3N7NA

Structure of csm1/lrs4 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
163
Chain Sequence
b'PLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monopolin complex subunit CSM1
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 53
structure length 163
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3n7nA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n7nA02
2POHA 3P8CD 3N7NA 3N4XA 4N3YB 3N4SA 4I1LA 1NKNA 1WT6A 3C9IA 3VP8A 5BU5A 2JEEA 5BVZA 4GIFA 3U1CA 3N4RA 5BU8B 4ZKPA 3U1AA 4N78D 3BASA 1IC2A 4ZKUA 3U59A 5KTBA 3HRNA 4O9BA 1X79B 3VP9A 3OJAB 3BATA 2FXMA
chains in the Genus database with same CATH superfamily
3NUIA 2QJPC 4YTPC 2AATA 1TATA 1IK7A 1LT9A 2QVAA 2QJYC 1M1JA 1YJYA 3DZZA 1ASBA 3FQ8A 1SFCB 1NTZJ 4LC1A 3SFEC 3D6YA 1NU1D 2BKWA 1YJZA 1GC0A 1GEYA 1Z56A 1PP9G 2WQYC 5L8RJ 2M0BA 3EWKA 1WYUB 4NPFX 2ZY3A 4K05A 3ZRQA 3A5TA 1JMBA 1S1CX 5KKZB 3IR9A 5B5EH 1PP9J 5KLVD 3LIDA 2JISA 4GOFA 3JCUH 2VMOA 2W7KA 3FXEA 1VEFA 1QIRA 4ZWMA 3PDXA 4L76A 1KB9H 2C9NY 2W83C 5KLIB 4I8AA 3R9AA 3VP9A 1YJSA 3H1LE 3H32A 3PJSK 3RK2D 2W7GA 3CXHD 3G3ZA 2OTKE 5BJ4A 4UHMA 1AY5A 5KAIE 4Y99C 1FZEA 4RLGA 4WXFA 1FJPA 1DJ9A 2BI2A 3H1JJ 2OATA 1BE3D 2FN6A 1AKBA 3ZRRA 4CPGA 4OH8B 2AY8A 3AEJA 1YIJP 2C0RA 1GK6A 3HE4B 1SFCD 3G6EP 4F5GA 2FNUA 1BJOA 5D5SA 5EUDA 3FKDA 3EZSA 1LS3A 3AEEC 3CCEP 1I43A 1IAXA 1HUCA 4NOGA 5F8VA 1SQPK 1H89A 2EGYA 1BGYE 2B89A 3V5BA 5G09A 4JF7A 5KJ7C 3Q3DA 1FZFA 3CWBG 1HVVA 2VGSA 4WXBA 2WK7A 5EAVA 1JTHB 1U7MA 2A06D 2GMSA 2Q5UA 3CWBJ 4K35A 1USEA 2B9BA 1LTJB 3VYIA 1GL2C 3A0HH 1EDLA 5EFSA 3F5HA 4H0LC 4YXDC 2ZYDA 2KZJA 3WKSA 4JYCA 2N1TB 3KE3A 2HFED 1JY2N 1D7SA 2LR2A 1XI9A 3AE3C 1AJRA 2B88A 3CC7P 4B86A 1NTME 5DX5A 3H1LD 1NU1G 2O01H 3KZIH 3AEMC 1G4VA 4PFFA 3G4SP 4O6ZA 2KOGA 2A45I 2R2NA 2KLUA 2KYVA 4AQRD 1QEXA 1NU1J 5G4IA 5AW3B 2Q7WA 1IFIA 2VRSA 5APSA 3ITKA 1MDZA 2UWJE 4JEYA 5KLVG 3N75A 4ZDPA 4CBSA 4U1TA 1X8YA 1S0AA 1AIAA 1U7JA 1JNMA 3MC6A 2JP3A 2CK3H 2JJFA 1T2KC 3EI6A 3D70A 3BCXA 1KTMA 1J1DC 3HUSB 1RE3C 2FFDC 2WSSH 3H1KE 3AEFC 3LVLB 3O8ZA 3RK3C 3ZZKA 3COGA 1N7SB 5APXA 4W91A 3K5BA 2N1TD 3ZDMA 1JY2O 2FKIA 3AE1C 2WKAA 5AW6B 1XTGB 4ZNCA 1CW5A 1AJSB 4HF8A 1CL1A 3EI8A 1BJNA 4L75A 3NFQA 1B5PA 5CHXA 2W7IA 4JQ0D 2R5CB 3R4YA 3ZRPA 5APWA 1P84H 3IHJA 2JKVA 1L2PA 2YIUB 2Y0CA 1YQ3C 4WWIA 3JW9A 1XTCC 3HE5B 4FL0A 2Q3EA 2HORA 2VLFA 3BCAA 3GZCA 1OWAA 3B1EA 1D7RA 1AQ5A 1SQBD 1RQUA 3QN6A 4WY4B 1VQMP 1SQVJ 2A06G 2W6JH 1QJ5A 2OKJA 4TMRA 3II0A 3H1IE 2E75B 4JBZA 4OWFA 1OVUA 3L73J 1B9IA 2B87B 2K9JB 2OQXA 2YCNA 4ATQA 4PD4E 3CCUP 2W6BA 2BIEA 1FG7A 3RK2C 2YKYA 3I4JA 1RF1C 2VMNA 3PLNA 2ZY2A 3GHGC 2ZY4A 2KS1A 4LW2A 1CQ7A 1PV3A 2R5DA 3FVUA 2FYUD 3CCVP 2VMPA 1YIZA 1RH5B 2NZ2A 3CX5I 1KILB 3DXVA 3H1LG 1QVGO 1YNUA 1UU2A 1GW4A 3L74E 2Y9YA 2CJHA 3AE9C 3L75J 1TOGA 4GEBA 2FM1A 1IBJA 2G8YA 2YKOA 1SFCC 2YXRB 1URQA 4W1XA 2C81A 4ZDLA 4UB8H 3H1KD 1W23A 1RE4A 2HUUA 1SVFA 1FDMA 4JPZB 1LTIC 5FT6A 1SQXE 4WB0B 1G4XA 3JWAA 2QB2A 1SPAA 2Z9XA 5EQCA 1AY8A 2E7JA 1NU1K 1I41A 1AAMA 1CI6B 2KK7A 1K04A 1L0NE 4OBVA 2QE7H 5KKZC 1VDFA 1SFFA 4F5JA 3MUDA 2HP1A 1EQ7A 2VMQA 3U59A 1R5LA 3W67A 3B1DA 4TN4A 1T3JA 3UAKA 3WGCA 2J58A 2OYHA 1T8ZA 3CPWO 3RL0D 3USFA 1YHQP 1FG3A 1M0PA 4WY4D 3FSLA 3L70G 3HTKA 3GZDA 1KD1Q 1DKAA 2WSEH 1PMOA 5KLIC 1W7MA 2NRGA 3SWKA 3C1LA 3L70J 1C9CA 1NHLA 3VTPC 3GF7A 2X8UA 4XA4A 2K1AA 2R44A 2P10A 1SZSA 4XFJA 3H1ID 3KPEA 1Q86Q 4F5MA 3I56P 2FYNB 4PD4D 1IO4A 3V6IA 4AO9A 2ZJSE 3W1IA 2XNXA 4HYTB 1JUNA 3MZWB 1ASMA 3II6A 3E6GA 1KZUB 4W7ZA 1KL1A 1V2DA 4YXWH 2IYPA 1W2BO 4H13D 4XJOA 1LC5A 1FC4A 4UQVA 3A2BA 2JJGA 3BCCE 4XEWA 1SQBG 3AE2C 3FTBA 1KYOH 1M32A 2PP6A 3LG0A 4HVKA 5G4JA 2HPCA 4GKGA 1SQBJ 3OA7A 1HBWA 5CJ4A 4L73A 2CINA 4ZWVA 2YKQA 1SQVK 1SQXD 3HL2A 3F89A 2G7JA 1IJIA 4Y0HA 2W7HA 1O4SA 4XAUA 2FYUG 3U1AA 1UU0A 1LTJC 2F8JA 4OT8A 4WXGA 1R8EA 4U3FE 3I5TA 4XQ2A 1LTGC 1L0ND 1S5LH 3LV2A 4MQQA 5E79H 4N0WA 2N1TC 1X79B 2FYUJ 2KSEA 4U7JA 1B8GA 1GD2E 2BIGA 1OW8A 1VQKP 1DJUA 1KL2A 5KAFE 1VQ8P 1D7VA 1PGJA 2AEFA 1NTZE 2FQ6A 1AJYA 5CCHD 1FZGA 2YKXA 1DTYA 1BDCA 1BS0A 5C39A 4BHDA 1JY3O 2N9BA 3CQ6A 1FDIA 3WY7A 3G0TA 5AVZB 1AAWA 3BCBA 2VMXA 3G7QA 5AW0B 2FXMA 1JCDA 3FDBA 3V2NA 1CS1A 3CQ4A 4Q31A 2QMAA 3N5MA 1HGZA 2CFBA 1N2DC 3AEPA 4RKCA 3OW2O 1NAYA 3UWCA 3H1HJ 1FU1A 3MADA 4R5ZA 3MIWA 5AVRB 4UB6H 2V7QH 3E2YA 2WPSA 3BN1A 2D2CD 2ZSMA 5KJ7A 3CLQA 2E74D 3BWOA 3HUSC 1I29A 2HOYA 3Q5PA 4LNJA 1VF5D 3H1IG 5CCGC 3DODA 2BASA 4IL6H 2E42A 1YQ4C 4BQ0A 3GW6A 3K7YA 1L4AB 5GTHH 1GL2A 2KSJA 1BCCE 2AY6A 3LVKA 1BW0A 3WMM0 1MLYA 3PIUA 2YMKA 2WSCH 2YRRA 3M9HA 1S72P 4E1OA 1LC8A 4ZSWA 1FZAA 1ZMEC 2VIAA 1LTBC 1M57D 2FXOA 1M8OB 1DEEG 2YIUC 4GOEA 1AVYA 1YBKA 3AEMA 4LNMA 1NKNA 4Q75A 3VP6A 1FS0E 3EIBA 4GRXA 2R32A 1YITP 4BRYB 3FVSA 5B66H 3HQTA 4ISYA 1M7YA 1SQXG 1LW5A 1IJDB 2HYNA 3AECC 4WY4C 4QGRA 4GODA 2Y0EA 3PRJA 1SQBK 2E75C 5DJUB 2R5EA 4R5FA 3AOWA 1OX3A 1Q2NA 1MDXA 1M4NA 3K28A 1O69A 1VQ6P 2WSEJ 1G7XA 3DXWA 3F0HA 3RBZA 1PGQA 4K3AA 2JJEA 1NGMB 2V4HA 3MD0A 4LGDE 3U1CA 3I5CA 2P1JA 1WYTA 2AY5A 4N6JA 3AE7C 3PHLA 3RK3B 1E5FA 1KILC 2GSAA 1RE3A 2FFDA 2FYUK 2O3JA 3B5ND 2OKKA 2NMPA 3LVMA 4ATPA 2BEZF 3NTNA 2FYZA 2FBWC 4H13C 4WYCA 2PFXA 2W7JA 3H9XA 2V0YA 1BCCD 4D6TE 4ZMDA 2W7EA 3WKRA 4WYFA 1OVRA 5AVYB 2YHKA 5E5IA 1KQSO 5CJ0A 1MFTA 2E5YA 2Q3IA 1ORDA 2WT7A 2VGUA 4EDFA 3HLMA 3EI5A 3RCHA 2XU6A 3RBLA 1OHVA 1W7NA 3MAFA 3RK2B 1EDJA 1ASEA 3N0LA 5EIGA 3USSA 5M49A 3L72D 4I7ZB 2PRRA 2YOBA 3VK4A 3CXHH 1NTKE 3AE5C 3O6QB 1LJ2A 2VI9A 5AVWB 1RF1A 4Y0IA 4KXKA 1IX7A 5E3KA 3GHGA 2WITA 2WK9A 2W7DA 4N3YB 2FYNC 3ZZJA 4ZAHA 1FZCA 2YXQB 1SVVA 2ZT9B 2AXTE 2CB1A 3GR9A 3A2AA 5K5GB 5H2FH 3EUCA 3V2QA 3VOPA 3WU2H 5GTIE 4OGQB 2A1VA 2O0RA 3H6PA 2ZSLA 5KTBA 3ISLA 3NYUA 2OTLP 3NMDA 1SFCA 2VI8A 2ZXEB 2WVRA 3ATHA 2HODB 3L36A 3FWNA 3QPGA 1YTZI 2KFPA 2VMUA 1WT6A 1GBNA 5EUEA 4RKDA 3MBBA 2D61A 5DJ9A 3L71G 3TGUE 1WYUA 3CCLP 3L73E 1G2CB 4RO0A 4PV1D 1ZW0A 2V7QJ 2W27A 4F5HA 4D6TD 1CQ8A 1KB9E 3GMAA 3L71J 3BRTB 3TNUB 4PVFA 3E9KA 3GSBA 1H88A 1W2EA 1MV8A 1QLED 3QH9A 4ADEA 5DJTB 1LP1B 1GC4A 2BI9A 1SZUA 1R5SA 3L75E 2D63A 3E2ZB 2D64A 1KB9I 2DGKA 3UE8A 2YCPA 1QJ3A 2WSCJ 2ZT9D 1L0LE 2GM4A 1HGVA 1NTKD 3IN6A 4H63Q 4OGQD 5KAIH 1LK9A 1V2EA 3JWBA 1DFOA 4GDOA 1OXOA 3HE4A 1KQFB 2BHXA 3P8MC 1WSTA 2ZXXA 1EC5A 4A0FA 5AW7B 3TF5A 3EI7A 1ZOYC 1E5WA 1V72A 2E5TA 5HHYA 3FXDA 1UIIA 1WRGA 4C7RA 5EFWB 3H25A 3L72G 2JR8A 2BI3A 1YJNP 1T6AA 3V2RA 1QGKB 1GU5A 2PB2A 2DGMA 4MKKA 1JTHA 1ELQA 2L5GB 4HKZH 2W7MA 2BCCE 3W1JA 3TGUD 3PPLA 1PL5A 1L4AC 1LTJA 1IVRA 5M4DA 4CXRA 2ZYGA 2N1TA 1ECXA 1OXZA 1S9KE 4EB5A 1M0OA 1M1KQ 1NKZB 3AEGC 2JWDA 5TISE 1KAFA 3FRKA 1OVVA 1OHWA 2VGZA 1IFDA 4DQ6A 2E54A 3G71P 1E79H 4W1WA 1AIBA 1BKGA 5E4ZA 1L0LD 1ZLLA 2GQNA 4D6TG 1AVOA 2IFNA 3BRVB 5KLVJ 3CQ5A 4EIJA 4XJMA 4AH3A 2HOXA 4FFCA 2C9LY 3VOMA 1AMRA 1RV4A 1D2FA 2YCTA 3AEBC 3P7KA 1BGYD 3PD6B 1BE3G 2WWWA 2QA4P 4DOJA 1B5OA 2C0WA 2M3BA 4NPDA 1IZNB 2W8ZA 2ZFCA 3HUSA 3CC2P 1JF9A 5AW5B 1YI2P 2CH1A 5AW8B 1PMMA 3PDBB 1AICA 3D6ZA 1G1JA 1AKCA 1KN7A 1BE3J 5I92A 5CCGA 1NTKG 4PIWA 1VQ5P 1N7SA 3M06A 4IX8A 2YNYA 1PPJE 2AXCA 4P3MA 1NOHA 3M0AA 1AJSA 2OGEA 1VQPP 3SWFA 3FGAD 1SZKA 3CCQP 4B9BA 2R0TA 1N86A 2R5CA 4E3QA 4I6MC 2D7YA 3ASAA 1M0NA 1NTMD 3E1RA 1S9KD 3H1HE 3IF4A 3C9IA 3VP8A 1TASA 2KIKA 3CX5E 3RL0B 3A0BE 3HE5A 2RMZA 2CTZA 4YPCA 4WLJA 2M5AB 2EPJA 2IX7C 4WBAA 1SQQE 1C4KA 4AO4A 1BT4A 2HUIA 3GLMA 2QBTA 4WY4A 4I7ZC 3TGUG 5EAAA 2QJKB 2B87A 2K9JA 1TPLA 2YMYA 1X28A 2WPRA 4WYEA 1GEXA 1ELUA 2HLOA 1WYVB 1LC7A 4PD4H 1VQ9P 1IC2A 2ZT9C 1FOSF 4RJ0A 1MFZA 3Q5SA 3BWNC 1RY3A 3DC1A 1KILA 2L91A 1M7LA 3KKIA 3H1LJ 3L44A 4OGQC 1GZLA 2DKBA 1FOSE 5AVUB 4H13B 1CZCA 4A00A 1NYHA 4DBCA 1VL2A 5AW9B 3N4XA 1M1JC 