3N7NA

Structure of csm1/lrs4 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
163
Chain Sequence
PLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Monopolin complex subunit CSM1
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 53
structure length 163
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3n7nA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n7nA02
3HRNA 3U59A 5BU8B 1IC2A 2POHA 3U1AA 5BVZA 3N4SA 4ZKPA 1NKNA 1WT6A 2JEEA 3C9IA 3N7NA 3P8CD 3N4RA 4I1LA 3N4XA 4ZKUA 4N3YB 1X79B 3BASA 3BATA 3VP9A 4N78D 3OJAB 3U1CA 3VP8A 5KTBA 4O9BA 4GIFA 2FXMA 5BU5A
chains in the Genus database with same CATH superfamily
4ATQA 4XJMA 4TMRA 1SFCC 1SQVG 1L4AC 3AEPA 3BCAA 3A2BA 2EH6A 1SQXK 4A6UA 4E77A 3TGUJ 2R32A 3AEMA 1SZKA 5B5EH 2Y0DA 4R8DA 2G3AA 1R8EA 1UU1A 2AY3A 3L75D 3W1HA 4IXOA 1SQVJ 1YJZA 4WYEA 1PMMA 2FXMA 3AEJC 2CINA 2VGUA 2HUUA 5DJUB 2CJHA 1GEWA 5EUEA 4H13B 1N73B 1AMAA 1JNMA 3H1LD 2CH1A 3A0BE 4U3FG 2YKPA 3H1JJ 1UIXA 3KQGA 5AW5B 3Q3DA 3VK2A 2D63A 3EFFK 2Y9YA 1YTZI 3L70D 4GDOA 2WT7A 2FM1A 1RE4A 1ASGA 2AEMA 3FXEA 1EQ7A 3L74J 3RL0D 3N75A 2W7IA 5C6UA 1PZQA 1FC2C 3B71A 1IK7A 1C7OA 1LJ2A 3V2RA 1NAFA 1X28A 4IX8A 3AE9C 3BATA 4ZLVA 2KFPA 5M49A 1SQBD 3I55P 1LKCA 3RK3D 1L0NG 5M4BA 1KL2A 1H89A 3HE4A 1JEKA 2R5EA 2ZT9D 3FDDA 3R4TA 2HFED 1LTSC 2KZIA 1M4NA 3HD7B 2R2NA 8AATA 4LLHA 3W67A 3RK2C 1VQ4P 3BC8A 3KPEA 5AVZB 3ZZJA 3MBBA 1L0NJ 1TATA 3AEFC 3RQ1A 4WP0A 3FZ7A 4L0OA 1WYUB 4N0WA 3CWBJ 5AW6B 2ZYGA 1SQPG 2Q1KA 5M1BA 2GQNA 3CLQA 5KKZC 4AO4A 3Q2YA 2FYUG 4OC9A 1RE4C 5FT6A 2H88C 1N7SA 1GCKA 2HLOA 4J8LA 1AJYA 5HHYA 5EAVA 2W8WA 3FZ8A 3RBLA 2W7EA 1PGJA 1VJOA 1KILB 1IAXA 4CPGA 2WSEJ 4TN4A 2E75C 3KXDA 4ZNCA 4XE5B 1EDLA 4AZKA 2GMSA 1HTLC 5KAFH 1NTZK 5APSA 1QJ5A 1GBNA 3GETA 1DJEA 4IY7A 1EZVI 2RFVA 1PIXA 4OWFA 1EDIA 1KB9H 1VQLP 4MQQA 2C9NY 3CCMP 3AEAC 3N4RA 2QJPB 1NTME 3PP5A 2LXBA 3H25A 3B1CA 1ZN5A 1PMOA 2XH1A 1NTKE 2E43A 3AE4C 1C7GA 3A0HH 3VOPA 3FDBA 2PGDA 1SF2A 3EIAA 4PV1C 3NYTA 4F4EA 1J1DC 1BW0A 2E76D 2M8RA 1K04A 1MV8A 4ZAHA 3Q8NA 3T97B 5EQCA 4AOAA 3IF4A 1CI6A 1EJIA 1H1CA 2VGTA 1VDFA 2R3CA 1BE3G 1LTJA 3PD6B 3RI6A 1GC0A 4EU1A 1N7SC 1SLQA 2JKVA 4H51A 2KS1B 3CAIA 1T3UA 2QJYC 2DKJA 2AY7A 1MAQA 1YBKA 3O6QA 1ARIA 2O01H 3JCUE 3V6IA 1GW4A 1FZFA 3FFHA 3WGBA 4A0FA 2R5CB 1VF5D 3B5ND 4H0LD 2AXCA 3L73G 1M1JB 3EI8A 3ISLA 4ZWVA 3P8CD 3WY7A 3MAFB 1QGKB 5G4JA 3HE5B 1PV3A 1OXOA 4H44B 3RBXA 2OKJA 5AX8A 2HOZA 2JO1A 3WGCA 4YTPC 4JEYA 4A0GA 4YXDC 5BU5A 2P1JA 2PAJA 3A9XA 1LS3A 4XQ2A 1BS0A 2GUSA 3CX5D 1KB9E 2W90A 3MEBA 3CXHH 1NYHA 3H1HG 1AY5A 3N7NA 1GC4A 2AY4A 1ASFA 3FZ6A 2CB1A 4AUWA 4BRYA 3P6KA 1XEYA 3W1IA 1IK9A 1AICA 3I56P 2X5FA 4IOIH 4R5FA 2JGTA 3RK3C 2EPJA 1C7NA 1LTJC 4PD4H 1N31A 3TFUA 4H13D 3H1IE 2R3SA 3L72E 1YAAA 2IX7C 4LC1A 1KQGB 2AEUA 3H1HJ 4BA4A 4ZMDA 1FZCB 1H0TA 4GT1A 3EZ1A 5KLIC 2YNYA 2XZRA 1JTHA 1NKZB 1CZCA 1IAYA 2AY1A 1IX7A 3VMYA 1JS3A 3TGUD 3CQ5A 1GD2E 1PGPA 1AKCA 1HWTC 1IFIA 4D6TJ 1KAFA 3PGYA 1QVGO 1VPCA 1P84D 2ITAA 4WY4B 2Y0CA 2BI2A 1AMRA 4EI2A 2IFMA 1L0LG 1Y4IA 4LC3A 2K9YA 4PFFA 2VGZA 4HVKA 5AVQB 2WPQA 1YJYA 4A00A 5AVRB 4K05A 2KSEA 2VMYA 3JSVC 3H1JD 4IYOA 3I4JA 2A06G 2VI8A 4K2IA 1I29A 1L0LJ 4AYCA 5JAYA 5BJ3A 2X3LA 4HKZH 1G7XA 1OVUA 5E5IA 1FS0E 1TU3F 2AEVA 3L74D 3A5TA 3HD7D 3CXHE 2BYJA 1BJOB 1ZLLA 1OATA 1FBMA 3MZWB 3VN0A 4ISYA 5GTIE 1EZVG 1AJRA 1S2EA 1SQQJ 1UKJA 2VMUA 1AAMA 3PJSK 3AE3C 1EDJA 1YTZT 2E76C 3U59A 1KZUB 4JBZA 4WBAA 1IC2A 2JJFA 1QJ3A 1BCCG 1FOSE 4WXFA 1V2FA 1N2TA 1BGYJ 1SQBK 2O1JA 1KILD 3II6A 2IFNA 1TOEA 1PGQA 1CQ8A 4R5ZA 1LP1B 1L0ND 3ABVC 3CWBD 2ZSLA 3E9KA 5G2QA 4TLFA 2YRIA 2YXQB 4RKCA 1C0NA 2OTLP 1VF5C 3B5NC 3L73E 4H0LC 2Q3EA 2V7QJ 1U08A 3L71G 1AFOA 1D7RA 1ECXA 7AATA 1NTZE 1AHGA 4RKUJ 3WZFA 1WYVB 1GL2B 1YYCA 3PDBB 2KNCA 2H7HA 2EYQA 1AQTA 1UU2A 2YKXA 1BDCA 4W80A 1CL1A 2R0TA 4JEZA 4RIZA 2QJKC 1AKBA 3K28A 1EXIA 3L71J 1AHEA 1LT9B 1DJ9A 3RBFA 1C9CA 2WWWA 2QRXA 1KFNA 1AHFA 4MY5A 5F9SA 1SZSA 3G9RA 2D64A 3AV7A 1MKMA 1VQOP 3I5CA 3D6ZA 4MN4C 3HQTA 1PP9J 3HD7A 5AW8B 4NPFX 1MZ9A 4H13C 2ZXEB 2H8PD 1IFMA 3VK4A 2OYHA 1ELQA 2KXPB 1WYUA 2YCNA 2WPVB 1WT6A 1LC7A 5AVSB 1ARSA 1QISA 1JY3N 4H44D 3SSUA 5AW4B 2JDIH 5J8QA 2AY5A 4PVFA 3DU4A 2B9BA 2HR3A 3AELA 1HH0A 1CZQA 1NU1D 2YKQA 2K3RA 4Z1MH 3ASBA 1ZRTD 2W7GA 1YQ3C 2XDJA 1ZW0A 4DCKA 3AE5C 3VYIA 2QSRA 3BCCE 4IFMA 1TPLA 3FTBA 3A7OA 3MC6A 4F5GA 2YOBA 3KGXA 4B86A 1O69A 2BWNA 3ZZKA 1TASA 2WSCJ 1GK6A 2WITA 2E74B 3B8EB 5TJHA 2FKIA 3E2ZB 1FG7A 2QBTA 3AE7C 2IZ1A 1QLED 2GMUA 4LNMA 2QLRA 2J59M 1V72A 1KKPA 1GEXA 2YCTA 1KB9I 1FJPA 3HD7C 2KOGA 4ADBA 4RESB 4E3QA 2K37A 4P7YA 1XI9A 3AOVA 1Q7YQ 2KYVA 2OYHC 1ARHA 1D7VA 4NPDA 4W1WA 1GW3A 4WY4D 3EI9A 3R2PA 2PP6A 4Q6RA 3V2QA 1OWAA 4WYGA 3B4SA 2PO3A 2N9YB 3NTNA 2ZJGA 4OMAA 2I1KA 5HXXA 1S3JA 1S72P 3SWFA 3H1HD 2QMAA 3PPLA 1TOIA 2NRGA 5TISE 1E5WA 4KT0J 1HF9A 5CCHA 2YCPA 5CCGA 3DXVA 1WYTB 3L75E 4JYBA 2RH0A 2W7HA 1OW8A 4D6TD 2ZSMA 1SFCA 4I7ZB 2N1TB 1QGNA 1L4AA 3GLMA 3QGUA 3G6EP 1OZHA 1U7JA 2Q6QA 4W1XA 3H1KJ 1V2DA 3H32B 1BKGA 1ZOBA 2QJPC 3R4YA 5AW9B 4XA4A 1S09A 2CJGA 5KLVJ 1ASNA 3A0BH 1IFJA 4GE7A 4GSAA 2G7JA 4W1VA 1LW5A 5C39A 1FC4A 3AEJA 2JR8A 4XJLA 3L70E 1ASBA 2FYNB 1BSNA 3HUSA 3WMM0 1OW7A 3CXHI 2JISA 1KQSO 4ZASA 1MAPA 3KHUA 1VQ9P 3M9BA 3ZRQA 3NU8A 1OXPA 3A8UX 3T32A 1D7SA 2BWOA 2K1AA 2NPSB 2QM8A 3CC7P 1GC2A 3GW6A 2Z4EA 2M5AB 3EI5A 1NTMG 1BJWA 4OVNF 2FYZA 3VMZA 1SQQD 4B9BA 2RMZA 5CCHC 3OJAB 1SQBE 1NTKG 3RK3E 2CY8A 2Q9IA 3NU7A 4MSOA 2WZ7A 4IXSA 2I1JA 1U7MA 2BI3A 5APWA 1FDMA 2FBWC 1J1EC 2E5YA 2VIBA 1E79H 4A0RA 3LY1A 4OTLA 5G09A 1KMKA 2JEEA 1NTMJ 2V0YA 1BGYD 2V1PA 1KL1A 3EUCA 4F5HA 3LVJA 1GL2D 3K5BA 1Q2NA 5EIGA 4DJGA 2XNXA 3FKDA 3NXSA 3P8MC 5CMZA 1RQUA 2F8JA 2VI9A 3FVXA 1Z56A 4XFJA 1MLYA 4C7NA 2KK7A 1EC5A 3D6YA 1YJWP 3HMUA 1OMIA 4XJOA 1FZEA 4UB8E 2RN0A 1LGHB 3HUSC 2B88A 2ZYDA 3NMDA 2X8UA 4KXKA 3MP7B 2BYLA 1N2DC 3M0DA 1URQB 3F6TA 1LW4A 3CC4P 1B5OA 3AENB 1B9HA 3WCNA 1C4KA 4I2LC 1LNQA 5KTBA 1FZCC 1S0AA 4CBRA 1PG8A 1ZV8A 4U3FJ 5GTHE 1LTIC 1D7MA 1BJ4A 3MHVA 3L71D 3AEEC 3MD0A 4RO0A 2ZC0A 3FQAA 2K9JA 1SFFA 3PHLA 2KZJA 3V4QA 5AW1B 4ASWA 1NH4A 2ZVOB 2KUBA 3SWYA 1PP9D 3TFTA 2CTZA 1PFFA 1EG5A 1X22A 3TNUA 2GM4A 4WB4A 2ZXXA 1W2BO 1K8AQ 4K2MA 3FXDA 3PTZA 3VMXA 4ASVA 3H1IG 4EMYA 3L72G 3TF5A 3QN6A 1LWUB 2UWJE 4K3AA 1G1JA 2E74D 1JO5A 1KYOH 3RCHB 3L37A 3CCSP 2VGSA 2I8DA 4I6MC 2HOXA 3M0DC 3H1IJ 4M2MA 2C0RA 3PJ0A 4ITXA 3MTUE 3CCLP 3OAKA 3FVSA 5TF5A 3IFMA 1ASEA 4BWNA 1JY3P 1NU1K 3E1RA 2VMXA 1M32A 1M7YA 4JEWA 3JCUH 3P8CE 5F8VA 4EFFA 3A3YB 1IX6A 3TDKA 2OYIB 2WK7A 1QL2A 2X5DA 1SQPJ 4Y0HA 2AY2A 2E7JA 4BXLA 4ZDPA 1EXJA 2HPCA 4GIFA 3HDOA 1CSBA 1JY2N 2FYUJ 2O01J 3GG2A 4HJGH 1YOOA 1ASAA 4U7JA 5APYA 1A02J 2VMPA 3F0HA 3CX5E 2C81A 3L36A 3AEDC 5APQA 3LG0A 3N4SA 4RJTA 3NTJA 3D70A 4Y99B 2FFDA 2ZFCA 2HUIA 2HODB 3ECDA 1VEFA 4BA5A 2N1TD 3TCMA 2KB7P 4AO9A 2PB0A 5CBOA 2JJHA 2H89C 1A02F 5APVA 2AY6A 3LVLB 1ASDA 4UB6E 2ZVNB 1H88A 3FD0A 5AVXB 4F5IA 1LTTC 3P32A 1IBJA 1ORDA 2OATA 1X9VA 1AHXA 3TGUE 1T8ZA 3G0TA 2J5UA 1KYOE 1MGVA 5IWQA 1DX7A 1JUNA 1GL2C 1WRGA 3P7KA 3Q5RA 4U1TA 1P84E 2YO2A 3BCBA 2WSSH 2D7ZA 1DKAA 2BEZF 3WKRA 5M4DA 1VQ7P 3DRDA 2BEQD 3H1KD 4KAMA 2NPSD 1RQVA 2Q7CA 1BE3J 5KLVD 1JY3O 1O4SA 3KGWA 3AEGC 3H1JE 1ASCA 5DX5A 2FFDC 3GF3A 2GA1A 1NTZG 1M0PA 3N5MA 1S4XA 3FQ8A 1FOSF 4WLJA 3M06A 1I43A 1M0QA 3AEOA 3RBZA 3WU2E 3RL0C 3PDXA 3L74E 2JP3A 3L73J 2QSIA 2VLHA 3FGAD 2XBNA 2CPBA 1JMMA 4PFNA 2AY8A 1I48A 4IL6H 4L75A 1SP4A 3W68A 1SQXE 3UIAA 1AJSB 5GTIH 4GRXA 1V2EA 2ZY3A 1VL2A 1WKHA 1AIBA 1CS1A 3HL2A 1GD9A 2VIAA 4XAUA 2PFXA 3M9HA 3V4WA 5APUA 4CXRA 2ZT9C 1S06A 2O3JA 3N0LA 2BCCE 1S08A 1QX8A 1SQQK 3HTKA 2Y9ZA 2ZY5A 1CL2A 4CBSA 2E74C 1MUUA 1URQD 4KJMA 