1ARSA

X-ray crystallographic study of pyridoxal 5'-phosphate-type aspartate aminotransferases from escherichia coli in open and closed form
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title X-ray crystallographic study of pyridoxal 5'-phosphate-type aspartate aminotransferases from Escherichia coli in open and closed form.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
total genus 138
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1arsA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1arsA01
4XJLA 5EIGA 1AJSA 2FM1A 1CZEA 3K7YA 2O1BA 2W7KA 4BHDA 1E5EA 1UU0A 2E7JA 1WSTA 4ZSYA 5HHYA 1WKGA 1JS3A 5F9SA 1YJYA 3E9KA 3E6GA 3QHXA 4W8IA 4W1XA 3JW9A 1FG3A 5I92A 1C7OA 2VMYA 1IX8A 1RV4A 1GDEA 2YRIA 3HDOA 4TN4A 4W1WA 2E54A 2ZSLA 3ELEA 2R5CB 4ZASA 5G09A 3FZ8A 1W7LA 2AY4A 3UE8A 1XEYA 3USFA 2JJHA 4Q31A 2O7CA 3F6TA 3LVJA 3PAAA 1MDOA 4U1TA 2CJGA 1V2DA 1KL1A 2ZY5A 4EMYA 3EI7A 2BWOA 1DFOA 1AAMA 1M6SA 2EZ1A 4EB7A 2ZY3A 2CFBA 3KGWA 2VGWA 1C0NA 1ARIA 1MGVA 3L8AA 1TATA 2QMAA 4IYOB 3DYDA 1CQ6A 3NUBA 1ZOBA 3HT4A 4Q75A 1FC4A 5EAVA 5FT4A 1E5FA 1KKJA 1KMJA 1MDXA 1YAAA 1KL2A 4UHNA 1PMOA 3ZRQA 4A0GA 5DB5A 2W8UA 2DOUA 3NUIA 2WK7A 5E3KA 1QISA 2BIEA 1TASA 2VMPA 1S09A 1C7GA 9AATA 1C4KA 3DRDA 1DGDA 2AATA 4HF8A 4I8AA 5DJ1A 3KGXA 3GJUA 2W8TA 1CJ0A 2R5EA 1AIAA 2VMQA 1OXOA 1RVYA 2W7HA 1GC3A 1M0PA 3MKJA 2Z1ZA 1H1CA 2ZP7A 3R9AA 4ADBA 1N2TA 2D5YA 4XAUA 4GRXA 4L0OA 4W91A 2W8VA 2W7DA 3II0A 3B8XA 3COGA 3AEPA 2Q7WA 1CL2A 3OP7A 4W5KA 5EQCA 1ASCA 1DJUA 5F8VA 2X5FA 4RIZA 3E2YA 1ARTA 4BA4A 3Q8NA 1BW0A 3N0LA 1DJ9A 1AAWA 2VMZA 2YKUA 3E2FA 3JWBA 4JEVA 4O6ZA 4IX8A 1QJ5A 1X2AA 3DU4A 4WLHA 1S06A 2HOZA 1WYUB 4IXSA 4DBCA 4F5LA 5C6UA 1B9HA 3HL2A 3D6KA 4XJOA 4DQ6A 4BA5A 2O0RA 3UWCA 4WXBA 3MAUA 1ASGA 3BWNC 3FDBA 4W1VA 2OATA 4OBUA 3B1DA 2HOYA 1X29A 3LV2A 1H0CA 3EIBA 4WB0A 3G7QA 1ASEA 5EFSA 3WZFA 1TPLA 3W1JA 3JU7A 3H7FA 3GWPA 3RQ1A 1ASMA 3GSBA 3NX3A 2QLRA 3UAKA 1AKBA 3GR9A 2D66A 2VLHA 1I29A 3NU8A 1TOKA 1D7VA 1QITA 1W7MA 2QBTA 3W1IA 3WY7A 1VEFA 2D65A 3AEOA 1B9IA 4FFCA 3A8UX 1GEXA 2VMRA 1SZUA 3FVXA 2VGSA 4OTLA 3NDNA 5HXXA 1VP4A 3GZDA 3HVYA 1I48A 2NMPA 1KKPA 1IUGA 1M0QA 4ITGA 1M0OA 5E4ZA 1M7YA 4Q76A 1WYVA 1AY5A 1SZSA 2ZSMA 1J04A 2X3LA 4U2HA 3FFRA 3AOWA 1YNUA 4BMKA 2YOBA 2YRRA 5M4BA 1DKAA 2CSTA 3LY1A 3WLXA 2HP2A 3VK3A 5EIGB 1AJSB 3FCRA 2VMVA 1B8GA 2VMXA 1IAXA 4R5FA 4Y0HA 1V2FA 4E3RA 3BCAA 4ATQA 2F8JA 2JJGA 3IF2A 3KKIA 1AJRA 4ZWMA 3ACZA 2VGVA 1D2FA 3LVMA 1UU1A 2V1PA 3BWNA 3TFUA 1BQDA 3I16A 4M2KA 4LC3A 1LKCA 2C81A 3B1EA 1FG7A 1ASFA 2CANA 2VI8A 4OCAA 4F4EA 2DGKA 3TQXA 3OKSA 4AO4A 1G7WA 1VJOA 3AEMC 3ASBA 2EH6A 2TPLA 2VGZA 1BQAA 3ATHA 2ORDA 1AMAA 1BJWA 2JGTA 4ISYA 4WYGA 4F5JA 1LS3A 1ELQA 3EIAA 2D64A 1UU2A 4J5UA 1YIZA 4N0BA 1YIYA 2C7TA 1LK9A 1SPAA 1DGEA 5LH9A 2JJFA 4QGRA 3EI9A 1GEWA 2YKVA 4WLJA 4A6RA 2ZUKA 2AY3A 4A0HA 2DKJA 4ATPA 3TATA 2XBNA 3JWAA 1AMRA 1I41A 3ASAA 3A2BA 2AY8A 2FYFA 3EI8A 1MLZA 4XEWA 3W1HA 3CAIA 4KXKA 2GSAA 1D7SA 2AEVA 3QPGA 4RLGA 1ELUA 3ECDA 1MAPA 5FT8A 1AHXA 1BKGA 2CY8A 1JG8A 2HZPA 2Z9XA 2Z1YA 2VMSA 4KAMA 3CQ5A 2R2NA 3FTBA 4R2NA 4RKDA 3LVLB 1CL1A 1CZCA 1M0NA 4XJPA 4AO9A 4CXQA 3GBXA 3FRKA 3PA9A 2CB1A 4CBRA 1DTYA 3HLMA 2GB3A 1MAQA 3BN1A 4F5MA 1OXPA 1BJNA 1V2EA 4AZJA 4XQ2A 2Z9WA 2W7EA 3NU7A 1O69A 3B46A 2GQNA 1O4SA 1AKCA 2BIGA 3DXVA 4J8LA 1XI9A 2CJHA 3BB8A 1Z3ZA 5D5SA 5G2PA 2Z9UA 4GE9A 5TF5A 4A0FA 3GZDC 3PGYA 4MQQA 3VP6A 4GE7A 1ASDA 3DZZA 3AENA 4K2MA 1DJEA 3AEMA 1ARHA 1QJ3A 3H14A 1AMSA 1B4XA 1G4XA 4B98A 3ZZJA 4AOAA 3BCXA 1IVRA 2WKAA 3KE3A 1EQBA 2AY5A 3CQ6A 4R8DA 3WCNA 4F5IA 3FFHA 2FQ6A 4JEXA 4TMRA 2CTZA 3DODA 3LWSA 1GCKA 2DGLA 4WB0B 1JF9A 1W7NA 2OQXA 3A9YA 4M2MA 3G8MA 1GC0A 4K2IA 1WYTA 3FVUA 2ZY4A 3ELPA 4IXZA 2W7IA 1OHVA 2RFVA 3DR7A 2FN6A 4UOYA 2ZYJA 4ZWVA 2AY1A 1SVVA 2YKYA 3TFTA 4UHMA 4M2JA 4P3MA 1AMQA 3CQ4A 2Z61A 3MAFA 3PD6A 4LNLA 4OC9A 2AEUA 5JAYA 5J8QA 4WYCA 1YJSA 2BI2A 4JF1A 4WYAA 2EZ2A 5G0AA 4A6TA 2VGTA 5IWQA 2CH1A 4MKKA 1RVUA 3DXWA 3IHJA 3LG0A 1S08A 1WYVB 4LNJA 2XH1A 4MQRA 3E77A 4WYFA 2BYLA 3WGCA 3RCHA 1TOJA 1GC4A 1J32A 3P1TA 1QGNA 2EPJA 3G0TA 2VLFA 1RV3A 2YCNA 3JTXA 2QB2A 2E7UA 1ASLA 1BJOA 2BI3A 3QBOA 2VMWA 4AH3A 3TCMA 2CH2A 1OHWA 2QA3A 4E3QA 4OYTA 3QN6A 2DKBA 2FNUA 3FQAA 4H51A 1AHGA 4MGRA 4N0WA 3BCBA 4TV7A 2W7LA 4F5GA 2BI1A 1AHYA 1TOEA 3DR4A 4UQVA 2HP1A 1EG5A 3GETA 5G4IA 2W8JA 1ASNA 4MKJA 3CBFA 3EI5A 3AOVA 4ZDPA 2W7JA 4E77A 1QIRA 4IW7A 1M32A 3PDXA 3ISLA 2AY6A 3FSLA 1T3IA 2X5DA 3HQTA 3PIUA 4WYEA 5HDMA 1D7UA 2OGAA 1I43A 3PDBA 4P7YA 4IY7A 4GEBA 2YCTA 4ZAHA 2E7IA 1ASAA 5M46A 1V72A 5G2QA 2C0RA 3VAXA 5K8BA 2HOXA 3NTJA 3WGBA 4BQ0A 1Z7DA 2FNIA 1G7XA 1SF2A 1IAYA 2VMUA 1ECXA 3MC6C 4Y0IA 