A;  1WT6 A;  3CWB D;  3P8C D;  4IY7 A;  1YJY A;  2CIN A;  2GMU A;  4W7Z A;  1HBW A;  3CL3 D;  5AW6 B;  3C1L A;  4F5K A;  3WGC A;  1S4X A;  4H13 B;  2OYI C;  3PDB B;  5BJ3 A;  1IAX A;  2O0R A;  1E79 H;  3PA9 A;  1LKC A;  3L72 D;  2YRI A;  5M49 A;  1IUG A;  3BVH A;  4GOD A;  1TOE A;  4L0O A;  5CCG C;  3NNK A;  1JY2 N;  1S5L E;  1BDD A;  4MKK A;  2ZYJ A;  4NPE A;  3PPL A;  3LVL B;  1SQQ E;  1NO4 A;  1IBJ A;  3CCV P;  3FFH A;  2Y0D A;  3CMA P;  5EAV A;  3USF A;  3DXV A;  1SQX K;  3QBO A;  2OGU A;  1RV3 A;  5BJ4 A;  3BCX A;  2K88 A;  3FVU A;  2V1P A;  1JTH A;  1KFM A;  1SQB G;  4ASV A;  2HR3 A;  2V7Q H;  3HTK B;  1HJB A;  3WU2 H;  1C0N A;  2FYU J;  4RO0 A;  2D66 A;  3K40 A;  1NTZ K;  2J58 A;  2E54 A;  1FAV A;  5DJU B;  1BJO A;  1W2B O;  1SQB J;  2P2U A;  3Q3D A;  1QEX A;  1AY8 A;  1CQ7 A;  1WYT A;  4R4M A;  2XND H;  5APX A;  3RL0 D;  5EQC A;  2BCC G;  2R2N A;  5AVZ B;  3NX3 A;  3FXD A;  3MUD C;  1CW5 A;  1NOH A;  2VMT A;  3LVM A;  5KLI C;  1YI2 P;  1M4N A;  3CCQ P;  1GTW A;  2C0R A;  2W8V A;  3WX9 A;  2ZT9 B;  2FYU E;  1GCK A;  2WK7 A;  2KYV A;  4ADE A;  4LW4 A;  3HBX A;  2FYN C;  4DCK A;  1YQ3 C;  2H8P D;  1G7W A;  2YKV A;  1SF2 A;  1IFN A;  5KJ7 C;  2JIS A;  1Y4I A;  1JF9 A;  3B71 A;  1C7G A;  3HL2 A;  3PJS K;  1SQQ K;  2WWW A;  4ZKP A;  4ADD A;  3JZL A;  1AVO A;  2OTJ P;  3N4R A;  1HVV A;  1DD3 A;  3D71 A;  5AVU B;  1WST A;  2W83 C;  2D2C D;  4IXO A;  3D6Z A;  1GL2 B;  1OHW A;  3H1L J;  1IFJ A;  2K9J A;  1VF5 B;  2DGM A;  5AW7 B;  1CQ6 A;  2FFD A;  4K05 A;  2X8U A;  2W6J H;  5EAA A;  1ASE A;  4A00 A;  3BCA A;  2B9B A;  3G7Q A;  3E1R A;  4PV1 D;  3TK1 A;  1VJO A;  1TAR A;  4K2B A;  1ART A;  2KNC B;  2VGU A;  2P7J A;  2ZT9 D;  3JWB A;  3PRJ A;  3M5U A;  2ZUK A;  5CHX A;  3NMD A;  3V2Q A;  1BGY J;  4N6J A;  1S5L H;  4ZM4 A;  4CXQ A;  5CCG D;  1MLZ A;  2BI3 A;  1IFI A;  3I4J A;  3H1L E;  3RCH B;  2FYU K;  3TDK A;  2W7I A;  4YPC A;  1BSH A;  4BMK A;  1R5S A;  4OGQ B;  4WYA A;  1KMI Z;  1MFT A;  2OKK A;  3FQ8 A;  4HVK A;  1DKA A;  2IYP A;  2JJH A;  5C6U A;  1SVF A;  3A9X A;  1M56 D;  2Q7C A;  1VF5 D;  1JO5 A;  5M46 A;  1BGY E;  2PFX A;  3H1L D;  1QVF O;  2W7H A;  1AJS B;  1KQF B;  1ZRT D;  1GC0 A;  3P8M C;  3C9I A;  5G2Q A;  1W7M A;  1N73 A;  4OH8 B;  1PP9 J;  4U3F J;  1QGK B;  2WSC J;  2A45 I;  3L36 A;  1OW7 A;  4IW7 A;  1KQS O;  3E7K A;  3VYI A;  1FE6 A;  1SQP D;  1M0O A;  2ZY3 A;  1HWT C;  4UB8 E;  2OTK E;  1SQV G;  3FQ7 A;  2VMP A;  1YHQ P;  2W7E A;  1OW8 A;  1BGY D;  4HF8 A;  1IVR A;  1SQV J;  1NU1 G;  1DJU A;  2G7J A;  1SFC B;  1C4K A;  2JG2 A;  1XTC C;  3LW5 J;  1KL2 A;  3PD6 B;  4OGQ D;  5KLV G;  1S09 A;  1N8P A;  5CCH C;  1PP9 E;  2QVA A;  4U3F E;  4OBU A;  4C46 A;  1NH4 A;  1MAP A;  2FXM A;  2Q5U A;  5I92 A;  4BWN A;  2NPS C;  2OQQ A;  3RK2 C;  2GQN A;  3ASA A;  2VLF A;  1LK9 A;  1AHY A;  1RE3 A;  4WLH A;  1AY4 A;  3B8E B;  3A3Y B;  5CJ4 A;  2B89 A;  4YXW H;  2M5A A;  4WY4 B;  1DEE G;  2OYH A;  3HE5 B;  1VQ5 P;  2WMM A;  3LV2 A;  4KJM A;  2EPJ A;  3M0A A;  2IBZ E;  1KZU B;  3L35 A;  1AMQ A;  4Q6R A;  4KHX A;  2VMX A;  4HJG H;  1GU5 A;  3AEA C;  1CZC A;  3FWL A;  3L70 D;  3H1H G;  3R4T A;  2R5C A;  1URQ A;  4WVZ A;  1IFD A;  1T3I A;  4W80 A;  1JCD A;  1JY3 N;  1HGZ A;  3JTX A;  3LIE A;  4PFN A;  1Z56 A;  2IBZ D;  3L71 D;  2NRG A;  1KC8 Q;  2A06 E;  3D6K A;  2MKV