2RKLA 3N4SA 2KLVA 2JWAA 1L0LG 2YRIA 2QSIA 1S07A 3DYDA 4WB0A 4EYYQ 3AE8C 1PPJD 2CPBA 5APVA 3RBFA 1DIPA 3NNKA 3FCRA 1IAYA 1CI6A 2DOUA 1PFFA 5KLVK 3BVHA 4GE7A 1BGYG 2K3RA 2BIAA 1KMIZ 1ARSA 2YO3A 2GB3A 1DJEA 1HJBA 1YJ9P 2FYFA 3CX5D 3RGUA 2IBZE 1JMMA 2KZIA 3RUYA 2KXPB 2OYIB 4GE9A 2A45G 4TLFA 1SQQD 3HD7B 1Y9BA 1LWUB 3VK3A 1AHFA 7AATA 1Q7YQ 3M0DC 1H0TB 1EJIA 2QM7A 3CD6P 1ARIA 1JY3N 1AHGA 4A6RA 4ASVA 4I2LC 1NTMG 3GWPA 2IBZI 2P2UA 1TOJA 3KHUA 4K2BA 2VGVA 1JM0A 3AEJC 4IYOB 2WSFH 1SQPE 1ZN5A 3L74D 2ORDA 1DX7A 2IYOA 2AEVA 4WYDA 3WGBA 3T97B 1A02F 3FWLA 3A8UX 2YKPA 3TFTA 2QM8A 2AY1A 5C6UA 2D2CB 2WPVB 2E74B 4NPEA 1KQGB 4MQRA 3JSVC 4XE5B 4ASWA 1X2AA 4HB1A 2D66A 3NU8A 5M4BA 1KFNA 1I48A 1EZVE 1VF5B 1J2JB 4WVZA 2E7IA 8AATA 2ZC0A 1OATA 5AVSB 3AATA 1RV3A 3L37A 2P58A 3MKJA 4J8LA 5AW1B 3FX0A 3Q8NA 3A9XA 4ITXA 1JB0J 2D7ZA 4K2MA 3MEBA 2VMZA 1FBMA 4BMKA 3H1KG 2CJDA 1OMIA 3HD7D 1Z3ZA 5EUNA 1GU4A 2VGWA 4M2JA 1EZVI 3FVXA 4W8IA 3HDOA 3GETA 1S4XA 2EO5A 3H1KJ 1EDKA 1H0CA 4H51A 3G9RA 1AMSA 3VMYA 3E2FA 4W5KA 1KKJA 3P8CE 4RAEA 3AEDC 1JS6A 3AEOA 1AA0A 2QRXA 1W3UA 1PP9E 1WMKA 1CSBA 1ASGA 3FZ8A 2I1KA 4KHXA 4A0GA 4C46A 5CBOA 1AY4A 1N73B 4ZKPA 1X0MA 4LC3A 3KXDA 4QMAA 3ELPA 1N8PA 3QGUA 2AY9A 2HZPA 1SQPD 2H7HA 3BCCD 3A3YB 4OCAA 4Y0DA 3PH0A 2PB0A 3WCNA 1AHXA 3I16A 2EZ1A 2HUFA 3HT4A 1D7MA 1SQQG 3H1JE 3B5NB 4N78E 1MGVA 4RITA 2CPSA 3H1IJ 2ITAA 3OKSA 3ECDA 1EQBA 1M6SA 3NUBA 3AENB 3W68A 4C7NB 1HF9A 4O9BA 4CBRA 1L4AA 4U3FD 1LKCA 2O01N 3PAAA 4HH2A 2W8TA 1GD9A 2NPSB 1QISA 5F9SA 3VMXA 3L74G 3AELA 5AVTB 3AE6C 4I1LA 1BDDA 3RI6A 3AE4C 3A9YA 1QX8A 3HBXA 3P32A 1ASAA 2VMRA 1GW3A 3TATA 4ZDOA 3A7OA 1CJ0A 1NTZD 2BI5A 4OTLA 3JC22 1NTMK 1GEWA 4EU1A 1TOKA 3RL0C 5HDMA 3QHXA 4R4MA 2XNDH 4RKUJ 1GC3A 3CCJP 1CZEA 4BRYA 3GJUA 3ASBA 3MAUA 4PJ0E 1Y4IA 1SQXJ 3P8CD 1B9HA 1L0NG 3CWBE 2O7CA 3NYTA 1S09A 2WZ7A 1K8AQ 2P67A 3C8VA 1KV4A 2QJKC 2G6WA 1PP9D 3A9ZA 4WLHA 1L0NJ 5FT8A 2QIWA 1HH0A 1T3IA 4DT0A 3LWSA 1DEBA 5KJ7D 3RK3E 5G2QA 2JGTA 4EMYA 2QA3A 2C7TA 3CBFA 4JEXA 2POHA 4F5IA 2WMMA 1C0NA 1ASCA 3L35A 1TOEA 3FZ6A 1ASDA 3UIAA 1OZHA 2VGTA 2W8JA 1GL2D 3E77A 4H0LD 1NU1E 2G3AA 2N9YB 3H1JD 2AY2A 4N78D 2NPSD 2SPZA 1EXJA 4ZKUA 2XBNA 5G0AA 2Z1ZA 4A6UA 5FT4A 2WSFJ 4A6TA 2YKUA 4U2HA 2ZY5A 3LW5H 1FZBA 2DW3A 2ZP7A 4IFFA 1FAVA 2W8VA 2LXCB 1ZXGA 1SQPG 4PV1B 3BCCG 1KMKA 4K2IA 1G1IA 4AZKA 4IFMA 1KQLA 4L74A 1D7UA 4ITGA 4F4EA 2KNCB 5TJHA 1YAAA 1ZODA 3BASA 3TFUA 2ZVNB 2XZRA 3BCCJ 2OYHC 3V4QA 1JO5A 5CBNA 3QI6A 1P3WA 1IUGA 2MKVA 2LKMA 2IFMA 3GZDC 2AEMA 2K37A 4E3RA 2OYIC 1OHYA 4U3FG 2IDBA 3HD7C 3WUTA 3O6QA 2E7UA 1LWUC 2R3SA 3CWBD 2QB3A 5CCHC 3CMEP 1T2KD 3VAXA 4WP0A 1S3JA 5H2FE 2GA1A 2JJHA 3WLXA 1AHEA 4U3FJ 3ELEA 1JEKA 1BQDA 2QEXP 2BYLA 3E7KA 3GBXA 2VMWA 1LT9B 2GUVA 1EXIA 1M1JB 1K73Q 3FDDA 1NTZG 1X9VA 2ZAEB 4IFDK 1AQTA 1ARGA 2GUSA 2VMVA 2AXTH 5AVXB 3V2PA 5B5EE 5GTIH 4TT3H 1BQAA 1SQVE 2HODA 1VQ7P 4HJGH 3JCUE 2W6AA 2O1JA 1OW7A 3P1TA 2D2CC 2E74C 4GT1A 2X3LA 2QSRA 4OMAA 2A06E 3S1KA 1J32A 4GSAA 1SQXK 1VF5C 1M90Q 2WK8A 4OYTA 2CY8A 5TF5A 1G2CA 3E1IA 3TDKA 2X5DA 3NYSA 1RF0C 1L0NK 5AVVB 4RJYA 3H32B 1LNQA 3AV7A 3TNUA 4UOYA 1BSNA 1G7WA 3I55P 3HMUA 2YKVA 3DR7A 2OTJP 3H1JG 1S06A 1TARA 3MTUE 1LP1A 1BCCG 1B4XA 3K40A 1DH3A 3FZ7A 4BA5A 1MKMA 3E2ZA 3M0DA 3SSUA 5APTA 1OXPA 2VMSA 3S4RA 2Z61A 3WUVA 1BCCJ 1YYCA 1TOIA 1BJOB 3M9BA 4EOTA 3L4FA 1W7LA 1ZP0C 2Q7CA 3B71A 4RM1A 4F5FA 1IFMA 3PP5A 3HRNA 1DGDA 1VQ4P 2Z1YA 4KJMA 1N73C 1QZ9A 1S2EA 2PAJA 1OFCX 4WYAA 1WKGA 1IX8A 4JYBA 3EIAA 3EZ1A 4EB7A 3A0HE 2Z5IA 1ASLA 3L70E 3L72J 4ZM3A 3KQGA 1SQVD 3TK1A 3B5NC 3L73D 4KAMA 1OIPA 4EFFA 3ABVC 1KB9D 4MN4C 1ARHA 3MHVA 2C0XA 2H89C 4OC9A 2Z5HA 3KZIE 2A45H 2FNIA 2E43A 3NRAA 3PGYA 4M2KA 2NPSC 1E5EA 2OGUA 3IAOA 1Q90D 5AX8A 1SF2A 3ACZA 3EFGA 1S5LX 1MAPA 2Q1KA 3L75D 2AY7A 1AHYA 4OBUA 2Z20A 5DJ1A 3NX3A 1KMJA 1MZ9A 3BATA 3LW5J 4A7PA 2BWNA 4R8DA 1N7LA 3FQ7A 1SQBE 1NTZK 4A0RA 5TISH 1H8AA 1FDOA 2OGAA 2ZYAA 1ASFA 1SLQA 2VMYA 2M3EA 2KB7P 4MY5A 4DJGA 4ZM4A 4D6TJ 4A72A 4R2NA 3BS8A 3FQAA 4WB4A 3EI9A 4L0OA 2FYUE 1GCKA 2W7LA 1NO4A 3CAIA 2BWOA 3M91A 4BWNA 1FC2C 1JOCA 1GDEA 2BWPA 1PGOA 3PD6A 1AMAA 3CC4P 3AEAC 4JF0A 4GIFA 4F5LA 3D6KA 3L70D 1X22A 3PDBA 1JCCA 1CZQA 1P84E 2HG5D 1NTKJ 1NH4A 2X5FA 2BCCD 2FKWB 5M1BA 4ADCA 2RH0A 5AVQB 3FFHA 4DCKA 3T32A 4IL6X 2BYJA 2J5UA 3TCMA 4JF1A 1JY2P 2Q6QA 1CQ6A 2O1KA 2XV5A 5AW4B 4PV1C 1HWTC 1VP4A 1P84I 4ZASA 3BB8A 1IFNA 4ZSYA 5APQA 3B1CA 2ZVOB 1KKPA 3M9QA 1N8RQ 2ZUKA 4KYOA 1RVUA 1SQVG 1USDA 2M5AA 3LIEA 3EQ2A 3PJ0A 3L73G 1AKAA 1GC2A 3P6KA 1J04A 1U57A 3CX5H 3A0BH 3CCMP 2JG2A 3H7FA 1VJOA 2W90A 4WD2A 3CMAP 3TGUJ 2KS1B 3TSIA 1KILE 4A0HA 3DRDA 4LW4A 2EYQA 3CCSP 1WYVA 4J5UA 5HXXA 4UB8E 1FZCC 3G8MA 1PG8A 1KFMA 3L75G 1LT9C 3DR4A 5CCGD 4ADBA 2EH6A 3OAKA 3B8EB 1URQB 5BU5A 1N7SD 5IWQA 2TPLA 3JTXA 2GMUA 1MAQA 3N4RA 1T3UA 4AUWA 4PD4I 4GE4A 2E76B 1ZRTE 2IPPA 3HVYA 1L0LJ 9AATA 1P84D 3CCRP 1DD3A 3OJAB 1LTAC 3EFFK 1GDTA 4WBTA 3LY1A 1KC8Q 4B98A 2MJZA 2XDJA 5BVZA 2OYHB 4P7YA 1J1EB 1Q81Q 5FT5A 3H1HD 2R5BA 3VMZA 4OVNF 1YJWP 3HTKB 2CJGA 3CI9A 2BI1A 1BGYJ 2CANA 1LW4A 1C7GA 3WX9A 1MDOA 5M46A 2E75D 4IOIH 5APUA 2RN0A 2EZ2A 2RFVA 1BJWA 2Z9WA 5APYA 1GTWA 2PO3A 1ZV8A 2BCCG 2OYIA 1EG5A 5AW2B 2C44A 4M2MA 3HD7A 1NJIQ 1LWUA 3WCOA 5CCHA 4H44B 1M0QA 1XEYA 1H0TA 1NTKK 4BXLA 2VLHA 2BCCJ 2J59M 1MLZA 1KILD 2JJLA 2QJPB 3RL0g 1URQD 2OQQA 2WPQA 4PFNA 1KYOE 3FFRA 1W5CE 1NTMJ 1N31A 2QJYB 2IZ0A 3LVJA 2VMTA 4Q6RA 2H43A 4IYOA 2O01J 2P7JA 4IXOA 2E76D 2WTYA 3NU7A 3R4TA 1IFJA 2HPCB 1AV1A 2ZJGA 1QGNA 1GK4A 3T97A 1ZR4A 1ASNA 3BV0A 3KGXA 1KYOI 1S5LE 4MQPA 1ZRTD 5E79E 3M5UA 3L8AA 4XJLA 2LXBA 1S08A 1Q82Q 4RJTA 2W8WA 3N7NA 1H1CA 3PA9A 3B8XA 2Y0DA 1PIXA 2KP8A 1UU1A 1BSHA 5DB5A 1PGPA 2W8UA 1RF0A 4LNLA 5BU8B 4E77A 4F5KA 2K9YA 2AEJA 4CVQA 1HJ0A 2IBZD 4W1VA 1Z7DA 4Y99B 1YIYA 4H44D 1X29A 1PPJG 2FY8A 4Y28J 1UIXA 3Q1MA 5KAFH 3B46A 4LLHA 1K9MQ 3VN0A 4ZLVA 4GDYA 1LTSC 1DD4A 1KORA 1VQNP 1IFPA 3VK2A 1VQLP 1L0LK 1U08A 2Y9ZA 1RHZB 4UB6E 3MP7B 2I8DA 2HP2A 3H1HG 3L71E 1N73A 4M3LA 3MC6C 1O62A 1KYOD 1JY3P 3QBOA 3V4WA 4IL6E 1CL2A 1JS3A 4JEVA 2XKMA 4DZOA 1QITA 3F9TA 1O61A 1YOOA 4XK1A 5GTHE 1PFIA 1SP4A 3SWYA 2H8PD 2OARA 2DKJA 1SQQJ 1DGEA 1EZVD 3B5NA 3D71A 1C7OA 1GL2B 4H0LB 3TQXA 4UHNA 5JAYA 2BEQD 3Q5RA 4CXQA 1LTTC 2CSTA 3AENA 1LGHB 4XJPA 4C7NA 1N7SC 4AZJA 3RQ1A 3SFDC 5G2PA 1FE6A 3NTJA 1QL2A 2O1BA 4IW7A 1RQVA 2VIBA 1V2FA 2JO1A 2NPSA 1NAFA 2AEUA 3L74J 5B66E 2KI7B 1QL1A 2WB6A 1ZC9A 3BC8A 1ZOBA 2HR3A 4Q76A 3PTZA 1ARTA 3S9OA 4JEWA 2QLRA 2AY4A 3L72E 2AY3A 1GMJA 1Y47A 4BA4A 4EI2A 1YTZT 5J8QA 4ADDA 1Y8AA 5CMZA 4RIZA 1LT1A 3NXSA 4JEZA 2HOZA 3OP7A 3RBXA 3GF3A 3IFMA 1WYTB 4PJ0H 2W7FA 3L71D 1J1DB 1JG8A 4RESB 2IBZG 2Q9IA 1VPCA 2FFDB 2Z9VA 1AX4A 2I1JA 1TU3F 2D65A 2DR1A 1NWQA 2ZYJA 1SS1A 2YO2A 4Z1MH 2JDIH 1URQC 3KDPB 3QWOC 1K05A 1L4AD 1RE4C 1X0TA 4R4LA 2QG4A 1BJ4A 1AFOA 4MSOA 2E76C 2H88C 4W7YA 2D5YA 3WZFA 3NDNA 2Z9UA 5KLVE 3KGWA 3FD0A 5BJ3A 1NVOA 4IY7A 4W80A 2JEEA 4AOAA 1C7NA 2R3CA 1FJKA 5D95A 2Z4EA 1OW6A 3MUDC 1VQOP 3Q2YA 3F6TA 4DGTA 2WT7B 3GG2A 3DU4A 1SQPJ 1J1EC 3RCHB 3CXHE 2FXPA 2V1PA 4IXZA 2KUBA 1N2TA 4AYCA 3JZLA 3MAFB 2KNCA 5EIGB 1EDIA 3W1HA 3AOVA 3B4SA 1RVYA 1BE3E 1EZVG 3R2PA 2DGLA 1M56D 3CL3D 1MUUA 2IZ1A 2VYCA 4MKJA 1AMQA 1A02J 2CH2A 4KT0J 1RF1B 3QM2A 4WYGA 1SQQK 5K8BA 1UKJA 3GHGB 1IX6A 4UHOA 3WU2E 1WKHA 3KYQA 2XH1A 1FZCB 3CXHI 3WUUA 3MGNA 1IK9A 1HTLC 1ZR2A 4H44C 3TYYA 3BWNA 4IXSA 1PZQA 2K88A 2OYOA 2M8RA 2PGDA 3VMAA 1QVFO 3RK3D
chains in the Genus database with same CATH topology