1HJBA 3LW5H 3BRVB 2HP2A 3GF7A 1PPJD 5E4ZA 4Q31A 2W27A 3CWBE 1SQVD 4Q75A 1ARGA 2O1KA 2N9BA 2Z9UA 5B66H 4GE9A 4WB0A 1VQ8P 1RVYA 3BCCG 3MGNA 3EI6A 2QIWA 4TT3H 2K88A 2OQQA 3BWOA 4N3YB 1PL5A 1WSTA 2CPSA 3PRJA 1HJ0A 5G4IA 2C0WA 2CK3H 3CCRP 2FNUA 3KKIA 3TYYA 3LV2A 2DOUA 1Q86Q 3AE6C 2D66A 2B87A 3B5NA 3BCCJ 4GOFA 3OA7A 1G2CA 1K73Q 5EUNA 4U3FD 2YKOA 4IL6E 1ZMEC 4I7ZC 3NX3A 2BIAA 1ARTA 1JMBA 3RUYA 3AE2C 3E7KA 2WKAA 2AXTE 4BMKA 2IYPA 2FXOA 5AVYB 1M0NA 1KB9D 1FDOA 2Z1YA 5CHXA 5H2FE 1OFCX 2WT7B 2C44A 2WSFJ 2FYNC 1G7WA 4HF8A 1TOJA 1N73A 3MADA 3WX9A 4IL6X 1NU1E 4GOEA 3SFEC 3L75G 5AW3B 2EZ2A 1BCCJ 1K9MQ 3FRKA 5KAIH 1ELUA 4IFFA 1URQA 2E75B 5B66E 1RF0C 4IFDK 3AENA 5AVVB 1YHQP 1I41A 1YITP 1AX4A 2NPSC 4LGDE 4LW4A 3Q5SA 2KLVA 1OXZA 5CJ4A 2WMMA 3L75J 2YKUA 3MUDA 3HE4B 4MKJA 4DT0A 3W1JA 4EDFA 1XTGB 1NHLA 3RL0g 3QWOC 1SQPD 2YHKA 5EAAA 2NMPA 3L70G 3CX5I 3V2NA 1E5FA 4UQVA 3EQ2A 4ADDA 5DB5A 1T2KD 2FYUD 2A1VA 1OVRA 4PV1B 1DGDA 1J1DB 1X29A 5CJ0A 3USFA 1Q81Q 3DYDA 3OW2O 1KN7A 3F5HA 1GDEA 2G6WA 1J04A 1FE6A 1KD1Q 3NYUA 3BRTB 2SPZA 2L5GB 2G8YA 3NFQA 1JY2P 2WSFH 1NGMB 1NJIQ 1N7SB 2HZPA 3UAKA 3LIEA 1N73C 1SQBG 2KSJA 4RITA 1X2AA 3GZCA 3CXHD 3LVMA 1KYOI 2BASA 1URQC 4L73A 2XKMA 1MLZA 1JCCA 1P84I 5KJ7D 5TISH 3JW9A 1DEBA 3O8ZA 4N78E 4D6TE 2CANA 3AOWA 1FJKA 4RLGA 1KC8Q 4PD4D 5KAIE 3TQXA 3VP8A 4O9BA 3MUDC 2YO3A 3M9QA 4QMAA 1JOCA 1IJDB 2P2UA 1KILA 4KYOA 3E77A 3NRAA 4K35A 4Y0IA 3E1IA 1M8OB 2CFBA 1VQ5P 3C8VA 5EFSA 1NO4A 1BE3D 3N4XA 3AATA 3IHJA 3A9ZA 1W23A 1CI6B 4ZSYA 4ADEA 5KLVK 2A45H 2Z20A 4HH2A 1LTJB 1VQNP 2IBZE 3G3ZA 4F5LA 3L73D 4EYYQ 1DFOA 2IYOA 1GU4A 4IW7A 2QG4A 2VMQA 5KLIB 3NUIA 3T97A 3O6QB 1SQQE 3L4FA 5E3KA 2WVRA 1IO4A 4K2BA 1AMSA 5D95A 1JY2O 3C1LA 1JF9A 4O6ZA 3PD6A 1SPAA 1FZAA 3TATA 2KS1A 3ASAA 1D2FA 2OYIC 4WYDA 4W7YA 3EWKA 4B98A 1KILC 1BGYE 2EO5A 2JWAA 2FN6A 4ZKUA 1UIIA 4BHDA 2FY8A 3MAUA 2R44A 2YIUB 2KI7B 4DBCA 2E42A 2R5CA 1AAWA 4F5MA 1M1JA 4JF1A 3EZSA 3CD6P 3MAFA 4PIWA 3HE5A 1FDIA 2VMSA 1CJ0A 2C9LY 4BRYB 1W3UA 3H1LE 4A6TA 3ELEA 2OGEA 3FVUA 4UB8H 1SQVK 5AW7B 1MDZA 1X8YA 3GJUA 4GE4A 4PJ0E 1QVFO 2H43A 3WLXA 1X79B 2O1BA 1UU0A 3AEBC 3Q5PA 4W5KA 1RF1B 1KORA 4BQ0A 1G4XA 1H0TB 4JF0A 2D2CB 4C7RA 4M2KA 1L2PA 1K05A 1L0LD 3S9OA 4W8IA 1VP4A 2JJGA 1DEEG 3BCCD 2OARA 1O61A 4WVZA 1T3JA 1BDDA 2W6BA 5GTHH 1KTMA 1B4XA 3CBFA 1S9KD 1NOHA 2A06D 1YJSA 1FZCA 1KV4A 3FWLA 1IFNA 4DZOA 3FX0A 3P1TA 4AH3A 4GODA 1N7LA 2OYOA 2B89A 2YXRB 2E75D 3QI6A 9AATA 2QVAA 1PP9E 2E7IA 4GDYA 1W2EA 1Q90D 3VTPC 5DJ9A 1M1JC 1ZR2A 4Q76A 3F89A 4JQ0D 3KDPB 2Q5UA 4WY4A 3COGA 4H44C 2KIKA 3FFRA 1XTCC 1EZVD 3UE8A 3TGUG 2W6JH 1NTKJ 1SVFA 3PA9A 1M1KQ 3A9YA 4PV1D 1KQLA 1KFMA 1BCCD 1GTWA 2VMTA 1M7LA 2WPRA 1Z3ZA 3E2YA 3AECC 1O62A 3HVYA 1L0NK 3MIWA 2QJKB 4UHOA 3OP7A 1HGZA 3M91A 4F5JA 3H1JG 1N7SD 2WB6A 1BJOA 4N6JA 1S07A 1OVVA 1KQFB 4KHXA 3VK3A 3ZRRA 3EI7A 1M6SA 5I92A 5AVWB 1QEXA 2D7YA 3VOMA 2VMRA 2HP1A 2W7FA 3KZIH 2VMOA 3L74G 1SS1A 1SQPK 3CX5H 1W5CE 2VMWA 1WMKA 1H0CA 3A2AA 5K5GB 2E54A 1YIYA 2ZYJA 4JEVA 1GK4A 1ASMA 2BHXA 2FYUK 3ATHA 1X0TA 3M0AA 1GZLA 1RE3C 4WY4C 4EB5A 3RGUA 4Y0DA 3DR4A 1SQXG 1VQMP 2YKYA 2EZ1A 5D5SA 4UB6H 1LP1A 2P7JA 1OHYA 4ZWMA 1AY4A 2BCCG 5E79E 1RVUA 2KNCB 3CMEP 1SQXJ 1OHWA 3AEMC 3CCQP 1USEA 2P10A 4RJYA 1EDKA 3H9XA 4J5UA 1P84H 5G0AA 2Z1ZA 3L72J 4YPCA 4ITGA 3CWBG 2BCCJ 3IN6A 3H1KE 2KP8A 2W6AA 1WYVA 2P58A 1GL2A 3PDBA 5B5EE 5KLVE 4F5FA 1YNUA 1ZXGA 3HLMA 4L76A 1HUCA 4UHMA 3CPWO 2FQ6A 1LT9A 4AQRD 1RH5B 3PLNA 3CCJP 2FKWB 2OYHB 2OGAA 2Z9VA 4ZM3A 1DTYA 1GEYA 1JM0A 1W7NA 3G7QA 2ZYAA 2CH2A 2IBZI 2BWPA 3KZIE 3WU2H 4OYTA 3AE1C 3KYQA 1X0MA 1M57D 4OBUA 4Y28J 3Q1MA 2BI5A 1JG8A 3G71P 1T6AA 3E6GA 4OCAA 1MDOA 2Z9WA 1AQ5A 4HYTB 3KE3A 4ZDLA 3IR9A 3GHGB 3CL3D 2VMNA 4MQPA 3L35A 5BU8B 4L74A 3BVHA 2WK8A 2AEFA 3HBXA 4UOYA 2HYNA 2BI9A 3VMAA 3G4SP 4HB1A 3L44A 2Z5HA 1E5EA 2XV5A 3CMAP 2ZJSE 2PB2A 2D2CD 2VGVA 3VP9A 1PPJE 2JG2A 1OHVA 2Y0EA 1ZP0C 2W8UA 4DGTA 1NU1G 1SQVE 2QEXP 1LT9C 3DR7A 1ASLA 3MKJA 1IUGA 3E2ZA 1GMJA 2AY9A 1NVOA 2ZY2A 1OX3A 3LW5J 1B8GA 4OGQB 3ACZA 4MQRA 2FXPA 1NU1J 2A45I 3BASA 3USSA 3JWAA 1GDTA 2VMZA 1ZR4A 1DH3A 4DQ6A 3NUBA 1AVYA 1ZODA 2WQYC 2WSEH 2ZP7A 1ZC9A 3H6PA 3R9AA 2FNIA 1YIZA 2LR2A 4U3FE 1M90Q 1H8AA 2O7CA 5BVZA 1TARA 1SFCB 3SWKA 4P3MA 1L0LK 4FFCA 1L4AB 1J1EB 2QE7H 1DIPA 1NTZJ 2W8JA 3QHXA 3S4RA 4I8AA 3OKSA 3BN1A 3BWNA 3GZDA 4JF7A 3EFGA 2VMVA 1BQAA 1NAYA 1LC5A 5KAFE 4M2JA 4E3RA 2AXTH 1WYTA 2DW3A 2GB3A 2OQXA 2MKVA 1QL1A 1M0OA 4EOTA 2N1TA 1SVVA 4ATPA 2M3BA 2QM7A 3B1DA 2HORA 2BIEA 4WXBA 1KILE 2ORDA 4JYCA 3HUSB 3L8AA 5H2FH 1NTMD 1GC3A 3H32A 5HDMA 3A0HE 2WK9A 4R2NA 3JWBA 1NTKD 2ZAEB 4C46A 1YJNP 1L0NE 1AVOA 1ZOYC 3CQ4A 4AZJA 1USDA 5APXA 4D6TG 1VQKP 1BJNA 4OT8A 3DODA 2D5YA 2DR1A 5M46A 1IX8A 1RF1A 1TOKA 1AA0A 4M3LA 2J58A 1BQDA 1FG3A 3LWSA 1B9IA 1KYOD 1Z7DA 1MFZA 1B5PA 2Q7WA 2EGYA 2OGUA 1LTBC 3JZLA 1SQPE 1RF0A 1DD4A 2W8ZA 1AY8A 1KKJA 1RHZB 1P3WA 2NPSA 3BCXA 3BWNC 3D6KA 3E2FA 3GZDC 2CJDA 2FYUE 4CXQA 2XU6A 3IAOA 3G8MA 2M5AA 5EIGB 3VAXA 1Y9BA 4ZKPA 2R5DA 2IBZG 2YIUC 1RV3A 1KMIZ 2LXCB 4LW2A 2Q3IA 2DGMA 4C7NB 3K7YA 1FZGA 2N1TC 3WUTA 2YMKA 3RK2B 2QA4P 3WCOA 1SQQG 1FZBA 4JEXA 2HG5D 3B46A 1YI2P 3I5TA 4GEBA 2POHA 2MJZA 3NNKA 2HUFA 4LNJA 4A0HA 1NKNA 1G1IA 1Y8AA 3TSIA 3D71A 5AVTB 3C9IA 5KKZB 1RF1C 2D61A 1W7LA 1LT1A 4I1LA 3ITKA 2D2CC 4WXGA 1BGYG 2W7LA 1U57A 3HT4A 1DD3A 1SQXD 4PD4E 4ZM4A 4FL0A 1IZNB 1ZRTE 4RJ0A 1CQ6A 2K9JB 3H1ID 2W7KA 3FQ7A 3L72D 5G2PA 2QB2A 2BCCD 4YXWH 1HBWA 2AEJA 1Q82Q 4EIJA 1DJUA 2W83C 3BS8A 1FU1A 1BE3E 3H1LG 3TNUB 3FCRA 1JCDA 2Z9XA 2C0XA 4CVQA 3WKSA 2XNDH 1CQ7A 2A45G 1QITA 3QBOA 3VP6A 3H1LJ 3UWCA 4JPZB 2DGLA 1QZ9A 1OIPA 1WKGA 3S1KA 4GKGA 5BJ4A 1IVRA 3M5UA 2VLFA 3L70J 1LWUA 1BT4A 1KMJA 2E7UA 4H63Q 3U1CA 1N8PA 2HOYA 1M56D 4A6RA 2L91A 3GBXA 4ZDOA 1IFPA 1PP9G 4WYAA 3RCHA 4OGQD 5AW2B 5DJTB 2QJYB 2O01N 4XEWA 2NZ2A 3H1HE 2YKVA 3ELPA 2CSTA 4EB7A 2HPCB 2M3EA 3GR9A 1YQ4C 3JC22 4UHNA 4XJPA 1MDXA 4LNLA 3K40A 3CCUP 1JS6A 3GWPA 2C7TA 1SQBJ 1W7MA 4WYFA 5CCHD 4NPEA 5AVUB 4F5KA 5CCGD 2FFDB 2GUVA 1S5LH 1N8RQ 1LTAC 2OYIA 3B1EA 3GSBA 5AW0B 4OBVA 3I16A 5FT4A 2OKKA 1SFCD 2E5TA 2JJEA 1L4AD 1LTGC 2IPPA 1CZEA 3CCVP 3RL0B 5FT8A 2LKMA 3TK1A 2BKWA 1SZUA 2V7QH 4RKDA 3DZZA 4PJ0H 1YJ9P 2WTYA 1JB0J 2HODA 1L0LE 2BI1A 1RV4A 3BB8A 2W8VA 2IDBA 1LWUC 5CBNA 4ADCA 3PH0A 1J32A 3RK3B 4W91A 3DC1A 5DJ1A 2W7JA 3GHGA 3V2PA 1GU5A 2ZT9B 4MKKA 3AE8C 1S9KE 2A06E 1S1CX 1NTZD 1LC8A 1HGVA 2Z61A 4R4MA 1VQPP 4WWIA 2V4HA 1J2JB 2BIGA 1T3IA 2IZ0A 5L8RJ 3WUUA 1D7UA 2VYCA 3U1AA 3NYSA 4A72A 2OTKE 2ZY4A 3JTXA 1R5LA 1EZVE 1FAVA 2P67A 1EQBA 1PFIA 4QGRA 4RAEA 2OTJP 1HVVA 1PGOA 5EUDA 2KLUA 2PRRA 3FWNA 3GMAA 1DGEA 1S5LE 3PIUA 4W7ZA 2R5BA 2TPLA 1BCCE 1AMQA 3HRNA 1AV1A 1NTMK 4Y99C 1Y47A 2QB3A 3LIDA 2YRRA 1CW5A 3F9TA 1NTKK 3V5BA 2JJLA 2W7DA 4WLHA 4R4LA 5KJ7A 1BSHA 4WBTA 3H1KG 2JWDA 3II0A 3FSLA 2RKLA 2W7MA 2FYFA 5KLVG 4A7PA 3RK2D 3MC6C 3GHGC 3QPGA 1AKAA 1MFTA 4N78D 4E1OA 1N86A 3HTKB 1OW6A 5EFWB 4IXZA 2WSCH 2O0RA 4RM1A 4WYCA 1JTHB 3B8XA 3H7FA 1T2KC 1S5LX 2WPSA 3LVKA 1LK9A 1R5SA 1NWQA 1RY3A 1AJSA 1TOGA 4WD2A 2W8TA 1QIRA 2E76B 2AATA 3CI9A 3L71E 2VGWA 3SFDC 2QA3A 3BV0A 1G4VA 3NDNA 4DOJA 3DXWA 3CC2P 2GSAA 4WB0B 2M0BA 3QH9A 3WUVA 1IFDA 4OGQC 1AIAA 5APTA 2DGKA 4ZSWA 2D65A 2YMYA 2ZUKA 4NOGA 4IYOB 2IBZD 2Z5IA 3QM2A 3ZDMA 1IJIA 1YIJP 1RE3A 3CCEP 1VQ6P 2B87B 1VF5B 3B5NB 4H0LB 2VRSA 5E79H 5KJ7C 4PD4I 4U2HA 1G2CB 4OH8B 2DKBA 1AHYA 3CQ6A 5FT5A 5K8BA 5CCGC 1PPJG 4XK1A 3ZRPA 3EIBA 3PAAA
chains in the Genus database with same CATH topology