A;  3Q8N A;  3KKI A;  2ZSM A;  1N86 A;  4WD2 A;  4Q75 A;  3Q5P A;  1MKM A;  1FOS F;  3MC6 C;  4W91 A;  1AKA A;  5M1B A;  1YIY A;  3GZD A;  2XV5 A;  2RKL A;  2IYO A;  4GRX A;  2Z20 A;  1W2E A;  3RBF A;  4GEB A;  3JC2 2;  2BWP A;  1X0M A;  2C44 A;  3AOW A;  4MQQ A;  1ZN5 A;  3PJ0 A;  1DGD A;  3TYY A;  4WY4 D;  1DIP A;  4A7P A;  3NYU A;  3QPG A;  3NUI A;  1OFC X;  1IX7 A;  1BCC G;  3M06 A;  2BIA A;  3EI6 A;  3H1I E;  1RQU A;  1AKC A;  2QJY C;  2VMN A;  4Y99 C;  3WZF A;  2FKW B;  1AJR A;  4E3Q A;  2W7G A;  1CL1 A;  1DJ9 A;  4EFF A;  3OW2 O;  2FFD C;  1BCC J;  3KGX A;  1U08 A;  1JUN A;  4QMA A;  3H1J G;  1Q90 D;  2AEJ A;  2CK3 H;  1VQ8 P;  5CBO A;  2GM4 A;  1ORD A;  3JSV C;  3GBX A;  4B98 A;  2YCN A;  2E74 C;  2JKV A;  1G2C B;  3L44 A;  1D2F A;  1EG5 A;  1PFI A;  2WSS H;  3H1I D;  4YTP C;  1NWQ A;  1DH3 A;  1M1K Q;  3PDB A;  3VP6 A;  5CCH D;  3QM2 A;  1VQ9 P;  3CME P;  4GE7 A;  3FDD A;  3CCM P;  3ECD A;  3B8X A;  3SWF A;  4R5F A;  1AAW A;  3SWK A;  3B1E A;  1E5E A;  2E5Y A;  4XE5 B;  3HD7 B;  2LXC B;  2W8U A;  1Y9B A;  3WUV A;  2HOZ A;  1AHX A;  1GW4 A;  5EIG B;  1PZQ A;  1YIZ A;  2QLR A;  2W7J A;  1LC7 A;  2BKW A;  1HGV A;  1G7X A;  2B87 A;  2Y0C A;  3HTK A;  1CZQ A;  2YKQ A;  2E7I A;  2QM8 A;  1G1J A;  1XEY A;  3DR4 A;  1EZV G;  4RKD A;  3VOP A;  1PPJ G;  3JW9 A;  1KYO I;  2D7Y A;  3CCE P;  2ZVN B;  1W7N A;  2L91 A;  4JF0 A;  3CXH E;  3G3Z A;  4JEV A;  1UU2 A;  4HKZ H;  3SFE C;  1OAT A;  1QL1 A;  1FJK A;  3Q5R A;  5E5I A;  3AEL A;  4WLJ A;  3ITK A;  1LS3 A;  1N8R Q;  4CVQ A;  3QN6 A;  4DGT A;  3FWN A;  3FSL A;  1KD1 Q;  4WB0 A;  4JF7 A;  2PP6 A;  3F0H A;  3FZ8 A;  3H1K G;  3HD7 D;  1RE4 A;  4JBZ A;  3PDX A;  4A6R A;  5BU5 A;  3L74 D;  1ZOY C;  3CXH D;  3OKS A;  3WKS A;  1KOR A;  1HUC A;  1WYU A;  2CPS A;  4ITG A;  4BA5 A;  1PIX A;  3H6P A;  2KLU A;  4CBS A;  3IAO A;  4TN4 A;  1WMK A;  3U59 A;  1RE3 C;  3DYD A;  1ELU A;  1T8Z A;  3K7Y A;  1DD4 A;  3TGU G;  1Q82 Q;  5HXX A;  1M1J B;  1LTG C;  2IFM A;  4OWF A;  3BCC D;  1LT9 A;  1LTB C;  4IL6 X;  2XBN A;  2E76 B;  4ZWM A;  1GL2 A;  2OYH C;  3N4S A;  2CB1 A;  3UWC A;  1OHY A;  3HLM A;  1DJE A;  4B9B A;  1I29 A;  4ZWV A;  4JYB A;  1WYV B;  8AAT A;  2WVR A;  4AZK A;  2V0Y A;  3HUS B;  1OHV A;  2J59 M;  4W1X A;  1BE3 E;  4ADB A;  3M0D C;  4R5Z A;  1ASF A;  1ZR4 A;  2Y9Y A;  3GZC A;  2KNC A;  2CY8 A;  3LVK A;  1LP1 B;  3BV0 A;  4GSA A;  3HQT A;  1QGN A;  1URQ C;  4WYF A;  3SWY A;  1YJS A;  1M57 D;  3GG2 A;  1JNM A;  2QJP C;  2FM1 A;  1EC5 A;  2V4H A;  3MD0 A;  5B66 E;  2P10 A;  1SFF A;  3RCH A;  3M9H A;  5AVR B;  1YIT P;  2PAJ A;  2WK9 A;  3KHU A;  4BRY B;  4Z1M H;  1WKH A;  1I41 A;  1BE3 D;  2Z61 A;  2FQ6 A;  3GZD C;  3GET A;  3CQ4 A;  1J1E C;  1V72 A;  3BRV B;  4B86 A;  1CZE A;  3BN1 A;  1BJW A;  3GR9 A;  2R0T A;  3Q5S A;  2IBZ I;  1AFO A;  2W90 A;  2E76 D;  3I5T A;  4XJL A;  2ZFC A;  3B5N B;  1BKG A;  1S06 A;  3HE4 B;  1JEK A;  5HHY A;  3MIW A;  1M8O B;  3N0L A;  2M3B A;  1TU3 F;  5AW3 B;  3CXH H;  4JEY A;  1VP4 A;  3VTP C;  2W7L A;  1FZE A;  1K04 A;  4ZNC A;  3GMA A;  1SZK A;  2O3J A;  5FT6 A;  1PGQ A;  1FOS E;  4JEW A;  1QIS A;  1KV4 A;  2KB7 P;  3CWB G;  2W7K A;  3ZRP A;  2B88 A;  3E9K A;  4TMR A;  2I1J A;  4JPZ B;  4XAU A;  2QA3 A;  2KZI A;  4OT8 A;  4L76 A;  3MAF B;  3CCS P;  5JAY A;  1SFC A;  3I56 P;  1JG8 A;  