3NUIA 2AATA 1TATA 1LT9A 1M1JA 1YJYA 3DZZA 1ASBA 3FQ8A 1SFCB 4LC1A 2BKWA 1YJZA 1GC0A 1GEYA 1Z56A 1WYUB 2ZY3A 4K05A 3ZRQA 3A5TA 3IR9A 3LIDA 2JISA 2VMOA 2W7KA 1VEFA 1QIRA 4ZWMA 3PDXA 2C9NY 4I8AA 3R9AA 3VP9A 1YJSA 3H32A 3RK2D 2W7GA 3G3ZA 5BJ4A 4UHMA 1AY5A 4Y99C 1FZEA 4RLGA 4WXFA 1FJPA 1DJ9A 2BI2A 2OATA 2FN6A 1AKBA 3ZRRA 4OH8B 2AY8A 3AEJA 2C0RA 1GK6A 3HE4B 1SFCD 4F5GA 2FNUA 1BJOA 5D5SA 5EUDA 3FKDA 3EZSA 1LS3A 1I43A 1IAXA 1HUCA 4NOGA 5F8VA 1SQPK 1H89A 2EGYA 3V5BA 5G09A 4JF7A 5KJ7C 1FZFA 1HVVA 2VGSA 4WXBA 2WK7A 5EAVA 1JTHB 2GMSA 2Q5UA 1LTJB 3VYIA 1GL2C 5EFSA 3WKSA 4JYCA 2N1TB 3KE3A 2HFED 1JY2N 1D7SA 1XI9A 1AJRA 4B86A 5DX5A 2O01H 3AEMC 1G4VA 4PFFA 4O6ZA 2KOGA 2A45I 2R2NA 2KYVA 4AQRD 5G4IA 5AW3B 2Q7WA 1IFIA 2VRSA 5APSA 1MDZA 4JEYA 3N75A 4ZDPA 4CBSA 4U1TA 1X8YA 1S0AA 1AIAA 1JNMA 3MC6A 2JJFA 1T2KC 3EI6A 3BCXA 1J1DC 3HUSB 1RE3C 2FFDC 3LVLB 3O8ZA 3RK3C 3ZZKA 3COGA 1N7SB 5APXA 4W91A 2N1TD 1JY2O 2FKIA 2WKAA 5AW6B 1XTGB 1CW5A 1AJSB 4HF8A 1CL1A 3EI8A 1BJNA 3NFQA 1B5PA 5CHXA 2W7IA 2R5CB 3ZRPA 5APWA 3IHJA 3JW9A 1XTCC 3HE5B 4FL0A 2HORA 2VLFA 3BCAA 3GZCA 1OWAA 3B1EA 1D7RA 1AQ5A 3QN6A 4WY4B 4TMRA 1QJ5A 2OKJA 3II0A 1B9IA 2OQXA 2YCNA 4ATQA 2W6BA 2BIEA 1FG7A 3RK2C 2YKYA 3I4JA 1RF1C 2VMNA 2ZY2A 3GHGC 2ZY4A 4LW2A 1CQ7A 2R5DA 3FVUA 2VMPA 1YIZA 1KILB 3DXVA 1YNUA 1UU2A 1GW4A 2CJHA 4GEBA 1TOGA 2FM1A 1IBJA 2YKOA 1SFCC 1URQA 4W1XA 2C81A 4ZDLA 1W23A 1RE4A 2HUUA 1SVFA 1FDMA 1LTIC 5FT6A 4WB0B 1G4XA 3JWAA 2QB2A 1SPAA 2Z9XA 5EQCA 1AY8A 2E7JA 1NU1K 1I41A 1AAMA 1CI6B 4OBVA 4F5JA 1VDFA 1SFFA 3MUDA 2HP1A 1EQ7A 2VMQA 3U59A 3B1DA 4TN4A 1T3JA 3UAKA 3WGCA 2J58A 2OYHA 1T8ZA 3RL0D 3USFA 1FG3A 1M0PA 4WY4D 3FSLA 3HTKA 3GZDA 1DKAA 2WSEH 1PMOA 1W7MA 1C9CA 1NHLA 3VTPC 2X8UA 4XA4A 1SZSA 3KPEA 4F5MA 1IO4A 4AO9A 3W1IA 2XNXA 4HYTB 1JUNA 1ASMA 3II6A 3E6GA 1KZUB 4W7ZA 1KL1A 1V2DA 4XJOA 1LC5A 1FC4A 4UQVA 3A2BA 2JJGA 4XEWA 3FTBA 1M32A 2PP6A 3LG0A 4HVKA 5G4JA 2HPCA 4GKGA 3OA7A 1HBWA 5CJ4A 2CINA 4ZWVA 2YKQA 1SQVK 3HL2A 2G7JA 1IJIA 4Y0HA 2W7HA 1O4SA 4XAUA 3U1AA 1UU0A 1LTJC 2F8JA 4OT8A 4WXGA 3I5TA 4XQ2A 1LTGC 3LV2A 4MQQA 4N0WA 2N1TC 1X79B 1B8GA 1GD2E 2BIGA 1DJUA 1KL2A 1D7VA 2FQ6A 5CCHD 1FZGA 2YKXA 1DTYA 1BS0A 4BHDA 1JY3O 2N9BA 3CQ6A 3WY7A 3G0TA 5AVZB 1AAWA 3BCBA 2VMXA 3G7QA 5AW0B 2FXMA 1JCDA 3FDBA 3V2NA 1CS1A 3CQ4A 4Q31A 2QMAA 3N5MA 1HGZA 2CFBA 1N2DC 3AEPA 4RKCA 3UWCA 1FU1A 3MADA 4R5ZA 3MIWA 5AVRB 3E2YA 2WPSA 3BN1A 2ZSMA 5KJ7A 3CLQA 3BWOA 3HUSC 1I29A 2HOYA 4LNJA 5CCGC 3DODA 2BASA 2E42A 4BQ0A 3K7YA 1L4AB 1GL2A 2KSJA 2AY6A 3LVKA 1BW0A 3WMM0 1MLYA 3PIUA 2WSCH 2YRRA 3M9HA 4E1OA 1LC8A 4ZSWA 1FZAA 2VIAA 1LTBC 3AEMA 4LNMA 1NKNA 4Q75A 3VP6A 3EIBA 4GRXA 2R32A 3FVSA 3HQTA 4ISYA 1M7YA 1LW5A 1IJDB 2HYNA 4WY4C 4QGRA 1SQBK 2R5EA 4R5FA 3AOWA 1MDXA 1M4NA 3K28A 1O69A 1G7XA 3DXWA 3F0HA 2JJEA 3MD0A 4LGDE 3U1CA 3I5CA 2P1JA 1WYTA 2AY5A 4N6JA 3RK3B 1E5FA 1KILC 2GSAA 1RE3A 2FFDA 2FYUK 3B5ND 2OKKA 2NMPA 3LVMA 4ATPA 3NTNA 2FYZA 4WYCA 2W7JA 3H9XA 2V0YA 2W7EA 3WKRA 4WYFA 5AVYB 2YHKA 5E5IA 5CJ0A 2Q3IA 1ORDA 2WT7A 2VGUA 3HLMA 3EI5A 3RCHA 2XU6A 3RBLA 1OHVA 1W7NA 3MAFA 3RK2B 1ASEA 3N0LA 5EIGA 5M49A 2YOBA 3VK4A 2VI9A 5AVWB 1RF1A 4Y0IA 4KXKA 1IX7A 5E3KA 3GHGA 2WITA 2WK9A 2W7DA 4N3YB 3ZZJA 4ZAHA 1FZCA 1SVVA 2CB1A 3GR9A 3A2AA 3EUCA 3V2QA 3VOPA 2A1VA 2O0RA 3H6PA 2ZSLA 5KTBA 3ISLA 3NYUA 3NMDA 1SFCA 2VI8A 2ZXEB 3ATHA 2HODB 3L36A 3QPGA 1YTZI 2KFPA 2VMUA 1WT6A 1GBNA 5EUEA 4RKDA 3MBBA 2D61A 5DJ9A 1WYUA 1G2CB 2W27A 4F5HA 1CQ8A 3BRTB 3TNUB 4PVFA 3E9KA 3GSBA 1H88A 1W2EA 1MV8A 4ADEA 2BI9A 1GC4A 1SZUA 2D63A 3E2ZB 2D64A 2DGKA 3UE8A 2YCPA 1QJ3A 2GM4A 1HGVA 4H63Q 1LK9A 1V2EA 3JWBA 1DFOA 1OXOA 3HE4A 2BHXA 3P8MC 1WSTA 4A0FA 5AW7B 3EI7A 1E5WA 1V72A 5HHYA 1WRGA 4C7RA 2BI3A 3V2RA 1GU5A 2PB2A 2DGMA 4MKKA 1JTHA 1ELQA 2L5GB 2W7MA 3W1JA 3PPLA 1L4AC 1LTJA 1IVRA 5M4DA 4CXRA 2N1TA 1ECXA 1OXZA 1S9KE 4EB5A 1M0OA 1NKZB 3FRKA 1OHWA 2VGZA 1IFDA 4DQ6A 2E54A 4W1WA 1AIBA 1BKGA 5E4ZA 1ZLLA 2GQNA 2IFNA 3BRVB 3CQ5A 4EIJA 4XJMA 4AH3A 2HOXA 4FFCA 2C9LY 3VOMA 1AMRA 1RV4A 1D2FA 2YCTA 3P7KA 3PD6B 2WWWA 4DOJA 1B5OA 2C0WA 2M3BA 2ZFCA 3HUSA 1JF9A 5AW5B 2CH1A 5AW8B 1PMMA 3PDBB 1AICA 1G1JA 1AKCA 5I92A 5CCGA 4PIWA 1N7SA 3M06A 4IX8A 2YNYA 4P3MA 1NOHA 3M0AA 1AJSA 2OGEA 3SWFA 4B9BA 1SZKA 2R0TA 1N86A 2R5CA 4E3QA 4I6MC 2D7YA 3ASAA 1M0NA 1S9KD 3C9IA 3VP8A 1TASA 3RL0B 3HE5A 2CTZA 4WLJA 2EPJA 2IX7C 4WBAA 1C4KA 4AO4A 1BT4A 2HUIA 2QBTA 4WY4A 5EAAA 1TPLA 2YMYA 1X28A 2WPRA 4WYEA 1GEXA 1ELUA 2HLOA 1WYVB 1LC7A 1IC2A 1FOSF 4RJ0A 1MFZA 3BWNC 1RY3A 3DC1A 1KILA 1M7LA 3KKIA 3L44A 1GZLA 2DKBA 1FOSE 5AVUB 1CZCA 4A00A 4DBCA 5AW9B 3N4XA 1M1JC 3N4SA 2KLVA 2YRIA 1S07A 3DYDA 4WB0A 2CPBA 5APVA 3RBFA 3NNKA 3FCRA 1IAYA 1CI6A 2DOUA 1PFFA 5KLVK 3BVHA 4GE7A 2BIAA 1ARSA 2YO3A 2GB3A 1DJEA 1HJBA 2FYFA 1JMMA 3RUYA 2OYIB 4GE9A 2A45G 3HD7B 1LWUB 3VK3A 1AHFA 7AATA 3M0DC 1EJIA 2QM7A 1ARIA 1JY3N 1AHGA 4A6RA 4I2LC 3GWPA 2P2UA 1TOJA 4K2BA 2VGVA 3AEJC 4IYOB 2WSFH 1ZN5A 2ORDA 1DX7A 2AEVA 4WYDA 3WGBA 1A02F 3TFTA 3A8UX 2YKPA 2QM8A 2AY1A 5C6UA 4MQRA 4XE5B 1X2AA 2D66A 3NU8A 5M4BA 1KFNA 1I48A 1J2JB 2E7IA 8AATA 2ZC0A 1OATA 5AVSB 3AATA 1RV3A 3L37A 3MKJA 4J8LA 5AW1B 3Q8NA 3A9XA 4ITXA 2D7ZA 4K2MA 3MEBA 2VMZA 1FBMA 4BMKA 2CJDA 3HD7D 1Z3ZA 5EUNA 1GU4A 2VGWA 4M2JA 3FVXA 4W8IA 3HDOA 3GETA 2EO5A 1H0CA 4H51A 1AMSA 3VMYA 3E2FA 4W5KA 1KKJA 3P8CE 4RAEA 1JS6A 3AEOA 1W3UA 1ASGA 1CSBA 3FZ8A 4A0GA 2I1KA 4KHXA 4C46A 1AY4A 1N73B 4ZKPA 1X0MA 4LC3A 3ELPA 1N8PA 3QGUA 2AY9A 2HZPA 2H7HA 3A3YB 4OCAA 4Y0DA 2PB0A 3WCNA 1AHXA 3I16A 2EZ1A 2HUFA 3HT4A 3B5NB 4N78E 1MGVA 4RITA 2CPSA 3OKSA 3ECDA 1EQBA 1M6SA 3NUBA 3AENB 4C7NB 4O9BA 4CBRA 1L4AA 1LKCA 3PAAA 4HH2A 2W8TA 1GD9A 2NPSB 1QISA 5F9SA 3VMXA 3AELA 5AVTB 4I1LA 3RI6A 3A9YA 3HBXA 3P32A 1ASAA 2VMRA 1GW3A 3TATA 4ZDOA 3A7OA 1CJ0A 2BI5A 4OTLA 1NTMK 1GEWA 4EU1A 1TOKA 3RL0C 5HDMA 3QHXA 1GC3A 1CZEA 3GJUA 3ASBA 3MAUA 1Y4IA 3P8CD 1B9HA 2O7CA 3NYTA 1S09A 2WZ7A 2P67A 2G6WA 3A9ZA 4WLHA 5FT8A 1HH0A 1T3IA 3LWSA 1DEBA 5KJ7D 5G2QA 2JGTA 4EMYA 2QA3A 2C7TA 3CBFA 4JEXA 2POHA 4F5IA 1C0NA 1ASCA 3L35A 1TOEA 3FZ6A 1ASDA 3UIAA 2VGTA 2W8JA 1GL2D 3E77A 2AY2A 4N78D 2NPSD 5G0AA 4ZKUA 2XBNA 4A6UA 2Z1ZA 5FT4A 4A6TA 2YKUA 4U2HA 2ZY5A 3LW5H 1FZBA 2ZP7A 4IFFA 1FAVA 2W8VA 1KMKA 4K2IA 1G1IA 4AZKA 4IFMA 1KQLA 1D7UA 4ITGA 4F4EA 1YAAA 1ZODA 3BASA 3TFUA 2XZRA 2OYHC 3V4QA 1JO5A 3QI6A 1P3WA 1IUGA 2LKMA 2IFMA 3GZDC 4E3RA 2OYIC 1OHYA 3HD7C 2E7UA 1LWUC 2QB3A 5CCHC 1T2KD 3VAXA 4WP0A 2JJHA 3WLXA 1AHEA 3ELEA 1BQDA 2BYLA 3GBXA 2VMWA 1LT9B 2GUVA 1M1JB 3FDDA 1X9VA 4IFDK 1ARGA 2GUSA 2VMVA 5AVXB 3V2PA 1BQAA 2HODA 2W6AA 2O1JA 3P1TA 4GT1A 2X3LA 2QSRA 4OMAA 1J32A 4GSAA 1SQXK 2WK8A 4OYTA 2CY8A 5TF5A 1G2CA 3E1IA 3NYSA 2X5DA 1RF0C 1L0NK 5AVVB 4RJYA 3H32B 3AV7A 3TNUA 4UOYA 1G7WA 3HMUA 2YKVA 3DR7A 1S06A 1TARA 3MTUE 1B4XA 3K40A 1DH3A 3FZ7A 4BA5A 3E2ZA 3M0DA 5APTA 1OXPA 2VMSA 2Z61A 1YYCA 1TOIA 1BJOB 3M9BA 4EOTA 3L4FA 1W7LA 2Q7CA 4RM1A 4F5FA 1IFMA 3PP5A 3HRNA 1DGDA 2Z1YA 1N73C 1QZ9A 2PAJA 4WYAA 1WKGA 1IX8A 4JYBA 3EIAA 3EZ1A 4EB7A 2Z5IA 1ASLA 4ZM3A 3KQGA 3TK1A 3B5NC 4KAMA 4EFFA 1ARHA 2C0XA 4OC9A 2Z5HA 2A45H 2FNIA 2E43A 3NRAA 3PGYA 4M2KA 2NPSC 1E5EA 5AX8A 1SF2A 3ACZA 3EFGA 4OBUA 1MAPA 2AY7A 1AHYA 2Z20A 5DJ1A 3NX3A 1KMJA 1MZ9A 3BATA 2BWNA 4R8DA 1N7LA 3FQ7A 1NTZK 4A0RA 1H8AA 2OGAA 1ASFA 1SLQA 2VMYA 2KB7P 4MY5A 4ZM4A 4A72A 4R2NA 3BS8A 3FQAA 4WB4A 3EI9A 4L0OA 1GCKA 2W7LA 1NO4A 3CAIA 2BWOA 3M91A 1JOCA 1GDEA 2BWPA 3PD6A 1AMAA 4JF0A 4GIFA 4F5LA 3D6KA 3PDBA 1JCCA 1CZQA 2HG5D 1NH4A 2X5FA 2FKWB 4ADCA 5AVQB 3FFHA 3T32A 2BYJA 3TCMA 4JF1A 1JY2P 1CQ6A 2O1KA 2XV5A 5AW4B 1HWTC 1VP4A 4ZASA 3BB8A 1IFNA 4ZSYA 5APQA 3B1CA 1KKPA 3M9QA 2ZUKA 4KYOA 1RVUA 3LIEA 3EQ2A 3PJ0A 1AKAA 1GC2A 3P6KA 1J04A 2JG2A 3H7FA 1VJOA 4WD2A 3TSIA 4A0HA 3DRDA 4LW4A 2EYQA 1WYVA 4J5UA 5HXXA 1FZCC 3G8MA 1PG8A 1KFMA 1LT9C 3DR4A 5CCGD 4ADBA 2EH6A 3OAKA 3B8EB 1URQB 5BU5A 1N7SD 5IWQA 2TPLA 3JTXA 2GMUA 