3RUYA 3PJ0A 2HORA 1KMKA 4JEYA 1QZ9A 3K40A 3EZSA 4HVKA 2Z20A 3K28A 4WXFA 4R5ZA 4JEZA 3E2ZA 4UHOA 4FL0A 3I4JA 1EJIA 2DR1A 2BYJA 1OATA 2BIAA 1TARA 2CINA 3LVKA 2G6WA 5BJ3A 3FKDA 5M4DA 1ARGA 4PFNA 3MBBA 4XJMA 4EB5A 5FT6A 3BC8A 4GE4A 3FQ8A 1D7RA 1O61A 1AHFA 3HMUA 2R0TA 3M5UA 3ZRRA 4KYOA 2BKWA 2OGEA 1ARSA 3A9XA 4RM1A 3F0HA 1PG8A 4JEWA 2W7FA 3ZRPA 4RJ0A 2VMNA 1GBNA 3AEJC 4OT8A 2AY9A 2GMUA 3NRAA 2VIAA 3JZLA 3NYSA 2BI9A 3PPLA 2R5CA 3RI6A 7AATA 5E5IA 2JJEA 3I5TA 2Z9VA 3P6KA 3FZ7A 2V0YA 2BHXA 3AENB 3DC1A 1MLYA 4LW4A 5EAAA 3L44A 3WKSA 2W7GA 4JE5A 3FVSA 3RBLA 5D95A 1YJZA 4IYOA 2CJDA 2BI5A 4LW2A 1ORDA 1W23A 2ZJGA 1WKHA 3BV0A 4ITXA 4JE5D 1IX7A 3ZZKA 2PB2A 2WK9A 2DGMA 4A0RA 1X28A 1AX4A 3A9ZA 2OKJA 2YCPA 1AY4A 4WXGA 4NOGA 3N5MA 3VK2A 3MEBA 4F5FA 3MC6A 2YKXA 4ZM3A 1BT4A 1WYTB 2JISA 5G4JA 1BS0A 2JG2A 2PB0A 2W8WA 1AIBA 3AELA 4Q6RA 1P3WA 1B5OA 1O62A 4F5HA 1IX6A 2D61A 1PFFA 3QI6A 2QB3A 2VGUA 4OBVA 4MSOA 1JS6A 2D7ZA 3MAFB 3PD6B 3B1CA 4EFFA 1TOIA 1CQ8A 1UKJA 4RJYA 1S0AA 5DJ9A 1PMMA 1X0MA 3HBXA 4WP0A 4WBTA 3FQ7A 3NNKA 1LW4A 1IBJA 3BWOA 2W7MA 3FD0A 1AHEA 2ZY2A 3AEJA 2Z67A 1LC8A 3N75A 3GZCA 3WX9A 3EZ1A 2PO3A 1ASBA 2OKKA 2WK8A 3RCHB 1U08A 1ZODA 3RBFA 1AKAA 1IJIA 4ZM4A 3F9TA 1B5PA 1GD9A 2D7YA 4A00A 2AY7A 1W3UA 1AICA 1WYUA 4PFFA 4WD2A 4A6UA 4F5KA 4ZSWA 4AZKA 4GDYA 5EUDA 1BJOB 3BS8A 2EGYA 3NYTA 4PIWA 2BWNA 3MADA 1CS1A 2VMOA 4ADEA 2GMSA 1LC5A 4PVFA 3VOMA 1TOGA 4ADDA 5EUEA 4MQPA 1LC7A 5M49A 3NYUA 4ZDLA 3WKRA 2HUIA 2X8UA 1CQ7A 4EU1A 4RKCA 1LW5A 3T32A 4OMAA 1G4VA 4GSAA 5BJ4A 1M4NA 4B9BA 1MDZA 4K2BA 2AY2A 4A72A 4CXRA 1Y4IA 1GEYA 2C44A 4DGTA 2EO5A 1SFFA 4WYDA 4E1OA 2VI9A 2VMTA 4JF0A 1AY8A 4CVQA 4RAEA 4Y0DA 1GC2A 5EUNA 1C9CA 3WCOA 1SZKA 3FZ6A 4IXOA 3PDBB 3FDDA 4MY5A 2VIBA 5FT5A 1OHYA 4ADCA 2YHKA 3AATA 3R4TA 8AATA 2D63A 3AV7A 4RITA 4ZDOA 2BWPA 3EI6A 2HUUA 3VK4A 5DX5A 1N31A 2ZC0A 5LHAA 4XK1A 1BJ4A 4ZLVA 3QM2A 1YOOA 1ZC9A 2HUFA 3EUCA 3E2ZB 1C7NA 5AX8A 3QGUA 1S07A 2VYCA 4LNMA 1N8PA 4CBSA
chains in the Genus database with same CATH superfamily
4XJLA 5EIGA 1AJSA 2FM1A 1CZEA 3K7YA 2O1BA 2W7KA 4BHDA 1E5EA 1UU0A 2E7JA 1WSTA 4ZSYA 5HHYA 1WKGA 1JS3A 5F9SA 1YJYA 3E9KA 3E6GA 3QHXA 4W8IA 4W1XA 3JW9A 1FG3A 5I92A 1C7OA 2VMYA 1IX8A 1RV4A 1GDEA 2YRIA 3HDOA 4TN4A 4W1WA 2E54A 2ZSLA 3ELEA 2R5CB 4ZASA 5G09A 3FZ8A 1W7LA 2AY4A 3UE8A 1XEYA 3USFA 2JJHA 4Q31A 2O7CA 3F6TA 3LVJA 3PAAA 1MDOA 4U1TA 2CJGA 1V2DA 1KL1A 2ZY5A 4EMYA 3EI7A 2BWOA 1DFOA 1AAMA 1M6SA 2EZ1A 4EB7A 2ZY3A 2CFBA 3KGWA 2VGWA 1C0NA 1ARIA 1MGVA 3L8AA 1TATA 2QMAA 4IYOB 3DYDA 1CQ6A 3NUBA 1ZOBA 3HT4A 4Q75A 1FC4A 5EAVA 5FT4A 1E5FA 1KKJA 1KMJA 1MDXA 1YAAA 1KL2A 4UHNA 1PMOA 3ZRQA 4A0GA 5DB5A 2W8UA 2A1VA 2DOUA 3NUIA 2WK7A 5E3KA 1QISA 2BIEA 1TASA 2VMPA 1S09A 1C7GA 9AATA 1C4KA 3DRDA 1DGDA 2AATA 4HF8A 4I8AA 5DJ1A 3KGXA 2FKIA 3GJUA 2W8TA 1CJ0A 2R5EA 1AIAA 2VMQA 1OXOA 1RVYA 2W7HA 1GC3A 1M0PA 3MKJA 2Z1ZA 1H1CA 2ZP7A 3R9AA 4ADBA 1N2TA 2D5YA 4XAUA 4GRXA 4L0OA 4W91A 2W8VA 2W7DA 3II0A 3B8XA 3COGA 3AEPA 2Q7WA 1CL2A 3OP7A 4W5KA 5EQCA 1ASCA 1DJUA 5F8VA 2X5FA 4RIZA 3E2YA 1ARTA 4BA4A 3Q8NA 1BW0A 3N0LA 1DJ9A 1AAWA 2VMZA 2YKUA 3E2FA 3JWBA 4JEVA 4O6ZA 4IX8A 1QJ5A 1X2AA 3DU4A 4WLHA 1S06A 2HOZA 1WYUB 4IXSA 4DBCA 4F5LA 5C6UA 1B9HA 3HL2A 3D6KA 2QSRA 4XJOA 4DQ6A 4BA5A 2O0RA 3UWCA 4WXBA 3MAUA 1ASGA 3BWNC 3FDBA 4W1VA 2OATA 4OBUA 3B1DA 2HOYA 1X29A 3LV2A 1H0CA 3EIBA 4WB0A 3G7QA 1ASEA 5EFSA 3WZFA 1TPLA 3W1JA 3JU7A 3H7FA 3GWPA 3RQ1A 1ASMA 3GSBA 3NX3A 2QLRA 3UAKA 1AKBA 3GR9A 2D66A 2VLHA 1I29A 3NU8A 1TOKA 1D7VA 1QITA 1W7MA 2QBTA 3W1IA 3WY7A 3N7NA 1VEFA 2D65A 3AEOA 1B9IA 4FFCA 3N4RA 3A8UX 1GEXA 2VMRA 1SZUA 3FVXA 2VGSA 4OTLA 3NDNA 5HXXA 1VP4A 3GZDA 3HVYA 1I48A 2NMPA 1KKPA 1IUGA 1M0QA 4ITGA 1M0OA 5E4ZA 1M7YA 4Q76A 1WYVA 1AY5A 1SZSA 2ZSMA 1J04A 2X3LA 4U2HA 3FFRA 3AOWA 1YNUA 4BMKA 2YOBA 2YRRA 5M4BA 1DKAA 2CSTA 3LY1A 3WLXA 2HP2A 3VK3A 5EIGB 1AJSB 3FCRA 2VMVA 1B8GA 2VMXA 1IAXA 4R5FA 4Y0HA 1V2FA 4E3RA 3BCAA 4ATQA 2F8JA 2JJGA 3IF2A 3KKIA 1AJRA 4ZWMA 3ACZA 2VGVA 1D2FA 3LVMA 1UU1A 2V1PA 3BWNA 3TFUA 1BQDA 3I16A 4M2KA 4LC3A 1LKCA 2C81A 3B1EA 1FG7A 1ASFA 2CANA 2VI8A 4OCAA 4F4EA 2DGKA 3TQXA 3OKSA 4AO4A 1G7WA 1VJOA 3AEMC 3ASBA 2EH6A 2TPLA 2VGZA 1BQAA 3ATHA 2ORDA 1AMAA 1BJWA 2JGTA 4ISYA 4WYGA 4F5JA 1LS3A 1ELQA 3EIAA 2D64A 4H63Q 1UU2A 4J5UA 1YIZA 4N0BA 1YIYA 2C7TA 1LK9A 1SPAA 1DGEA 5LH9A 2JJFA 4QGRA 3EI9A 1GEWA 2YKVA 4WLJA 4A6RA 2ZUKA 2AY3A 4A0HA 2DKJA 4ATPA 3TATA 2XBNA 3JWAA 1AMRA 1I41A 3ASAA 3A2BA 2AY8A 2FYFA 3EI8A 1MLZA 4XEWA 3W1HA 3CAIA 4KXKA 2GSAA 1D7SA 2AEVA 3QPGA 4RLGA 1ELUA 3ECDA 1MAPA 5FT8A 1AHXA 1BKGA 2CY8A 1JG8A 2KFPA 5KTBA 2HZPA 2Z9XA 2Z1YA 2VMSA 4KAMA 3CQ5A 2R2NA 3FTBA 4R2NA 4RKDA 3LVLB 1CL1A 