2O01 J;  1DTY A;  3PD6 A;  1D7U A;  3A5T A;  1JB0 J;  4LC1 A;  1OVU A;  4DT0 A;  1AIC A;  4WYE A;  2N1T D;  3FZ7 A;  4ASW A;  1Q2N A;  1K8A Q;  1X28 A;  2PGD A;  3OP7 A;  2M0B A;  3B5N D;  5KAF H;  2ZY2 A;  4K2M A;  3HT4 A;  1NTZ E;  3NYS A;  4LLH A;  2IDB A;  2YCT A;  1J1D C;  1GD9 A;  5K8B A;  4MQR A;  2JGT A;  3R9A A;  4P3M A;  2PRR A;  1T2K D;  1FDM A;  4D6T E;  4DZO A;  2E75 C;  4WBA A;  3GSB A;  1S08 A;  4A0G A;  2BWN A;  4E77 A;  4KAM A;  1NGM B;  3RBZ A;  1USE A;  1NTZ D;  4EB7 A;  3E77 A;  3RL0 B;  1GU4 A;  3FTB A;  3S4R A;  5KTB A;  2JJL A;  4RIZ A;  4EU1 A;  3VOM A;  3CX5 E;  1IJI A;  1L0N E;  5GTH E;  1T6A A;  2UWJ E;  3ASB A;  5IWQ A;  4N0W A;  3L75 G;  2ZP7 A;  4D6T D;  1MZ9 A;  1YJ9 P;  1Z7D A;  1L4A B;  5AX8 A;  3RUY A;  2YXQ B;  4GE4 A;  1YTZ T;  4PIW A;  1ELQ A;  4XFJ A;  3SFD C;  2W7M A;  3L75 J;  5AVV B;  3E2F A;  1MGV A;  4Y28 J;  5DJ1 A;  4F5M A;  2WSE H;  4I1L A;  4UOY A;  1N7S B;  1T3U A;  3B1C A;  5GTI E;  2H43 A;  1QX8 A;  1J2J B;  3MEB A;  3CX5 D;  3TQX A;  3U1A A;  3AEM C;  1L0N D;  3BS8 A;  3UAK A;  1RF0 A;  2K9Y A;  2BI5 A;  5HDM A;  3AE5 C;  4R8D A;  3T97 A;  1GZL A;  4KT0 J;  1AJY A;  4IXS A;  5E3K A;  1KKJ A;  3F89 A;  3PIU A;  2YMK A;  3IN6 A;  1PMM A;  3JCU E;  5DX5 A;  3CXH I;  1SQQ D;  1SZS A;  2D2C B;  4WXB A;  4IFM A;  3AV7 A;  1LT9 C;  2A45 H;  3MAU A;  1S07 A;  4RIT A;  1VQP P;  2W7D A;  1GL2 C;  4ISY A;  3VP8 A;  3RBL A;  3ZRR A;  4R4L A;  3A8U X;  4UHM A;  2HOD A;  2O01 N;  1L4A D;  4PV1 B;  2OYI B;  2BCC J;  4RKC A;  1FZC C;  4RES B;  1ZLL A;  4F5I A;  2MJZ A;  3G71 P;  1U7J A;  1G2C A;  2HPC A;  2NMP A;  4CPG A;  1TPL A;  1L0N K;  1SPA A;  1BJN A;  3U1C A;  1SQB E;  3EFF K;  3O6Q B;  3NTN A;  1N7S D;  1ZP0 C;  3BWO A;  1JOC A;  3FXE A;  2AY1 A;  3GHG C;  4UB6 E;  1AY5 A;  1GDT A;  2TPL A;  4BQ0 A;  2AEF A;  3QWO C;  2FXO A;  3D70 A;  2VLH A;  2WK8 A;  2FYU D;  3G6E P;  2J5U A;  4LC3 A;  2AY9 A;  1M7L A;  3HD7 A;  2W8W A;  2JDI H;  2BCC E;  5AW0 B;  4ATP A;  5B5E E;  4WWI A;  1SQB D;  1ASG A;  4LNL A;  2WT7 B;  2VMU A;  5EIG A;  1C9C A;  2E75 D;  4GOE A;  1FZF A;  2Q3I A;  3COG A;  5AVW B;  5CJ0 A;  1LTI C;  2AY8 A;  3AEF C;  5EFW B;  3NYT A;  4A6U A;  1KIL C;  4AZJ A;  4K35 A;  1FZG A;  3B46 A;  5AW5 B;  3CX5 H;  3H32 B;  2FNU A;  3F6T A;  1GC2 A;  2R5D A;  3EWK A;  2EGY A;  1EQ7 A;  1KYO E;  5E79 E;  1SQP G;  4M2K A;  4R2N A;  5KLI B;  4PVF A;  3E2Z A;  5AW2 B;  3EI7 A;  1H88 A;  3CD6 P;  1N31 A;  3ZRQ A;  4W7Y A;  5APV A;  1O69 A;  5EUN A;  1O4S A;  2FYN B;  2KS1 B;  1JS6 A;  4LNJ A;  1SQB K;  1MV8 A;  5GTI H;  4IOI H;  2YKX A;  1KTM A;  1VEF A;  2VMZ A;  2KLV A;  2CH2 A;  1LWU A;  2ZY4 A;  1S5L X;  1KYO D;  3N7N A;  1FDO A;  1ARS A;  4AQR D;  1YIJ P;  2LKM A;  4WYC A;  3JCU H;  4WP0 A;  1UU0 A;  1LNQ A;  4ZKU A;  1ASD A;  4WBT A;  5FT4 A;  1JY2 O;  2POH A;  3ELP A;  3Q1M A;  4F5J A;  4JYC A;  3KQG A;  2AXC A;  2YIU C;  4JF1 A;  1NTM G;  3QH9 A;  1LTT C;  1JM0 A;  4OC9 A;  3TFT A;  1WYV A;  1NTM J;  5AVT B;  3EI9 A;  3HVY A;  4K2I A;  3HUS A;  5TF5 A;  4H63 Q;  3E6G A;  3KE3 A;  4TLF A;  2EZ2 A;  2XZR A;  3L70 G;  4Q31 A;  5KJ7 D;  3VMZ A;  1LP1 A;  4UB6 H;  1NU1 J;  1QIR A;  2IZ0 A;  3GLM A;  5G0A A;  2QMA A;  1KKP A;  2C81 A;  1S3J A;  4M2J A;  5KLV J;  3CC2 P;  1PL5 A;  1KIL E;  1QZ9 A;  3L71 G;  2Z9U A;  3P1T A;  