1MAQA 3N4RA 1T3UA 4AUWA 4GE4A 2IPPA 3HVYA 9AATA 3OJAB 1LTAC 1GDTA 4WBTA 3LY1A 4B98A 2MJZA 2XDJA 5BVZA 2OYHB 4P7YA 1J1EB 5FT5A 2R5BA 3VMZA 3HTKB 2CJGA 3CI9A 2BI1A 2CANA 1LW4A 1C7GA 3WX9A 1MDOA 5M46A 5APUA 2EZ2A 2RFVA 1BJWA 2Z9WA 5APYA 1GTWA 2PO3A 1ZV8A 2OYIA 1EG5A 5AW2B 2C44A 4M2MA 3HD7A 1LWUA 3WCOA 5CCHA 1M0QA 1XEYA 1NTKK 2VLHA 2J59M 1MLZA 1KILD 2JJLA 1URQD 4PFNA 2WPQA 3FFRA 1N31A 3LVJA 2VMTA 4Q6RA 2H43A 4IYOA 2P7JA 4IXOA 2WTYA 3NU7A 3R4TA 1IFJA 2HPCB 2ZJGA 1QGNA 1GK4A 3T97A 1ZR4A 1ASNA 3BV0A 3KGXA 4MQPA 3M5UA 3L8AA 4XJLA 1S08A 2W8WA 3N7NA 1H1CA 3PA9A 3B8XA 2KP8A 1UU1A 5DB5A 2W8UA 1RF0A 4LNLA 5BU8B 4E77A 4F5KA 4CVQA 4W1VA 1Z7DA 4Y99B 1YIYA 1X29A 3B46A 4LLHA 3VN0A 4ZLVA 4GDYA 1LTSC 3VK2A 1L0LK 1U08A 2HP2A 1N73A 4M3LA 3MC6C 1O62A 1JY3P 3QBOA 3V4WA 1CL2A 1JS3A 4JEVA 2XKMA 4DZOA 1QITA 3F9TA 1O61A 1YOOA 4XK1A 1PFIA 1SP4A 3SWYA 2H8PD 2OARA 2DKJA 1DGEA 3B5NA 1C7OA 1GL2B 3TQXA 4UHNA 5JAYA 4CXQA 1LTTC 2CSTA 3AENA 1LGHB 4XJPA 4C7NA 1N7SC 4AZJA 3RQ1A 5G2PA 3NTJA 1QL2A 2O1BA 4IW7A 2VIBA 1V2FA 2NPSA 1NAFA 2AEUA 1QL1A 2WB6A 1ZC9A 3BC8A 1ZOBA 4Q76A 1ARTA 4JEWA 2QLRA 2AY4A 2AY3A 4BA4A 5J8QA 1YTZT 4ADDA 5CMZA 4RIZA 3NXSA 4JEZA 2HOZA 3OP7A 3IFMA 1WYTB 2W7FA 1J1DB 1JG8A 4RESB 2Q9IA 1VPCA 2FFDB 2Z9VA 1AX4A 2I1JA 2D65A 2DR1A 1NWQA 2ZYJA 2YO2A 1URQC 3KDPB 1RE4C 1L4AD 1BJ4A 1AFOA 4MSOA 4W7YA 2D5YA 3WZFA 3NDNA 2Z9UA 3KGWA 3FD0A 5BJ3A 4IY7A 4W80A 2JEEA 4AOAA 1C7NA 2R3CA 1FJKA 5D95A 2Z4EA 3F6TA 4DGTA 2WT7B 3DU4A 1J1EC 3RCHB 2V1PA 4IXZA 1N2TA 4AYCA 3JZLA 3MAFB 5EIGB 3W1HA 3AOVA 1RVYA 3R2PA 2DGLA 3CL3D 1MUUA 2VYCA 4MKJA 1AMQA 1A02J 2CH2A 1RF1B 3QM2A 4WYGA 1SQQK 5K8BA 1UKJA 3GHGB 1IX6A 4UHOA 1WKHA 3KYQA 2XH1A 1FZCB 3MGNA 1IK9A 1HTLC 1ZR2A 3TYYA 3BWNA 4IXSA 2M8RA 3RK3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2POH A;  3P8C D;  3N7N A;  3N4X A;  4N3Y B;  3N4S A;  4I1L A;  1NKN A;  1WT6 A;  3C9I A;  3VP8 A;  5BU5 A;  2JEE A;  5BVZ A;  4GIF A;  3U1C A;  3N4R A;  5BU8 B;  4ZKP A;  3U1A A;  4N78 D;  3BAS A;  1IC2 A;  4ZKU A;  3U59 A;  5KTB A;  3HRN A;  4O9B A;  1X79 B;  3VP9 A;  3OJA B;  3BAT A;  2FXM A; 
#chains in the Genus database with same CATH topology
 3NUI A;  2QJP C;  4YTP C;  2AAT A;  1TAT A;  1IK7 A;  1LT9 A;  2QVA A;  2QJY C;  1M1J A;  1YJY A;  3DZZ A;  1ASB A;  3FQ8 A;  1SFC B;  1NTZ J;  4LC1 A;  3SFE C;  3D6Y A;  1NU1 D;  2BKW A;  1YJZ A;  1GC0 A;  1GEY A;  1Z56 A;  1PP9 G;  2WQY C;  5L8R J;  2M0B A;  3EWK A;  1WYU B;  4NPF X;  2ZY3 A;  4K05 A;  3ZRQ A;  3A5T A;  1JMB A;  1S1C X;  5KKZ B;  3IR9 A;  5B5E H;  1PP9 J;  5KLV D;  3LID A;  2JIS A;  4GOF A;  3JCU H;  2VMO A;  2W7K A;  3FXE A;  1VEF A;  1QIR A;  4ZWM A;  3PDX A;  4L76 A;  1KB9 H;  2C9N Y;  2W83 C;  5KLI B;  4I8A A;  3R9A A;  3VP9 A;  1YJS A;  3H1L E;  3H32 A;  3PJS K;  3RK2 D;  2W7G A;  3CXH D;  3G3Z A;  2OTK E;  5BJ4 A;  4UHM A;  1AY5 A;  5KAI E;  4Y99 C;  1FZE A;  4RLG A;  4WXF A;  1FJP A;  1DJ9 A;  2BI2 A;  3H1J J;  2OAT A;  1BE3 D;  2FN6 A;  1AKB A;  3ZRR A;  4CPG A;  4OH8 B;  2AY8 A;  3AEJ A;  1YIJ P;  2C0R A;  1GK6 A;  3HE4 B;  1SFC D;  3G6E P;  4F5G A;  2FNU A;  1BJO A;  5D5S A;  5EUD A;  3FKD A;  3EZS A;  1LS3 A;  3AEE C;  3CCE P;  1I43 A;  1IAX A;  1HUC A;  4NOG A;  5F8V A;  1SQP K;  1H89 A;  2EGY A;  1BGY E;  2B89 A;  3V5B A;  5G09 A;  4JF7 A;  5KJ7 C;  3Q3D A;  1FZF A;  3CWB G;  1HVV A;  2VGS A;  4WXB A;  2WK7 A;  5EAV A;  1JTH B;  1U7M A;  2A06 D;  2GMS A;  2Q5U A;  3CWB J;  4K35 A;  1USE A;  2B9B A;  1LTJ B;  3VYI A;  1GL2 C;  3A0H H;  1EDL A;  5EFS A;  3F5H A;  4H0L C;  4YXD C;  2ZYD A;  2KZJ A;  3WKS A;  4JYC A;  2N1T B;  3KE3 A;  2HFE D;  1JY2 N;  1D7S A;  2LR2 A;  1XI9 A;  3AE3 C;  1AJR A;  2B88 A;  3CC7 P;  4B86 A;  1NTM E;  5DX5 A;  3H1L D;  1NU1 G;  2O01 H;  3KZI H;  3AEM C;  1G4V A;  4PFF A;  3G4S P;  4O6Z A;  2KOG A;  2A45 I;  2R2N A;  2KLU A;  2KYV A;  4AQR D;  1QEX A;  1NU1 J;  5G4I A;  5AW3 B;  2Q7W A;  1IFI A;  2VRS A;  5APS A;  3ITK A;  1MDZ A;  2UWJ E;  4JEY A;  5KLV G;  3N75 A;  4ZDP A;  4CBS A;  4U1T A;  1X8Y A;  1S0A A;  1AIA A;  1U7J A;  1JNM A;  3MC6 A;  2JP3 A;  2CK3 H;  2JJF A;  1T2K C;  3EI6 A;  3D70 A;  3BCX A;  1KTM A;  1J1D C;  3HUS B;  1RE3 C;  2FFD C;  2WSS H;  3H1K E;  3AEF C;  3LVL B;  3O8Z A;  3RK3 C;  3ZZK A;  3COG A;  1N7S B;  5APX A;  4W91 A;  3K5B A;  2N1T D;  3ZDM A;  1JY2 O;  2FKI A;  3AE1 C;  2WKA A;  5AW6 B;  1XTG B;  4ZNC A;  1CW5 A;  1AJS B;  4HF8 A;  1CL1 A;  3EI8 A;  1BJN A;  4L75 A;  3NFQ A;  1B5P A;  5CHX A;  2W7I A;  4JQ0 D;  2R5C B;  3R4Y A;  3ZRP A;  5APW A;  1P84 H;  3IHJ A;  2JKV A;  1L2P A;  2YIU B;  2Y0C A;  1YQ3 C;  4WWI A;  3JW9 A;  1XTC C;  3HE5 B;  4FL0 A;  2Q3E A;  2HOR A;  2VLF A;  3BCA A;  3GZC A;  1OWA A;  3B1E A;  1D7R A;  1AQ5 A;  1SQB D;  1RQU A;  3QN6 A;  4WY4 B;  1VQM P;  1SQV J;  2A06 G;  2W6J H;  1QJ5 A;  2OKJ A;  4TMR A;  3II0 A;  3H1I E;  2E75 B;  4JBZ A;  4OWF A;  1OVU A;  3L73 J;  1B9I A;  2B87 B;  2K9J B;  2OQX A;  2YCN A;  4ATQ A;  4PD4 E;  3CCU P;  2W6B A;  2BIE A;  1FG7 A;  3RK2 C;  2YKY A;  3I4J A;  1RF1 C;  2VMN A;  3PLN A;  2ZY2 A;  3GHG C;  2ZY4 A;  2KS1 A;  4LW2 A;  1CQ7 A;  1PV3 A;  2R5D A;  3FVU A;  2FYU D;  3CCV P;  2VMP A;  1YIZ A;  1RH5 B;  2NZ2 A;  3CX5 I;  1KIL B;  3DXV A;  3H1L G;  1QVG O;  1YNU A;  1UU2 A;  1GW4 A;  3L74 E;  2Y9Y A;  2CJH A;  3AE9 C;  3L75 J;  1TOG A;  4GEB A;  2FM1 A;  1IBJ A;  2G8Y A;  2YKO A;  1SFC C;  2YXR B;  1URQ A;  4W1X A;  2C81 A;  4ZDL A;  4UB8 H;  3H1K D;  1W23 A;  1RE4 A;  2HUU A;  1SVF A;  1FDM A;  4JPZ B;  1LTI C;  5FT6 A;  1SQX E;  4WB0 B;  1G4X A;  3JWA A;  2QB2 A;  1SPA A;  2Z9X A;  5EQC A;  1AY8 A;  2E7J A;  1NU1 K;  1I41 A;  1AAM A;  1CI6 B;  2KK7 A;  1K04 A;  1L0N E;  4OBV A;  2QE7 H;  5KKZ C;  1VDF A;  1SFF A;  4F5J A;  3MUD A;  2HP1 A;  1EQ7 A;  2VMQ A;  3U59 A;  1R5L A;  3W67 A;  3B1D A;  4TN4 A;  1T3J A;  3UAK A;  3WGC A;  2J58 A;  2OYH A;  1T8Z A;  3CPW O;  3RL0 D;  3USF A;  1YHQ P;  1FG3 A;  1M0P A;  4WY4 D;  3FSL A;  3L70 G;  3HTK A;  3GZD A;  1KD1 Q;  1DKA A;  2WSE H;  1PMO A;  5KLI C;  1W7M A;  2NRG A;  3SWK A;  3C1L A;  3L70 J;  1C9C A;  1NHL A;  3VTP C;  3GF7 A;  2X8U A;  4XA4 A;  2K1A A;  2R44 A;  2P10 A;  1SZS A;  4XFJ A;  3H1I D;  3KPE A;  1Q86 Q;  4F5M A;  3I56 P;  2FYN B;  4PD4 D;  1IO4 A;  3V6I A;  4AO9 A;  2ZJS E;  3W1I A;  2XNX A;  4HYT B;  1JUN A;  3MZW B;  1ASM A;  3II6 A;  3E6G A;  1KZU B;  4W7Z A;  1KL1 A;  1V2D A;  4YXW H;  2IYP A;  1W2B O;  4H13 D;  4XJO A;  1LC5 A;  1FC4 A;  4UQV A;  3A2B A;  2JJG A;  3BCC E;  4XEW A;  1SQB G;  3AE2 C;  3FTB A;  1KYO H;  1M32 A;  2PP6 A;  3LG0 A;  4HVK A;  5G4J A;  2HPC A;  4GKG A;  1SQB J;  3OA7 A;  1HBW A;  5CJ4 A;  4L73 A;  2CIN A;  4ZWV A;  2YKQ A;  1SQV K;  1SQX D;  3HL2 A;  3F89 A;  2G7J A;  1IJI A;  4Y0H A;  2W7H A;  1O4S A;  4XAU A;  2FYU G;  3U1A A;  1UU0 A;  1LTJ C;  2F8J A;  4OT8 A;  4WXG A;  1R8E A;  4U3F E;  3I5T A;  4XQ2 A;  1LTG C;  1L0N D;  1S5L H;  3LV2 A;  4MQQ A;  5E79 H;  4N0W A;  2N1T C;  1X79 B;  2FYU J;  2KSE A;  4U7J A;  1B8G A;  1GD2 E;  2BIG A;  1OW8 A;  1VQK P;  1DJU A;  1KL2 A;  5KAF E;  1VQ8 P;  1D7V A;  1PGJ A;  2AEF A;  1NTZ E;  2FQ6 A;  1AJY A;  5CCH D;  1FZG A;  2YKX A;  1DTY A;  1BDC A;  1BS0 A;  5C39 A;  4BHD A;  1JY3 O;  2N9B A;  3CQ6 A;  1FDI A;  3WY7 A;  3G0T A;  5AVZ B;  1AAW A;  3BCB A;  2VMX A;  3G7Q A;  5AW0 B;  2FXM A;  1JCD A;  3FDB A;  3V2N A;  1CS1 A;  3CQ4 A;  4Q31 A;  2QMA A;  3N5M A;  1HGZ A;  2CFB A;  1N2D C;  3AEP A;  4RKC A;  3OW2 O;  1NAY A;  3UWC A;  3H1H J;  1FU1 A;  3MAD A;  4R5Z A;  3MIW A;  5AVR B;  4UB6 H;  2V7Q H;  3E2Y A;  2WPS A;  