4ATQA 4XJMA 4TMRA 1SFCC 1L4AC 3AEPA 3BCAA 3A2BA 2EH6A 1SQXK 4A6UA 4E77A 2R32A 3AEMA 1SZKA 4R8DA 1UU1A 2AY3A 3W1HA 4IXOA 1YJZA 4WYEA 1PMMA 2FXMA 3AEJC 2CINA 2VGUA 2HUUA 2CJHA 1GEWA 5EUEA 1N73B 1AMAA 1JNMA 2CH1A 2YKPA 3KQGA 5AW5B 3VK2A 2D63A 1YTZI 2WT7A 2FM1A 1RE4A 1ASGA 1EQ7A 3RL0D 3N75A 2W7IA 5C6UA 1C7OA 3V2RA 1NAFA 1X28A 4IX8A 3BATA 4ZLVA 2KFPA 5M49A 1LKCA 3RK3D 5M4BA 1KL2A 1H89A 3HE4A 2R5EA 3FDDA 3R4TA 2HFED 1LTSC 1M4NA 3HD7B 2R2NA 8AATA 4LLHA 3RK2C 3BC8A 3KPEA 5AVZB 3ZZJA 3MBBA 1TATA 3RQ1A 4WP0A 3FZ7A 4L0OA 1WYUB 4N0WA 5AW6B 2GQNA 3CLQA 4AO4A 4OC9A 1RE4C 5FT6A 1N7SA 1GCKA 2HLOA 4J8LA 5HHYA 5EAVA 2W8WA 3FZ8A 3RBLA 2W7EA 1VJOA 1KILB 1IAXA 4TN4A 4XE5B 4AZKA 2GMSA 1HTLC 1NTZK 5APSA 1QJ5A 1GBNA 3GETA 1DJEA 4IY7A 2RFVA 4MQQA 2C9NY 3N4RA 3PP5A 3B1CA 1ZN5A 1PMOA 2XH1A 2E43A 1C7GA 3VOPA 3FDBA 3EIAA 1SF2A 3NYTA 4F4EA 1J1DC 1BW0A 2M8RA 1MV8A 4ZAHA 3Q8NA 5EQCA 4AOAA 1CI6A 1EJIA 1H1CA 2VGTA 1VDFA 2R3CA 1LTJA 3PD6B 3RI6A 1GC0A 4EU1A 1N7SC 1SLQA 4H51A 3CAIA 1T3UA 2DKJA 2AY7A 1MAQA 1ARIA 2O01H 3FFHA 4A0FA 1GW4A 1FZFA 3WGBA 2R5CB 3B5ND 1M1JB 3EI8A 3ISLA 4ZWVA 3P8CD 3WY7A 3MAFB 5G4JA 3HE5B 1OXOA 2OKJA 5AX8A 2HOZA 3WGCA 4JEYA 4A0GA 5BU5A 2P1JA 2PAJA 3A9XA 1LS3A 4XQ2A 1BS0A 2GUSA 3MEBA 1AY5A 3N7NA 1GC4A 2AY4A 1ASFA 3FZ6A 2CB1A 4AUWA 3P6KA 1XEYA 3W1IA 1IK9A 1AICA 2X5FA 4R5FA 2JGTA 3RK3C 2EPJA 1C7NA 1LTJC 1N31A 3TFUA 2AEUA 1YAAA 2IX7C 4LC1A 4BA4A 1FZCB 3EZ1A 4GT1A 2YNYA 2XZRA 1JTHA 1NKZB 1CZCA 1IAYA 2AY1A 1IX7A 3VMYA 1JS3A 3CQ5A 1GD2E 1AKCA 1HWTC 1IFIA 3PGYA 1VPCA 4WY4B 2BI2A 1AMRA 2IFMA 1Y4IA 4LC3A 4PFFA 2VGZA 4HVKA 5AVQB 2WPQA 1YJYA 4A00A 5AVRB 4K05A 2VMYA 4IYOA 3I4JA 2VI8A 4K2IA 1I29A 4AYCA 5JAYA 5BJ3A 2X3LA 1G7XA 5E5IA 2AEVA 3A5TA 3HD7D 2BYJA 1BJOB 1ZLLA 1OATA 1FBMA 3VN0A 4ISYA 1AJRA 1UKJA 2VMUA 1AAMA 1YTZT 3U59A 1KZUB 4WBAA 1IC2A 2JJFA 1QJ3A 1FOSE 4WXFA 1V2FA 1N2TA 1SQBK 2O1JA 1KILD 3II6A 2IFNA 1TOEA 1CQ8A 4R5ZA 2ZSLA 3E9KA 5G2QA 2YRIA 4RKCA 1C0NA 3B5NC 1U08A 1AFOA 1D7RA 1ECXA 7AATA 1AHGA 3WZFA 1WYVB 1GL2B 1YYCA 3PDBB 2H7HA 2EYQA 1UU2A 2YKXA 4W80A 1CL1A 2R0TA 4JEZA 4RIZA 1AKBA 3K28A 3RBFA 1AHEA 1LT9B 1DJ9A 1C9CA 2WWWA 1KFNA 1AHFA 4MY5A 5F9SA 1SZSA 2D64A 3AV7A 3I5CA 3HQTA 3HD7A 5AW8B 1MZ9A 2ZXEB 2H8PD 1IFMA 3VK4A 2OYHA 1ELQA 1WYUA 2YCNA 1WT6A 1LC7A 5AVSB 1ARSA 1QISA 1JY3N 5AW4B 5J8QA 2AY5A 4PVFA 3DU4A 3AELA 1HH0A 1CZQA 2YKQA 3ASBA 2W7GA 2XDJA 3VYIA 2QSRA 4IFMA 1TPLA 3FTBA 3A7OA 3MC6A 4F5GA 2YOBA 3KGXA 4B86A 1O69A 2BWNA 3ZZKA 1TASA 1GK6A 2WITA 3B8EB 3E2ZB 2FKIA 1FG7A 2QBTA 2GMUA 4LNMA 2QLRA 2J59M 1V72A 1KKPA 1GEXA 2YCTA 1FJPA 3HD7C 2KOGA 4ADBA 4RESB 4E3QA 4P7YA 1XI9A 3AOVA 2KYVA 2OYHC 1ARHA 1D7VA 4W1WA 1GW3A 4WY4D 3EI9A 3R2PA 2PP6A 4Q6RA 3V2QA 1OWAA 4WYGA 2PO3A 3NTNA 2ZJGA 4OMAA 2I1KA 5HXXA 3SWFA 3PPLA 2QMAA 1TOIA 1E5WA 5CCHA 2YCPA 5CCGA 3DXVA 1WYTB 4JYBA 2W7HA 2ZSMA 1SFCA 2N1TB 1QGNA 1L4AA 3QGUA 4W1XA 1V2DA 3H32B 1BKGA 1ZOBA 5AW9B 4XA4A 1S09A 2CJGA 1ASNA 1IFJA 4GE7A 4GSAA 2G7JA 4W1VA 1LW5A 1FC4A 3AEJA 4XJLA 1ASBA 3HUSA 3WMM0 2JISA 4ZASA 1MAPA 3M9BA 3ZRQA 3NU8A 1OXPA 3A8UX 3T32A 1D7SA 2BWOA 2NPSB 2QM8A 1GC2A 2Z4EA 3EI5A 1BJWA 2FYZA 3VMZA 4B9BA 3OJAB 5CCHC 2CY8A 2Q9IA 3NU7A 4MSOA 2WZ7A 4IXSA 2I1JA 2BI3A 5APWA 1FDMA 1J1EC 2VIBA 4A0RA 3LY1A 4OTLA 5G09A 1KMKA 2JEEA 2V0YA 2V1PA 3EUCA 1KL1A 4F5HA 3LVJA 1GL2D 5EIGA 2XNXA 3FKDA 3NXSA 3P8MC 5CMZA 2F8JA 3FVXA 2VI9A 1Z56A 1MLYA 4C7NA 3HMUA 4XJOA 1FZEA 1LGHB 3HUSC 3NMDA 2X8UA 4KXKA 2BYLA 1N2DC 3M0DA 1URQB 3F6TA 1LW4A 1B5OA 3AENB 1B9HA 3WCNA 1C4KA 4I2LC 5KTBA 1FZCC 1S0AA 4CBRA 1PG8A 1ZV8A 1LTIC 1BJ4A 3MD0A 2ZC0A 3FQAA 1SFFA 3EIBA 3V4QA 5AW1B 1NH4A 3SWYA 3TFTA 2CTZA 1PFFA 1EG5A 3TNUA 2GM4A 4WB4A 4K2MA 3VMXA 4EMYA 3QN6A 1LWUB 1G1JA 1JO5A 3RCHB 3L37A 2VGSA 4I6MC 2HOXA 3M0DC 4M2MA 2C0RA 3PJ0A 4ITXA 3MTUE 3OAKA 3FVSA 5TF5A 3IFMA 1ASEA 1JY3P 1NU1K 2VMXA 1M32A 1M7YA 4JEWA 5F8VA 3P8CE 4EFFA 3A3YB 1IX6A 2OYIB 2WK7A 1QL2A 2X5DA 4Y0HA 2AY2A 2E7JA 4ZDPA 2HPCA 4GIFA 3HDOA 1CSBA 1JY2N 1YOOA 1ASAA 5APYA 1A02J 2VMPA 3F0HA 2C81A 3L36A 5APQA 3LG0A 3N4SA 3NTJA 4Y99B 2FFDA 2ZFCA 2HUIA 2HODB 3ECDA 1VEFA 4BA5A 2N1TD 3TCMA 2KB7P 4AO9A 2PB0A 2JJHA 1A02F 5APVA 2AY6A 3LVLB 1ASDA 1H88A 3FD0A 5AVXB 4F5IA 1LTTC 3P32A 1IBJA 1ORDA 2OATA 1X9VA 1AHXA 1T8ZA 3G0TA 1MGVA 5IWQA 1DX7A 1JUNA 1GL2C 1WRGA 3P7KA 4U1TA 2YO2A 3BCBA 2D7ZA 1DKAA 3WKRA 5M4DA 3DRDA 4KAMA 2NPSD 2Q7CA 1JY3O 1O4SA 3KGWA 1ASCA 5DX5A 2FFDC 1M0PA 3N5MA 3FQ8A 1FOSF 4WLJA 3M06A 1I43A 1M0QA 3AEOA 3RL0C 3PDXA 2VLHA 2XBNA 2CPBA 1JMMA 4PFNA 2AY8A 1I48A 1SP4A 3UIAA 1AJSB 4GRXA 1V2EA 2ZY3A 1WKHA 1AIBA 1CS1A 3HL2A 1GD9A 2VIAA 4XAUA 3M9HA 5APUA 3V4WA 4CXRA 1S06A 3N0LA 1S08A 1SQQK 3HTKA 2ZY5A 1CL2A 4CBSA 1MUUA 1URQD 1HJBA 3LW5H 3BRVB 2HP2A 5E4ZA 4Q31A 2W27A 4Q75A 1ARGA 2O1KA 2N9BA 2Z9UA 4GE9A 4WB0A 1RVYA 3MGNA 3EI6A 3BWOA 4N3YB 1WSTA 2CPSA 5G4IA 2C0WA 3KKIA 2FNUA 3TYYA 3LV2A 2DOUA 2D66A 3B5NA 3OA7A 1G2CA 5EUNA 2YKOA 3NX3A 2BIAA 1ARTA 3RUYA 2WKAA 4BMKA 5AVYB 1M0NA 2Z1YA 5CHXA 2WT7B 2C44A 1G7WA 4HF8A 1TOJA 1N73A 3MADA 3WX9A 5AW3B 2EZ2A 3FRKA 1ELUA 4IFFA 1URQA 4IFDK 1RF0C 3AENA 5AVVB 1I41A 1AX4A 2NPSC 4LGDE 4LW4A 2KLVA 1OXZA 5CJ4A 2YKUA 3MUDA 3HE4B 4MKJA 3W1JA 1XTGB 1NHLA 2YHKA 5EAAA 2NMPA 3V2NA 1E5FA 4UQVA 3EQ2A 4ADDA 5DB5A 1T2KD 2A1VA 1DGDA 1J1DB 1X29A 5CJ0A 3USFA 3DYDA 1GDEA 2G6WA 1J04A 3NYUA 3BRTB 2L5GB 3NFQA 1JY2P 2WSFH 1N7SB 2HZPA 3UAKA 3LIEA 1N73C 2KSJA 4RITA 1X2AA 3GZCA 3LVMA 2BASA 1URQC 2XKMA 1MLZA 1JCCA 5KJ7D 3JW9A 1DEBA 3O8ZA 4N78E 2CANA 3AOWA 1FJKA 4RLGA 3TQXA 3VP8A 4O9BA 2YO3A 3M9QA 1JOCA 1IJDB 2P2UA 1KILA 4KYOA 3E77A 3NRAA 4Y0IA 3E1IA 2CFBA 5EFSA 1NO4A 3N4XA 3AATA 3IHJA 3A9ZA 1W23A 1CI6B 4ZSYA 4ADEA 5KLVK 2A45H 2Z20A 4HH2A 1LTJB 3G3ZA 4F5LA 1DFOA 1GU4A 4IW7A 2VMQA 3NUIA 3T97A 3L4FA 5E3KA 1IO4A 4K2BA 1AMSA 5D95A 1JY2O 1JF9A 4O6ZA 3PD6A 1SPAA 1FZAA 3TATA 3ASAA 1D2FA 2OYIC 4WYDA 4W7YA 4B98A 1KILC 2EO5A 2FN6A 4ZKUA 4BHDA 3MAUA 4DBCA 2E42A 2R5CA 1AAWA 4F5MA 1M1JA 4JF1A 3EZSA 3MAFA 4PIWA 3HE5A 2VMSA 1CJ0A 2C9LY 1W3UA 4A6TA 3ELEA 2OGEA 3FVUA 1SQVK 5AW7B 1MDZA 1X8YA 3GJUA 4GE4A 2H43A 3WLXA 1X79B 2O1BA 1UU0A 4W5KA 1RF1B 4BQ0A 1G4XA 4JF0A 4C7RA 4M2KA 4W8IA 1VP4A 2JJGA 2OARA 1O61A 1T3JA 2W6BA 1B4XA 3CBFA 1S9KD 1NOHA 1YJSA 1FZCA 1IFNA 4DZOA 3P1TA 4AH3A 1N7LA 3QI6A 9AATA 2E7IA 4GDYA 1W2EA 3VTPC 5DJ9A 1M1JC 1ZR2A 4Q76A 3KDPB 2Q5UA 4WY4A 3COGA 3FFRA 1XTCC 3UE8A 1SVFA 3PA9A 3A9YA 1KQLA 1KFMA 1GTWA 2VMTA 1M7LA 2WPRA 1Z3ZA 3E2YA 1O62A 3HVYA 1L0NK 3MIWA 4UHOA 3OP7A 1HGZA 3M91A 4F5JA 1N7SD 2WB6A 1BJOA 4N6JA 1S07A 3VK3A 4KHXA 3ZRRA 3EI7A 1M6SA 5I92A 5AVWB 2D7YA 3VOMA 2VMRA 2HP1A 2W7FA 2VMOA 2VMWA 1SQPK 1H0CA 3A2AA 2E54A 1YIYA 2ZYJA 4JEVA 1GK4A 1ASMA 2BHXA 2FYUK 3ATHA 3M0AA 1GZLA 1RE3C 4WY4C 4EB5A 4Y0DA 3DR4A 2YKYA 2EZ1A 5D5SA 2P7JA 1OHYA 4ZWMA 1AY4A 1RVUA 1OHWA 3AEMC 4RJYA 3H9XA 4J5UA 5G0AA 2Z1ZA 4ITGA 2KP8A 2W6AA 1WYVA 1GL2A 3PDBA 4F5FA 1YNUA 3HLMA 1HUCA 4UHMA 2FQ6A 1LT9A 4AQRD 2FKWB 2OYHB 2OGAA 2Z9VA 4ZM3A 1DTYA 1GEYA 1W7NA 3G7QA 2CH2A 2BWPA 4OYTA 1X0MA 3KYQA 4OBUA 2BI5A 1JG8A 3E6GA 4OCAA 1MDOA 2Z9WA 1AQ5A 4HYTB 3KE3A 4ZDLA 3IR9A 3GHGB 3CL3D 2VMNA 4MQPA 3L35A 5BU8B 3BVHA 2WK8A 3HBXA 4UOYA 2HYNA 2BI9A 3L44A 2Z5HA 1E5EA 2XV5A 2PB2A 2VGVA 3VP9A 2JG2A 1OHVA 2W8UA 4DGTA 1LT9C 3DR7A 1ASLA 3MKJA 1IUGA 3E2ZA 2AY9A 2ZY2A 1B8GA 3ACZA 4MQRA 2A45I 3BASA 1GDTA 2VMZA 1ZR4A 1DH3A 4DQ6A 3NUBA 1ZODA 2WSEH 2ZP7A 1ZC9A 3H6PA 3R9AA 2FNIA 1YIZA 1H8AA 2O7CA 5BVZA 1TARA 1SFCB 4P3MA 1L0LK 4FFCA 1L4AB 1J1EB 2W8JA 3QHXA 4I8AA 3OKSA 3BN1A 3BWNA 3GZDA 4JF7A 3EFGA 2VMVA 1BQAA 1LC5A 4M2JA 4E3RA 1WYTA 2GB3A 2OQXA 1QL1A 1M0OA 4EOTA 2N1TA 1SVVA 4ATPA 2M3BA 2QM7A 3B1DA 2HORA 2BIEA 4WXBA 2ORDA 4JYCA 3HUSB 3L8AA 1GC3A 3H32A 5HDMA 2WK9A 4R2NA 3JWBA 4C46A 3CQ4A 4AZJA 5APXA 1BJNA 4OT8A 3DODA 2D5YA 2DR1A 5M46A 1IX8A 1RF1A 1TOKA 4M3LA 2J58A 1BQDA 1FG3A 3LWSA 1B9IA 1Z7DA 1MFZA 1B5PA 2Q7WA 2EGYA 1LTBC 3JZLA 1RF0A 1AY8A 