1D7R A;  5G2P A;  4IYO B;  2FY8 A;  5B5E H;  5EUD A;  4Y0D A;  4BRY A;  2QB2 A;  1AMR A;  4XJO A;  4JEX A;  1SQV E;  2L5G B;  2VMQ A;  4M3L A;  1P84 E;  4UQV A;  1RF0 C;  1IAY A;  1PP9 D;  4U3F D;  3OA7 A;  1M0Q A;  1U7M A;  2K37 A;  4AOA A;  1NU1 E;  3CC4 P;  3B5N A;  3AE2 C;  1KIL D;  2Y9Z A;  2VGV A;  3I5C A;  1GW3 A;  2Q9I A;  3CX5 I;  1JMB A;  5KLV E;  4F4E A;  1OVR A;  3BCB A;  3H9X A;  1KYO H;  4I7Z B;  2P58 A;  4IFF A;  5E79 H;  1TAS A;  4J5U A;  1PFF A;  4DBC A;  2Y0E A;  3ABV C;  1SQV D;  4RKU J;  4A0H A;  2R44 A;  3LID A;  1P84 D;  1X79 B;  4PFF A;  2KUB A;  1SZU A;  3FZ6 A;  4ADC A;  3A2A A;  4F5F A;  3O8Z A;  3H1H J;  5DB5 A;  3WUT A;  2XNX A;  3WKR A;  2CJG A;  3DOD A;  3RL0 g;  4XEW A;  2QA4 P;  3PGY A;  3FFR A;  2NPS B;  2Z5I A;  1DX7 A;  1V2F A;  4ATQ A;  1GK6 A;  1ASN A;  1OXO A;  2W8Z A;  3V2N A;  1HTL C;  2ITA A;  3VK2 A;  4F5H A;  3DXW A;  3CQ6 A;  3CC7 P;  5G09 A;  4WB4 A;  3HRN A;  2A06 D;  2ZXX A;  2E5T A;  4UHO A;  1X22 A;  1M0N A;  1JTH B;  1ZC9 A;  1NTM K;  2YCP A;  1KMJ A;  1SQV K;  3W1H A;  2GA1 A;  2D5Y A;  2XKM A;  4UB8 H;  2Z9W A;  4IL6 E;  5CMZ A;  3CCU P;  1RY3 A;  2BI1 A;  4MQP A;  2JWD A;  3G9R A;  1PGJ A;  3NUB A;  1BJO B;  1NKN A;  3FX0 A;  5H2F E;  1NU1 K;  3L73 G;  1IX6 A;  5KLV K;  1R5L A;  2BEQ D;  2QM7 A;  1WRG A;  2IZ1 A;  2YHK A;  3H1J J;  4PJ0 E;  5DJT B;  4C7N B;  2OGE A;  2AY7 A;  3IHJ A;  1EJI A;  2WSC H;  3KZI E;  2DR1 A;  2Z1Y A;  2HOR A;  3D6Y A;  1V2D A;  1KB9 E;  2PB2 A;  2NPS D;  5G4I A;  3RK2 D;  2VYC A;  3MP7 B;  1QJ5 A;  2GMS A;  1U57 A;  1ZXG A;  1BCC E;  4RLG A;  3WCO A;  1NJI Q;  3RK3 C;  1X29 A;  1PGP A;  2VGS A;  3CCJ P;  4LNM A;  2WTY A;  3EI5 A;  1EQB A;  3W1J A;  3WUU A;  5C39 A;  2OQX A;  3EUC A;  2W7F A;  1P84 H;  2AAT A;  3L74 G;  3LW5 H;  2BYJ A;  1LWU C;  3H1J E;  4E3R A;  1USD A;  4XQ2 A;  4GIF A;  3DR7 A;  2ZY5 A;  4J8L A;  1KB9 D;  1Y8A A;  1B4X A;  2EZ1 A;  2CST A;  3T32 A;  3SSU A;  1ZV8 A;  1X2A A;  2VIA A;  1G4V A;  1IO4 A;  4U2H A;  4EI2 A;  1BCC D;  4XK1 A;  2QJY B;  2P1J A;  1N73 C;  1YNU A;  4Y99 B;  3A7O A;  2K9J B;  2C9L Y;  2Q7W A;  4H44 C;  1AQT A;  1VDF A;  1HF9 A;  5AVQ B;  5AW1 B;  2FFD B;  2FBW C;  3F5H A;  3AE7 C;  3BCC G;  3HDO A;  1DGE A;  4A72 A;  1IFM A;  2E74 B;  4A6T A;  4QGR A;  2BHX A;  2RH0 A;  3CAI A;  2QG4 A;  5KKZ C;  3KPE A;  2PO3 A;  2M8R A;  4XA4 A;  3EZS A;  1CL2 A; 
#chains in the Genus database with same CATH homology
 5APQ A;  1FG3 A;  1TOG A;  2OKJ A;  3G0T A;  5CCG A;  4DOJ A;  4JEZ A;  1S0A A;  3NFQ A;  2C7T A;  1JY3 O;  3IFM A;  2WPQ A;  2AY2 A;  4GE9 A;  2WB6 A;  3TNU B;  1A02 F;  3R2P A;  3EI8 A;  4WYD A;  1DEB A;  1LW5 A;  2WT7 A;  3FD0 A;  4A0R A;  2JJF A;  3ISL A;  1B5O A;  1AHF A;  4W1W A;  1KMK A;  3FKD A;  1T3J A;  2YNY A;  1AQ5 A;  3KDP B;  2FKI A;  1N2D C;  3B1D A;  1RF1 B;  3AEN B;  3H32 A;  3QHX A;  1ZOD A;  2VRS A;  4BA4 A;  2YRR A;  3MUD A;  4RJY A;  4ZSY A;  1X9V A;  1RVY A;  1IX8 A;  3NTJ A;  4IFD K;  1W7L A;  4IXZ A;  2D64 A;  3M9B A;  2KFP A;  4ZAH A;  3I16 A;  3RQ1 A;  4O9B A;  2VGZ A;  3OJA B;  5AW9 B;  2N1T B;  3LWS A;  2O1J A;  1ASC A;  3DRD A;  3NXS A;  1AJS A;  4MKJ A;  1HH0 A;  3EZ1 A;  2R5E A;  1GC4 A;  2OYH B;  1LTJ B;  2W6B A;  2JEE A;  1KL1 A;  2R3C A;  2QB3 A;  1ASA A;  3P6K A;  1GEW A;  2QSR A;  2ORD A;  1SVV A;  4ZLV