3BN1 A;  2D2C D;  2ZSM A;  5KJ7 A;  3CLQ A;  2E74 D;  3BWO A;  3HUS C;  1I29 A;  2HOY A;  3Q5P A;  4LNJ A;  1VF5 D;  3H1I G;  5CCG C;  3DOD A;  2BAS A;  4IL6 H;  2E42 A;  1YQ4 C;  4BQ0 A;  3GW6 A;  3K7Y A;  1L4A B;  5GTH H;  1GL2 A;  2KSJ A;  1BCC E;  2AY6 A;  3LVK A;  1BW0 A;  3WMM 0;  1MLY A;  3PIU A;  2YMK A;  2WSC H;  2YRR A;  3M9H A;  1S72 P;  4E1O A;  1LC8 A;  4ZSW A;  1FZA A;  1ZME C;  2VIA A;  1LTB C;  1M57 D;  2FXO A;  1M8O B;  1DEE G;  2YIU C;  4GOE A;  1AVY A;  1YBK A;  3AEM A;  4LNM A;  1NKN A;  4Q75 A;  3VP6 A;  1FS0 E;  3EIB A;  4GRX A;  2R32 A;  1YIT P;  4BRY B;  3FVS A;  5B66 H;  3HQT A;  4ISY A;  1M7Y A;  1SQX G;  1LW5 A;  1IJD B;  2HYN A;  3AEC C;  4WY4 C;  4QGR A;  4GOD A;  2Y0E A;  3PRJ A;  1SQB K;  2E75 C;  5DJU B;  2R5E A;  4R5F A;  3AOW A;  1OX3 A;  1Q2N A;  1MDX A;  1M4N A;  3K28 A;  1O69 A;  1VQ6 P;  2WSE J;  1G7X A;  3DXW A;  3F0H A;  3RBZ A;  1PGQ A;  4K3A A;  2JJE A;  1NGM B;  2V4H A;  3MD0 A;  4LGD E;  3U1C A;  3I5C A;  2P1J A;  1WYT A;  2AY5 A;  4N6J A;  3AE7 C;  3PHL A;  3RK3 B;  1E5F A;  1KIL C;  2GSA A;  1RE3 A;  2FFD A;  2FYU K;  2O3J A;  3B5N D;  2OKK A;  2NMP A;  3LVM A;  4ATP A;  2BEZ F;  3NTN A;  2FYZ A;  2FBW C;  4H13 C;  4WYC A;  2PFX A;  2W7J A;  3H9X A;  2V0Y A;  1BCC D;  4D6T E;  4ZMD A;  2W7E A;  3WKR A;  4WYF A;  1OVR A;  5AVY B;  2YHK A;  5E5I A;  1KQS O;  5CJ0 A;  1MFT A;  2E5Y A;  2Q3I A;  1ORD A;  2WT7 A;  2VGU A;  4EDF A;  3HLM A;  3EI5 A;  3RCH A;  2XU6 A;  3RBL A;  1OHV A;  1W7N A;  3MAF A;  3RK2 B;  1EDJ A;  1ASE A;  3N0L A;  5EIG A;  3USS A;  5M49 A;  3L72 D;  4I7Z B;  2PRR A;  2YOB A;  3VK4 A;  3CXH H;  1NTK E;  3AE5 C;  3O6Q B;  1LJ2 A;  2VI9 A;  5AVW B;  1RF1 A;  4Y0I A;  4KXK A;  1IX7 A;  5E3K A;  3GHG A;  2WIT A;  2WK9 A;  2W7D A;  4N3Y B;  2FYN C;  3ZZJ A;  4ZAH A;  1FZC A;  2YXQ B;  1SVV A;  2ZT9 B;  2AXT E;  2CB1 A;  3GR9 A;  3A2A A;  5K5G B;  5H2F H;  3EUC A;  3V2Q A;  3VOP A;  3WU2 H;  5GTI E;  4OGQ B;  2A1V A;  2O0R A;  3H6P A;  2ZSL A;  5KTB A;  3ISL A;  3NYU A;  2OTL P;  3NMD A;  1SFC A;  2VI8 A;  2ZXE B;  2WVR A;  3ATH A;  2HOD B;  3L36 A;  3FWN A;  3QPG A;  1YTZ I;  2KFP A;  2VMU A;  1WT6 A;  1GBN A;  5EUE A;  4RKD A;  3MBB A;  2D61 A;  5DJ9 A;  3L71 G;  3TGU E;  1WYU A;  3CCL P;  3L73 E;  1G2C B;  4RO0 A;  4PV1 D;  1ZW0 A;  2V7Q J;  2W27 A;  4F5H A;  4D6T D;  1CQ8 A;  1KB9 E;  3GMA A;  3L71 J;  3BRT B;  3TNU B;  4PVF A;  3E9K A;  3GSB A;  1H88 A;  1W2E A;  1MV8 A;  1QLE D;  3QH9 A;  4ADE A;  5DJT B;  1LP1 B;  1GC4 A;  2BI9 A;  1SZU A;  1R5S A;  3L75 E;  2D63 A;  3E2Z B;  2D64 A;  1KB9 I;  2DGK A;  3UE8 A;  2YCP A;  1QJ3 A;  2WSC J;  2ZT9 D;  1L0L E;  2GM4 A;  1HGV A;  1NTK D;  3IN6 A;  4H63 Q;  4OGQ D;  5KAI H;  1LK9 A;  1V2E A;  3JWB A;  1DFO A;  4GDO A;  1OXO A;  3HE4 A;  1KQF B;  2BHX A;  3P8M C;  1WST A;  2ZXX A;  1EC5 A;  4A0F A;  5AW7 B;  3TF5 A;  3EI7 A;  1ZOY C;  1E5W A;  1V72 A;  2E5T A;  5HHY A;  3FXD A;  1UII A;  1WRG A;  4C7R A;  5EFW B;  3H25 A;  3L72 G;  2JR8 A;  2BI3 A;  1YJN P;  1T6A A;  3V2R A;  1QGK B;  1GU5 A;  2PB2 A;  2DGM A;  4MKK A;  1JTH A;  1ELQ A;  2L5G B;  4HKZ H;  2W7M A;  2BCC E;  3W1J A;  3TGU D;  3PPL A;  1PL5 A;  1L4A C;  1LTJ A;  1IVR A;  5M4D A;  4CXR A;  2ZYG A;  2N1T A;  1ECX A;  1OXZ A;  1S9K E;  4EB5 A;  1M0O A;  1M1K Q;  1NKZ B;  3AEG C;  2JWD A;  5TIS E;  1KAF A;  3FRK A;  1OVV A;  1OHW A;  2VGZ A;  1IFD A;  4DQ6 A;  2E54 A;  3G71 P;  1E79 H;  4W1W A;  1AIB A;  1BKG A;  5E4Z A;  1L0L D;  1ZLL A;  2GQN A;  4D6T G;  1AVO A;  2IFN A;  3BRV B;  5KLV J;  3CQ5 A;  4EIJ A;  4XJM A;  4AH3 A;  2HOX A;  4FFC A;  2C9L Y;  3VOM A;  1AMR A;  1RV4 A;  1D2F A;  2YCT A;  3AEB C;  3P7K A;  1BGY D;  3PD6 B;  1BE3 G;  2WWW A;  2QA4 P;  4DOJ A;  1B5O A;  2C0W A;  2M3B A;  4NPD A;  1IZN B;  2W8Z A;  2ZFC A;  3HUS A;  3CC2 P;  1JF9 A;  5AW5 B;  1YI2 P;  2CH1 A;  5AW8 B;  1PMM A;  3PDB B;  1AIC A;  3D6Z A;  1G1J A;  1AKC A;  1KN7 A;  1BE3 J;  5I92 A;  5CCG A;  1NTK G;  4PIW A;  1VQ5 P;  1N7S A;  3M06 A;  4IX8 A;  2YNY A;  1PPJ E;  2AXC A;  4P3M A;  1NOH A;  3M0A A;  1AJS A;  2OGE A;  1VQP P;  3SWF A;  3FGA D;  1SZK A;  3CCQ P;  4B9B A;  2R0T A;  1N86 A;  2R5C A;  4E3Q A;  4I6M C;  2D7Y A;  3ASA A;  1M0N A;  1NTM D;  3E1R A;  1S9K D;  3H1H E;  3IF4 A;  3C9I A;  3VP8 A;  1TAS A;  2KIK A;  3CX5 E;  3RL0 B;  3A0B E;  3HE5 A;  2RMZ A;  2CTZ A;  4YPC A;  4WLJ A;  2M5A B;  2EPJ A;  2IX7 C;  4WBA A;  1SQQ E;  1C4K A;  4AO4 A;  1BT4 A;  2HUI A;  3GLM A;  2QBT A;  4WY4 A;  4I7Z C;  3TGU G;  5EAA A;  2QJK B;  2B87 A;  2K9J A;  1TPL A;  2YMY A;  1X28 A;  2WPR A;  4WYE A;  1GEX A;  1ELU A;  2HLO A;  1WYV B;  1LC7 A;  4PD4 H;  1VQ9 P;  1IC2 A;  2ZT9 C;  1FOS F;  4RJ0 A;  1MFZ A;  3Q5S A;  3BWN C;  1RY3 A;  3DC1 A;  1KIL A;  2L91 A;  1M7L A;  3KKI A;  3H1L J;  3L44 A;  4OGQ C;  1GZL A;  2DKB A;  1FOS E;  5AVU B;  4H13 B;  1CZC A;  4A00 A;  1NYH A;  4DBC A;  1VL2 A;  5AW9 B;  3N4X A;  1M1J C;  2RKL A;  3N4S A;  2KLV A;  2JWA A;  1L0L G;  2YRI A;  2QSI A;  1S07 A;  3DYD A;  4WB0 A;  4EYY Q;  3AE8 C;  1PPJ D;  2CPB A;  5APV A;  3RBF A;  1DIP A;  3NNK A;  3FCR A;  1IAY A;  1CI6 A;  2DOU A;  1PFF A;  5KLV K;  3BVH A;  4GE7 A;  1BGY G;  2K3R A;  2BIA A;  1KMI Z;  1ARS A;  2YO3 A;  2GB3 A;  1DJE A;  1HJB A;  1YJ9 P;  2FYF A;  3CX5 D;  3RGU A;  2IBZ E;  1JMM A;  2KZI A;  3RUY A;  2KXP B;  2OYI B;  4GE9 A;  2A45 G;  4TLF A;  1SQQ D;  3HD7 B;  1Y9B A;  1LWU B;  3VK3 A;  1AHF A;  7AAT A;  1Q7Y Q;  3M0D C;  1H0T B;  1EJI A;  2QM7 A;  3CD6 P;  1ARI A;  1JY3 N;  1AHG A;  4A6R A;  4ASV A;  4I2L C;  1NTM G;  3GWP A;  2IBZ I;  2P2U A;  1TOJ A;  3KHU A;  4K2B A;  2VGV A;  1JM0 A;  3AEJ C;  4IYO B;  2WSF H;  1SQP E;  1ZN5 A;  3L74 D;  2ORD A;  1DX7 A;  2IYO A;  2AEV A;  4WYD A;  3WGB A;  3T97 B;  1A02 F;  3FWL A;  3A8U X;  2YKP A;  3TFT A;  2QM8 A;  2AY1 A;  5C6U A;  2D2C B;  2WPV B;  2E74 B;  4NPE A;  1KQG B;  4MQR A;  3JSV C;  4XE5 B;  4ASW A;  1X2A A;  4HB1 A;  2D66 A;  3NU8 A;  5M4B A;  1KFN A;  1I48 A;  1EZV E;  1VF5 B;  1J2J B;  4WVZ A;  2E7I A;  8AAT A;  2ZC0 A;  1OAT A;  5AVS B;  3AAT A;  1RV3 A;  3L37 A;  2P58 A;  3MKJ A;  4J8L A;  5AW1 B;  3FX0 A;  3Q8N A;  3A9X A;  4ITX A;  1JB0 J;  2D7Z A;  4K2M A;  3MEB A;  2VMZ A;  1FBM A;  4BMK A;  3H1K G;  2CJD A;  1OMI A;  3HD7 D;  1Z3Z A;  5EUN A;  1GU4 A;  2VGW A;  4M2J A;  1EZV I;  3FVX A;  4W8I A;  3HDO A;  3GET A;  1S4X A;  2EO5 A;  3H1K J;  1EDK A;  1H0C A;  4H51 A;  3G9R A;  1AMS A;  3VMY A;  3E2F A;  4W5K A;  1KKJ A;  3P8C E;  4RAE A;  3AED C;  1JS6 A;  3AEO A;  1AA0 A;  2QRX A;  1W3U A;  1PP9 E;  1WMK A;  1CSB A;  1ASG A;  3FZ8 A;  2I1K A;  4KHX A;  4A0G A;  4C46 A;  5CBO A;  1AY4 A;  1N73 B;  4ZKP A;  1X0M A;  4LC3 A;  3KXD A;  4QMA A;  3ELP A;  1N8P A;  3QGU A;  2AY9 A;  2HZP A;  1SQP D;  2H7H A;  3BCC D;  3A3Y B;  4OCA A;  4Y0D A;  3PH0 A;  2PB0 A;  3WCN A;  1AHX A;  3I16 A;  2EZ1 A;  2HUF A;  3HT4 A;  1D7M A;  1SQQ G;  3H1J E;  3B5N B;  4N78 E;  1MGV A;  4RIT A;  2CPS A;  3H1I J;  2ITA A;  3OKS A;  3ECD A;  1EQB A;  1M6S A;  3NUB A;  3AEN B;  3W68 A;  4C7N B;  1HF9 A;  4O9B A;  4CBR A;  1L4A A;  4U3F D;  1LKC A;  2O01 N;  3PAA A;  4HH2 A;  2W8T A;  1GD9 A;  2NPS B;  1QIS A;  5F9S A;  3VMX A;  3L74 G;  3AEL A;  5AVT B;  3AE6 C;  4I1L A;  1BDD A;  3RI6 A;  3AE4 C;  3A9Y A;  1QX8 A;  3HBX A;  3P32 A;  1ASA A;  2VMR A;  1GW3 A;  3TAT A;  4ZDO A;  3A7O A;  1CJ0 A;  1NTZ D;  2BI5 A;  4OTL A;  3JC2 2;  1NTM K;  1GEW A;  4EU1 A;  1TOK A;  3RL0 C;  5HDM A;  3QHX A;  4R4M A;  2XND H;  4RKU J;  1GC3 A;  3CCJ P;  1CZE A;  4BRY A;  3GJU