1KKJA 1P3WA 2NPSA 3BCXA 3BWNC 3D6KA 3E2FA 3GZDC 2CJDA 4CXQA 2XU6A 3G8MA 5EIGB 3VAXA 4ZKPA 2R5DA 1RV3A 4LW2A 2Q3IA 2DGMA 4C7NB 3K7YA 1FZGA 2N1TC 3WCOA 3RK2B 1FZBA 4JEXA 2HG5D 3B46A 3I5TA 4GEBA 2POHA 2MJZA 3NNKA 2HUFA 4LNJA 4A0HA 1NKNA 1G1IA 3TSIA 5AVTB 3C9IA 2D61A 1RF1C 1W7LA 4I1LA 4WXGA 2W7LA 3HT4A 4ZM4A 4FL0A 4RJ0A 1CQ6A 2W7KA 3FQ7A 5G2PA 2QB2A 1HBWA 4EIJA 1DJUA 3BS8A 1FU1A 3TNUB 3FCRA 1JCDA 2Z9XA 2C0XA 4CVQA 3WKSA 1CQ7A 2A45G 1QITA 3QBOA 3VP6A 3UWCA 2DGLA 1QZ9A 1WKGA 4GKGA 5BJ4A 1IVRA 3M5UA 2VLFA 1LWUA 1BT4A 1KMJA 2E7UA 4H63Q 3U1CA 1N8PA 2HOYA 4A6RA 3GBXA 4ZDOA 3RCHA 4WYAA 5AW2B 4XEWA 2YKVA 3ELPA 2CSTA 4EB7A 2HPCB 3GR9A 4UHNA 4XJPA 1MDXA 4LNLA 3K40A 1JS6A 3GWPA 2C7TA 1W7MA 4WYFA 5CCHD 5AVUB 4F5KA 5CCGD 2FFDB 2GUVA 1LTAC 2OYIA 3B1EA 3GSBA 5AW0B 4OBVA 3I16A 5FT4A 2OKKA 1SFCD 2JJEA 1L4AD 1LTGC 2IPPA 1CZEA 3RL0B 5FT8A 2LKMA 3TK1A 2BKWA 1SZUA 4RKDA 3DZZA 2WTYA 2HODA 2BI1A 1RV4A 3BB8A 2W8VA 1LWUC 4ADCA 1J32A 3RK3B 4W91A 3DC1A 5DJ1A 2W7JA 3GHGA 3V2PA 1GU5A 4MKKA 1S9KE 1LC8A 1HGVA 2Z61A 1J2JB 2BIGA 1T3IA 1D7UA 2VYCA 3U1AA 3NYSA 4A72A 2ZY4A 3JTXA 1FAVA 2P67A 1EQBA 1PFIA 4QGRA 4RAEA 1HVVA 5EUDA 1DGEA 3PIUA 4W7ZA 2R5BA 2TPLA 1AMQA 3HRNA 1NTMK 4Y99C 2QB3A 3LIDA 2YRRA 1CW5A 3F9TA 1NTKK 3V5BA 2JJLA 2W7DA 4WLHA 5KJ7A 4WBTA 3II0A 3FSLA 2W7MA 2FYFA 3RK2D 3MC6C 3GHGC 3QPGA 1AKAA 4N78D 4E1OA 1N86A 3HTKB 4IXZA 2WSCH 2O0RA 4RM1A 4WYCA 1JTHB 3B8XA 3H7FA 1T2KC 3LVKA 2WPSA 1LK9A 1TOGA 1RY3A 1NWQA 1AJSA 4WD2A 2W8TA 1QIRA 2AATA 3CI9A 2VGWA 2QA3A 3BV0A 1G4VA 3NDNA 4DOJA 3DXWA 2GSAA 4WB0B 1IFDA 1AIAA 5APTA 2DGKA 4ZSWA 2D65A 2YMYA 2ZUKA 4NOGA 4IYOB 2Z5IA 3QM2A 1IJIA 1RE3A 3B5NB 2VRSA 5KJ7C 4U2HA 1G2CB 4OH8B 2DKBA 1AHYA 3CQ6A 5FT5A 5K8BA 5CCGC 4XK1A 3ZRPA 3JWAA 3PAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRN A;  3U59 A;  5BU8 B;  1IC2 A;  2POH A;  3U1A A;  5BVZ A;  3N4S A;  4ZKP A;  1NKN A;  1WT6 A;  2JEE A;  3C9I A;  3N7N A;  3P8C D;  3N4R A;  4I1L A;  3N4X A;  4ZKU A;  4N3Y B;  1X79 B;  3BAS A;  3BAT A;  3VP9 A;  4N78 D;  3OJA B;  3U1C A;  3VP8 A;  5KTB A;  4O9B A;  4GIF A;  2FXM A;  5BU5 A; 
#chains in the Genus database with same CATH topology
 4ATQ A;  4XJM A;  4TMR A;  1SFC C;  1SQV G;  1L4A C;  3AEP A;  3BCA A;  3A2B A;  2EH6 A;  1SQX K;  4A6U A;  4E77 A;  3TGU J;  2R32 A;  3AEM A;  1SZK A;  5B5E H;  2Y0D A;  4R8D A;  2G3A A;  1R8E A;  1UU1 A;  2AY3 A;  3L75 D;  3W1H A;  4IXO A;  1SQV J;  1YJZ A;  4WYE A;  1PMM A;  2FXM A;  3AEJ C;  2CIN A;  2VGU A;  2HUU A;  5DJU B;  2CJH A;  1GEW A;  5EUE A;  4H13 B;  1N73 B;  1AMA A;  1JNM A;  3H1L D;  2CH1 A;  3A0B E;  4U3F G;  2YKP A;  3H1J J;  1UIX A;  3KQG A;  5AW5 B;  3Q3D A;  3VK2 A;  2D63 A;  3EFF K;  2Y9Y A;  1YTZ I;  3L70 D;  4GDO A;  2WT7 A;  2FM1 A;  1RE4 A;  1ASG A;  2AEM A;  3FXE A;  1EQ7 A;  3L74 J;  3RL0 D;  3N75 A;  2W7I A;  5C6U A;  1PZQ A;  1FC2 C;  3B71 A;  1IK7 A;  1C7O A;  1LJ2 A;  3V2R A;  1NAF A;  1X28 A;  4IX8 A;  3AE9 C;  3BAT A;  4ZLV A;  2KFP A;  5M49 A;  1SQB D;  3I55 P;  1LKC A;  3RK3 D;  1L0N G;  5M4B A;  1KL2 A;  1H89 A;  3HE4 A;  1JEK A;  2R5E A;  2ZT9 D;  3FDD A;  3R4T A;  2HFE D;  1LTS C;  2KZI A;  1M4N A;  3HD7 B;  2R2N A;  8AAT A;  4LLH A;  3W67 A;  3RK2 C;  1VQ4 P;  3BC8 A;  3KPE A;  5AVZ B;  3ZZJ A;  3MBB A;  1L0N J;  1TAT A;  3AEF C;  3RQ1 A;  4WP0 A;  3FZ7 A;  4L0O A;  1WYU B;  4N0W A;  3CWB J;  5AW6 B;  2ZYG A;  1SQP G;  2Q1K A;  5M1B A;  2GQN A;  3CLQ A;  5KKZ C;  4AO4 A;  3Q2Y A;  2FYU G;  4OC9 A;  1RE4 C;  5FT6 A;  2H88 C;  1N7S A;  1GCK A;  2HLO A;  4J8L A;  1AJY A;  5HHY A;  5EAV A;  2W8W A;  3FZ8 A;  3RBL A;  2W7E A;  1PGJ A;  1VJO A;  1KIL B;  1IAX A;  4CPG A;  2WSE J;  4TN4 A;  2E75 C;  3KXD A;  4ZNC A;  4XE5 B;  1EDL A;  4AZK A;  2GMS A;  1HTL C;  5KAF H;  1NTZ K;  5APS A;  1QJ5 A;  1GBN A;  3GET A;  1DJE A;  4IY7 A;  1EZV I;  2RFV A;  1PIX A;  4OWF A;  1EDI A;  1KB9 H;  1VQL P;  4MQQ A;  2C9N Y;  3CCM P;  3AEA C;  3N4R A;  2QJP B;  1NTM E;  3PP5 A;  2LXB A;  3H25 A;  3B1C A;  1ZN5 A;  1PMO A;  2XH1 A;  1NTK E;  2E43 A;  3AE4 C;  1C7G A;  3A0H H;  3VOP A;  3FDB A;  2PGD A;  1SF2 A;  3EIA A;  4PV1 C;  3NYT A;  4F4E A;  1J1D C;  1BW0 A;  2E76 D;  2M8R A;  1K04 A;  1MV8 A;  4ZAH A;  3Q8N A;  3T97 B;  5EQC A;  4AOA A;  3IF4 A;  1CI6 A;  1EJI A;  1H1C A;  2VGT A;  1VDF A;  2R3C A;  1BE3 G;  1LTJ A;  3PD6 B;  3RI6 A;  1GC0 A;  4EU1 A;  1N7S C;  1SLQ A;  2JKV A;  4H51 A;  2KS1 B;  3CAI A;  1T3U A;  2QJY C;  2DKJ A;  2AY7 A;  1MAQ A;  1YBK A;  3O6Q A;  1ARI A;  2O01 H;  3JCU E;  3V6I A;  1GW4 A;  1FZF A;  3FFH A;  3WGB A;  4A0F A;  2R5C B;  1VF5 D;  3B5N D;  4H0L D;  2AXC A;  3L73 G;  1M1J B;  3EI8 A;  3ISL A;  4ZWV A;  3P8C D;  3WY7 A;  3MAF B;  1QGK B;  5G4J A;  3HE5 B;  1PV3 A;  1OXO A;  4H44 B;  3RBX A;  2OKJ A;  5AX8 A;  2HOZ A;  2JO1 A;  3WGC A;  4YTP C;  4JEY A;  4A0G A;  4YXD C;  5BU5 A;  2P1J A;  2PAJ A;  3A9X A;  1LS3 A;  4XQ2 A;  1BS0 A;  2GUS A;  3CX5 D;  1KB9 E;  2W90 A;  3MEB A;  3CXH H;  1NYH A;  3H1H G;  1AY5 A;  3N7N A;  1GC4 A;  2AY4 A;  1ASF A;  3FZ6 A;  2CB1 A;  4AUW A;  4BRY A;  3P6K A;  1XEY A;  3W1I A;  1IK9 A;  1AIC A;  3I56 P;  2X5F A;  4IOI H;  4R5F A;  2JGT A;  3RK3 C;  2EPJ A;  1C7N A;  1LTJ C;  4PD4 H;  1N31 A;  3TFU A;  4H13 D;  3H1I E;  2R3S A;  3L72 E;  1YAA A;  2IX7 C;  4LC1 A;  1KQG B;  2AEU A;  3H1H J;  4BA4 A;  4ZMD A;  1FZC B;  1H0T A;  4GT1 A;  3EZ1 A;  5KLI C;  2YNY A;  2XZR A;  1JTH A;  1NKZ B;  1CZC A;  1IAY A;  2AY1 A;  1IX7 A;  3VMY A;  1JS3 A;  3TGU D;  3CQ5 A;  1GD2 E;  1PGP A;  1AKC A;  1HWT C;  1IFI A;  4D6T J;  1KAF A;  3PGY A;  1QVG O;  1VPC A;  1P84 D;  2ITA A;  4WY4 B;  2Y0C A;  2BI2 A;  1AMR A;  4EI2 A;  2IFM A;  1L0L G;  1Y4I A;  4LC3 A;  2K9Y A;  4PFF A;  2VGZ A;  4HVK A;  5AVQ B;  2WPQ A;  1YJY A;  4A00 A;  5AVR B;  4K05 A;  2KSE A;  2VMY A;  3JSV C;  3H1J D;  4IYO A;  3I4J A;  2A06 G;  2VI8 A;  4K2I A;  1I29 A;  1L0L J;  4AYC A;  5JAY A;  5BJ3 A;  2X3L A;  4HKZ H;  1G7X A;  1OVU A;  5E5I A;  1FS0 E;  1TU3 F;  2AEV A;  3L74 D;  3A5T A;  3HD7 D;  3CXH E;  2BYJ A;  1BJO B;  1ZLL A;  1OAT A;  1FBM A;  3MZW B;  3VN0 A;  4ISY A;  5GTI E;  1EZV G;  1AJR A;  1S2E A;  1SQQ J;  1UKJ A;  2VMU A;  1AAM A;  3PJS K;  3AE3 C;  1EDJ A;  1YTZ T;  2E76 C;  3U59 A;  1KZU B;  4JBZ A;  4WBA A;  1IC2 A;  2JJF A;  1QJ3 A;  1BCC G;  1FOS E;  4WXF A;  1V2F A;  1N2T A;  1BGY J;  1SQB K;  2O1J A;  1KIL D;  3II6 A;  2IFN A;  1TOE A;  1PGQ A;  1CQ8 A;  4R5Z A;  1LP1 B;  1L0N D;  3ABV C;  3CWB D;  2ZSL A;  3E9K A;  5G2Q A;  4TLF A;  2YRI A;  2YXQ B;  4RKC A;  1C0N A;  2OTL P;  1VF5 C;  3B5N C;  3L73 E;  4H0L C;  2Q3E A;  2V7Q J;  1U08 A;  3L71 G;  1AFO A;  1D7R A;  1ECX A;  7AAT A;  1NTZ E;  1AHG A;  4RKU J;  3WZF A;  1WYV B;  1GL2 B;  1YYC A;  3PDB B;  2KNC A;  2H7H A;  2EYQ A;  1AQT A;  1UU2 A;  2YKX A;  1BDC A;  4W80 A;  1CL1 A;  2R0T A;  4JEZ A;  4RIZ A;  2QJK C;  1AKB A;  3K28 A;  1EXI A;  3L71 J;  1AHE A;  1LT9 B;  1DJ9 A;  3RBF A;  1C9C A;  2WWW A;  2QRX A;  1KFN A;  1AHF A;  4MY5 A;  5F9S A;  1SZS A;  3G9R A;  2D64 A;  3AV7 A;  1MKM A;  1VQO P;  3I5C A;  3D6Z A;  4MN4 C;  3HQT A;  1PP9 J;  3HD7 A;  5AW8 B;  4NPF X;  1MZ9 A;  4H13 C;  2ZXE B;  2H8P D;  1IFM A;  3VK4 A;  2OYH A;  1ELQ A;  2KXP B;  1WYU A;  2YCN A;  2WPV B;  1WT6 A;  1LC7 A;  5AVS B;  1ARS A;  1QIS A;  1JY3 N;  4H44 D;  3SSU A;  5AW4 B;  2JDI H;  5J8Q A;  2AY5 A;  4PVF A;  3DU4 A;  2B9B A;  2HR3 A;  3AEL A;  1HH0 A;  1CZQ A;  1NU1 D;  2YKQ A;  2K3R A;  4Z1M H;  3ASB A;  1ZRT D;  2W7G A;  1YQ3 C;  2XDJ A;  1ZW0 A;  4DCK A;  3AE5 C;  3VYI A;  2QSR A;  3BCC E;  4IFM A;  1TPL