1CZCA 1M0NA 4XJPA 4AO9A 4CXQA 3N4XA 3GBXA 3FRKA 2G7JA 3PA9A 2CB1A 4CBRA 1DTYA 3HLMA 2GB3A 1MAQA 3BN1A 4F5MA 1OXPA 1BJNA 1V2EA 4AZJA 4XQ2A 2Z9WA 2W7EA 3NU7A 1O69A 3B46A 2GQNA 1O4SA 1AKCA 2BIGA 3DXVA 4J8LA 1XI9A 2CJHA 3BB8A 1Z3ZA 5D5SA 5G2PA 2Z9UA 4GE9A 5TF5A 4A0FA 3GZDC 3PGYA 4MQQA 3VP6A 4GE7A 1ASDA 3DZZA 3AENA 4K2MA 1DJEA 3AEMA 1ARHA 1QJ3A 3H14A 1AMSA 1B4XA 1G4XA 4B98A 3ZZJA 4AOAA 3BCXA 1IVRA 2WKAA 3KE3A 3H9XA 1EQBA 2AY5A 3CQ6A 4R8DA 3WCNA 4F5IA 3FFHA 2FQ6A 4JEXA 4TMRA 2CTZA 3DODA 3LWSA 1GCKA 2DGLA 4WB0B 1JF9A 1W7NA 2OQXA 3A9YA 4M2MA 3G8MA 1GC0A 4K2IA 1WYTA 3FVUA 2ZY4A 3ELPA 4IXZA 2W7IA 1OHVA 2RFVA 3DR7A 2FN6A 4UOYA 2ZYJA 4ZWVA 2AY1A 1SVVA 2YKYA 3TFTA 4UHMA 4M2JA 4P3MA 1AMQA 3CQ4A 2Z61A 3MAFA 3PD6A 4LNLA 4OC9A 2AEUA 5JAYA 5J8QA 4WYCA 1YJSA 2BI2A 4JF1A 4WYAA 2EZ2A 5G0AA 4A6TA 2VGTA 5IWQA 2CH1A 4MKKA 1RVUA 3DXWA 3IHJA 3LG0A 1S08A 1WYVB 4LNJA 2XH1A 4MQRA 3E77A 4WYFA 2BYLA 3WGCA 3RCHA 1TOJA 1GC4A 1J32A 3P1TA 1QGNA 2EPJA 3G0TA 2VLFA 1RV3A 2YCNA 3JTXA 2QB2A 2E7UA 1ASLA 1BJOA 2BI3A 3QBOA 2VMWA 4AH3A 3TCMA 2CH2A 1OHWA 2QA3A 4E3QA 4OYTA 3QN6A 2DKBA 2FNUA 3FQAA 4H51A 1AHGA 4MGRA 4N0WA 3BCBA 4TV7A 2W7LA 4F5GA 2BI1A 1AHYA 1TOEA 3DR4A 4UQVA 2HP1A 1EG5A 3GETA 5G4IA 2W8JA 1ASNA 4MKJA 3CBFA 3EI5A 3AOVA 4ZDPA 2W7JA 4E77A 1QIRA 4IW7A 1M32A 3PDXA 3ISLA 2AY6A 3FSLA 1T3IA 2X5DA 3HQTA 3PIUA 4WYEA 5HDMA 1D7UA 2OGAA 1I43A 3PDBA 4P7YA 4IY7A 4GEBA 2YCTA 4ZAHA 2E7IA 1ASAA 5M46A 1V72A 5G2QA 2C0RA 3VAXA 2EYQA 5K8BA 2HOXA 3NTJA 3WGBA 4BQ0A 1Z7DA 2FNIA 1G7XA 1SF2A 1IAYA 2VMUA 1ECXA 3MC6C 4Y0IA 3RUYA 3PJ0A 2HORA 1KMKA 4JEYA 1QZ9A 3K40A 3EZSA 4HVKA 2Z20A 3K28A 4WXFA 4R5ZA 4JEZA 3E2ZA 4UHOA 4FL0A 3I4JA 1EJIA 2DR1A 2BYJA 1OATA 2BIAA 1TARA 2CINA 3LVKA 2G6WA 5BJ3A 3FKDA 5M4DA 1ARGA 4PFNA 3MBBA 4XJMA 4EB5A 5FT6A 3BC8A 4GE4A 3FQ8A 1D7RA 1O61A 1AHFA 3HMUA 2R0TA 3M5UA 3ZRRA 4KYOA 2BKWA 2OGEA 1ARSA 3A9XA 4RM1A 3F0HA 1PG8A 4JEWA 2W7FA 3ZRPA 2WB6A 4RJ0A 2VMNA 1GBNA 3AEJC 4OT8A 2AY9A 2GMUA 3NRAA 2VIAA 3JZLA 3NYSA 2BI9A 3PPLA 2R5CA 3RI6A 7AATA 5E5IA 2JJEA 3I5TA 2Z9VA 3P6KA 3FZ7A 2V0YA 2BHXA 3AENB 3DC1A 1MLYA 4LW4A 5EAAA 3L44A 3WKSA 2W7GA 4JE5A 3FVSA 3RBLA 5D95A 1YJZA 4IYOA 2CJDA 2BI5A 4LW2A 1ORDA 1W23A 2ZJGA 1WKHA 3BV0A 4ITXA 4JE5D 1IX7A 3ZZKA 2PB2A 2WK9A 2DGMA 4A0RA 1X28A 1AX4A 3A9ZA 2OKJA 2YCPA 1AY4A 4WXGA 4NOGA 3N5MA 3VK2A 3MEBA 4F5FA 3MC6A 2YKXA 4ZM3A 1BT4A 1WYTB 2JISA 5G4JA 1BS0A 2JG2A 2PB0A 2W8WA 1AIBA 3AELA 4Q6RA 1P3WA 1B5OA 1O62A 4F5HA 1IX6A 2D61A 1PFFA 3QI6A 2QB3A 2VGUA 4OBVA 4MSOA 1JS6A 2D7ZA 3MAFB 3PD6B 3B1CA 4EFFA 1TOIA 1CQ8A 1UKJA 4RJYA 1S0AA 5DJ9A 1PMMA 1X0MA 3HBXA 4WP0A 4WBTA 3FQ7A 3NNKA 1LW4A 1IBJA 3BWOA 2W7MA 3FD0A 1AHEA 2ZY2A 3AEJA 2Z67A 1LC8A 3N75A 3GZCA 3WX9A 3EZ1A 2PO3A 1ASBA 2OKKA 2WK8A 3RCHB 1U08A 1ZODA 3RBFA 1AKAA 1IJIA 4ZM4A 3F9TA 1B5PA 1GD9A 2D7YA 4A00A 2AY7A 1W3UA 1AICA 1WYUA 4PFFA 4WD2A 4A6UA 4F5KA 4ZSWA 4AZKA 4GDYA 5EUDA 1BJOB 3BS8A 2EGYA 3NYTA 4PIWA 2BWNA 3MADA 1CS1A 2VMOA 4ADEA 2GMSA 1LC5A 4PVFA 3VOMA 1TOGA 4ADDA 5EUEA 4MQPA 1LC7A 5M49A 3NYUA 4ZDLA 3WKRA 2HUIA 2X8UA 1CQ7A 4EU1A 4RKCA 1LW5A 3T32A 4OMAA 1G4VA 4GSAA 5BJ4A 1M4NA 4B9BA 1MDZA 4K2BA 2AY2A 4A72A 4CXRA 4K05A 1Y4IA 1GEYA 2C44A 4DGTA 2EO5A 1SFFA 4WYDA 4E1OA 2VI9A 2VMTA 4JF0A 1AY8A 4CVQA 4RAEA 4Y0DA 1GC2A 5EUNA 1C9CA 3WCOA 1SZKA 3FZ6A 4IXOA 3PDBB 3FDDA 4MY5A 2VIBA 5FT5A 1OHYA 4ADCA 2YHKA 3AATA 3R4TA 8AATA 2D63A 3AV7A 4RITA 4ZDOA 2BWPA 3EI6A 2HUUA 3VK4A 5DX5A 1N31A 2ZC0A 5LHAA 4XK1A 1BJ4A 4ZLVA 1KAFA 3QM2A 1YOOA 1ZC9A 2HUFA 3EUCA 3E2ZB 1C7NA 5AX8A 3QGUA 1S07A 2VYCA 4LNMA 1N8PA 3N4SA 4CBSA
chains in the Genus database with same CATH topology
4XJLA 5EIGA 1AJSA 2FM1A 1CZEA 3K7YA 2O1BA 2W7KA 4BHDA 1E5EA 1UU0A 2E7JA 1WSTA 4ZSYA 5HHYA 1WKGA 1JS3A 5F9SA 1YJYA 3E9KA 3E6GA 3QHXA 4W8IA 4W1XA 3JW9A 1FG3A 5I92A 1C7OA 2VMYA 1IX8A 1RV4A 1GDEA 2YRIA 3HDOA 4TN4A 4W1WA 2E54A 2ZSLA 3ELEA 2R5CB 4ZASA 5G09A 3FZ8A 1W7LA 2AY4A 3UE8A 1XEYA 3USFA 2JJHA 4Q31A 2O7CA 3F6TA 3LVJA 3PAAA 1MDOA 4U1TA 2CJGA 1V2DA 1KL1A 2ZY5A 4EMYA 3EI7A 2BWOA 1DFOA 1AAMA 1M6SA 2EZ1A 4EB7A 2ZY3A 2CFBA 3KGWA 2VGWA 1C0NA 1ARIA 1MGVA 3L8AA 1TATA 2QMAA 4IYOB 3DYDA 1CQ6A 3NUBA 1ZOBA 3HT4A 4Q75A 1FC4A 5EAVA 5FT4A 1E5FA 1KKJA 1KMJA 1MDXA 1YAAA 1KL2A 4UHNA 1PMOA 3ZRQA 4A0GA 5DB5A 2W8UA 2A1VA 2DOUA 3NUIA 2WK7A 5E3KA 1QISA 2BIEA 1TASA 2VMPA 1S09A 1C7GA 9AATA 1C4KA 3DRDA 1DGDA 2AATA 4HF8A 4I8AA 5DJ1A 3KGXA 2FKIA 3GJUA 2W8TA 1CJ0A 2R5EA 1AIAA 2VMQA 1OXOA 1RVYA 2W7HA 1GC3A 1M0PA 3MKJA 2Z1ZA 1H1CA 2ZP7A 3R9AA 4ADBA 1N2TA 2D5YA 4XAUA 4GRXA 4L0OA 4W91A 2W8VA 2W7DA 3II0A 3B8XA 3COGA 3AEPA 2Q7WA 1CL2A 3OP7A 4W5KA 5EQCA 1ASCA 1DJUA 5F8VA 2X5FA 4RIZA 3E2YA 1ARTA 4BA4A 3Q8NA 1BW0A 