A;  3ASB A;  3MAU A;  4PJ0 E;  1Y4I A;  1SQX J;  3P8C D;  1B9H A;  1L0N G;  3CWB E;  2O7C A;  3NYT A;  1S09 A;  2WZ7 A;  1K8A Q;  2P67 A;  3C8V A;  1KV4 A;  2QJK C;  2G6W A;  1PP9 D;  3A9Z A;  4WLH A;  1L0N J;  5FT8 A;  2QIW A;  1HH0 A;  1T3I A;  4DT0 A;  3LWS A;  1DEB A;  5KJ7 D;  3RK3 E;  5G2Q A;  2JGT A;  4EMY A;  2QA3 A;  2C7T A;  3CBF A;  4JEX A;  2POH A;  4F5I A;  2WMM A;  1C0N A;  1ASC A;  3L35 A;  1TOE A;  3FZ6 A;  1ASD A;  3UIA A;  1OZH A;  2VGT A;  2W8J A;  1GL2 D;  3E77 A;  4H0L D;  1NU1 E;  2G3A A;  2N9Y B;  3H1J D;  2AY2 A;  4N78 D;  2NPS D;  2SPZ A;  1EXJ A;  4ZKU A;  2XBN A;  5G0A A;  2Z1Z A;  4A6U A;  5FT4 A;  2WSF J;  4A6T A;  2YKU A;  4U2H A;  2ZY5 A;  3LW5 H;  1FZB A;  2DW3 A;  2ZP7 A;  4IFF A;  1FAV A;  2W8V A;  2LXC B;  1ZXG A;  1SQP G;  4PV1 B;  3BCC G;  1KMK A;  4K2I A;  1G1I A;  4AZK A;  4IFM A;  1KQL A;  4L74 A;  1D7U A;  4ITG A;  4F4E A;  2KNC B;  5TJH A;  1YAA A;  1ZOD A;  3BAS A;  3TFU A;  2ZVN B;  2XZR A;  3BCC J;  2OYH C;  3V4Q A;  1JO5 A;  5CBN A;  3QI6 A;  1P3W A;  1IUG A;  2MKV A;  2LKM A;  2IFM A;  3GZD C;  2AEM A;  2K37 A;  4E3R A;  2OYI C;  1OHY A;  4U3F G;  2IDB A;  3HD7 C;  3WUT A;  3O6Q A;  2E7U A;  1LWU C;  2R3S A;  3CWB D;  2QB3 A;  5CCH C;  3CME P;  1T2K D;  3VAX A;  4WP0 A;  1S3J A;  5H2F E;  2GA1 A;  2JJH A;  3WLX A;  1AHE A;  4U3F J;  3ELE A;  1JEK A;  1BQD A;  2QEX P;  2BYL A;  3E7K A;  3GBX A;  2VMW A;  1LT9 B;  2GUV A;  1EXI A;  1M1J B;  1K73 Q;  3FDD A;  1NTZ G;  1X9V A;  2ZAE B;  4IFD K;  1AQT A;  1ARG A;  2GUS A;  2VMV A;  2AXT H;  5AVX B;  3V2P A;  5B5E E;  5GTI H;  4TT3 H;  1BQA A;  1SQV E;  2HOD A;  1VQ7 P;  4HJG H;  3JCU E;  2W6A A;  2O1J A;  1OW7 A;  3P1T A;  2D2C C;  2E74 C;  4GT1 A;  2X3L A;  2QSR A;  4OMA A;  2A06 E;  3S1K A;  1J32 A;  4GSA A;  1SQX K;  1VF5 C;  1M90 Q;  2WK8 A;  4OYT A;  2CY8 A;  5TF5 A;  1G2C A;  3E1I A;  3TDK A;  2X5D A;  3NYS A;  1RF0 C;  1L0N K;  5AVV B;  4RJY A;  3H32 B;  1LNQ A;  3AV7 A;  3TNU A;  4UOY A;  1BSN A;  1G7W A;  3I55 P;  3HMU A;  2YKV A;  3DR7 A;  2OTJ P;  3H1J G;  1S06 A;  1TAR A;  3MTU E;  1LP1 A;  1BCC G;  1B4X A;  3K40 A;  1DH3 A;  3FZ7 A;  4BA5 A;  1MKM A;  3E2Z A;  3M0D A;  3SSU A;  5APT A;  1OXP A;  2VMS A;  3S4R A;  2Z61 A;  3WUV A;  1BCC J;  1YYC A;  1TOI A;  1BJO B;  3M9B A;  4EOT A;  3L4F A;  1W7L A;  1ZP0 C;  2Q7C A;  3B71 A;  4RM1 A;  4F5F A;  1IFM A;  3PP5 A;  3HRN A;  1DGD A;  1VQ4 P;  2Z1Y A;  4KJM A;  1N73 C;  1QZ9 A;  1S2E A;  2PAJ A;  1OFC X;  4WYA A;  1WKG A;  1IX8 A;  4JYB A;  3EIA A;  3EZ1 A;  4EB7 A;  3A0H E;  2Z5I A;  1ASL A;  3L70 E;  3L72 J;  4ZM3 A;  3KQG A;  1SQV D;  3TK1 A;  3B5N C;  3L73 D;  4KAM A;  1OIP A;  4EFF A;  3ABV C;  1KB9 D;  4MN4 C;  1ARH A;  3MHV A;  2C0X A;  2H89 C;  4OC9 A;  2Z5H A;  3KZI E;  2A45 H;  2FNI A;  2E43 A;  3NRA A;  3PGY A;  4M2K A;  2NPS C;  1E5E A;  2OGU A;  3IAO A;  1Q90 D;  5AX8 A;  1SF2 A;  3ACZ A;  3EFG A;  1S5L X;  1MAP A;  2Q1K A;  3L75 D;  2AY7 A;  1AHY A;  4OBU A;  2Z20 A;  5DJ1 A;  3NX3 A;  1KMJ A;  1MZ9 A;  3BAT A;  3LW5 J;  4A7P A;  2BWN A;  4R8D A;  1N7L A;  3FQ7 A;  1SQB E;  1NTZ K;  4A0R A;  5TIS H;  1H8A A;  1FDO A;  2OGA A;  2ZYA A;  1ASF A;  1SLQ A;  2VMY A;  2M3E A;  2KB7 P;  4MY5 A;  4DJG A;  4ZM4 A;  4D6T J;  4A72 A;  4R2N A;  3BS8 A;  3FQA A;  4WB4 A;  3EI9 A;  4L0O A;  2FYU E;  1GCK A;  2W7L A;  1NO4 A;  3CAI A;  2BWO A;  3M91 A;  4BWN A;  1FC2 C;  1JOC A;  1GDE A;  2BWP A;  1PGO A;  3PD6 A;  1AMA A;  3CC4 P;  3AEA C;  4JF0 A;  4GIF A;  4F5L A;  3D6K A;  3L70 D;  1X22 A;  3PDB A;  1JCC A;  1CZQ A;  1P84 E;  2HG5 D;  1NTK J;  1NH4 A;  2X5F A;  2BCC D;  2FKW B;  5M1B A;  4ADC A;  2RH0 A;  5AVQ B;  3FFH A;  4DCK A;  3T32 A;  4IL6 X;  2BYJ A;  2J5U A;  3TCM A;  4JF1 A;  1JY2 P;  2Q6Q A;  1CQ6 A;  2O1K A;  2XV5 A;  5AW4 B;  4PV1 C;  1HWT C;  1VP4 A;  1P84 I;  4ZAS A;  3BB8 A;  1IFN A;  4ZSY A;  5APQ A;  3B1C A;  2ZVO B;  1KKP A;  3M9Q A;  1N8R Q;  2ZUK A;  4KYO A;  1RVU A;  1SQV G;  1USD A;  2M5A A;  3LIE A;  3EQ2 A;  3PJ0 A;  3L73 G;  1AKA A;  1GC2 A;  3P6K A;  1J04 A;  1U57 A;  3CX5 H;  3A0B H;  3CCM P;  2JG2 A;  3H7F A;  1VJO A;  2W90 A;  4WD2 A;  3CMA P;  3TGU J;  2KS1 B;  3TSI A;  1KIL E;  4A0H A;  3DRD A;  4LW4 A;  2EYQ A;  3CCS P;  1WYV A;  4J5U A;  5HXX A;  4UB8 E;  1FZC C;  3G8M A;  1PG8 A;  1KFM A;  3L75 G;  1LT9 C;  3DR4 A;  5CCG D;  4ADB A;  2EH6 A;  3OAK A;  3B8E B;  1URQ B;  5BU5 A;  1N7S D;  5IWQ A;  2TPL A;  3JTX A;  2GMU A;  1MAQ A;  3N4R A;  1T3U A;  4AUW A;  4PD4 I;  4GE4 A;  2E76 B;  1ZRT E;  2IPP A;  3HVY A;  1L0L J;  9AAT A;  1P84 D;  3CCR P;  1DD3 A;  3OJA B;  1LTA C;  3EFF K;  1GDT A;  4WBT A;  3LY1 A;  1KC8 Q;  4B98 A;  2MJZ A;  2XDJ A;  5BVZ A;  2OYH B;  4P7Y A;  1J1E B;  1Q81 Q;  5FT5 A;  3H1H D;  2R5B A;  3VMZ A;  4OVN F;  1YJW P;  3HTK B;  2CJG A;  3CI9 A;  2BI1 A;  1BGY J;  2CAN A;  1LW4 A;  1C7G A;  3WX9 A;  1MDO A;  5M46 A;  2E75 D;  4IOI H;  5APU A;  2RN0 A;  2EZ2 A;  2RFV A;  1BJW A;  2Z9W A;  5APY A;  1GTW A;  2PO3 A;  1ZV8 A;  2BCC G;  2OYI A;  1EG5 A;  5AW2 B;  2C44 A;  4M2M A;  3HD7 A;  1NJI Q;  1LWU A;  3WCO A;  5CCH A;  4H44 B;  1M0Q A;  1XEY A;  1H0T A;  1NTK K;  4BXL A;  2VLH A;  2BCC J;  2J59 M;  1MLZ A;  1KIL D;  2JJL A;  2QJP B;  3RL0 g;  1URQ D;  2OQQ A;  2WPQ A;  4PFN A;  1KYO E;  3FFR A;  1W5C E;  1NTM J;  1N31 A;  2QJY B;  2IZ0 A;  3LVJ A;  2VMT A;  4Q6R A;  2H43 A;  4IYO A;  2O01 J;  2P7J A;  4IXO A;  2E76 D;  2WTY A;  3NU7 A;  3R4T A;  1IFJ A;  2HPC B;  1AV1 A;  2ZJG A;  1QGN A;  1GK4 A;  3T97 A;  1ZR4 A;  1ASN A;  3BV0 A;  3KGX A;  1KYO I;  1S5L E;  4MQP A;  1ZRT D;  5E79 E;  3M5U A;  3L8A A;  4XJL A;  2LXB A;  1S08 A;  1Q82 Q;  4RJT A;  2W8W A;  3N7N A;  1H1C A;  3PA9 A;  3B8X A;  2Y0D A;  1PIX A;  2KP8 A;  1UU1 A;  1BSH A;  5DB5 A;  1PGP A;  2W8U A;  1RF0 A;  4LNL A;  5BU8 B;  4E77 A;  4F5K A;  2K9Y A;  2AEJ A;  4CVQ A;  1HJ0 A;  2IBZ D;  4W1V A;  1Z7D A;  4Y99 B;  1YIY A;  4H44 D;  1X29 A;  1PPJ G;  2FY8 A;  4Y28 J;  1UIX A;  3Q1M A;  5KAF H;  3B46 A;  4LLH A;  1K9M Q;  3VN0 A;  4ZLV A;  4GDY A;  1LTS C;  1DD4 A;  1KOR A;  1VQN P;  1IFP A;  3VK2 A;  1VQL P;  1L0L K;  1U08 A;  2Y9Z A;  1RHZ B;  4UB6 E;  3MP7 B;  2I8D A;  2HP2 A;  3H1H G;  3L71 E;  1N73 A;  4M3L A;  3MC6 C;  1O62 A;  1KYO D;  1JY3 P;  3QBO A;  3V4W A;  4IL6 E;  1CL2 A;  1JS3 A;  4JEV A;  2XKM A;  4DZO A;  1QIT A;  3F9T A;  1O61 A;  1YOO A;  4XK1 A;  5GTH E;  1PFI A;  1SP4 A;  3SWY A;  2H8P D;  2OAR A;  2DKJ A;  1SQQ J;  1DGE A;  1EZV D;  3B5N A;  3D71 A;  1C7O A;  1GL2 B;  4H0L B;  3TQX A;  4UHN A;  5JAY A;  2BEQ D;  3Q5R A;  4CXQ A;  1LTT C;  2CST A;  3AEN A;  1LGH B;  4XJP A;  4C7N A;  1N7S C;  4AZJ A;  3RQ1 A;  3SFD C;  5G2P A;  1FE6 A;  3NTJ A;  1QL2 A;  2O1B A;  4IW7 A;  1RQV A;  2VIB A;  1V2F A;  2JO1 A;  2NPS A;  1NAF A;  2AEU A;  3L74 J;  5B66 E;  2KI7 B;  1QL1 A;  2WB6 A;  1ZC9 A;  3BC8 A;  1ZOB A;  2HR3 A;  4Q76 A;  3PTZ A;  1ART A;  3S9O A;  4JEW A;  2QLR A;  2AY4 A;  3L72 E;  2AY3 A;  1GMJ A;  1Y47 A;  4BA4 A;  4EI2 A;  1YTZ T;  5J8Q A;  4ADD A;  1Y8A A;  5CMZ A;  4RIZ A;  1LT1 A;  3NXS A;  4JEZ A;  2HOZ A;  3OP7 A;  3RBX A;  3GF3 A;  3IFM A;  1WYT B;  4PJ0 H;  2W7F A;  3L71 D;  1J1D B;  1JG8 A;  4RES B;  2IBZ G;  2Q9I A;  1VPC A;  2FFD B;  2Z9V A;  1AX4 A;  2I1J A;  1TU3 F;  2D65 A;  2DR1 A;  1NWQ A;  2ZYJ A;  1SS1 A;  2YO2 A;  4Z1M H;  2JDI H;  1URQ C;  3KDP B;  3QWO C;  1K05 A;  1L4A D;  1RE4 C;  1X0T A;  4R4L A;  2QG4 A;  1BJ4 A;  1AFO A;  4MSO A;  2E76 C;  2H88 C;  4W7Y A;  2D5Y A;  3WZF A;  3NDN A;  2Z9U A;  5KLV E;  3KGW A;  3FD0 A;  5BJ3 A;  1NVO A;  4IY7 A;  4W80 A;  2JEE A;  4AOA A;  1C7N A;  2R3C A;  1FJK A;  5D95 A;  2Z4E A;  1OW6 A;  3MUD C;  1VQO P;  3Q2Y A;  3F6T A;  4DGT A;  2WT7 B;  3GG2 A;  3DU4 A;  1SQP J;  1J1E C;  3RCH B;  3CXH E;  2FXP A;  2V1P A;  4IXZ A;  2KUB A;  1N2T A;  4AYC A;  3JZL A;  3MAF B;  2KNC A;  5EIG B;  1EDI A;  3W1H A;  3AOV A;  3B4S A;  1RVY A;  1BE3 E;  1EZV G;  3R2P A;  2DGL A;  1M56 D;  3CL3 D;  1MUU A;  2IZ1 A;  2VYC A;  4MKJ A;  1AMQ A;  1A02 J;  2CH2 A;  4KT0 J;  1RF1 B;  3QM2 A;  4WYG A;  1SQQ K;  5K8B A;  1UKJ A;  3GHG B;  1IX6 A;  4UHO A;  3WU2 E;  1WKH A;  3KYQ A;  2XH1 A;  1FZC B;  3CXH I;  3WUU A;  3MGN A;  1IK9 A;  1HTL C;  1ZR2 A;  4H44 C;  3TYY A;  3BWN A;  4IXS A;  1PZQ A;  2K88 A;  2OYO A;  2M8R A;  2PGD A;  3VMA A;  1QVF O;  3RK3 D; 