A;  3FTB A;  3A7O A;  3MC6 A;  4F5G A;  2YOB A;  3KGX A;  4B86 A;  1O69 A;  2BWN A;  3ZZK A;  1TAS A;  2WSC J;  1GK6 A;  2WIT A;  2E74 B;  3B8E B;  5TJH A;  2FKI A;  3E2Z B;  1FG7 A;  2QBT A;  3AE7 C;  2IZ1 A;  1QLE D;  2GMU A;  4LNM A;  2QLR A;  2J59 M;  1V72 A;  1KKP A;  1GEX A;  2YCT A;  1KB9 I;  1FJP A;  3HD7 C;  2KOG A;  4ADB A;  4RES B;  4E3Q A;  2K37 A;  4P7Y A;  1XI9 A;  3AOV A;  1Q7Y Q;  2KYV A;  2OYH C;  1ARH A;  1D7V A;  4NPD A;  4W1W A;  1GW3 A;  4WY4 D;  3EI9 A;  3R2P A;  2PP6 A;  4Q6R A;  3V2Q A;  1OWA A;  4WYG A;  3B4S A;  2PO3 A;  2N9Y B;  3NTN A;  2ZJG A;  4OMA A;  2I1K A;  5HXX A;  1S3J A;  1S72 P;  3SWF A;  3H1H D;  2QMA A;  3PPL A;  1TOI A;  2NRG A;  5TIS E;  1E5W A;  4KT0 J;  1HF9 A;  5CCH A;  2YCP A;  5CCG A;  3DXV A;  1WYT B;  3L75 E;  4JYB A;  2RH0 A;  2W7H A;  1OW8 A;  4D6T D;  2ZSM A;  1SFC A;  4I7Z B;  2N1T B;  1QGN A;  1L4A A;  3GLM A;  3QGU A;  3G6E P;  1OZH A;  1U7J A;  2Q6Q A;  4W1X A;  3H1K J;  1V2D A;  3H32 B;  1BKG A;  1ZOB A;  2QJP C;  3R4Y A;  5AW9 B;  4XA4 A;  1S09 A;  2CJG A;  5KLV J;  1ASN A;  3A0B H;  1IFJ A;  4GE7 A;  4GSA A;  2G7J A;  4W1V A;  1LW5 A;  5C39 A;  1FC4 A;  3AEJ A;  2JR8 A;  4XJL A;  3L70 E;  1ASB A;  2FYN B;  1BSN A;  3HUS A;  3WMM 0;  1OW7 A;  3CXH I;  2JIS A;  1KQS O;  4ZAS A;  1MAP A;  3KHU A;  1VQ9 P;  3M9B A;  3ZRQ A;  3NU8 A;  1OXP A;  3A8U X;  3T32 A;  1D7S A;  2BWO A;  2K1A A;  2NPS B;  2QM8 A;  3CC7 P;  1GC2 A;  3GW6 A;  2Z4E A;  2M5A B;  3EI5 A;  1NTM G;  1BJW A;  4OVN F;  2FYZ A;  3VMZ A;  1SQQ D;  4B9B A;  2RMZ A;  5CCH C;  3OJA B;  1SQB E;  1NTK G;  3RK3 E;  2CY8 A;  2Q9I A;  3NU7 A;  4MSO A;  2WZ7 A;  4IXS A;  2I1J A;  1U7M A;  2BI3 A;  5APW A;  1FDM A;  2FBW C;  1J1E C;  2E5Y A;  2VIB A;  1E79 H;  4A0R A;  3LY1 A;  4OTL A;  5G09 A;  1KMK A;  2JEE A;  1NTM J;  2V0Y A;  1BGY D;  2V1P A;  1KL1 A;  3EUC A;  4F5H A;  3LVJ A;  1GL2 D;  3K5B A;  1Q2N A;  5EIG A;  4DJG A;  2XNX A;  3FKD A;  3NXS A;  3P8M C;  5CMZ A;  1RQU A;  2F8J A;  2VI9 A;  3FVX A;  1Z56 A;  4XFJ A;  1MLY A;  4C7N A;  2KK7 A;  1EC5 A;  3D6Y A;  1YJW P;  3HMU A;  1OMI A;  4XJO A;  1FZE A;  4UB8 E;  2RN0 A;  1LGH B;  3HUS C;  2B88 A;  2ZYD A;  3NMD A;  2X8U A;  4KXK A;  3MP7 B;  2BYL A;  1N2D C;  3M0D A;  1URQ B;  3F6T A;  1LW4 A;  3CC4 P;  1B5O A;  3AEN B;  1B9H A;  3WCN A;  1C4K A;  4I2L C;  1LNQ A;  5KTB A;  1FZC C;  1S0A A;  4CBR A;  1PG8 A;  1ZV8 A;  4U3F J;  5GTH E;  1LTI C;  1D7M A;  1BJ4 A;  3MHV A;  3L71 D;  3AEE C;  3MD0 A;  4RO0 A;  2ZC0 A;  3FQA A;  2K9J A;  1SFF A;  3PHL A;  2KZJ A;  3V4Q A;  5AW1 B;  4ASW A;  1NH4 A;  2ZVO B;  2KUB A;  3SWY A;  1PP9 D;  3TFT A;  2CTZ A;  1PFF A;  1EG5 A;  1X22 A;  3TNU A;  2GM4 A;  4WB4 A;  2ZXX A;  1W2B O;  1K8A Q;  4K2M A;  3FXD A;  3PTZ A;  3VMX A;  4ASV A;  3H1I G;  4EMY A;  3L72 G;  3TF5 A;  3QN6 A;  1LWU B;  2UWJ E;  4K3A A;  1G1J A;  2E74 D;  1JO5 A;  1KYO H;  3RCH B;  3L37 A;  3CCS P;  2VGS A;  2I8D A;  4I6M C;  2HOX A;  3M0D C;  3H1I J;  4M2M A;  2C0R A;  3PJ0 A;  4ITX A;  3MTU E;  3CCL P;  3OAK A;  3FVS A;  5TF5 A;  3IFM A;  1ASE A;  4BWN A;  1JY3 P;  1NU1 K;  3E1R A;  2VMX A;  1M32 A;  1M7Y A;  4JEW A;  3JCU H;  3P8C E;  5F8V A;  4EFF A;  3A3Y B;  1IX6 A;  3TDK A;  2OYI B;  2WK7 A;  1QL2 A;  2X5D A;  1SQP J;  4Y0H A;  2AY2 A;  2E7J A;  4BXL A;  4ZDP A;  1EXJ A;  2HPC A;  4GIF A;  3HDO A;  1CSB A;  1JY2 N;  2FYU J;  2O01 J;  3GG2 A;  4HJG H;  1YOO A;  1ASA A;  4U7J A;  5APY A;  1A02 J;  2VMP A;  3F0H A;  3CX5 E;  2C81 A;  3L36 A;  3AED C;  5APQ A;  3LG0 A;  3N4S A;  4RJT A;  3NTJ A;  3D70 A;  4Y99 B;  2FFD A;  2ZFC A;  2HUI A;  2HOD B;  3ECD A;  1VEF A;  4BA5 A;  2N1T D;  3TCM A;  2KB7 P;  4AO9 A;  2PB0 A;  5CBO A;  2JJH A;  2H89 C;  1A02 F;  5APV A;  2AY6 A;  3LVL B;  1ASD A;  4UB6 E;  2ZVN B;  1H88 A;  3FD0 A;  5AVX B;  4F5I A;  1LTT C;  3P32 A;  1IBJ A;  1ORD A;  2OAT A;  1X9V A;  1AHX A;  3TGU E;  1T8Z A;  3G0T A;  2J5U A;  1KYO E;  1MGV A;  5IWQ A;  1DX7 A;  1JUN A;  1GL2 C;  1WRG A;  3P7K A;  3Q5R A;  4U1T A;  1P84 E;  2YO2 A;  3BCB A;  2WSS H;  2D7Z A;  1DKA A;  2BEZ F;  3WKR A;  5M4D A;  1VQ7 P;  3DRD A;  2BEQ D;  3H1K D;  4KAM A;  2NPS D;  1RQV A;  2Q7C A;  1BE3 J;  5KLV D;  1JY3 O;  1O4S A;  3KGW A;  3AEG C;  3H1J E;  1ASC A;  5DX5 A;  2FFD C;  3GF3 A;  2GA1 A;  1NTZ G;  1M0P A;  3N5M A;  1S4X A;  3FQ8 A;  1FOS F;  4WLJ A;  3M06 A;  1I43 A;  1M0Q A;  3AEO A;  3RBZ A;  3WU2 E;  3RL0 C;  3PDX A;  3L74 E;  2JP3 A;  3L73 J;  2QSI A;  2VLH A;  3FGA D;  2XBN A;  2CPB A;  1JMM A;  4PFN A;  2AY8 A;  1I48 A;  4IL6 H;  4L75 A;  1SP4 A;  3W68 A;  1SQX E;  3UIA A;  1AJS B;  5GTI H;  4GRX A;  1V2E A;  2ZY3 A;  1VL2 A;  1WKH A;  1AIB A;  1CS1 A;  3HL2 A;  1GD9 A;  2VIA A;  4XAU A;  2PFX A;  3M9H A;  3V4W A;  5APU A;  4CXR A;  2ZT9 C;  1S06 A;  2O3J A;  3N0L A;  2BCC E;  1S08 A;  1QX8 A;  1SQQ K;  3HTK A;  2Y9Z A;  2ZY5 A;  1CL2 A;  4CBS A;  2E74 C;  1MUU A;  1URQ D;  4KJM A;  1HJB A;  3LW5 H;  3BRV B;  2HP2 A;  3GF7 A;  1PPJ D;  5E4Z A;  4Q31 A;  2W27 A;  3CWB E;  1SQV D;  4Q75 A;  1ARG A;  2O1K A;  2N9B A;  2Z9U A;  5B66 H;  4GE9 A;  4WB0 A;  1VQ8 P;  1RVY A;  3BCC G;  3MGN A;  3EI6 A;  2QIW A;  4TT3 H;  2K88 A;  2OQQ A;  3BWO A;  4N3Y B;  1PL5 A;  1WST A;  2CPS A;  3PRJ A;  1HJ0 A;  5G4I A;  2C0W A;  2CK3 H;  3CCR P;  2FNU A;  3KKI A;  3TYY A;  3LV2 A;  2DOU A;  1Q86 Q;  3AE6 C;  2D66 A;  2B87 A;  3B5N A;  3BCC J;  4GOF A;  3OA7 A;  1G2C A;  1K73 Q;  5EUN A;  4U3F D;  2YKO A;  4IL6 E;  1ZME C;  4I7Z C;  3NX3 A;  2BIA A;  1ART A;  1JMB A;  3RUY A;  3AE2 C;  3E7K A;  2WKA A;  2AXT E;  4BMK A;  2IYP A;  2FXO A;  5AVY B;  1M0N A;  1KB9 D;  1FDO A;  2Z1Y A;  5CHX A;  5H2F E;  1OFC X;  2WT7 B;  2C44 A;  2WSF J;  2FYN C;  1G7W A;  4HF8 A;  1TOJ A;  1N73 A;  3MAD A;  3WX9 A;  4IL6 X;  1NU1 E;  4GOE A;  3SFE C;  3L75 G;  5AW3 B;  2EZ2 A;  1BCC J;  1K9M Q;  3FRK A;  5KAI H;  1ELU A;  4IFF A;  1URQ A;  2E75 B;  5B66 E;  1RF0 C;  4IFD K;  3AEN A;  5AVV B;  1YHQ P;  1I41 A;  1YIT P;  1AX4 A;  2NPS C;  4LGD E;  4LW4 A;  3Q5S A;  2KLV A;  1OXZ A;  5CJ4 A;  2WMM A;  3L75 J;  2YKU A;  3MUD A;  3HE4 B;  4MKJ A;  4DT0 A;  3W1J A;  4EDF A;  1XTG B;  1NHL A;  3RL0 g;  3QWO C;  1SQP D;  2YHK A;  5EAA A;  2NMP A;  3L70 G;  3CX5 I;  3V2N A;  1E5F A;  4UQV A;  3EQ2 A;  4ADD A;  5DB5 A;  1T2K D;  2FYU D;  2A1V A;  1OVR A;  4PV1 B;  1DGD A;  1J1D B;  1X29 A;  5CJ0 A;  3USF A;  1Q81 Q;  3DYD A;  3OW2 O;  1KN7 A;  3F5H A;  1GDE A;  2G6W A;  1J04 A;  1FE6 A;  1KD1 Q;  3NYU A;  3BRT B;  2SPZ A;  2L5G B;  2G8Y A;  3NFQ A;  1JY2 P;  2WSF H;  1NGM B;  1NJI Q;  1N7S B;  2HZP A;  3UAK A;  3LIE A;  1N73 C;  1SQB G;  2KSJ A;  4RIT A;  1X2A A;  3GZC A;  3CXH D;  3LVM A;  1KYO I;  2BAS A;  1URQ C;  4L73 A;  2XKM A;  1MLZ A;  1JCC A;  1P84 I;  5KJ7 D;  5TIS H;  3JW9 A;  1DEB A;  3O8Z A;  4N78 E;  4D6T E;  2CAN A;  3AOW A;  1FJK A;  4RLG A;  1KC8 Q;  4PD4 D;  5KAI E;  3TQX A;  3VP8 A;  4O9B A;  3MUD C;  2YO3 A;  3M9Q A;  4QMA A;  1JOC A;  1IJD B;  2P2U A;  1KIL A;  4KYO A;  3E77 A;  3NRA A;  4K35 A;  4Y0I A;  3E1I A;  1M8O B;  2CFB A;  1VQ5 P;  3C8V A;  5EFS A;  1NO4 A;  1BE3 D;  3N4X A;  3AAT A;  3IHJ A;  3A9Z A;  1W23 A;  1CI6 B;  4ZSY A;  4ADE A;  5KLV K;  2A45 H;  2Z20 A;  4HH2 A;  1LTJ B;  1VQN P;  2IBZ E;  3G3Z A;  4F5L A;  3L73 D;  4EYY Q;  1DFO A;  2IYO A;  1GU4 A;  4IW7 A;  2QG4 A;  2VMQ A;  5KLI B;  3NUI A;  3T97 A;  3O6Q B;  1SQQ E;  3L4F A;  5E3K A;  2WVR A;  1IO4 A;  4K2B A;  1AMS A;  5D95 A;  1JY2 O;  3C1L A;  1JF9 A;  4O6Z A;  3PD6 A;  1SPA A;  1FZA A;  3TAT A;  2KS1 A;  3ASA A;  