3N0LA 1DJ9A 1AAWA 2VMZA 2YKUA 3E2FA 3JWBA 4JEVA 4O6ZA 4IX8A 1QJ5A 1X2AA 3DU4A 4WLHA 1S06A 2HOZA 1WYUB 4IXSA 4DBCA 4F5LA 5C6UA 1B9HA 3HL2A 3D6KA 2QSRA 4XJOA 4DQ6A 4BA5A 2O0RA 3UWCA 4WXBA 3MAUA 1ASGA 3BWNC 3FDBA 4W1VA 2OATA 4OBUA 3B1DA 2HOYA 1X29A 3LV2A 1H0CA 3EIBA 4WB0A 3G7QA 1ASEA 5EFSA 3WZFA 1TPLA 3W1JA 3JU7A 3H7FA 3GWPA 3RQ1A 1ASMA 3GSBA 3NX3A 2QLRA 3UAKA 1AKBA 3GR9A 2D66A 2VLHA 1I29A 3NU8A 1TOKA 1D7VA 1QITA 1W7MA 2QBTA 3W1IA 3WY7A 3N7NA 1VEFA 2D65A 3AEOA 1B9IA 4FFCA 3N4RA 3A8UX 1GEXA 2VMRA 1SZUA 3FVXA 2VGSA 4OTLA 3NDNA 5HXXA 1VP4A 3GZDA 3HVYA 1I48A 2NMPA 1KKPA 1IUGA 1M0QA 4ITGA 1M0OA 5E4ZA 1M7YA 4Q76A 1WYVA 1AY5A 1SZSA 2ZSMA 1J04A 2X3LA 4U2HA 3FFRA 3AOWA 1YNUA 4BMKA 2YOBA 2YRRA 5M4BA 1DKAA 2CSTA 3LY1A 3WLXA 2HP2A 3VK3A 5EIGB 1AJSB 3FCRA 2VMVA 1B8GA 2VMXA 1IAXA 4R5FA 4Y0HA 1V2FA 4E3RA 3BCAA 4ATQA 2F8JA 2JJGA 3IF2A 3KKIA 1AJRA 4ZWMA 3ACZA 2VGVA 1D2FA 3LVMA 1UU1A 2V1PA 3BWNA 3TFUA 1BQDA 3I16A 4M2KA 4LC3A 1LKCA 2C81A 3B1EA 1FG7A 1ASFA 2CANA 2VI8A 4OCAA 4F4EA 2DGKA 3TQXA 3OKSA 4AO4A 1G7WA 1VJOA 3AEMC 3ASBA 2EH6A 2TPLA 2VGZA 1BQAA 3ATHA 2ORDA 1AMAA 1BJWA 2JGTA 4ISYA 4WYGA 4F5JA 1LS3A 1ELQA 3EIAA 2D64A 4H63Q 1UU2A 4J5UA 1YIZA 4N0BA 1YIYA 2C7TA 1LK9A 1SPAA 1DGEA 5LH9A 2JJFA 4QGRA 3EI9A 1GEWA 2YKVA 4WLJA 4A6RA 2ZUKA 2AY3A 4A0HA 2DKJA 4ATPA 3TATA 2XBNA 3JWAA 1AMRA 1I41A 3ASAA 3A2BA 2AY8A 2FYFA 3EI8A 1MLZA 4XEWA 3W1HA 3CAIA 4KXKA 2GSAA 1D7SA 2AEVA 3QPGA 4RLGA 1ELUA 3ECDA 1MAPA 5FT8A 1AHXA 1BKGA 2CY8A 1JG8A 2KFPA 5KTBA 2HZPA 2Z9XA 2Z1YA 2VMSA 4KAMA 3CQ5A 2R2NA 3FTBA 4R2NA 4RKDA 3LVLB 1CL1A 1CZCA 1M0NA 4XJPA 4AO9A 4CXQA 3N4XA 3GBXA 3FRKA 2G7JA 3PA9A 2CB1A 4CBRA 1DTYA 3HLMA 2GB3A 1MAQA 3BN1A 4F5MA 1OXPA 1BJNA 1V2EA 4AZJA 4XQ2A 2Z9WA 2W7EA 3NU7A 1O69A 3B46A 2GQNA 1O4SA 1AKCA 2BIGA 3DXVA 4J8LA 1XI9A 2CJHA 3BB8A 1Z3ZA 5D5SA 5G2PA 2Z9UA 4GE9A 5TF5A 4A0FA 3GZDC 3PGYA 4MQQA 3VP6A 4GE7A 1ASDA 3DZZA 3AENA 4K2MA 1DJEA 3AEMA 1ARHA 1QJ3A 3H14A 1AMSA 1B4XA 1G4XA 4B98A 3ZZJA 4AOAA 3BCXA 1IVRA 2WKAA 3KE3A 3H9XA 1EQBA 2AY5A 3CQ6A 4R8DA 3WCNA 4F5IA 3FFHA 2FQ6A 4JEXA 4TMRA 2CTZA 3DODA 3LWSA 1GCKA 2DGLA 4WB0B 1JF9A 1W7NA 2OQXA 3A9YA 4M2MA 3G8MA 1GC0A 4K2IA 1WYTA 3FVUA 2ZY4A 3ELPA 4IXZA 2W7IA 1OHVA 2RFVA 3DR7A 2FN6A 4UOYA 2ZYJA 4ZWVA 2AY1A 1SVVA 2YKYA 3TFTA 4UHMA 4M2JA 4P3MA 1AMQA 3CQ4A 2Z61A 3MAFA 3PD6A 4LNLA 4OC9A 2AEUA 5JAYA 5J8QA 4WYCA 1YJSA 2BI2A 4JF1A 4WYAA 2EZ2A 5G0AA 4A6TA 2VGTA 5IWQA 2CH1A 4MKKA 1RVUA 3DXWA 3IHJA 3LG0A 1S08A 1WYVB 4LNJA 2XH1A 4MQRA 3E77A 4WYFA 2BYLA 3WGCA 3RCHA 1TOJA 1GC4A 1J32A 3P1TA 1QGNA 2EPJA 3G0TA 2VLFA 1RV3A 2YCNA 3JTXA 2QB2A 2E7UA 1ASLA 1BJOA 2BI3A 3QBOA 2VMWA 4AH3A 3TCMA 2CH2A 1OHWA 2QA3A 4E3QA 4OYTA 3QN6A 2DKBA 2FNUA 3FQAA 4H51A 1AHGA 4MGRA 4N0WA 3BCBA 4TV7A 2W7LA 4F5GA 2BI1A 1AHYA 1TOEA 3DR4A 4UQVA 2HP1A 1EG5A 3GETA 5G4IA 2W8JA 1ASNA 4MKJA 3CBFA 3EI5A 3AOVA 4ZDPA 2W7JA 4E77A 1QIRA 4IW7A 1M32A 3PDXA 3ISLA 2AY6A 3FSLA 1T3IA 2X5DA 3HQTA 3PIUA 4WYEA 5HDMA 1D7UA 2OGAA 1I43A 3PDBA 4P7YA 4IY7A 4GEBA 2YCTA 4ZAHA 2E7IA 1ASAA 5M46A 1V72A 5G2QA 2C0RA 3VAXA 2EYQA 5K8BA 2HOXA 3NTJA 3WGBA 4BQ0A 1Z7DA 2FNIA 1G7XA 1SF2A 1IAYA 2VMUA 1ECXA 3MC6C 4Y0IA 3RUYA 3PJ0A 2HORA 1KMKA 4JEYA 1QZ9A 3K40A 3EZSA 4HVKA 2Z20A 3K28A 4WXFA 4R5ZA 4JEZA 3E2ZA 4UHOA 4FL0A 3I4JA 1EJIA 2DR1A 2BYJA 1OATA 2BIAA 1TARA 2CINA 3LVKA 2G6WA 5BJ3A 3FKDA 5M4DA 1ARGA 4PFNA 3MBBA 4XJMA 4EB5A 5FT6A 3BC8A 4GE4A 3FQ8A 1D7RA 1O61A 1AHFA 3HMUA 2R0TA 3M5UA 3ZRRA 4KYOA 2BKWA 2OGEA 1ARSA 3A9XA 4RM1A 3F0HA 1PG8A 4JEWA 2W7FA 3ZRPA 2WB6A 4RJ0A 2VMNA 1GBNA 3AEJC 4OT8A 2AY9A 2GMUA 3NRAA 2VIAA 3JZLA 3NYSA 2BI9A 3PPLA 2R5CA 3RI6A 7AATA 5E5IA 2JJEA 3I5TA 2Z9VA 3P6KA 3FZ7A 2V0YA 2BHXA 3AENB 3DC1A 1MLYA 4LW4A 5EAAA 3L44A 3WKSA 2W7GA 4JE5A 3FVSA 3RBLA 5D95A 1YJZA 4IYOA 2CJDA 2BI5A 4LW2A 1ORDA 1W23A 2ZJGA 1WKHA 3BV0A 4ITXA 4JE5D 1IX7A 3ZZKA 2PB2A 2WK9A 2DGMA 4A0RA 1X28A 1AX4A 3A9ZA 2OKJA 2YCPA 1AY4A 4WXGA 4NOGA 3N5MA 3VK2A 3MEBA 4F5FA 3MC6A 2YKXA 4ZM3A 1BT4A 1WYTB 2JISA 5G4JA 1BS0A 2JG2A 2PB0A 2W8WA 1AIBA 3AELA 4Q6RA 1P3WA 1B5OA 1O62A 4F5HA 1IX6A 2D61A 1PFFA 3QI6A 2QB3A 2VGUA 4OBVA 4MSOA 1JS6A 2D7ZA 3MAFB 3PD6B 3B1CA 4EFFA 1TOIA 1CQ8A 1UKJA 4RJYA 1S0AA 5DJ9A 1PMMA 1X0MA 3HBXA 4WP0A 4WBTA 3FQ7A 3NNKA 1LW4A 1IBJA 3BWOA 2W7MA 3FD0A 1AHEA 2ZY2A 3AEJA 2Z67A 1LC8A 3N75A 3GZCA 3WX9A 3EZ1A 2PO3A 1ASBA 2OKKA 2WK8A 3RCHB 1U08A 1ZODA 3RBFA 1AKAA 1IJIA 4ZM4A 3F9TA 1B5PA 1GD9A 2D7YA 4A00A 2AY7A 1W3UA 1AICA 1WYUA 4PFFA 4WD2A 4A6UA 4F5KA 4ZSWA 4AZKA 4GDYA 5EUDA 1BJOB 3BS8A 2EGYA 3NYTA 4PIWA 2BWNA 3MADA 1CS1A 2VMOA 4ADEA 2GMSA 1LC5A 4PVFA 3VOMA 1TOGA 4ADDA 5EUEA 4MQPA 1LC7A 5M49A 3NYUA 4ZDLA 3WKRA 2HUIA 2X8UA 1CQ7A 4EU1A 4RKCA 1LW5A 