#chains in the Genus database with same CATH homology
 3NUI A;  2AAT A;  1TAT A;  1LT9 A;  1M1J A;  1YJY A;  3DZZ A;  1ASB A;  3FQ8 A;  1SFC B;  4LC1 A;  2BKW A;  1YJZ A;  1GC0 A;  1GEY A;  1Z56 A;  1WYU B;  2ZY3 A;  4K05 A;  3ZRQ A;  3A5T A;  3IR9 A;  3LID A;  2JIS A;  2VMO A;  2W7K A;  1VEF A;  1QIR A;  4ZWM A;  3PDX A;  2C9N Y;  4I8A A;  3R9A A;  3VP9 A;  1YJS A;  3H32 A;  3RK2 D;  2W7G A;  3G3Z A;  5BJ4 A;  4UHM A;  1AY5 A;  4Y99 C;  1FZE A;  4RLG A;  4WXF A;  1FJP A;  1DJ9 A;  2BI2 A;  2OAT A;  2FN6 A;  1AKB A;  3ZRR A;  4OH8 B;  2AY8 A;  3AEJ A;  2C0R A;  1GK6 A;  3HE4 B;  1SFC D;  4F5G A;  2FNU A;  1BJO A;  5D5S A;  5EUD A;  3FKD A;  3EZS A;  1LS3 A;  1I43 A;  1IAX A;  1HUC A;  4NOG A;  5F8V A;  1SQP K;  1H89 A;  2EGY A;  3V5B A;  5G09 A;  4JF7 A;  5KJ7 C;  1FZF A;  1HVV A;  2VGS A;  4WXB A;  2WK7 A;  5EAV A;  1JTH B;  2GMS A;  2Q5U A;  1LTJ B;  3VYI A;  1GL2 C;  5EFS A;  3WKS A;  4JYC A;  2N1T B;  3KE3 A;  2HFE D;  1JY2 N;  1D7S A;  1XI9 A;  1AJR A;  4B86 A;  5DX5 A;  2O01 H;  3AEM C;  1G4V A;  4PFF A;  4O6Z A;  2KOG A;  2A45 I;  2R2N A;  2KYV A;  4AQR D;  5G4I A;  5AW3 B;  2Q7W A;  1IFI A;  2VRS A;  5APS A;  1MDZ A;  4JEY A;  3N75 A;  4ZDP A;  4CBS A;  4U1T A;  1X8Y A;  1S0A A;  1AIA A;  1JNM A;  3MC6 A;  2JJF A;  1T2K C;  3EI6 A;  3BCX A;  1J1D C;  3HUS B;  1RE3 C;  2FFD C;  3LVL B;  3O8Z A;  3RK3 C;  3ZZK A;  3COG A;  1N7S B;  5APX A;  4W91 A;  2N1T D;  1JY2 O;  2FKI A;  2WKA A;  5AW6 B;  1XTG B;  1CW5 A;  1AJS B;  4HF8 A;  1CL1 A;  3EI8 A;  1BJN A;  3NFQ A;  1B5P A;  5CHX A;  2W7I A;  2R5C B;  3ZRP A;  5APW A;  3IHJ A;  3JW9 A;  1XTC C;  3HE5 B;  4FL0 A;  2HOR A;  2VLF A;  3BCA A;  3GZC A;  1OWA A;  3B1E A;  1D7R A;  1AQ5 A;  3QN6 A;  4WY4 B;  4TMR A;  1QJ5 A;  2OKJ A;  3II0 A;  1B9I A;  2OQX A;  2YCN A;  4ATQ A;  2W6B A;  2BIE A;  1FG7 A;  3RK2 C;  2YKY A;  3I4J A;  1RF1 C;  2VMN A;  2ZY2 A;  3GHG C;  2ZY4 A;  4LW2 A;  1CQ7 A;  2R5D A;  3FVU A;  2VMP A;  1YIZ A;  1KIL B;  3DXV A;  1YNU A;  1UU2 A;  1GW4 A;  2CJH A;  4GEB A;  1TOG A;  2FM1 A;  1IBJ A;  2YKO A;  1SFC C;  1URQ A;  4W1X A;  2C81 A;  4ZDL A;  1W23 A;  1RE4 A;  2HUU A;  1SVF A;  1FDM A;  1LTI C;  5FT6 A;  4WB0 B;  1G4X A;  3JWA A;  2QB2 A;  1SPA A;  2Z9X A;  5EQC A;  1AY8 A;  2E7J A;  1NU1 K;  1I41 A;  1AAM A;  1CI6 B;  4OBV A;  4F5J A;  1VDF A;  1SFF A;  3MUD A;  2HP1 A;  1EQ7 A;  2VMQ A;  3U59 A;  3B1D A;  4TN4 A;  1T3J A;  3UAK A;  3WGC A;  2J58 A;  2OYH A;  1T8Z A;  3RL0 D;  3USF A;  1FG3 A;  1M0P A;  4WY4 D;  3FSL A;  3HTK A;  3GZD A;  1DKA A;  2WSE H;  1PMO A;  1W7M A;  1C9C A;  1NHL A;  3VTP C;  2X8U A;  4XA4 A;  1SZS A;  3KPE A;  4F5M A;  1IO4 A;  4AO9 A;  3W1I A;  2XNX A;  4HYT B;  1JUN A;  1ASM A;  3II6 A;  3E6G A;  1KZU B;  4W7Z A;  1KL1 A;  1V2D A;  4XJO A;  1LC5 A;  1FC4 A;  4UQV A;  3A2B A;  2JJG A;  4XEW A;  3FTB A;  1M32 A;  2PP6 A;  3LG0 A;  4HVK A;  5G4J A;  2HPC A;  4GKG A;  3OA7 A;  1HBW A;  5CJ4 A;  2CIN A;  4ZWV A;  2YKQ A;  1SQV K;  3HL2 A;  2G7J A;  1IJI A;  4Y0H A;  2W7H A;  1O4S A;  4XAU A;  3U1A A;  1UU0 A;  1LTJ C;  2F8J A;  4OT8 A;  4WXG A;  3I5T A;  4XQ2 A;  1LTG C;  3LV2 A;  4MQQ A;  4N0W A;  2N1T C;  1X79 B;  1B8G A;  1GD2 E;  2BIG A;  1DJU A;  1KL2 A;  1D7V A;  2FQ6 A;  5CCH D;  1FZG A;  2YKX A;  1DTY A;  1BS0 A;  4BHD A;  1JY3 O;  2N9B A;  3CQ6 A;  3WY7 A;  3G0T A;  5AVZ B;  1AAW A;  3BCB A;  2VMX A;  3G7Q A;  5AW0 B;  2FXM A;  1JCD A;  3FDB A;  3V2N A;  1CS1 A;  3CQ4 A;  4Q31 A;  2QMA A;  3N5M A;  1HGZ A;  2CFB A;  1N2D C;  3AEP A;  4RKC A;  3UWC A;  1FU1 A;  3MAD A;  4R5Z A;  3MIW A;  5AVR B;  3E2Y A;  2WPS A;  3BN1 A;  2ZSM A;  5KJ7 A;  3CLQ A;  3BWO A;  3HUS C;  1I29 A;  2HOY A;  4LNJ A;  5CCG C;  3DOD A;  2BAS A;  2E42 A;  4BQ0 A;  3K7Y A;  1L4A B;  1GL2 A;  2KSJ A;  2AY6 A;  3LVK A;  1BW0 A;  3WMM 0;  1MLY A;  3PIU A;  2WSC H;  2YRR A;  3M9H A;  4E1O A;  1LC8 A;  4ZSW A;  1FZA A;  2VIA A;  1LTB C;  3AEM A;  4LNM A;  1NKN A;  4Q75 A;  3VP6 A;  3EIB A;  4GRX A;  2R32 A;  3FVS A;  3HQT A;  4ISY A;  1M7Y A;  1LW5 A;  1IJD B;  2HYN A;  4WY4 C;  4QGR A;  1SQB K;  2R5E A;  4R5F A;  3AOW A;  1MDX A;  1M4N A;  3K28 A;  1O69 A;  1G7X A;  3DXW A;  3F0H A;  2JJE A;  3MD0 A;  4LGD E;  3U1C A;  3I5C A;  2P1J A;  1WYT A;  2AY5 A;  4N6J A;  3RK3 B;  1E5F A;  1KIL C;  2GSA A;  1RE3 A;  2FFD A;  2FYU K;  3B5N D;  2OKK A;  2NMP A;  3LVM A;  4ATP A;  3NTN A;  2FYZ A;  4WYC A;  2W7J A;  3H9X A;  2V0Y A;  2W7E A;  3WKR A;  4WYF A;  5AVY B;  2YHK A;  5E5I A;  5CJ0 A;  2Q3I A;  1ORD A;  2WT7 A;  2VGU A;  3HLM A;  3EI5 A;  3RCH A;  2XU6 A;  3RBL A;  1OHV A;  1W7N A;  3MAF A;  3RK2 B;  1ASE A;  3N0L A;  5EIG A;  5M49 A;  2YOB A;  3VK4 A;  2VI9 A;  5AVW B;  1RF1 A;  4Y0I A;  4KXK A;  1IX7 A;  5E3K A;  3GHG A;  2WIT A;  2WK9 A;  2W7D A;  4N3Y B;  3ZZJ A;  4ZAH A;  1FZC A;  1SVV A;  2CB1 A;  3GR9 A;  3A2A A;  3EUC A;  3V2Q A;  3VOP A;  2A1V A;  2O0R A;  3H6P A;  2ZSL A;  5KTB A;  3ISL A;  3NYU A;  3NMD A;  1SFC A;  2VI8 A;  2ZXE B;  3ATH A;  2HOD B;  3L36 A;  3QPG A;  1YTZ I;  2KFP A;  2VMU A;  1WT6 A;  1GBN A;  5EUE A;  4RKD A;  3MBB A;  2D61 A;  5DJ9 A;  1WYU A;  1G2C B;  2W27 A;  4F5H A;  1CQ8 A;  3BRT B;  3TNU B;  4PVF A;  3E9K A;  3GSB A;  1H88 A;  1W2E A;  1MV8 A;  4ADE A;  2BI9 A;  1GC4 A;  1SZU A;  2D63 A;  3E2Z B;  2D64 A;  2DGK A;  3UE8 A;  2YCP A;  1QJ3 A;  2GM4 A;  1HGV A;  4H63 Q;  1LK9 A;  1V2E A;  3JWB A;  1DFO A;  1OXO A;  3HE4 A;  2BHX A;  3P8M C;  1WST A;  4A0F A;  5AW7 B;  3EI7 A;  1E5W A;  1V72 A;  5HHY A;  1WRG A;  4C7R A;  2BI3 A;  3V2R A;  1GU5 A;  2PB2 A;  2DGM A;  4MKK A;  1JTH A;  1ELQ A;  2L5G B;  2W7M A;  3W1J A;  3PPL A;  1L4A C;  1LTJ A;  1IVR A;  5M4D A;  4CXR A;  2N1T A;  1ECX A;  1OXZ A;  1S9K E;  4EB5 A;  1M0O A;  1NKZ B;  3FRK A;  1OHW A;  2VGZ A;  1IFD A;  4DQ6 A;  2E54 A;  4W1W A;  1AIB A;  1BKG A;  5E4Z A;  1ZLL A;  2GQN A;  2IFN A;  3BRV B;  3CQ5 A;  4EIJ A;  4XJM A;  4AH3 A;  2HOX A;  4FFC A;  2C9L Y;  3VOM A;  1AMR A;  1RV4 A;  1D2F A;  2YCT A;  3P7K A;  3PD6 B;  2WWW A;  4DOJ A;  1B5O A;  2C0W A;  2M3B A;  2ZFC A;  3HUS A;  1JF9 A;  5AW5 B;  2CH1 A;  5AW8 B;  1PMM A;  3PDB B;  1AIC A;  1G1J A;  1AKC A;  5I92 A;  5CCG A;  4PIW A;  1N7S A;  3M06 A;  4IX8 A;  2YNY A;  4P3M A;  1NOH A;  3M0A A;  1AJS A;  2OGE A;  3SWF A;  4B9B A;  1SZK A;  2R0T A;  1N86 A;  2R5C A;  4E3Q A;  4I6M C;  2D7Y A;  3ASA A;  1M0N A;  1S9K D;  3C9I A;  3VP8 A;  1TAS A;  3RL0 B;  3HE5 A;  2CTZ A;  4WLJ A;  2EPJ A;  2IX7 C;  4WBA A;  1C4K A;  4AO4 A;  1BT4 A;  2HUI A;  2QBT A;  4WY4 A;  5EAA A;  1TPL A;  2YMY A;  1X28 A;  2WPR A;  4WYE A;  1GEX A;  1ELU A;  2HLO A;  1WYV B;  1LC7 A;  1IC2 A;  1FOS F;  4RJ0 A;  1MFZ A;  3BWN C;  1RY3 A;  3DC1 A;  1KIL A;  1M7L A;  3KKI A;  3L44 A;  1GZL A;  2DKB