1D2F A;  2OYI C;  4WYD A;  4W7Y A;  3EWK A;  4B98 A;  1KIL C;  1BGY E;  2EO5 A;  2JWA A;  2FN6 A;  4ZKU A;  1UII A;  4BHD A;  2FY8 A;  3MAU A;  2R44 A;  2YIU B;  2KI7 B;  4DBC A;  2E42 A;  2R5C A;  1AAW A;  4F5M A;  1M1J A;  4JF1 A;  3EZS A;  3CD6 P;  3MAF A;  4PIW A;  3HE5 A;  1FDI A;  2VMS A;  1CJ0 A;  2C9L Y;  4BRY B;  1W3U A;  3H1L E;  4A6T A;  3ELE A;  2OGE A;  3FVU A;  4UB8 H;  1SQV K;  5AW7 B;  1MDZ A;  1X8Y A;  3GJU A;  4GE4 A;  4PJ0 E;  1QVF O;  2H43 A;  3WLX A;  1X79 B;  2O1B A;  1UU0 A;  3AEB C;  3Q5P A;  4W5K A;  1RF1 B;  1KOR A;  4BQ0 A;  1G4X A;  1H0T B;  4JF0 A;  2D2C B;  4C7R A;  4M2K A;  1L2P A;  1K05 A;  1L0L D;  3S9O A;  4W8I A;  1VP4 A;  2JJG A;  1DEE G;  3BCC D;  2OAR A;  1O61 A;  4WVZ A;  1T3J A;  1BDD A;  2W6B A;  5GTH H;  1KTM A;  1B4X A;  3CBF A;  1S9K D;  1NOH A;  2A06 D;  1YJS A;  1FZC A;  1KV4 A;  3FWL A;  1IFN A;  4DZO A;  3FX0 A;  3P1T A;  4AH3 A;  4GOD A;  1N7L A;  2OYO A;  2B89 A;  2YXR B;  2E75 D;  3QI6 A;  9AAT A;  2QVA A;  1PP9 E;  2E7I A;  4GDY A;  1W2E A;  1Q90 D;  3VTP C;  5DJ9 A;  1M1J C;  1ZR2 A;  4Q76 A;  3F89 A;  4JQ0 D;  3KDP B;  2Q5U A;  4WY4 A;  3COG A;  4H44 C;  2KIK A;  3FFR A;  1XTC C;  1EZV D;  3UE8 A;  3TGU G;  2W6J H;  1NTK J;  1SVF A;  3PA9 A;  1M1K Q;  3A9Y A;  4PV1 D;  1KQL A;  1KFM A;  1BCC D;  1GTW A;  2VMT A;  1M7L A;  2WPR A;  1Z3Z A;  3E2Y A;  3AEC C;  1O62 A;  3HVY A;  1L0N K;  3MIW A;  2QJK B;  4UHO A;  3OP7 A;  1HGZ A;  3M91 A;  4F5J A;  3H1J G;  1N7S D;  2WB6 A;  1BJO A;  4N6J A;  1S07 A;  1OVV A;  1KQF B;  4KHX A;  3VK3 A;  3ZRR A;  3EI7 A;  1M6S A;  5I92 A;  5AVW B;  1QEX A;  2D7Y A;  3VOM A;  2VMR A;  2HP1 A;  2W7F A;  3KZI H;  2VMO A;  3L74 G;  1SS1 A;  1SQP K;  3CX5 H;  1W5C E;  2VMW A;  1WMK A;  1H0C A;  3A2A A;  5K5G B;  2E54 A;  1YIY A;  2ZYJ A;  4JEV A;  1GK4 A;  1ASM A;  2BHX A;  2FYU K;  3ATH A;  1X0T A;  3M0A A;  1GZL A;  1RE3 C;  4WY4 C;  4EB5 A;  3RGU A;  4Y0D A;  3DR4 A;  1SQX G;  1VQM P;  2YKY A;  2EZ1 A;  5D5S A;  4UB6 H;  1LP1 A;  2P7J A;  1OHY A;  4ZWM A;  1AY4 A;  2BCC G;  5E79 E;  1RVU A;  2KNC B;  3CME P;  1SQX J;  1OHW A;  3AEM C;  3CCQ P;  1USE A;  2P10 A;  4RJY A;  1EDK A;  3H9X A;  4J5U A;  1P84 H;  5G0A A;  2Z1Z A;  3L72 J;  4YPC A;  4ITG A;  3CWB G;  2BCC J;  3IN6 A;  3H1K E;  2KP8 A;  2W6A A;  1WYV A;  2P58 A;  1GL2 A;  3PDB A;  5B5E E;  5KLV E;  4F5F A;  1YNU A;  1ZXG A;  3HLM A;  4L76 A;  1HUC A;  4UHM A;  3CPW O;  2FQ6 A;  1LT9 A;  4AQR D;  1RH5 B;  3PLN A;  3CCJ P;  2FKW B;  2OYH B;  2OGA A;  2Z9V A;  4ZM3 A;  1DTY A;  1GEY A;  1JM0 A;  1W7N A;  3G7Q A;  2ZYA A;  2CH2 A;  2IBZ I;  2BWP A;  3KZI E;  3WU2 H;  4OYT A;  3AE1 C;  3KYQ A;  1X0M A;  1M57 D;  4OBU A;  4Y28 J;  3Q1M A;  2BI5 A;  1JG8 A;  3G71 P;  1T6A A;  3E6G A;  4OCA A;  1MDO A;  2Z9W A;  1AQ5 A;  4HYT B;  3KE3 A;  4ZDL A;  3IR9 A;  3GHG B;  3CL3 D;  2VMN A;  4MQP A;  3L35 A;  5BU8 B;  4L74 A;  3BVH A;  2WK8 A;  2AEF A;  3HBX A;  4UOY A;  2HYN A;  2BI9 A;  3VMA A;  3G4S P;  4HB1 A;  3L44 A;  2Z5H A;  1E5E A;  2XV5 A;  3CMA P;  2ZJS E;  2PB2 A;  2D2C D;  2VGV A;  3VP9 A;  1PPJ E;  2JG2 A;  1OHV A;  2Y0E A;  1ZP0 C;  2W8U A;  4DGT A;  1NU1 G;  1SQV E;  2QEX P;  1LT9 C;  3DR7 A;  1ASL A;  3MKJ A;  1IUG A;  3E2Z A;  1GMJ A;  2AY9 A;  1NVO A;  2ZY2 A;  1OX3 A;  3LW5 J;  1B8G A;  4OGQ B;  3ACZ A;  4MQR A;  2FXP A;  1NU1 J;  2A45 I;  3BAS A;  3USS A;  3JWA A;  1GDT A;  2VMZ A;  1ZR4 A;  1DH3 A;  4DQ6 A;  3NUB A;  1AVY A;  1ZOD A;  2WQY C;  2WSE H;  2ZP7 A;  1ZC9 A;  3H6P A;  3R9A A;  2FNI A;  1YIZ A;  2LR2 A;  4U3F E;  1M90 Q;  1H8A A;  2O7C A;  5BVZ A;  1TAR A;  1SFC B;  3SWK A;  4P3M A;  1L0L K;  4FFC A;  1L4A B;  1J1E B;  2QE7 H;  1DIP A;  1NTZ J;  2W8J A;  3QHX A;  3S4R A;  4I8A A;  3OKS A;  3BN1 A;  3BWN A;  3GZD A;  4JF7 A;  3EFG A;  2VMV A;  1BQA A;  1NAY A;  1LC5 A;  5KAF E;  4M2J A;  4E3R A;  2AXT H;  1WYT A;  2DW3 A;  2GB3 A;  2OQX A;  2MKV A;  1QL1 A;  1M0O A;  4EOT A;  2N1T A;  1SVV A;  4ATP A;  2M3B A;  2QM7 A;  3B1D A;  2HOR A;  2BIE A;  4WXB A;  1KIL E;  2ORD A;  4JYC A;  3HUS B;  3L8A A;  5H2F H;  1NTM D;  1GC3 A;  3H32 A;  5HDM A;  3A0H E;  2WK9 A;  4R2N A;  3JWB A;  1NTK D;  2ZAE B;  4C46 A;  1YJN P;  1L0N E;  1AVO A;  1ZOY C;  3CQ4 A;  4AZJ A;  1USD A;  5APX A;  4D6T G;  1VQK P;  1BJN A;  4OT8 A;  3DOD A;  2D5Y A;  2DR1 A;  5M46 A;  1IX8 A;  1RF1 A;  1TOK A;  1AA0 A;  4M3L A;  2J58 A;  1BQD A;  1FG3 A;  3LWS A;  1B9I A;  1KYO D;  1Z7D A;  1MFZ A;  1B5P A;  2Q7W A;  2EGY A;  2OGU A;  1LTB C;  3JZL A;  1SQP E;  1RF0 A;  1DD4 A;  2W8Z A;  1AY8 A;  1KKJ A;  1RHZ B;  1P3W A;  2NPS A;  3BCX A;  3BWN C;  3D6K A;  3E2F A;  3GZD C;  2CJD A;  2FYU E;  4CXQ A;  2XU6 A;  3IAO A;  3G8M A;  2M5A A;  5EIG B;  3VAX A;  1Y9B A;  4ZKP A;  2R5D A;  2IBZ G;  2YIU C;  1RV3 A;  1KMI Z;  2LXC B;  4LW2 A;  2Q3I A;  2DGM A;  4C7N B;  3K7Y A;  1FZG A;  2N1T C;  3WUT A;  2YMK A;  3RK2 B;  2QA4 P;  3WCO A;  1SQQ G;  1FZB A;  4JEX A;  2HG5 D;  3B46 A;  1YI2 P;  3I5T A;  4GEB A;  2POH A;  2MJZ A;  3NNK A;  2HUF A;  4LNJ A;  4A0H A;  1NKN A;  1G1I A;  1Y8A A;  3TSI A;  3D71 A;  5AVT B;  3C9I A;  5KKZ B;  1RF1 C;  2D61 A;  1W7L A;  1LT1 A;  4I1L A;  3ITK A;  2D2C C;  4WXG A;  1BGY G;  2W7L A;  1U57 A;  3HT4 A;  1DD3 A;  1SQX D;  4PD4 E;  4ZM4 A;  4FL0 A;  1IZN B;  1ZRT E;  4RJ0 A;  1CQ6 A;  2K9J B;  3H1I D;  2W7K A;  3FQ7 A;  3L72 D;  5G2P A;  2QB2 A;  2BCC D;  4YXW H;  1HBW A;  2AEJ A;  1Q82 Q;  4EIJ A;  1DJU A;  2W83 C;  3BS8 A;  1FU1 A;  1BE3 E;  3H1L G;  3TNU B;  3FCR A;  1JCD A;  2Z9X A;  2C0X A;  4CVQ A;  3WKS A;  2XND H;  1CQ7 A;  2A45 G;  1QIT A;  3QBO A;  3VP6 A;  3H1L J;  3UWC A;  4JPZ B;  2DGL A;  1QZ9 A;  1OIP A;  1WKG A;  3S1K A;  4GKG A;  5BJ4 A;  1IVR A;  3M5U A;  2VLF A;  3L70 J;  1LWU A;  1BT4 A;  1KMJ A;  2E7U A;  4H63 Q;  3U1C A;  1N8P A;  2HOY A;  1M56 D;  4A6R A;  2L91 A;  3GBX A;  4ZDO A;  1IFP A;  1PP9 G;  4WYA A;  3RCH A;  4OGQ D;  5AW2 B;  5DJT B;  2QJY B;  2O01 N;  4XEW A;  2NZ2 A;  3H1H E;  2YKV A;  3ELP A;  2CST A;  4EB7 A;  2HPC B;  2M3E A;  3GR9 A;  1YQ4 C;  3JC2 2;  4UHN A;  4XJP A;  1MDX A;  4LNL A;  3K40 A;  3CCU P;  1JS6 A;  3GWP A;  2C7T A;  1SQB J;  1W7M A;  4WYF A;  5CCH D;  4NPE A;  5AVU B;  4F5K A;  5CCG D;  2FFD B;  2GUV A;  1S5L H;  1N8R Q;  1LTA C;  2OYI A;  3B1E A;  3GSB A;  5AW0 B;  4OBV A;  3I16 A;  5FT4 A;  2OKK A;  1SFC D;  2E5T A;  2JJE A;  1L4A D;  1LTG C;  2IPP A;  1CZE A;  3CCV P;  3RL0 B;  5FT8 A;  2LKM A;  3TK1 A;  2BKW A;  1SZU A;  2V7Q H;  4RKD A;  3DZZ A;  4PJ0 H;  1YJ9 P;  2WTY A;  1JB0 J;  2HOD A;  1L0L E;  2BI1 A;  1RV4 A;  3BB8 A;  2W8V A;  2IDB A;  1LWU C;  5CBN A;  4ADC A;  3PH0 A;  1J32 A;  3RK3 B;  4W91 A;  3DC1 A;  5DJ1 A;  2W7J A;  3GHG A;  3V2P A;  1GU5 A;  2ZT9 B;  4MKK A;  3AE8 C;  1S9K E;  2A06 E;  1S1C X;  1NTZ D;  1LC8 A;  1HGV A;  2Z61 A;  4R4M A;  1VQP P;  4WWI A;  2V4H A;  1J2J B;  2BIG A;  1T3I A;  2IZ0 A;  5L8R J;  3WUU A;  1D7U A;  2VYC A;  3U1A A;  3NYS A;  4A72 A;  2OTK E;  2ZY4 A;  3JTX A;  1R5L A;  1EZV E;  1FAV A;  2P67 A;  1EQB A;  1PFI A;  4QGR A;  4RAE A;  2OTJ P;  1HVV A;  1PGO A;  5EUD A;  2KLU A;  2PRR A;  3FWN A;  3GMA A;  1DGE A;  1S5L E;  3PIU A;  4W7Z A;  2R5B A;  2TPL A;  1BCC E;  1AMQ A;  3HRN A;  1AV1 A;  1NTM K;  4Y99 C;  1Y47 A;  2QB3 A;  3LID A;  2YRR A;  1CW5 A;  3F9T A;  1NTK K;  3V5B A;  2JJL A;  2W7D A;  4WLH A;  4R4L A;  5KJ7 A;  1BSH A;  4WBT A;  3H1K G;  2JWD A;  3II0 A;  3FSL A;  2RKL A;  2W7M A;  2FYF A;  5KLV G;  4A7P A;  3RK2 D;  3MC6 C;  3GHG C;  3QPG A;  1AKA A;  1MFT A;  4N78 D;  4E1O A;  1N86 A;  3HTK B;  1OW6 A;  5EFW B;  4IXZ A;  2WSC H;  2O0R A;  4RM1 A;  4WYC A;  1JTH B;  3B8X A;  3H7F A;  1T2K C;  1S5L X;  2WPS A;  3LVK A;  1LK9 A;  1R5S A;  1NWQ A;  1RY3 A;  1AJS A;  1TOG A;  4WD2 A;  2W8T A;  1QIR A;  2E76 B;  2AAT A;  3CI9 A;  3L71 E;  2VGW A;  3SFD C;  2QA3 A;  3BV0 A;  1G4V A;  3NDN A;  4DOJ A;  3DXW A;  3CC2 P;  2GSA A;  4WB0 B;  2M0B A;  3QH9 A;  3WUV A;  1IFD A;  4OGQ C;  1AIA A;  5APT A;  2DGK A;  4ZSW A;  2D65 A;  2YMY A;  2ZUK A;  4NOG A;  4IYO B;  2IBZ D;  2Z5I A;  3QM2 A;  3ZDM A;  1IJI A;  1YIJ P;  1RE3 A;  3CCE P;  1VQ6 P;  2B87 B;  1VF5 B;  3B5N B;  4H0L B;  2VRS A;  5E79 H;  5KJ7 C;  4PD4 I;  4U2H A;  1G2C B;  4OH8 B;  2DKB A;  1AHY A;  3CQ6 A;  5FT5 A;  5K8B A;  5CCG C;  1PPJ G;  4XK1 A;  3ZRP A;  3EIB A;  3PAA A; 