A;  2EH6 A;  5APS A;  4OMA A;  4RJ0 A;  1URQ B;  1YTZ I;  3GWP A;  2I1K A;  3BWN A;  4AYC A;  3VMX A;  3ZZJ A;  1LGH B;  1QL2 A;  3P32 A;  1IC2 A;  5AW8 B;  3TSI A;  1TOI A;  2X5D A;  5EFS A;  4Y0I A;  2QBT A;  2CTZ A;  4P7Y A;  2HLO A;  3BB8 A;  3A9Z A;  4F5G A;  3P8C E;  2DGK A;  3W1I A;  4WY4 A;  2YKY A;  3HE5 A;  2R32 A;  1AHG A;  2E42 A;  1FZB A;  2VMV A;  1C7N A;  2WKA A;  1URQ D;  1SLQ A;  1H0C A;  1MDX A;  3PP5 A;  2O7C A;  2BWO A;  3QI6 A;  4AH3 A;  2VMS A;  5J8Q A;  3TFU A;  1DFO A;  1Z3Z A;  1ASL A;  1N2T A;  2C9N Y;  1RE4 C;  4I8A A;  3L37 A;  5CCH A;  3BC8 A;  3VK3 A;  1FBM A;  1TOJ A;  2NPS A;  2DKJ A;  3MAD A;  1JY3 P;  5APY A;  1J1D B;  1MLY A;  2HYN A;  1NAF A;  1ASM A;  3ATH A;  3H7F A;  3A2B A;  2DGL A;  2X3L A;  1ASB A;  4XJP A;  3V5B A;  1A02 J;  3VAX A;  1NKZ B;  1E5F A;  2BIE A;  3CLQ A;  3NU8 A;  2W6A A;  3V4W A;  4A0F A;  2HFE D;  4N78 E;  3MTU E;  2OAR A;  1AIA A;  3A9Y A;  3BRT B;  1CJ0 A;  5G4J A;  5BU8 B;  4C7N A;  3FQA A;  3KYQ A;  2HUF A;  1BQD A;  2HOX A;  3AEO A;  1J32 A;  4WB0 B;  1LW4 A;  2VI8 A;  2VMW A;  1H8A A;  2VIB A;  1NHL A;  4N78 D;  2EYQ A;  2YMY A;  4IX8 A;  3MC6 A;  4LW2 A;  1W23 A;  5BVZ A;  1CI6 B;  1YYC A;  1WYU B;  3G8M A;  4UHN A;  1UKJ A;  3FVS A;  2HG5 D;  2O01 H;  1I48 A;  2VGT A;  2YKP A;  3AEP A;  1BQA A;  3FCR A;  2E7J A;  4ITX A;  1X8Y A;  1IK9 A;  1CS1 A;  2XDJ A;  2A1V A;  3VK4 A;  1LT9 B;  1AMA A;  1XI9 A;  2YOB A;  2BIG A;  2YKO A;  2HZP A;  1WKG A;  1FZC B;  2Z5H A;  4AO4 A;  1OXP A;  2CFB A;  2CPB A;  2G6W A;  2JJE A;  1YAA A;  2N9B A;  1J04 A;  1M32 A;  1ZOB A;  3TAT A;  3NDN A;  2VMR A;  1SFC C;  1GDE A;  3V2P A;  1LTS C;  3BWN C;  1B8G A;  2OAT A;  3GHG B;  4ZAS A;  2WPS A;  2HOY A;  2HUI A;  1D7S A;  1AMS A;  4MY5 A;  3AEJ A;  4DQ6 A;  1ARH A;  4O6Z A;  3FVX A;  2C0X A;  2GUS A;  4C7R A;  4H51 A;  1OWA A;  1QJ3 A;  3AOV A;  2PB0 A;  3FDB A;  2AEU A;  5DJ9 A;  1GL2 D;  2AY3 A;  1M1J A;  3EQ2 A;  3TNU A;  4W5K A;  3DC1 A;  4WY4 C;  3N5M A;  1KIL B;  1UU1 A;  2E7U A;  4OTL A;  3LVJ A;  1D7V A;  2Z1Z A;  1CL2 A;  1S9K E;  3UE8 A;  1RF1 A;  3AEN A;  3WY7 A;  1FG7 A;  3P7K A;  2D63 A;  1C7O A;  4MSO A;  1GK4 A;  2CJD A;  5M4B A;  2BAS A;  2DOU A;  2ZXE B;  2GB3 A;  2W8T A;  1BS0 A;  2IPP A;  3DU4 A;  3JWA A;  2ZSL A;  1S9K D;  1OXZ A;  1GC3 A;  1JMM A;  2O1B A;  1IJD B;  2ZC0 A;  5E4Z A;  1O62 A;  3NRA A;  9AAT A;  3L4F A;  2N1T A;  1MFZ A;  3E1I A;  2WPR A;  4U1T A;  1SQP K;  3HE4 A;  1VPC A;  4RM1 A;  1N7L A;  3N75 A;  1MDZ A;  4ZDL A;  2YO2 A;  1CQ8 A;  3IR9 A;  2R5B A;  1LTJ A;  3RI6 A;  5D5S A;  5EUE A;  2HUU A;  4KYO A;  3ZZK A;  3M0D A;  1SFC D;  2WIT A;  3MAF A;  3RK2 B;  1GEY A;  1TAT A;  3QGU A;  3EIB A;  1FZA A;  1B9I A;  3M9Q A;  2HP2 A;  4NOG A;  1GBN A;  2BI9 A;  2AY4 A;  3F9T A;  3L8A A;  3LG0 A;  1BJ4 A;  1FC4 A;  2C0W A;  3HD7 C;  1G4X A;  2VI9 A;  1FJP A;  1V2E A;  5AW4 B;  1AAM A;  1SP4 A;  2ZJG A;  2D65 A;  3PAA A;  1WYT B;  2AY6 A;  1LC5 A;  3LY1 A;  4I2L C;  1XTG B;  4WXF A;  1PG8 A;  1YJZ A;  2KOG A;  2BYL A;  3WGB A;  2H7H A;  2HOD B;  4BHD A;  1PMO A;  1L4A A;  2HPC B;  2FNI A;  4KXK A;  2JJG A;  5AVY B;  2KP8 A;  1LTA C;  1O61 A;  1FU1 A;  5AVX B;  3II0 A;  1N7S A;  3AEJ C;  1AKB A;  2X5F A;  4M2M A;  1MDO A;  4Y0H A;  1JY2 P;  4E1O A;  2W27 A;  3CI9 A;  4WYG A;  1KFN A;  