A;  1FOS E;  5AVU B;  1CZC A;  4A00 A;  4DBC A;  5AW9 B;  3N4X A;  1M1J C;  3N4S A;  2KLV A;  2YRI A;  1S07 A;  3DYD A;  4WB0 A;  2CPB A;  5APV A;  3RBF A;  3NNK A;  3FCR A;  1IAY A;  1CI6 A;  2DOU A;  1PFF A;  5KLV K;  3BVH A;  4GE7 A;  2BIA A;  1ARS A;  2YO3 A;  2GB3 A;  1DJE A;  1HJB A;  2FYF A;  1JMM A;  3RUY A;  2OYI B;  4GE9 A;  2A45 G;  3HD7 B;  1LWU B;  3VK3 A;  1AHF A;  7AAT A;  3M0D C;  1EJI A;  2QM7 A;  1ARI A;  1JY3 N;  1AHG A;  4A6R A;  4I2L C;  3GWP A;  2P2U A;  1TOJ A;  4K2B A;  2VGV A;  3AEJ C;  4IYO B;  2WSF H;  1ZN5 A;  2ORD A;  1DX7 A;  2AEV A;  4WYD A;  3WGB A;  1A02 F;  3TFT A;  3A8U X;  2YKP A;  2QM8 A;  2AY1 A;  5C6U A;  4MQR A;  4XE5 B;  1X2A A;  2D66 A;  3NU8 A;  5M4B A;  1KFN A;  1I48 A;  1J2J B;  2E7I A;  8AAT A;  2ZC0 A;  1OAT A;  5AVS B;  3AAT A;  1RV3 A;  3L37 A;  3MKJ A;  4J8L A;  5AW1 B;  3Q8N A;  3A9X A;  4ITX A;  2D7Z A;  4K2M A;  3MEB A;  2VMZ A;  1FBM A;  4BMK A;  2CJD A;  3HD7 D;  1Z3Z A;  5EUN A;  1GU4 A;  2VGW A;  4M2J A;  3FVX A;  4W8I A;  3HDO A;  3GET A;  2EO5 A;  1H0C A;  4H51 A;  1AMS A;  3VMY A;  3E2F A;  4W5K A;  1KKJ A;  3P8C E;  4RAE A;  1JS6 A;  3AEO A;  1W3U A;  1ASG A;  1CSB A;  3FZ8 A;  4A0G A;  2I1K A;  4KHX A;  4C46 A;  1AY4 A;  1N73 B;  4ZKP A;  1X0M A;  4LC3 A;  3ELP A;  1N8P A;  3QGU A;  2AY9 A;  2HZP A;  2H7H A;  3A3Y B;  4OCA A;  4Y0D A;  2PB0 A;  3WCN A;  1AHX A;  3I16 A;  2EZ1 A;  2HUF A;  3HT4 A;  3B5N B;  4N78 E;  1MGV A;  4RIT A;  2CPS A;  3OKS A;  3ECD A;  1EQB A;  1M6S A;  3NUB A;  3AEN B;  4C7N B;  4O9B A;  4CBR A;  1L4A A;  1LKC A;  3PAA A;  4HH2 A;  2W8T A;  1GD9 A;  2NPS B;  1QIS A;  5F9S A;  3VMX A;  3AEL A;  5AVT B;  4I1L A;  3RI6 A;  3A9Y A;  3HBX A;  3P32 A;  1ASA A;  2VMR A;  1GW3 A;  3TAT A;  4ZDO A;  3A7O A;  1CJ0 A;  2BI5 A;  4OTL A;  1NTM K;  1GEW A;  4EU1 A;  1TOK A;  3RL0 C;  5HDM A;  3QHX A;  1GC3 A;  1CZE A;  3GJU A;  3ASB A;  3MAU A;  1Y4I A;  3P8C D;  1B9H A;  2O7C A;  3NYT A;  1S09 A;  2WZ7 A;  2P67 A;  2G6W A;  3A9Z A;  4WLH A;  5FT8 A;  1HH0 A;  1T3I A;  3LWS A;  1DEB A;  5KJ7 D;  5G2Q A;  2JGT A;  4EMY A;  2QA3 A;  2C7T A;  3CBF A;  4JEX A;  2POH A;  4F5I A;  1C0N A;  1ASC A;  3L35 A;  1TOE A;  3FZ6 A;  1ASD A;  3UIA A;  2VGT A;  2W8J A;  1GL2 D;  3E77 A;  2AY2 A;  4N78 D;  2NPS D;  5G0A A;  4ZKU A;  2XBN A;  4A6U A;  2Z1Z A;  5FT4 A;  4A6T A;  2YKU A;  4U2H A;  2ZY5 A;  3LW5 H;  1FZB A;  2ZP7 A;  4IFF A;  1FAV A;  2W8V A;  1KMK A;  4K2I A;  1G1I A;  4AZK A;  4IFM A;  1KQL A;  1D7U A;  4ITG A;  4F4E A;  1YAA A;  1ZOD A;  3BAS A;  3TFU A;  2XZR A;  2OYH C;  3V4Q A;  1JO5 A;  3QI6 A;  1P3W A;  1IUG A;  2LKM A;  2IFM A;  3GZD C;  4E3R A;  2OYI C;  1OHY A;  3HD7 C;  2E7U A;  1LWU C;  2QB3 A;  5CCH C;  1T2K D;  3VAX A;  4WP0 A;  2JJH A;  3WLX A;  1AHE A;  3ELE A;  1BQD A;  2BYL A;  3GBX A;  2VMW A;  1LT9 B;  2GUV A;  1M1J B;  3FDD A;  1X9V A;  4IFD K;  1ARG A;  2GUS A;  2VMV A;  5AVX B;  3V2P A;  1BQA A;  2HOD A;  2W6A A;  2O1J A;  3P1T A;  4GT1 A;  2X3L A;  2QSR A;  4OMA A;  1J32 A;  4GSA A;  1SQX K;  2WK8 A;  4OYT A;  2CY8 A;  5TF5 A;  1G2C A;  3E1I A;  3NYS A;  2X5D A;  1RF0 C;  1L0N K;  5AVV B;  4RJY A;  3H32 B;  3AV7 A;  3TNU A;  4UOY A;  1G7W A;  3HMU A;  2YKV A;  3DR7 A;  1S06 A;  1TAR A;  3MTU E;  1B4X A;  3K40 A;  1DH3 A;  3FZ7 A;  4BA5 A;  3E2Z A;  3M0D A;  5APT A;  1OXP A;  2VMS A;  2Z61 A;  1YYC A;  1TOI A;  1BJO B;  3M9B A;  4EOT A;  3L4F A;  1W7L A;  2Q7C A;  4RM1 A;  4F5F A;  1IFM A;  3PP5 A;  3HRN A;  1DGD A;  2Z1Y A;  1N73 C;  1QZ9 A;  2PAJ A;  4WYA A;  1WKG A;  1IX8 A;  4JYB A;  3EIA A;  3EZ1 A;  4EB7 A;  2Z5I A;  1ASL A;  4ZM3 A;  3KQG A;  3TK1 A;  3B5N C;  4KAM A;  4EFF A;  1ARH A;  2C0X A;  4OC9 A;  2Z5H A;  2A45 H;  2FNI A;  2E43 A;  3NRA A;  3PGY A;  4M2K A;  2NPS C;  1E5E A;  5AX8 A;  1SF2 A;  3ACZ A;  3EFG A;  4OBU A;  1MAP A;  2AY7 A;  1AHY A;  2Z20 A;  5DJ1 A;  3NX3 A;  1KMJ A;  1MZ9 A;  3BAT A;  2BWN A;  4R8D A;  1N7L A;  3FQ7 A;  1NTZ K;  4A0R A;  1H8A A;  2OGA A;  1ASF A;  1SLQ A;  2VMY A;  2KB7 P;  4MY5 A;  4ZM4 A;  4A72 A;  4R2N A;  3BS8 A;  3FQA A;  4WB4 A;  3EI9 A;  4L0O A;  1GCK A;  2W7L A;  1NO4 A;  3CAI A;  2BWO A;  3M91 A;  1JOC A;  1GDE A;  2BWP A;  3PD6 A;  1AMA A;  4JF0 A;  4GIF A;  4F5L A;  3D6K A;  3PDB A;  1JCC A;  1CZQ A;  2HG5 D;  1NH4 A;  2X5F A;  2FKW B;  4ADC A;  5AVQ B;  3FFH A;  3T32 A;  2BYJ A;  3TCM A;  4JF1 A;  1JY2 P;  1CQ6 A;  2O1K A;  2XV5 A;  5AW4 B;  1HWT C;  1VP4 A;  4ZAS A;  3BB8 A;  1IFN A;  4ZSY A;  5APQ A;  3B1C A;  1KKP A;  3M9Q A;  2ZUK A;  4KYO A;  1RVU A;  3LIE A;  3EQ2 A;  3PJ0 A;  1AKA A;  1GC2 A;  3P6K A;  1J04 A;  2JG2 A;  3H7F A;  1VJO A;  4WD2 A;  3TSI A;  4A0H A;  3DRD A;  4LW4 A;  2EYQ A;  1WYV A;  4J5U A;  5HXX A;  1FZC C;  3G8M A;  1PG8 A;  1KFM A;  1LT9 C;  3DR4 A;  5CCG D;  4ADB A;  2EH6 A;  3OAK A;  3B8E B;  1URQ B;  5BU5 A;  1N7S D;  5IWQ A;  2TPL A;  3JTX A;  2GMU A;  1MAQ A;  3N4R A;  1T3U A;  4AUW A;  4GE4 A;  2IPP A;  3HVY A;  9AAT A;  3OJA B;  1LTA C;  1GDT A;  4WBT A;  3LY1 A;  4B98 A;  2MJZ A;  2XDJ A;  5BVZ A;  2OYH B;  4P7Y A;  1J1E B;  5FT5 A;  2R5B A;  3VMZ A;  3HTK B;  2CJG A;  3CI9 A;  2BI1 A;  2CAN A;  1LW4 A;  1C7G A;  3WX9 A;  1MDO A;  5M46 A;  5APU A;  2EZ2 A;  2RFV A;  1BJW A;  2Z9W A;  5APY A;  1GTW A;  2PO3 A;  1ZV8 A;  2OYI A;  1EG5 A;  5AW2 B;  2C44 A;  4M2M A;  3HD7 A;  1LWU A;  3WCO A;  5CCH A;  1M0Q A;  1XEY A;  1NTK K;  2VLH A;  2J59 M;  1MLZ A;  1KIL D;  2JJL A;  1URQ D;  4PFN A;  2WPQ A;  3FFR A;  1N31 A;  3LVJ A;  2VMT A;  4Q6R A;  2H43 A;  4IYO A;  2P7J A;  4IXO A;  2WTY A;  3NU7 A;  3R4T A;  1IFJ A;  2HPC B;  2ZJG A;  1QGN A;  1GK4 A;  3T97 A;  1ZR4 A;  1ASN A;  3BV0 A;  3KGX A;  4MQP A;  3M5U A;  3L8A A;  4XJL A;  1S08 A;  2W8W A;  3N7N A;  1H1C A;  3PA9 A;  3B8X A;  2KP8 A;  1UU1 A;  5DB5 A;  2W8U A;  1RF0 A;  4LNL A;  5BU8 B;  4E77 A;  4F5K A;  4CVQ A;  4W1V A;  1Z7D A;  4Y99 B;  1YIY A;  1X29 A;  3B46 A;  4LLH A;  3VN0 A;  4ZLV A;  4GDY A;  1LTS C;  3VK2 A;  1L0L K;  1U08 A;  2HP2 A;  1N73 A;  4M3L A;  3MC6 C;  1O62 A;  1JY3 P;  3QBO A;  3V4W A;  1CL2 A;  1JS3 A;  4JEV A;  2XKM A;  4DZO A;  1QIT A;  3F9T A;  1O61 A;  1YOO A;  4XK1 A;  1PFI A;  1SP4 A;  3SWY A;  2H8P D;  2OAR A;  2DKJ A;  1DGE A;  3B5N A;  1C7O A;  1GL2 B;  3TQX A;  4UHN A;  5JAY A;  4CXQ A;  1LTT C;  2CST A;  3AEN A;  1LGH B;  4XJP A;  4C7N A;  1N7S C;  4AZJ A;  3RQ1 A;  5G2P A;  3NTJ A;  1QL2 A;  2O1B A;  4IW7 A;  2VIB A;  1V2F A;  2NPS A;  1NAF A;  2AEU A;  1QL1 A;  2WB6 A;  1ZC9 A;  3BC8 A;  1ZOB A;  4Q76 A;  1ART A;  4JEW A;  2QLR A;  2AY4 A;  2AY3 A;  4BA4 A;  5J8Q A;  1YTZ T;  4ADD A;  5CMZ A;  4RIZ A;  3NXS A;  4JEZ A;  2HOZ A;  3OP7 A;  3IFM A;  1WYT B;  2W7F A;  1J1D B;  1JG8 A;  4RES B;  2Q9I A;  1VPC A;  2FFD B;  2Z9V A;  1AX4 A;  2I1J A;  2D65 A;  2DR1 A;  1NWQ A;  2ZYJ A;  2YO2 A;  1URQ C;  3KDP B;  1RE4 C;  1L4A D;  1BJ4 A;  1AFO A;  4MSO A;  4W7Y A;  2D5Y A;  3WZF A;  3NDN A;  2Z9U A;  3KGW A;  3FD0 A;  5BJ3 A;  4IY7 A;  4W80 A;  2JEE A;  4AOA A;  1C7N A;  2R3C A;  1FJK A;  5D95 A;  2Z4E A;  3F6T A;  4DGT A;  2WT7 B;  3DU4 A;  1J1E C;  3RCH B;  2V1P A;  4IXZ A;  1N2T A;  4AYC A;  3JZL A;  3MAF B;  5EIG B;  3W1H A;  3AOV A;  1RVY A;  3R2P A;  2DGL A;  3CL3 D;  1MUU A;  2VYC A;  4MKJ A;  1AMQ A;  1A02 J;  2CH2 A;  1RF1 B;  3QM2 A;  4WYG A;  1SQQ K;  5K8B A;  1UKJ A;  3GHG B;  1IX6 A;  4UHO A;  1WKH A;  3KYQ A;  2XH1 A;  1FZC B;  3MGN A;  1IK9 A;  1HTL C;  1ZR2 A;  3TYY A;  3BWN A;  4IXS A;  2M8R A;  3RK3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...