#chains in the Genus database with same CATH homology
 4ATQ A;  4XJM A;  4TMR A;  1SFC C;  1L4A C;  3AEP A;  3BCA A;  3A2B A;  2EH6 A;  1SQX K;  4A6U A;  4E77 A;  2R32 A;  3AEM A;  1SZK A;  4R8D A;  1UU1 A;  2AY3 A;  3W1H A;  4IXO A;  1YJZ A;  4WYE A;  1PMM A;  2FXM A;  3AEJ C;  2CIN A;  2VGU A;  2HUU A;  2CJH A;  1GEW A;  5EUE A;  1N73 B;  1AMA A;  1JNM A;  2CH1 A;  2YKP A;  3KQG A;  5AW5 B;  3VK2 A;  2D63 A;  1YTZ I;  2WT7 A;  2FM1 A;  1RE4 A;  1ASG A;  1EQ7 A;  3RL0 D;  3N75 A;  2W7I A;  5C6U A;  1C7O A;  3V2R A;  1NAF A;  1X28 A;  4IX8 A;  3BAT A;  4ZLV A;  2KFP A;  5M49 A;  1LKC A;  3RK3 D;  5M4B A;  1KL2 A;  1H89 A;  3HE4 A;  2R5E A;  3FDD A;  3R4T A;  2HFE D;  1LTS C;  1M4N A;  3HD7 B;  2R2N A;  8AAT A;  4LLH A;  3RK2 C;  3BC8 A;  3KPE A;  5AVZ B;  3ZZJ A;  3MBB A;  1TAT A;  3RQ1 A;  4WP0 A;  3FZ7 A;  4L0O A;  1WYU B;  4N0W A;  5AW6 B;  2GQN A;  3CLQ A;  4AO4 A;  4OC9 A;  1RE4 C;  5FT6 A;  1N7S A;  1GCK A;  2HLO A;  4J8L A;  5HHY A;  5EAV A;  2W8W A;  3FZ8 A;  3RBL A;  2W7E A;  1VJO A;  1KIL B;  1IAX A;  4TN4 A;  4XE5 B;  4AZK A;  2GMS A;  1HTL C;  1NTZ K;  5APS A;  1QJ5 A;  1GBN A;  3GET A;  1DJE A;  4IY7 A;  2RFV A;  4MQQ A;  2C9N Y;  3N4R A;  3PP5 A;  3B1C A;  1ZN5 A;  1PMO A;  2XH1 A;  2E43 A;  1C7G A;  3VOP A;  3FDB A;  3EIA A;  1SF2 A;  3NYT A;  4F4E A;  1J1D C;  1BW0 A;  2M8R A;  1MV8 A;  4ZAH A;  3Q8N A;  5EQC A;  4AOA A;  1CI6 A;  1EJI A;  1H1C A;  2VGT A;  1VDF A;  2R3C A;  1LTJ A;  3PD6 B;  3RI6 A;  1GC0 A;  4EU1 A;  1N7S C;  1SLQ A;  4H51 A;  3CAI A;  1T3U A;  2DKJ A;  2AY7 A;  1MAQ A;  1ARI A;  2O01 H;  3FFH A;  4A0F A;  1GW4 A;  1FZF A;  3WGB A;  2R5C B;  3B5N D;  1M1J B;  3EI8 A;  3ISL A;  4ZWV A;  3P8C D;  3WY7 A;  3MAF B;  5G4J A;  3HE5 B;  1OXO A;  2OKJ A;  5AX8 A;  2HOZ A;  3WGC A;  4JEY A;  4A0G A;  5BU5 A;  2P1J A;  2PAJ A;  3A9X A;  1LS3 A;  4XQ2 A;  1BS0 A;  2GUS A;  3MEB A;  1AY5 A;  3N7N A;  1GC4 A;  2AY4 A;  1ASF A;  3FZ6 A;  2CB1 A;  4AUW A;  3P6K A;  1XEY A;  3W1I A;  1IK9 A;  1AIC A;  2X5F A;  4R5F A;  2JGT A;  3RK3 C;  2EPJ A;  1C7N A;  1LTJ C;  1N31 A;  3TFU A;  2AEU A;  1YAA A;  2IX7 C;  4LC1 A;  4BA4 A;  1FZC B;  3EZ1 A;  4GT1 A;  2YNY A;  2XZR A;  1JTH A;  1NKZ B;  1CZC A;  1IAY A;  2AY1 A;  1IX7 A;  3VMY A;  1JS3 A;  3CQ5 A;  1GD2 E;  1AKC A;  1HWT C;  1IFI A;  3PGY A;  1VPC A;  4WY4 B;  2BI2 A;  1AMR A;  2IFM A;  1Y4I A;  4LC3 A;  4PFF A;  2VGZ A;  4HVK A;  5AVQ B;  2WPQ A;  1YJY A;  4A00 A;  5AVR B;  4K05 A;  2VMY A;  4IYO A;  3I4J A;  2VI8 A;  4K2I A;  1I29 A;  4AYC A;  5JAY A;  5BJ3 A;  2X3L A;  1G7X A;  5E5I A;  2AEV A;  3A5T A;  3HD7 D;  2BYJ A;  1BJO B;  1ZLL A;  1OAT A;  1FBM A;  3VN0 A;  4ISY A;  1AJR A;  1UKJ A;  2VMU A;  1AAM A;  1YTZ T;  3U59 A;  1KZU B;  4WBA A;  1IC2 A;  2JJF A;  1QJ3 A;  1FOS E;  4WXF A;  1V2F A;  1N2T A;  1SQB K;  2O1J A;  1KIL D;  3II6 A;  2IFN A;  1TOE A;  1CQ8 A;  4R5Z A;  2ZSL A;  3E9K A;  5G2Q A;  2YRI A;  4RKC A;  1C0N A;  3B5N C;  1U08 A;  1AFO A;  1D7R A;  1ECX A;  7AAT A;  1AHG A;  3WZF A;  1WYV B;  1GL2 B;  1YYC A;  3PDB B;  2H7H A;  2EYQ A;  1UU2 A;  2YKX A;  4W80 A;  1CL1 A;  2R0T A;  4JEZ A;  4RIZ A;  1AKB A;  3K28 A;  3RBF A;  1AHE A;  1LT9 B;  1DJ9 A;  1C9C A;  2WWW A;  1KFN A;  1AHF A;  4MY5 A;  5F9S A;  1SZS A;  2D64 A;  3AV7 A;  3I5C A;  3HQT A;  3HD7 A;  5AW8 B;  1MZ9 A;  2ZXE B;  2H8P D;  1IFM A;  3VK4 A;  2OYH A;  1ELQ A;  1WYU A;  2YCN A;  1WT6 A;  1LC7 A;  5AVS B;  1ARS A;  1QIS A;  1JY3 N;  5AW4 B;  5J8Q A;  2AY5 A;  4PVF A;  3DU4 A;  3AEL A;  1HH0 A;  1CZQ A;  2YKQ A;  3ASB A;  2W7G A;  2XDJ A;  3VYI A;  2QSR A;  4IFM A;  1TPL A;  3FTB A;  3A7O A;  3MC6 A;  4F5G A;  2YOB A;  3KGX A;  4B86 A;  1O69 A;  2BWN A;  3ZZK A;  1TAS A;  1GK6 A;  2WIT A;  3B8E B;  3E2Z B;  2FKI A;  1FG7 A;  2QBT A;  2GMU A;  4LNM A;  2QLR A;  2J59 M;  1V72 A;  1KKP A;  1GEX A;  2YCT A;  1FJP A;  3HD7 C;  2KOG A;  4ADB A;  4RES B;  4E3Q A;  4P7Y A;  1XI9 A;  3AOV A;  2KYV A;  2OYH C;  1ARH A;  1D7V A;  4W1W A;  1GW3 A;  4WY4 D;  3EI9 A;  3R2P A;  2PP6 A;  4Q6R A;  3V2Q A;  1OWA A;  4WYG A;  2PO3 A;  3NTN A;  2ZJG A;  4OMA A;  2I1K A;  5HXX A;  3SWF A;  3PPL A;  2QMA A;  1TOI A;  1E5W A;  5CCH A;  2YCP A;  5CCG A;  3DXV A;  1WYT B;  4JYB A;  2W7H A;  2ZSM A;  1SFC A;  2N1T B;  1QGN A;  1L4A A;  3QGU A;  4W1X A;  1V2D A;  3H32 B;  1BKG A;  1ZOB A;  5AW9 B;  4XA4 A;  1S09 A;  2CJG A;  1ASN A;  1IFJ A;  4GE7 A;  4GSA A;  2G7J A;  4W1V A;  1LW5 A;  1FC4 A;  3AEJ A;  4XJL A;  1ASB A;  3HUS A;  3WMM 0;  2JIS A;  4ZAS A;  1MAP A;  3M9B A;  3ZRQ A;  3NU8 A;  1OXP A;  3A8U X;  3T32 A;  1D7S A;  2BWO A;  2NPS B;  2QM8 A;  1GC2 A;  2Z4E A;  3EI5 A;  1BJW A;  2FYZ A;  3VMZ A;  4B9B A;  3OJA B;  5CCH C;  2CY8 A;  2Q9I A;  3NU7 A;  4MSO A;  2WZ7 A;  4IXS A;  2I1J A;  2BI3 A;  5APW A;  1FDM A;  1J1E C;  2VIB A;  4A0R A;  3LY1 A;  4OTL A;  5G09 A;  1KMK A;  2JEE A;  2V0Y A;  2V1P A;  3EUC A;  1KL1 A;  4F5H A;  3LVJ A;  1GL2 D;  5EIG A;  2XNX A;  3FKD A;  3NXS A;  3P8M C;  5CMZ A;  2F8J A;  3FVX A;  2VI9 A;  1Z56 A;  1MLY A;  4C7N A;  3HMU A;  4XJO A;  1FZE A;  1LGH B;  3HUS C;  3NMD A;  2X8U A;  4KXK A;  2BYL A;  1N2D C;  3M0D A;  1URQ B;  3F6T A;  1LW4 A;  1B5O A;  3AEN B;  1B9H A;  3WCN A;  1C4K A;  4I2L C;  5KTB A;  1FZC C;  1S0A A;  4CBR A;  1PG8 A;  1ZV8 A;  1LTI C;  1BJ4 A;  3MD0 A;  2ZC0 A;  3FQA A;  1SFF A;  3EIB A;  3V4Q A;  5AW1 B;  1NH4 A;  3SWY A;  3TFT A;  2CTZ A;  1PFF A;  1EG5 A;  3TNU A;  2GM4 A;  4WB4 A;  4K2M A;  3VMX A;  4EMY A;  3QN6 A;  1LWU B;  1G1J A;  1JO5 A;  3RCH B;  3L37 A;  2VGS A;  4I6M C;  2HOX A;  3M0D C;  4M2M A;  2C0R A;  3PJ0 A;  4ITX A;  3MTU E;  3OAK A;  3FVS A;  5TF5 A;  3IFM A;  1ASE A;  1JY3 P;  1NU1 K;  2VMX A;  1M32 A;  1M7Y A;  4JEW A;  5F8V A;  3P8C E;  4EFF A;  3A3Y B;  1IX6 A;  2OYI B;  2WK7 A;  1QL2 A;  2X5D A;  4Y0H A;  2AY2 A;  2E7J A;  4ZDP A;  2HPC A;  4GIF A;  3HDO A;  1CSB A;  1JY2 N;  1YOO A;  1ASA A;  5APY A;  1A02 J;  2VMP A;  3F0H A;  2C81 A;  3L36 A;  5APQ A;  3LG0 A;  3N4S A;  3NTJ A;  4Y99 B;  2FFD A;  2ZFC A;  2HUI A;  2HOD B;  3ECD A;  1VEF A;  4BA5 A;  2N1T D;  3TCM A;  2KB7 P;  4AO9 A;  2PB0 A;  2JJH A;  1A02 F;  5APV A;  2AY6 A;  3LVL B;  1ASD A;  1H88 A;  3FD0 A;  5AVX B;  4F5I A;  1LTT C;  3P32 A;  1IBJ A;  1ORD A;  2OAT A;  1X9V A;  1AHX A;  1T8Z A;  3G0T A;  1MGV A;  5IWQ A;  1DX7 A;  1JUN A;  1GL2 C;  1WRG A;  3P7K A;  4U1T A;  2YO2 A;  3BCB A;  2D7Z A;  1DKA A;  3WKR A;  5M4D A;  3DRD A;  4KAM A;  2NPS D;  2Q7C A;  1JY3 O;  1O4S A;  3KGW A;  1ASC A;  5DX5 A;  2FFD C;  1M0P A;  3N5M A;  3FQ8 A;  1FOS F;  4WLJ A;  3M06 A;  1I43 A;  1M0Q A;  3AEO A;  3RL0 C;  3PDX A;  2VLH A;  2XBN A;  2CPB A;  1JMM A;  4PFN A;  2AY8 A;  1I48 A;  1SP4 A;  3UIA A;  1AJS B;  4GRX A;  