3BAS A;  3WCN A;  3N4X A;  4FL0 A;  1M1J C;  4FFC A;  1MAQ A;  3VP9 A;  3WMM 0;  3EFG A;  4AO9 A;  2IX7 C;  4EIJ A;  1AIB A;  5APT A;  3HUS C;  2OYI A;  1TOK A;  3GJU A;  1RF1 C;  3E2Z B;  4W1V A;  2CH1 A;  2FYZ A;  4ZDO A;  3WLX A;  2O1K A;  2WZ7 A;  4EOT A;  3RK3 B;  1AHE A;  3CBF A;  4GDY A;  1JS3 A;  1ARI A;  2Z9X A;  4Q76 A;  1E5W A;  2D61 A;  1G1I A;  2YKU A;  3V4Q A;  1LWU B;  1H89 A;  1AX4 A;  2W8J A;  5FT8 A;  2VMO A;  3AEM A;  1CI6 A;  5APW A;  1KQL A;  4LGD E;  4OBV A;  5APU A;  1BW0 A;  1LC8 A;  3MKJ A;  3FRK A;  2N1T C;  1N73 B;  3B5N C;  2FYF A;  1RVU A;  4CXR A;  2VMY A;  4HH2 A;  1W3U A;  4W8I A;  2GSA A;  1T2K C;  1LTJ C;  2YO3 A;  4GT1 A;  1QIT A;  3RK3 D;  1GEX A;  1FZC A;  1YOO A;  3BAT A;  2GUV A;  1I43 A;  2F8J A;  1M7Y A;  4ZDP A;  3MBB A;  3M91 A;  5M4D A;  2E43 A;  3MGN A;  2Z9V A;  1M0P A;  5KJ7 A;  4WXG A;  2A45 G;  3GHG A;  3AAT A;  4RAE A;  2XU6 A;  4AUW A;  4GKG A;  2AY5 A;  4ZSW A;  1MUU A;  3ACZ A;  3HMU A;  1ECX A;  4EB5 A;  2VGW A;  3VMY A;  1B9H A;  3EIA A;  4ZM3 A;  1CSB A;  2IFN A;  3II6 A;  1GD2 E;  3V2R A;  2HP1 A;  1B5P A;  4F5L A;  5D95 A;  1KIL A;  4EMY A;  2R5C B;  4CBR A;  3RL0 C;  1NTK K;  2XH1 A;  5F8V A;  1JCC A;  3OAK A;  2OGA A;  1BT4 A;  3VN0 A;  2DKB A;  2Z4E A;  1L4A C;  2KSJ A;  2FN6 A;  1ARG A;  4OCA A;  1H1C A;  1J1E B;  4HYT B;  3ELE A;  5F9S A;  4IYO A;  1M6S A;  2CAN A;  3DZZ A;  1L0L K;  3UIA A;  4OYT A;  2BI2 A;  1N7S C;  2P67 A;  2EO5 A;  3NU7 A;  3E2Y A;  1RV4 A;  3K28 A;  2WSF H;  2D7Z A;  5AVS B;  1P3W A;  1ZR2 A;  4I6M C;  7AAT A;  3KGW A;  5FT5 A;  4XJM A;  4N3Y B;  2AEV A;  3TCM A;  3CQ5 A;  2RFV A;  1WT6 A;  3P8C D;  4IY7 A;  1YJY A;  2CIN A;  2GMU A;  4W7Z A;  1HBW A;  3CL3 D;  5AW6 B;  4F5K A;  3WGC A;  2OYI C;  3PDB B;  5BJ3 A;  1IAX A;  2O0R A;  3PA9 A;  1LKC A;  2YRI A;  5M49 A;  1IUG A;  3BVH A;  1TOE A;  4L0O A;  5CCG C;  3NNK A;  1JY2 N;  4MKK A;  2ZYJ A;  3PPL A;  3LVL B;  1NO4 A;  1IBJ A;  3FFH A;  5EAV A;  3USF A;  3DXV A;  1SQX K;  3QBO A;  1RV3 A;  5BJ4 A;  3BCX A;  3FVU A;  2V1P A;  1JTH A;  1KFM A;  3HTK B;  1HJB A;  1C0N A;  2D66 A;  3K40 A;  1NTZ K;  2J58 A;  2E54 A;  1FAV A;  1BJO A;  2P2U A;  1AY8 A;  1CQ7 A;  1WYT A;  5APX A;  3RL0 D;  5EQC A;  2R2N A;  3NX3 A;  5AVZ B;  2VMT A;  1CW5 A;  1NOH A;  3LVM A;  1M4N A;  1GTW A;  2C0R A;  2W8V A;  3WX9 A;  1GCK A;  2WK7 A;  2KYV A;  4ADE A;  4LW4 A;  3HBX A;  2H8P D;  1G7W A;  2YKV A;  1SF2 A;  1IFN A;  5KJ7 C;  2JIS A;  1Y4I A;  1JF9 A;  3HL2 A;  1C7G A;  1SQQ K;  2WWW A;  4ZKP A;  4ADD A;  3JZL A;  3N4R A;  1HVV A;  5AVU B;  1WST A;  4IXO A;  1GL2 B;  1OHW A;  1IFJ A;  2DGM A;  5AW7 B;  1CQ6 A;  2FFD A;  4K05 A;  2X8U A;  5EAA A;  1ASE A;  4A00 A;  3BCA A;  3G7Q A;  3TK1 A;  1VJO A;  1TAR A;  4K2B A;  1ART A;  2VGU A;  3JWB A;  2P7J A;  3M5U A;  2ZUK A;  5CHX A;  3NMD A;  3V2Q A;  4N6J A;  4ZM4 A;  4CXQ A;  5CCG D;  1MLZ A;  2BI3 A;  1IFI A;  3I4J A;  3RCH B;  2FYU K;  2W7I A;  4BMK A;  4WYA A;  2OKK A;  3FQ8 A;  4HVK A;  1DKA A;  2JJH A;  5C6U A;  1SVF A;  3A9X A;  2Q7C A;  1JO5 A;  5M46 A;  2W7H A;  1AJS B;  1GC0 A;  3P8M C;  3C9I A;  5G2Q A;  1W7M A;  4OH8 B;  1N73 A;  2A45 I;  3L36 A;  4IW7 A;  3VYI A;  1M0O A;  2ZY3 A;  1HWT C;  3FQ7 A;  2VMP A;  2W7E A;  4HF8 A;  1IVR A;  1DJU A;  2G7J A;  1SFC B;  1C4K A;  2JG2 A;  1XTC C;  