3T32A 4OMAA 1G4VA 4GSAA 5BJ4A 1M4NA 4B9BA 1MDZA 4K2BA 2AY2A 4A72A 4CXRA 4K05A 1Y4IA 1GEYA 2C44A 4DGTA 2EO5A 1SFFA 4WYDA 4E1OA 2VI9A 2VMTA 4JF0A 1AY8A 4CVQA 4RAEA 4Y0DA 1GC2A 5EUNA 1C9CA 3WCOA 1SZKA 3FZ6A 4IXOA 3PDBB 3FDDA 4MY5A 2VIBA 5FT5A 1OHYA 4ADCA 2YHKA 3AATA 3R4TA 8AATA 2D63A 3AV7A 4RITA 4ZDOA 2BWPA 3EI6A 2HUUA 3VK4A 5DX5A 1N31A 2ZC0A 5LHAA 4XK1A 1BJ4A 4ZLVA 3QM2A 1YOOA 1ZC9A 2HUFA 3EUCA 3E2ZB 1C7NA 5AX8A 3QGUA 1S07A 2VYCA 4LNMA 1N8PA 3N4SA 4CBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJL A;  5EIG A;  1AJS A;  2FM1 A;  1CZE A;  3K7Y A;  2O1B A;  2W7K A;  4BHD A;  1E5E A;  1UU0 A;  2E7J A;  1WST A;  4ZSY A;  5HHY A;  1WKG A;  1JS3 A;  5F9S A;  1YJY A;  3E9K A;  3E6G A;  3QHX A;  4W8I A;  4W1X A;  3JW9 A;  1FG3 A;  5I92 A;  1C7O A;  2VMY A;  1IX8 A;  1RV4 A;  1GDE A;  2YRI A;  3HDO A;  4TN4 A;  4W1W A;  2E54 A;  2ZSL A;  3ELE A;  2R5C B;  4ZAS A;  5G09 A;  3FZ8 A;  1W7L A;  2AY4 A;  3UE8 A;  1XEY A;  3USF A;  2JJH A;  4Q31 A;  2O7C A;  3F6T A;  3LVJ A;  3PAA A;  1MDO A;  4U1T A;  2CJG A;  1V2D A;  1KL1 A;  2ZY5 A;  4EMY A;  3EI7 A;  2BWO A;  1DFO A;  1AAM A;  1M6S A;  2EZ1 A;  4EB7 A;  2ZY3 A;  2CFB A;  3KGW A;  2VGW A;  1C0N A;  1ARI A;  1MGV A;  3L8A A;  1TAT A;  2QMA A;  4IYO B;  3DYD A;  1CQ6 A;  3NUB A;  1ZOB A;  3HT4 A;  4Q75 A;  1FC4 A;  5EAV A;  5FT4 A;  1E5F A;  1KKJ A;  1KMJ A;  1MDX A;  1YAA A;  1KL2 A;  4UHN A;  1PMO A;  3ZRQ A;  4A0G A;  5DB5 A;  2W8U A;  2DOU A;  3NUI A;  2WK7 A;  5E3K A;  1QIS A;  2BIE A;  1TAS A;  2VMP A;  1S09 A;  1C7G A;  9AAT A;  1C4K A;  3DRD A;  1DGD A;  2AAT A;  4HF8 A;  4I8A A;  5DJ1 A;  3KGX A;  3GJU A;  2W8T A;  1CJ0 A;  2R5E A;  1AIA A;  2VMQ A;  1OXO A;  1RVY A;  2W7H A;  1GC3 A;  1M0P A;  3MKJ A;  2Z1Z A;  1H1C A;  2ZP7 A;  3R9A A;  4ADB A;  1N2T A;  2D5Y A;  4XAU A;  4GRX A;  4L0O A;  4W91 A;  2W8V A;  2W7D A;  3II0 A;  3B8X A;  3COG A;  3AEP A;  2Q7W A;  1CL2 A;  3OP7 A;  4W5K A;  5EQC A;  1ASC A;  1DJU A;  5F8V A;  2X5F A;  4RIZ A;  3E2Y A;  1ART A;  4BA4 A;  3Q8N A;  1BW0 A;  3N0L A;  1DJ9 A;  1AAW A;  2VMZ A;  2YKU A;  3E2F A;  3JWB A;  4JEV A;  4O6Z A;  4IX8 A;  1QJ5 A;  1X2A A;  3DU4 A;  4WLH A;  1S06 A;  2HOZ A;  1WYU B;  4IXS A;  4DBC A;  4F5L A;  5C6U A;  1B9H A;  3HL2 A;  3D6K A;  4XJO A;  4DQ6 A;  4BA5 A;  2O0R A;  3UWC A;  4WXB A;  3MAU A;  1ASG A;  3BWN C;  3FDB A;  4W1V A;  2OAT A;  4OBU A;  3B1D A;  2HOY A;  1X29 A;  3LV2 A;  1H0C A;  3EIB A;  4WB0 A;  3G7Q A;  1ASE A;  5EFS A;  3WZF A;  1TPL A;  3W1J A;  3JU7 A;  3H7F A;  3GWP A;  3RQ1 A;  1ASM A;  3GSB A;  3NX3 A;  2QLR A;  3UAK A;  1AKB A;  3GR9 A;  2D66 A;  2VLH A;  1I29 A;  3NU8 A;  1TOK A;  1D7V A;  1QIT A;  1W7M A;  2QBT A;  3W1I A;  3WY7 A;  1VEF A;  2D65 A;  3AEO A;  1B9I A;  4FFC A;  3A8U X;  1GEX A;  2VMR A;  1SZU A;  3FVX A;  2VGS A;  4OTL A;  3NDN A;  5HXX A;  1VP4 A;  3GZD A;  3HVY A;  1I48 A;  2NMP A;  1KKP A;  1IUG A;  1M0Q A;  4ITG A;  1M0O A;  5E4Z A;  1M7Y A;  4Q76 A;  1WYV A;  1AY5 A;  1SZS A;  2ZSM A;  1J04 A;  2X3L A;  4U2H A;  3FFR A;  3AOW A;  1YNU A;  4BMK A;  2YOB A;  2YRR A;  5M4B A;  1DKA A;  2CST A;  3LY1 A;  3WLX A;  2HP2 A;  3VK3 A;  5EIG B;  1AJS B;  3FCR A;  2VMV A;  1B8G A;  2VMX A;  1IAX A;  4R5F A;  4Y0H A;  1V2F A;  4E3R A;  3BCA A;  4ATQ A;  2F8J A;  2JJG A;  3IF2 A;  3KKI A;  1AJR A;  4ZWM A;  3ACZ A;  2VGV A;  1D2F A;  3LVM A;  1UU1 A;  2V1P A;  3BWN A;  3TFU A;  1BQD A;  3I16 A;  4M2K A;  4LC3 A;  1LKC A;  2C81 A;  3B1E A;  1FG7 A;  1ASF A;  2CAN A;  2VI8 A;  4OCA A;  4F4E A;  2DGK A;  3TQX A;  3OKS A;  4AO4 A;  1G7W A;  1VJO A;  3AEM C;  3ASB A;  2EH6 A;  2TPL A;  2VGZ A;  1BQA A;  3ATH A;  2ORD A;  1AMA A;  1BJW A;  2JGT A;  4ISY A;  4WYG A;  4F5J A;  1LS3 A;  1ELQ A;  3EIA A;  2D64 A;  1UU2 A;  4J5U A;  1YIZ A;  4N0B A;  1YIY A;  2C7T A;  1LK9 A;  1SPA A;  1DGE A;  5LH9 A;  2JJF A;  4QGR A;  3EI9 A;  1GEW A;  2YKV A;  4WLJ A;  4A6R A;  2ZUK A;  2AY3 A;  4A0H A;  2DKJ A;  4ATP A;  3TAT A;  2XBN A;  3JWA A;  1AMR A;  1I41 A;  3ASA A;  3A2B A;  2AY8 A;  2FYF A;  3EI8 A;  1MLZ A;  4XEW A;  3W1H A;  3CAI A;  4KXK A;  2GSA A;  1D7S A;  2AEV A;  3QPG A;  4RLG A;  1ELU A;  3ECD A;  1MAP A;  5FT8 A;  1AHX A;  1BKG A;  2CY8 A;  1JG8 A;  2HZP A;  2Z9X A;  2Z1Y A;  2VMS A;  4KAM A;  3CQ5 A;  2R2N A;  3FTB A;  4R2N A;  4RKD A;  3LVL B;  1CL1 A;  1CZC A;  1M0N A;  4XJP A;  4AO9 A;  4CXQ A;  3GBX A;  3FRK A;  3PA9 A;  2CB1 A;  4CBR A;  1DTY A;  3HLM A;  2GB3 A;  1MAQ A;  3BN1 A;  4F5M A;  1OXP A;  1BJN A;  1V2E A;  4AZJ A;  4XQ2 A;  2Z9W A;  2W7E A;  3NU7 A;  1O69 A;  3B46 A;  2GQN A;  1O4S A;  