1V2E A;  2ZY3 A;  1WKH A;  1AIB A;  1CS1 A;  3HL2 A;  1GD9 A;  2VIA A;  4XAU A;  3M9H A;  5APU A;  3V4W A;  4CXR A;  1S06 A;  3N0L A;  1S08 A;  1SQQ K;  3HTK A;  2ZY5 A;  1CL2 A;  4CBS A;  1MUU A;  1URQ D;  1HJB A;  3LW5 H;  3BRV B;  2HP2 A;  5E4Z A;  4Q31 A;  2W27 A;  4Q75 A;  1ARG A;  2O1K A;  2N9B A;  2Z9U A;  4GE9 A;  4WB0 A;  1RVY A;  3MGN A;  3EI6 A;  3BWO A;  4N3Y B;  1WST A;  2CPS A;  5G4I A;  2C0W A;  3KKI A;  2FNU A;  3TYY A;  3LV2 A;  2DOU A;  2D66 A;  3B5N A;  3OA7 A;  1G2C A;  5EUN A;  2YKO A;  3NX3 A;  2BIA A;  1ART A;  3RUY A;  2WKA A;  4BMK A;  5AVY B;  1M0N A;  2Z1Y A;  5CHX A;  2WT7 B;  2C44 A;  1G7W A;  4HF8 A;  1TOJ A;  1N73 A;  3MAD A;  3WX9 A;  5AW3 B;  2EZ2 A;  3FRK A;  1ELU A;  4IFF A;  1URQ A;  4IFD K;  1RF0 C;  3AEN A;  5AVV B;  1I41 A;  1AX4 A;  2NPS C;  4LGD E;  4LW4 A;  2KLV A;  1OXZ A;  5CJ4 A;  2YKU A;  3MUD A;  3HE4 B;  4MKJ A;  3W1J A;  1XTG B;  1NHL A;  2YHK A;  5EAA A;  2NMP A;  3V2N A;  1E5F A;  4UQV A;  3EQ2 A;  4ADD A;  5DB5 A;  1T2K D;  2A1V A;  1DGD A;  1J1D B;  1X29 A;  5CJ0 A;  3USF A;  3DYD A;  1GDE A;  2G6W A;  1J04 A;  3NYU A;  3BRT B;  2L5G B;  3NFQ A;  1JY2 P;  2WSF H;  1N7S B;  2HZP A;  3UAK A;  3LIE A;  1N73 C;  2KSJ A;  4RIT A;  1X2A A;  3GZC A;  3LVM A;  2BAS A;  1URQ C;  2XKM A;  1MLZ A;  1JCC A;  5KJ7 D;  3JW9 A;  1DEB A;  3O8Z A;  4N78 E;  2CAN A;  3AOW A;  1FJK A;  4RLG A;  3TQX A;  3VP8 A;  4O9B A;  2YO3 A;  3M9Q A;  1JOC A;  1IJD B;  2P2U A;  1KIL A;  4KYO A;  3E77 A;  3NRA A;  4Y0I A;  3E1I A;  2CFB A;  5EFS A;  1NO4 A;  3N4X A;  3AAT A;  3IHJ A;  3A9Z A;  1W23 A;  1CI6 B;  4ZSY A;  4ADE A;  5KLV K;  2A45 H;  2Z20 A;  4HH2 A;  1LTJ B;  3G3Z A;  4F5L A;  1DFO A;  1GU4 A;  4IW7 A;  2VMQ A;  3NUI A;  3T97 A;  3L4F A;  5E3K A;  1IO4 A;  4K2B A;  1AMS A;  5D95 A;  1JY2 O;  1JF9 A;  4O6Z A;  3PD6 A;  1SPA A;  1FZA A;  3TAT A;  3ASA A;  1D2F A;  2OYI C;  4WYD A;  4W7Y A;  4B98 A;  1KIL C;  2EO5 A;  2FN6 A;  4ZKU A;  4BHD A;  3MAU A;  4DBC A;  2E42 A;  2R5C A;  1AAW A;  4F5M A;  1M1J A;  4JF1 A;  3EZS A;  3MAF A;  4PIW A;  3HE5 A;  2VMS A;  1CJ0 A;  2C9L Y;  1W3U A;  4A6T A;  3ELE A;  2OGE A;  3FVU A;  1SQV K;  5AW7 B;  1MDZ A;  1X8Y A;  3GJU A;  4GE4 A;  2H43 A;  3WLX A;  1X79 B;  2O1B A;  1UU0 A;  4W5K A;  1RF1 B;  4BQ0 A;  1G4X A;  4JF0 A;  4C7R A;  4M2K A;  4W8I A;  1VP4 A;  2JJG A;  2OAR A;  1O61 A;  1T3J A;  2W6B A;  1B4X A;  3CBF A;  1S9K D;  1NOH A;  1YJS A;  1FZC A;  1IFN A;  4DZO A;  3P1T A;  4AH3 A;  1N7L A;  3QI6 A;  9AAT A;  2E7I A;  4GDY A;  1W2E A;  3VTP C;  5DJ9 A;  1M1J C;  1ZR2 A;  4Q76 A;  3KDP B;  2Q5U A;  4WY4 A;  3COG A;  3FFR A;  1XTC C;  3UE8 A;  1SVF A;  3PA9 A;  3A9Y A;  1KQL A;  1KFM A;  1GTW A;  2VMT A;  1M7L A;  2WPR A;  1Z3Z A;  3E2Y A;  1O62 A;  3HVY A;  1L0N K;  3MIW A;  4UHO A;  3OP7 A;  1HGZ A;  3M91 A;  4F5J A;  1N7S D;  2WB6 A;  1BJO A;  4N6J A;  1S07 A;  3VK3 A;  4KHX A;  3ZRR A;  3EI7 A;  1M6S A;  5I92 A;  5AVW B;  2D7Y A;  3VOM A;  2VMR A;  2HP1 A;  2W7F A;  2VMO A;  2VMW A;  1SQP K;  1H0C A;  3A2A A;  2E54 A;  1YIY A;  2ZYJ A;  4JEV A;  1GK4 A;  1ASM A;  2BHX A;  2FYU K;  3ATH A;  3M0A A;  1GZL A;  1RE3 C;  4WY4 C;  4EB5 A;  4Y0D A;  3DR4 A;  2YKY A;  2EZ1 A;  5D5S A;  2P7J A;  1OHY A;  4ZWM A;  1AY4 A;  1RVU A;  1OHW A;  3AEM C;  4RJY A;  3H9X A;  4J5U A;  5G0A A;  2Z1Z A;  4ITG A;  2KP8 A;  2W6A A;  1WYV A;  1GL2 A;  3PDB A;  4F5F A;  1YNU A;  3HLM A;  1HUC A;  4UHM A;  2FQ6 A;  1LT9 A;  4AQR D;  2FKW B;  2OYH B;  2OGA A;  2Z9V A;  4ZM3 A;  1DTY A;  1GEY A;  1W7N A;  3G7Q A;  2CH2 A;  2BWP A;  4OYT A;  1X0M A;  3KYQ A;  4OBU A;  2BI5 A;  1JG8 A;  3E6G A;  4OCA A;  1MDO A;  2Z9W A;  1AQ5 A;  4HYT B;  3KE3 A;  4ZDL A;  3IR9 A;  3GHG B;  3CL3 D;  2VMN A;  4MQP A;  3L35 A;  5BU8 B;  3BVH A;  2WK8 A;  3HBX A;  4UOY A;  2HYN A;  2BI9 A;  3L44 A;  2Z5H A;  1E5E A;  2XV5 A;  2PB2 A;  2VGV A;  3VP9 A;  2JG2 A;  1OHV A;  2W8U A;  4DGT A;  1LT9 C;  3DR7 A;  1ASL A;  3MKJ A;  1IUG A;  3E2Z A;  2AY9 A;  2ZY2 A;  1B8G A;  3ACZ A;  4MQR A;  2A45 I;  3BAS A;  1GDT A;  2VMZ A;  1ZR4 A;  1DH3 A;  4DQ6 A;  3NUB A;  1ZOD A;  2WSE H;  2ZP7 A;  1ZC9 A;  3H6P A;  3R9A A;  2FNI A;  1YIZ A;  1H8A A;  2O7C A;  5BVZ A;  1TAR A;  1SFC B;  4P3M A;  1L0L K;  4FFC A;  1L4A B;  1J1E B;  2W8J A;  3QHX A;  4I8A A;  3OKS A;  3BN1 A;  3BWN A;  3GZD A;  4JF7 A;  3EFG A;  2VMV A;  1BQA A;  1LC5 A;  4M2J A;  4E3R A;  1WYT A;  2GB3 A;  2OQX A;  1QL1 A;  1M0O A;  4EOT A;  2N1T A;  1SVV A;  4ATP A;  2M3B A;  2QM7 A;  3B1D A;  2HOR A;  2BIE A;  4WXB A;  2ORD A;  4JYC A;  3HUS B;  3L8A A;  1GC3 A;  3H32 A;  5HDM A;  2WK9 A;  4R2N A;  3JWB A;  4C46 A;  3CQ4 A;  4AZJ A;  5APX A;  1BJN A;  4OT8 A;  3DOD A;  2D5Y A;  2DR1 A;  5M46 A;  1IX8 A;  1RF1 A;  1TOK A;  4M3L A;  2J58 A;  1BQD A;  1FG3 A;  3LWS A;  1B9I A;  1Z7D A;  1MFZ A;  1B5P A;  2Q7W A;  2EGY A;  1LTB C;  3JZL A;  1RF0 A;  1AY8 A;  1KKJ A;  1P3W A;  2NPS A;  3BCX A;  3BWN C;  3D6K A;  3E2F A;  3GZD C;  2CJD A;  4CXQ A;  2XU6 A;  3G8M A;  5EIG B;  3VAX A;  4ZKP A;  2R5D A;  1RV3 A;  4LW2 A;  2Q3I A;  2DGM A;  4C7N B;  3K7Y A;  1FZG A;  2N1T C;  3WCO A;  3RK2 B;  1FZB A;  4JEX A;  2HG5 D;  3B46 A;  3I5T A;  4GEB A;  2POH A;  2MJZ A;  3NNK A;  2HUF A;  4LNJ A;  4A0H A;  1NKN A;  1G1I A;  3TSI A;  5AVT B;  3C9I A;  2D61 A;  1RF1 C;  1W7L A;  4I1L A;  4WXG A;  2W7L A;  3HT4 A;  4ZM4 A;  4FL0 A;  4RJ0 A;  1CQ6 A;  2W7K A;  3FQ7 A;  5G2P A;  2QB2 A;  1HBW A;  4EIJ A;  1DJU A;  3BS8 A;  1FU1 A;  3TNU B;  3FCR A;  1JCD A;  2Z9X A;  2C0X A;  4CVQ A;  3WKS A;  1CQ7 A;  2A45 G;  1QIT A;  3QBO A;  3VP6 A;  3UWC A;  2DGL A;  1QZ9 A;  1WKG A;  4GKG A;  5BJ4 A;  1IVR A;  3M5U A;  2VLF A;  1LWU A;  1BT4 A;  1KMJ A;  2E7U A;  4H63 Q;  3U1C A;  1N8P A;  2HOY A;  4A6R A;  3GBX A;  4ZDO A;  3RCH A;  4WYA A;  5AW2 B;  4XEW A;  2YKV A;  3ELP A;  2CST A;  4EB7 A;  2HPC B;  3GR9 A;  4UHN A;  4XJP A;  1MDX A;  4LNL A;  3K40 A;  1JS6 A;  3GWP A;  2C7T A;  1W7M A;  4WYF A;  5CCH D;  5AVU B;  4F5K A;  5CCG D;  2FFD B;  2GUV A;  1LTA C;  2OYI A;  3B1E A;  3GSB A;  5AW0 B;  4OBV A;  3I16 A;  5FT4 A;  2OKK A;  1SFC D;  2JJE A;  1L4A D;  1LTG C;  2IPP A;  1CZE A;  3RL0 B;  5FT8 A;  2LKM A;  3TK1 A;  2BKW A;  1SZU A;  4RKD A;  3DZZ A;  2WTY A;  2HOD A;  2BI1 A;  1RV4 A;  3BB8 A;  2W8V A;  1LWU C;  4ADC A;  1J32 A;  3RK3 B;  4W91 A;  3DC1 A;  5DJ1 A;  2W7J A;  3GHG A;  3V2P A;  1GU5 A;  4MKK A;  1S9K E;  1LC8 A;  1HGV A;  2Z61 A;  1J2J B;  2BIG A;  1T3I A;  1D7U A;  2VYC A;  3U1A A;  3NYS A;  4A72 A;  2ZY4 A;  3JTX A;  1FAV A;  2P67 A;  1EQB A;  1PFI A;  4QGR A;  4RAE A;  1HVV A;  5EUD A;  1DGE A;  3PIU A;  4W7Z A;  2R5B A;  2TPL A;  1AMQ A;  3HRN A;  1NTM K;  4Y99 C;  2QB3 A;  3LID A;  2YRR A;  1CW5 A;  3F9T A;  1NTK K;  3V5B A;  2JJL A;  2W7D A;  4WLH A;  5KJ7 A;  4WBT A;  3II0 A;  3FSL A;  2W7M A;  2FYF A;  3RK2 D;  3MC6 C;  3GHG C;  3QPG A;  1AKA A;  4N78 D;  4E1O A;  1N86 A;  3HTK B;  4IXZ A;  2WSC H;  2O0R A;  4RM1 A;  4WYC A;  1JTH B;  3B8X A;  3H7F A;  1T2K C;  3LVK A;  2WPS A;  1LK9 A;  1TOG A;  1RY3 A;  1NWQ A;  1AJS A;  4WD2 A;  2W8T A;  1QIR A;  2AAT A;  3CI9 A;  2VGW A;  2QA3 A;  3BV0 A;  1G4V A;  3NDN A;  4DOJ A;  3DXW A;  2GSA A;  4WB0 B;  1IFD A;  1AIA A;  5APT A;  2DGK A;  4ZSW A;  2D65 A;  2YMY A;  2ZUK A;  4NOG A;  4IYO B;  2Z5I A;  3QM2 A;  1IJI A;  1RE3 A;  3B5N B;  2VRS A;  5KJ7 C;  4U2H A;  1G2C B;  4OH8 B;  2DKB A;  1AHY A;  3CQ6 A;  5FT5 A;  5K8B A;  5CCG C;  4XK1 A;  3ZRP A;  3JWA A;  3PAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...