1KL2 A;  3PD6 B;  1S09 A;  1N8P A;  5CCH C;  4OBU A;  4C46 A;  1NH4 A;  1MAP A;  2FXM A;  2Q5U A;  5I92 A;  2NPS C;  3RK2 C;  2GQN A;  3ASA A;  2VLF A;  1LK9 A;  1AHY A;  1RE3 A;  4WLH A;  1AY4 A;  3B8E B;  3A3Y B;  5CJ4 A;  4WY4 B;  2OYH A;  3HE5 B;  3LV2 A;  2EPJ A;  3M0A A;  1KZU B;  3L35 A;  1AMQ A;  4Q6R A;  4KHX A;  2VMX A;  1GU5 A;  1CZC A;  3R4T A;  2R5C A;  1URQ A;  1IFD A;  1T3I A;  4W80 A;  1JCD A;  1JY3 N;  1HGZ A;  3JTX A;  3LIE A;  4PFN A;  1Z56 A;  3D6K A;  3Q8N A;  3KKI A;  2ZSM A;  1N86 A;  4WD2 A;  4Q75 A;  1FOS F;  3MC6 C;  4W91 A;  1AKA A;  1YIY A;  3GZD A;  2XV5 A;  4GRX A;  2Z20 A;  1W2E A;  3RBF A;  4GEB A;  2BWP A;  1X0M A;  2C44 A;  3AOW A;  4MQQ A;  1ZN5 A;  3PJ0 A;  1DGD A;  3TYY A;  4WY4 D;  3NYU A;  3QPG A;  3NUI A;  1IX7 A;  3M06 A;  2BIA A;  3EI6 A;  1AKC A;  2VMN A;  4Y99 C;  3WZF A;  2FKW B;  1AJR A;  4E3Q A;  2W7G A;  1CL1 A;  1DJ9 A;  4EFF A;  2FFD C;  3KGX A;  1U08 A;  1JUN A;  1ORD A;  2GM4 A;  3GBX A;  4B98 A;  2YCN A;  1G2C B;  3L44 A;  1D2F A;  1EG5 A;  1PFI A;  1NWQ A;  1DH3 A;  3PDB A;  3VP6 A;  5CCH D;  3QM2 A;  4GE7 A;  3FDD A;  3ECD A;  3B8X A;  3SWF A;  4R5F A;  1AAW A;  3B1E A;  1E5E A;  4XE5 B;  3HD7 B;  2W8U A;  2HOZ A;  1AHX A;  1GW4 A;  5EIG B;  1YIZ A;  2QLR A;  2W7J A;  1LC7 A;  2BKW A;  1HGV A;  1G7X A;  3HTK A;  1CZQ A;  2YKQ A;  2E7I A;  2QM8 A;  1G1J A;  1XEY A;  3DR4 A;  4RKD A;  3VOP A;  3JW9 A;  2D7Y A;  1W7N A;  4JF0 A;  3G3Z A;  4JEV A;  1UU2 A;  1OAT A;  1QL1 A;  1FJK A;  5E5I A;  3AEL A;  4WLJ A;  1LS3 A;  4CVQ A;  3QN6 A;  4DGT A;  3FSL A;  4WB0 A;  4JF7 A;  2PP6 A;  3F0H A;  3FZ8 A;  3HD7 D;  1RE4 A;  3PDX A;  4A6R A;  5BU5 A;  3OKS A;  3WKS A;  1HUC A;  1WYU A;  2CPS A;  4ITG A;  4BA5 A;  3H6P A;  4CBS A;  4TN4 A;  3U59 A;  1RE3 C;  3DYD A;  1ELU A;  1T8Z A;  3K7Y A;  5HXX A;  1M1J B;  1LTG C;  2IFM A;  1LT9 A;  1LTB C;  2XBN A;  4ZWM A;  1GL2 A;  2OYH C;  3N4S A;  2CB1 A;  3UWC A;  1OHY A;  3HLM A;  1DJE A;  4B9B A;  1I29 A;  4ZWV A;  4JYB A;  1WYV B;  8AAT A;  4AZK A;  2V0Y A;  3HUS B;  1OHV A;  2J59 M;  4W1X A;  4ADB A;  3M0D C;  4R5Z A;  1ASF A;  1ZR4 A;  3GZC A;  2CY8 A;  3LVK A;  3BV0 A;  4GSA A;  3HQT A;  1QGN A;  1URQ C;  4WYF A;  3SWY A;  1YJS A;  1JNM A;  2FM1 A;  3MD0 A;  1SFF A;  3RCH A;  3M9H A;  5AVR B;  2PAJ A;  2WK9 A;  1WKH A;  1I41 A;  2Z61 A;  2FQ6 A;  3GZD C;  3GET A;  3CQ4 A;  1J1E C;  1V72 A;  3BN1 A;  3BRV B;  3GR9 A;  4B86 A;  1BJW A;  1CZE A;  2R0T A;  1AFO A;  3I5T A;  4XJL A;  2ZFC A;  3B5N B;  1BKG A;  1S06 A;  3HE4 B;  5HHY A;  3MIW A;  3N0L A;  2M3B A;  5AW3 B;  4JEY A;  1VP4 A;  3VTP C;  2W7L A;  1FZE A;  1SZK A;  5FT6 A;  1FOS E;  4JEW A;  1QIS A;  2KB7 P;  2W7K A;  3ZRP A;  3E9K A;  4TMR A;  2I1J A;  4XAU A;  2QA3 A;  4OT8 A;  3MAF B;  5JAY A;  1SFC A;  1JG8 A;  1DTY A;  3PD6 A;  1D7U A;  3A5T A;  4LC1 A;  1AIC A;  4WYE A;  2N1T D;  3FZ7 A;  1X28 A;  3OP7 A;  3B5N D;  2ZY2 A;  4K2M A;  3HT4 A;  3NYS A;  4LLH A;  2YCT A;  1J1D C;  1GD9 A;  5K8B A;  4MQR A;  2JGT A;  3R9A A;  4P3M A;  1T2K D;  1FDM A;  4DZO A;  4WBA A;  3GSB A;  1S08 A;  4A0G A;  2BWN A;  4E77 A;  4KAM A;  4EB7 A;  3E77 A;  3RL0 B;  1GU4 A;  3FTB A;  5KTB A;  2JJL A;  4RIZ A;  4EU1 A;  3VOM A;  1IJI A;  3ASB A;  5IWQ A;  4N0W A;  2ZP7 A;  1MZ9 A;  1Z7D A;  1L4A B;  5AX8 A;  3RUY A;  4GE4 A;  1YTZ T;  