1AKC A;  2BIG A;  3DXV A;  4J8L A;  1XI9 A;  2CJH A;  3BB8 A;  1Z3Z A;  5D5S A;  5G2P A;  2Z9U A;  4GE9 A;  5TF5 A;  4A0F A;  3GZD C;  3PGY A;  4MQQ A;  3VP6 A;  4GE7 A;  1ASD A;  3DZZ A;  3AEN A;  4K2M A;  1DJE A;  3AEM A;  1ARH A;  1QJ3 A;  3H14 A;  1AMS A;  1B4X A;  1G4X A;  4B98 A;  3ZZJ A;  4AOA A;  3BCX A;  1IVR A;  2WKA A;  3KE3 A;  1EQB A;  2AY5 A;  3CQ6 A;  4R8D A;  3WCN A;  4F5I A;  3FFH A;  2FQ6 A;  4JEX A;  4TMR A;  2CTZ A;  3DOD A;  3LWS A;  1GCK A;  2DGL A;  4WB0 B;  1JF9 A;  1W7N A;  2OQX A;  3A9Y A;  4M2M A;  3G8M A;  1GC0 A;  4K2I A;  1WYT A;  3FVU A;  2ZY4 A;  3ELP A;  4IXZ A;  2W7I A;  1OHV A;  2RFV A;  3DR7 A;  2FN6 A;  4UOY A;  2ZYJ A;  4ZWV A;  2AY1 A;  1SVV A;  2YKY A;  3TFT A;  4UHM A;  4M2J A;  4P3M A;  1AMQ A;  3CQ4 A;  2Z61 A;  3MAF A;  3PD6 A;  4LNL A;  4OC9 A;  2AEU A;  5JAY A;  5J8Q A;  4WYC A;  1YJS A;  2BI2 A;  4JF1 A;  4WYA A;  2EZ2 A;  5G0A A;  4A6T A;  2VGT A;  5IWQ A;  2CH1 A;  4MKK A;  1RVU A;  3DXW A;  3IHJ A;  3LG0 A;  1S08 A;  1WYV B;  4LNJ A;  2XH1 A;  4MQR A;  3E77 A;  4WYF A;  2BYL A;  3WGC A;  3RCH A;  1TOJ A;  1GC4 A;  1J32 A;  3P1T A;  1QGN A;  2EPJ A;  3G0T A;  2VLF A;  1RV3 A;  2YCN A;  3JTX A;  2QB2 A;  2E7U A;  1ASL A;  1BJO A;  2BI3 A;  3QBO A;  2VMW A;  4AH3 A;  3TCM A;  2CH2 A;  1OHW A;  2QA3 A;  4E3Q A;  4OYT A;  3QN6 A;  2DKB A;  2FNU A;  3FQA A;  4H51 A;  1AHG A;  4MGR A;  4N0W A;  3BCB A;  4TV7 A;  2W7L A;  4F5G A;  2BI1 A;  1AHY A;  1TOE A;  3DR4 A;  4UQV A;  2HP1 A;  1EG5 A;  3GET A;  5G4I A;  2W8J A;  1ASN A;  4MKJ A;  3CBF A;  3EI5 A;  3AOV A;  4ZDP A;  2W7J A;  4E77 A;  1QIR A;  4IW7 A;  1M32 A;  3PDX A;  3ISL A;  2AY6 A;  3FSL A;  1T3I A;  2X5D A;  3HQT A;  3PIU A;  4WYE A;  5HDM A;  1D7U A;  2OGA A;  1I43 A;  3PDB A;  4P7Y A;  4IY7 A;  4GEB A;  2YCT A;  4ZAH A;  2E7I A;  1ASA A;  5M46 A;  1V72 A;  5G2Q A;  2C0R A;  3VAX A;  5K8B A;  2HOX A;  3NTJ A;  3WGB A;  4BQ0 A;  1Z7D A;  2FNI A;  1G7X A;  1SF2 A;  1IAY A;  2VMU A;  1ECX A;  3MC6 C;  4Y0I A;  3RUY A;  3PJ0 A;  2HOR A;  1KMK A;  4JEY A;  1QZ9 A;  3K40 A;  3EZS A;  4HVK A;  2Z20 A;  3K28 A;  4WXF A;  4R5Z A;  4JEZ A;  3E2Z A;  4UHO A;  4FL0 A;  3I4J A;  1EJI A;  2DR1 A;  2BYJ A;  1OAT A;  2BIA A;  1TAR A;  2CIN A;  3LVK A;  2G6W A;  5BJ3 A;  3FKD A;  5M4D A;  1ARG A;  4PFN A;  3MBB A;  4XJM A;  4EB5 A;  5FT6 A;  3BC8 A;  4GE4 A;  3FQ8 A;  1D7R A;  1O61 A;  1AHF A;  3HMU A;  2R0T A;  3M5U A;  3ZRR A;  4KYO A;  2BKW A;  2OGE A;  1ARS A;  3A9X A;  4RM1 A;  3F0H A;  1PG8 A;  4JEW A;  2W7F A;  3ZRP A;  4RJ0 A;  2VMN A;  1GBN A;  3AEJ C;  4OT8 A;  2AY9 A;  2GMU A;  3NRA A;  2VIA A;  3JZL A;  3NYS A;  2BI9 A;  3PPL A;  2R5C A;  3RI6 A;  7AAT A;  5E5I A;  2JJE A;  3I5T A;  2Z9V A;  3P6K A;  3FZ7 A;  2V0Y A;  2BHX A;  3AEN B;  3DC1 A;  1MLY A;  4LW4 A;  5EAA A;  3L44 A;  3WKS A;  2W7G A;  4JE5 A;  3FVS A;  3RBL A;  5D95 A;  1YJZ A;  4IYO A;  2CJD A;  2BI5 A;  4LW2 A;  1ORD A;  1W23 A;  2ZJG A;  1WKH A;  3BV0 A;  4ITX A;  4JE5 D;  1IX7 A;  3ZZK A;  2PB2 A;  2WK9 A;  2DGM A;  4A0R A;  1X28 A;  1AX4 A;  3A9Z A;  2OKJ A;  2YCP A;  1AY4 A;  4WXG A;  4NOG A;  3N5M A;  3VK2 A;  3MEB A;  4F5F A;  3MC6 A;  2YKX A;  4ZM3 A;  1BT4 A;  1WYT B;  2JIS A;  5G4J A;  1BS0 A;  2JG2 A;  2PB0 A;  2W8W A;  1AIB A;  3AEL A;  4Q6R A;  1P3W A;  1B5O A;  1O62 A;  4F5H A;  1IX6 A;  2D61 A;  1PFF A;  3QI6 A;  2QB3 A;  2VGU A;  4OBV A;  4MSO A;  1JS6 A;  2D7Z A;  3MAF B;  3PD6 B;  3B1C A;  4EFF A;  1TOI A;  1CQ8 A;  1UKJ A;  4RJY A;  1S0A A;  5DJ9 A;  1PMM A;  1X0M A;  3HBX A;  4WP0 A;  4WBT A;  3FQ7 A;  3NNK A;  1LW4 A;  1IBJ A;  3BWO A;  2W7M A;  3FD0 A;  1AHE A;  2ZY2 A;  3AEJ A;  2Z67 A;  1LC8 A;  3N75 A;  3GZC A;  3WX9 A;  3EZ1 A;  2PO3 A;  1ASB A;  2OKK A;  2WK8 A;  3RCH B;  1U08 A;  1ZOD A;  3RBF A;  1AKA A;  1IJI A;  4ZM4 A;  3F9T A;  1B5P A;  1GD9 A;  2D7Y A;  4A00 A;  2AY7 A;  1W3U A;  1AIC A;  1WYU A;  4PFF A;  4WD2 A;  4A6U A;  4F5K A;  4ZSW A;  4AZK A;  4GDY A;  5EUD A;  1BJO B;  3BS8 A;  2EGY A;  3NYT A;  4PIW A;  2BWN A;  3MAD A;  1CS1 A;  2VMO A;  4ADE A;  2GMS A;  1LC5 A;  4PVF A;  3VOM A;  1TOG A;  4ADD A;  5EUE A;  4MQP A;  1LC7 A;  5M49 A;  3NYU A;  4ZDL A;  3WKR A;  2HUI A;  2X8U A;  1CQ7 A;  4EU1 A;  4RKC A;  1LW5 A;  3T32 A;  4OMA A;  1G4V A;  4GSA A;  5BJ4 A;  1M4N A;  4B9B A;  1MDZ A;  4K2B A;  2AY2 A;  4A72 A;  4CXR A;  1Y4I A;  1GEY A;  2C44 A;  4DGT A;  2EO5 A;  1SFF A;  4WYD A;  4E1O A;  2VI9 A;  2VMT A;  4JF0 A;  1AY8 A;  4CVQ A;  4RAE A;  4Y0D A;  1GC2 A;  5EUN A;  1C9C A;  3WCO A;  1SZK A;  3FZ6 A;  4IXO A;  3PDB B;  3FDD A;  4MY5 A;  2VIB A;  5FT5 A;  1OHY A;  4ADC A;  2YHK A;  3AAT A;  3R4T A;  8AAT A;  2D63 A;  3AV7 A;  4RIT A;  4ZDO A;  2BWP A;  3EI6 A;  2HUU A;  3VK4 A;  5DX5 A;  1N31 A;  2ZC0 A;  5LHA A;  4XK1 A;  1BJ4 A;  4ZLV A;  3QM2 A;  1YOO A;  1ZC9 A;  2HUF A;  3EUC A;  3E2Z B;  1C7N A;  5AX8 A;  3QGU A;  1S07 A;  2VYC A;  4LNM A;  1N8P A;  4CBS A; 
#chains in the Genus database with same CATH topology
 4XJL A;  5EIG A;  1AJS A;  2FM1 A;  1CZE A;  3K7Y A;  2O1B A;  2W7K A;  4BHD A;  1E5E A;  1UU0 A;  2E7J A;  1WST A;  4ZSY A;  5HHY A;  1WKG A;  1JS3 A;  5F9S A;  1YJY A;  3E9K A;  3E6G A;  3QHX A;  4W8I A;  4W1X A;  3JW9 A;  1FG3 A;  5I92 A;  1C7O A;  2VMY A;  1IX8 A;  1RV4 A;  1GDE A;  2YRI A;  3HDO A;  4TN4 A;  4W1W A;  2E54 A;  2ZSL A;  3ELE A;  2R5C B;  4ZAS A;  5G09 A;  3FZ8 A;  1W7L A;  2AY4 A;  3UE8 A;  1XEY A;  3USF A;  2JJH A;  4Q31 A;  2O7C A;  3F6T A;  3LVJ A;  3PAA A;  1MDO A;  4U1T A;  2CJG A;  1V2D A;  1KL1 A;  2ZY5 A;  4EMY A;  3EI7 A;  2BWO A;  1DFO A;  1AAM A;  1M6S A;  2EZ1 A;  4EB7 A;  2ZY3 A;  2CFB A;  3KGW A;  2VGW A;  1C0N A;  1ARI A;  1MGV A;  3L8A A;  1TAT A;  2QMA A;  4IYO B;  3DYD A;  1CQ6 A;  3NUB A;  1ZOB A;  3HT4 A;  4Q75 A;  1FC4 A;  5EAV A;  5FT4 A;  1E5F A;  1KKJ A;  1KMJ A;  1MDX A;  1YAA A;  1KL2 A;  4UHN A;  1PMO A;  3ZRQ A;  4A0G A;  5DB5 A;  2W8U A;  2A1V A;  2DOU A;  3NUI A;  2WK7 A;  5E3K A;  1QIS A;  2BIE A;  1TAS A;  2VMP A;  1S09 A;  1C7G A;  9AAT A;  1C4K A;  3DRD A;  1DGD A;  2AAT A;  4HF8 A;  4I8A A;  5DJ1 A;  3KGX A;  2FKI A;  3GJU A;  2W8T A;  1CJ0 A;  2R5E A;  1AIA A;  2VMQ A;  1OXO A;  1RVY A;  2W7H A;  1GC3 A;  1M0P A;  3MKJ A;  2Z1Z A;  1H1C A;  2ZP7 A;  3R9A A;  4ADB A;  1N2T A;  2D5Y A;  4XAU A;  4GRX A;  4L0O A;  4W91 A;  2W8V A;  2W7D A;  3II0 A;  3B8X A;  3COG A;  3AEP A;  2Q7W A;  1CL2 A;  3OP7 A;  4W5K A;  5EQC A;  1ASC A;  1DJU A;  5F8V A;  2X5F A;  4RIZ A;  3E2Y A;  1ART A;  4BA4 A;  3Q8N A;  1BW0 A;  3N0L A;  1DJ9 A;  1AAW A;  2VMZ A;  2YKU A;  3E2F A;  3JWB A;  4JEV A;  4O6Z A;  4IX8 A;  1QJ5 A;  1X2A A;  3DU4 A;  4WLH A;  1S06 A;  2HOZ A;  1WYU B;  4IXS A;  4DBC A;  4F5L A;  5C6U A;  1B9H A;  3HL2 A;  3D6K A;  2QSR A;  4XJO A;  4DQ6 A;  4BA5 A;  2O0R A;  3UWC A;  4WXB A;  3MAU A;  1ASG A;  3BWN C;  3FDB A;  4W1V A;  2OAT A;  4OBU A;  3B1D A;  2HOY A;  1X29 A;  3LV2 A;  1H0C A;  3EIB A;  4WB0 A;  3G7Q A;  1ASE A;  5EFS A;  3WZF A;  1TPL A;  3W1J A;  3JU7 A;  3H7F A;  3GWP A;  3RQ1 A;  1ASM A;  3GSB A;  3NX3 A;  2QLR A;  3UAK A;  1AKB A;  3GR9 A;  2D66 A;  2VLH A;  1I29 A;  3NU8 A;  1TOK A;  1D7V A;  1QIT A;  1W7M A;  2QBT A;  3W1I A;  3WY7 A;  3N7N A;  1VEF A;  2D65 A;  3AEO A;  1B9I A;  4FFC A;  3N4R A;  3A8U X;  1GEX A;  2VMR A;  1SZU A;  3FVX A;  2VGS A;  4OTL A;  3NDN A;  5HXX A;  1VP4 A;  3GZD A;  3HVY A;  1I48 A;  2NMP A;  1KKP A;  1IUG A;  1M0Q A;  4ITG A;  1M0O A;  5E4Z A;  1M7Y A;  4Q76 A;  1WYV A;  1AY5 A;  1SZS A;  2ZSM A;  1J04 A;  2X3L A;  4U2H A;  3FFR A;  3AOW A;  1YNU A;  4BMK A;  2YOB A;  2YRR A;  5M4B A;  1DKA A;  2CST A;  3LY1 A;  3WLX A;  2HP2 A;  3VK3 A;  5EIG B;  1AJS B;  3FCR A;  2VMV A;  1B8G A;  2VMX A;  1IAX A;  4R5F A;  4Y0H A;  1V2F A;  4E3R A;  3BCA A;  4ATQ A;  2F8J A;  2JJG A;  3IF2 A;  3KKI A;  1AJR A;  4ZWM A;  3ACZ A;  2VGV A;  1D2F A;  3LVM A;  1UU1 A;  2V1P A;  3BWN A;  3TFU A;  1BQD A;  3I16 A;  4M2K A;  4LC3 A;  1LKC A;  2C81 A;  3B1E A;  1FG7 A;  1ASF A;  2CAN A;  2VI8 A;  4OCA A;  4F4E A;  2DGK A;  3TQX A;  3OKS A;  4AO4 A;  1G7W A;  1VJO A;  3AEM C;  3ASB A;  2EH6 A;  2TPL A;  2VGZ A;  1BQA A;  3ATH A;  2ORD A;  1AMA A;  1BJW A;  2JGT A;  4ISY A;  4WYG A;  4F5J A;  1LS3 A;  1ELQ A;  3EIA A;  2D64 A;  4H63 Q;  1UU2 A;  4J5U A;  1YIZ A;  4N0B A;  1YIY A;  2C7T A;  1LK9 A;  1SPA A;  1DGE A;  5LH9 A;  2JJF A;  4QGR A;  3EI9 A;  1GEW A;  2YKV A;  4WLJ A;  4A6R A;  2ZUK A;  2AY3 A;  4A0H A;  2DKJ A;  4ATP A;  3TAT A;  2XBN A;  3JWA A;  1AMR A;  1I41 A;  3ASA A;  3A2B A;  2AY8 A;  2FYF A;  3EI8 A;  1MLZ A;  4XEW A;  3W1H A;  3CAI A;  4KXK A;  2GSA A;  1D7S A;  2AEV A;  3QPG A;  4RLG A;  1ELU A;  3ECD A;  1MAP A;  5FT8 A;  1AHX A;  1BKG A;  2CY8 A;  1JG8 A;  2KFP A;  5KTB A;  2HZP A;  2Z9X A;  2Z1Y A;  2VMS A;  4KAM A;  3CQ5 A;  2R2N A;  3FTB A;  4R2N A;  4RKD A;  3LVL B;  1CL1 A;  1CZC A;  1M0N A;  4XJP A;  4AO9 A;  4CXQ A;  3N4X A;  3GBX A;  3FRK A;  2G7J A;  3PA9 A;  2CB1 A;  4CBR A;  1DTY A;  3HLM A;  2GB3 A;  1MAQ A;  3BN1 A;  4F5M A;  1OXP A;  1BJN A;  1V2E A;  4AZJ A;  4XQ2 A;  2Z9W A;  2W7E A;  3NU7 A;  1O69 A;  3B46 A;  2GQN A;  1O4S A;  1AKC A;  2BIG A;  3DXV A;  4J8L A;  