4PIW A;  1ELQ A;  2W7M A;  5AVV B;  3E2F A;  1MGV A;  5DJ1 A;  4F5M A;  2WSE H;  4I1L A;  4UOY A;  1N7S B;  1T3U A;  3B1C A;  2H43 A;  1J2J B;  3MEB A;  3TQX A;  3U1A A;  3AEM C;  3BS8 A;  3UAK A;  1RF0 A;  2BI5 A;  5HDM A;  4R8D A;  3T97 A;  1GZL A;  4IXS A;  5E3K A;  1KKJ A;  3PIU A;  1PMM A;  5DX5 A;  1SZS A;  4WXB A;  4IFM A;  3AV7 A;  1LT9 C;  2A45 H;  3MAU A;  1S07 A;  4RIT A;  2W7D A;  1GL2 C;  4ISY A;  3VP8 A;  3RBL A;  3ZRR A;  3A8U X;  4UHM A;  2HOD A;  1L4A D;  2OYI B;  4RKC A;  1FZC C;  4RES B;  1ZLL A;  4F5I A;  2MJZ A;  1G2C A;  2HPC A;  2NMP A;  1TPL A;  1L0N K;  1SPA A;  1BJN A;  3U1C A;  3NTN A;  1N7S D;  3BWO A;  1JOC A;  2AY1 A;  3GHG C;  1AY5 A;  1GDT A;  2TPL A;  4BQ0 A;  2VLH A;  2WK8 A;  4LC3 A;  2AY9 A;  1M7L A;  3HD7 A;  2W8W A;  5AW0 B;  4ATP A;  1ASG A;  4LNL A;  2WT7 B;  2VMU A;  5EIG A;  1C9C A;  1FZF A;  2Q3I A;  3COG A;  5AVW B;  5CJ0 A;  1LTI C;  2AY8 A;  3NYT A;  4A6U A;  1KIL C;  4AZJ A;  1FZG A;  3B46 A;  5AW5 B;  2FNU A;  3H32 B;  3F6T A;  1GC2 A;  2R5D A;  2EGY A;  1EQ7 A;  4M2K A;  4R2N A;  4PVF A;  3E2Z A;  5AW2 B;  3EI7 A;  1H88 A;  1N31 A;  3ZRQ A;  4W7Y A;  5APV A;  1O69 A;  5EUN A;  1O4S A;  1JS6 A;  4LNJ A;  1SQB K;  1MV8 A;  2YKX A;  1VEF A;  2VMZ A;  2KLV A;  2CH2 A;  1LWU A;  2ZY4 A;  3N7N A;  1ARS A;  4AQR D;  2LKM A;  4WYC A;  4WP0 A;  1UU0 A;  4ZKU A;  1ASD A;  4WBT A;  5FT4 A;  1JY2 O;  2POH A;  3ELP A;  4F5J A;  4JYC A;  3KQG A;  4JF1 A;  1LTT C;  4OC9 A;  3TFT A;  1WYV A;  3EI9 A;  5AVT B;  3HVY A;  4K2I A;  5TF5 A;  3HUS A;  4H63 Q;  3E6G A;  3KE3 A;  2EZ2 A;  2XZR A;  4Q31 A;  5KJ7 D;  3VMZ A;  1QIR A;  5G0A A;  2QMA A;  1KKP A;  2C81 A;  4M2J A;  1QZ9 A;  2Z9U A;  3P1T A;  1D7R A;  5G2P A;  4IYO B;  5EUD A;  4Y0D A;  2QB2 A;  1AMR A;  4XJO A;  4JEX A;  2L5G B;  2VMQ A;  4M3L A;  4UQV A;  1RF0 C;  1IAY A;  3OA7 A;  1M0Q A;  4AOA A;  3B5N A;  1KIL D;  2VGV A;  3I5C A;  1GW3 A;  2Q9I A;  4F4E A;  3BCB A;  3H9X A;  4IFF A;  1TAS A;  4J5U A;  1PFF A;  4DBC A;  4A0H A;  3LID A;  1X79 B;  4PFF A;  1SZU A;  3FZ6 A;  4ADC A;  3A2A A;  4F5F A;  3O8Z A;  5DB5 A;  2XNX A;  3WKR A;  2CJG A;  3DOD A;  4XEW A;  3PGY A;  3FFR A;  2NPS B;  2Z5I A;  1DX7 A;  1V2F A;  4ATQ A;  1GK6 A;  1ASN A;  1OXO A;  3V2N A;  1HTL C;  3VK2 A;  4F5H A;  3DXW A;  3CQ6 A;  5G09 A;  4WB4 A;  3HRN A;  4UHO A;  1ZC9 A;  1M0N A;  1JTH B;  2YCP A;  1NTM K;  1KMJ A;  1SQV K;  3W1H A;  2D5Y A;  2XKM A;  2Z9W A;  5CMZ A;  1RY3 A;  2BI1 A;  4MQP A;  3NUB A;  1BJO B;  1NKN A;  1NU1 K;  1IX6 A;  5KLV K;  2QM7 A;  1WRG A;  2YHK A;  4C7N B;  2OGE A;  3IHJ A;  2AY7 A;  1EJI A;  2WSC H;  2Z1Y A;  2DR1 A;  2HOR A;  1V2D A;  2PB2 A;  2NPS D;  5G4I A;  3RK2 D;  2VYC A;  1QJ5 A;  2GMS A;  4RLG A;  3WCO A;  3RK3 C;  1X29 A;  2VGS A;  4LNM A;  2WTY A;  3EI5 A;  1EQB A;  3W1J A;  2OQX A;  3EUC A;  2W7F A;  2AAT A;  3LW5 H;  2BYJ A;  1LWU C;  4E3R A;  4XQ2 A;  4GIF A;  3DR7 A;  2ZY5 A;  4J8L A;  1B4X A;  3T32 A;  2EZ1 A;  2CST A;  1ZV8 A;  1X2A A;  2VIA A;  1G4V A;  1IO4 A;  4U2H A;  4XK1 A;  2P1J A;  1N73 C;  1YNU A;  4Y99 B;  3A7O A;  2C9L Y;  2Q7W A;  1VDF A;  5AVQ B;  5AW1 B;  2FFD B;  3HDO A;  1DGE A;  4A72 A;  1IFM A;  4A6T A;  4QGR A;  2BHX A;  3CAI A;  3KPE A;  2PO3 A;  2M8R A;  4XA4 A;  3EZS A;  2CJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...