1XI9 A;  2CJH A;  3BB8 A;  1Z3Z A;  5D5S A;  5G2P A;  2Z9U A;  4GE9 A;  5TF5 A;  4A0F A;  3GZD C;  3PGY A;  4MQQ A;  3VP6 A;  4GE7 A;  1ASD A;  3DZZ A;  3AEN A;  4K2M A;  1DJE A;  3AEM A;  1ARH A;  1QJ3 A;  3H14 A;  1AMS A;  1B4X A;  1G4X A;  4B98 A;  3ZZJ A;  4AOA A;  3BCX A;  1IVR A;  2WKA A;  3KE3 A;  3H9X A;  1EQB A;  2AY5 A;  3CQ6 A;  4R8D A;  3WCN A;  4F5I A;  3FFH A;  2FQ6 A;  4JEX A;  4TMR A;  2CTZ A;  3DOD A;  3LWS A;  1GCK A;  2DGL A;  4WB0 B;  1JF9 A;  1W7N A;  2OQX A;  3A9Y A;  4M2M A;  3G8M A;  1GC0 A;  4K2I A;  1WYT A;  3FVU A;  2ZY4 A;  3ELP A;  4IXZ A;  2W7I A;  1OHV A;  2RFV A;  3DR7 A;  2FN6 A;  4UOY A;  2ZYJ A;  4ZWV A;  2AY1 A;  1SVV A;  2YKY A;  3TFT A;  4UHM A;  4M2J A;  4P3M A;  1AMQ A;  3CQ4 A;  2Z61 A;  3MAF A;  3PD6 A;  4LNL A;  4OC9 A;  2AEU A;  5JAY A;  5J8Q A;  4WYC A;  1YJS A;  2BI2 A;  4JF1 A;  4WYA A;  2EZ2 A;  5G0A A;  4A6T A;  2VGT A;  5IWQ A;  2CH1 A;  4MKK A;  1RVU A;  3DXW A;  3IHJ A;  3LG0 A;  1S08 A;  1WYV B;  4LNJ A;  2XH1 A;  4MQR A;  3E77 A;  4WYF A;  2BYL A;  3WGC A;  3RCH A;  1TOJ A;  1GC4 A;  1J32 A;  3P1T A;  1QGN A;  2EPJ A;  3G0T A;  2VLF A;  1RV3 A;  2YCN A;  3JTX A;  2QB2 A;  2E7U A;  1ASL A;  1BJO A;  2BI3 A;  3QBO A;  2VMW A;  4AH3 A;  3TCM A;  2CH2 A;  1OHW A;  2QA3 A;  4E3Q A;  4OYT A;  3QN6 A;  2DKB A;  2FNU A;  3FQA A;  4H51 A;  1AHG A;  4MGR A;  4N0W A;  3BCB A;  4TV7 A;  2W7L A;  4F5G A;  2BI1 A;  1AHY A;  1TOE A;  3DR4 A;  4UQV A;  2HP1 A;  1EG5 A;  3GET A;  5G4I A;  2W8J A;  1ASN A;  4MKJ A;  3CBF A;  3EI5 A;  3AOV A;  4ZDP A;  2W7J A;  4E77 A;  1QIR A;  4IW7 A;  1M32 A;  3PDX A;  3ISL A;  2AY6 A;  3FSL A;  1T3I A;  2X5D A;  3HQT A;  3PIU A;  4WYE A;  5HDM A;  1D7U A;  2OGA A;  1I43 A;  3PDB A;  4P7Y A;  4IY7 A;  4GEB A;  2YCT A;  4ZAH A;  2E7I A;  1ASA A;  5M46 A;  1V72 A;  5G2Q A;  2C0R A;  3VAX A;  2EYQ A;  5K8B A;  2HOX A;  3NTJ A;  3WGB A;  4BQ0 A;  1Z7D A;  2FNI A;  1G7X A;  1SF2 A;  1IAY A;  2VMU A;  1ECX A;  3MC6 C;  4Y0I A;  3RUY A;  3PJ0 A;  2HOR A;  1KMK A;  4JEY A;  1QZ9 A;  3K40 A;  3EZS A;  4HVK A;  2Z20 A;  3K28 A;  4WXF A;  4R5Z A;  4JEZ A;  3E2Z A;  4UHO A;  4FL0 A;  3I4J A;  1EJI A;  2DR1 A;  2BYJ A;  1OAT A;  2BIA A;  1TAR A;  2CIN A;  3LVK A;  2G6W A;  5BJ3 A;  3FKD A;  5M4D A;  1ARG A;  4PFN A;  3MBB A;  4XJM A;  4EB5 A;  5FT6 A;  3BC8 A;  4GE4 A;  3FQ8 A;  1D7R A;  1O61 A;  1AHF A;  3HMU A;  2R0T A;  3M5U A;  3ZRR A;  4KYO A;  2BKW A;  2OGE A;  1ARS A;  3A9X A;  4RM1 A;  3F0H A;  1PG8 A;  4JEW A;  2W7F A;  3ZRP A;  2WB6 A;  4RJ0 A;  2VMN A;  1GBN A;  3AEJ C;  4OT8 A;  2AY9 A;  2GMU A;  3NRA A;  2VIA A;  3JZL A;  3NYS A;  2BI9 A;  3PPL A;  2R5C A;  3RI6 A;  7AAT A;  5E5I A;  2JJE A;  3I5T A;  2Z9V A;  3P6K A;  3FZ7 A;  2V0Y A;  2BHX A;  3AEN B;  3DC1 A;  1MLY A;  4LW4 A;  5EAA A;  3L44 A;  3WKS A;  2W7G A;  4JE5 A;  3FVS A;  3RBL A;  5D95 A;  1YJZ A;  4IYO A;  2CJD A;  2BI5 A;  4LW2 A;  1ORD A;  1W23 A;  2ZJG A;  1WKH A;  3BV0 A;  4ITX A;  4JE5 D;  1IX7 A;  3ZZK A;  2PB2 A;  2WK9 A;  2DGM A;  4A0R A;  1X28 A;  1AX4 A;  3A9Z A;  2OKJ A;  2YCP A;  1AY4 A;  4WXG A;  4NOG A;  3N5M A;  3VK2 A;  3MEB A;  4F5F A;  3MC6 A;  2YKX A;  4ZM3 A;  1BT4 A;  1WYT B;  2JIS A;  5G4J A;  1BS0 A;  2JG2 A;  2PB0 A;  2W8W A;  1AIB A;  3AEL A;  4Q6R A;  1P3W A;  1B5O A;  1O62 A;  4F5H A;  1IX6 A;  2D61 A;  1PFF A;  3QI6 A;  2QB3 A;  2VGU A;  4OBV A;  4MSO A;  1JS6 A;  2D7Z A;  3MAF B;  3PD6 B;  3B1C A;  4EFF A;  1TOI A;  1CQ8 A;  1UKJ A;  4RJY A;  1S0A A;  5DJ9 A;  1PMM A;  1X0M A;  3HBX A;  4WP0 A;  4WBT A;  3FQ7 A;  3NNK A;  1LW4 A;  1IBJ A;  3BWO A;  2W7M A;  3FD0 A;  1AHE A;  2ZY2 A;  3AEJ A;  2Z67 A;  1LC8 A;  3N75 A;  3GZC A;  3WX9 A;  3EZ1 A;  2PO3 A;  1ASB A;  2OKK A;  2WK8 A;  3RCH B;  1U08 A;  1ZOD A;  3RBF A;  1AKA A;  1IJI A;  4ZM4 A;  3F9T A;  1B5P A;  1GD9 A;  2D7Y A;  4A00 A;  2AY7 A;  1W3U A;  1AIC A;  1WYU A;  4PFF A;  4WD2 A;  4A6U A;  4F5K A;  4ZSW A;  4AZK A;  4GDY A;  5EUD A;  1BJO B;  3BS8 A;  2EGY A;  3NYT A;  4PIW A;  2BWN A;  3MAD A;  1CS1 A;  2VMO A;  4ADE A;  2GMS A;  1LC5 A;  4PVF A;  3VOM A;  1TOG A;  4ADD A;  5EUE A;  4MQP A;  1LC7 A;  5M49 A;  3NYU A;  4ZDL A;  3WKR A;  2HUI A;  2X8U A;  1CQ7 A;  4EU1 A;  4RKC A;  1LW5 A;  3T32 A;  4OMA A;  1G4V A;  4GSA A;  5BJ4 A;  1M4N A;  4B9B A;  1MDZ A;  4K2B A;  2AY2 A;  4A72 A;  4CXR A;  4K05 A;  1Y4I A;  1GEY A;  2C44 A;  4DGT A;  2EO5 A;  1SFF A;  4WYD A;  4E1O A;  2VI9 A;  2VMT A;  4JF0 A;  1AY8 A;  4CVQ A;  4RAE A;  4Y0D A;  1GC2 A;  5EUN A;  1C9C A;  3WCO A;  1SZK A;  3FZ6 A;  4IXO A;  3PDB B;  3FDD A;  4MY5 A;  2VIB A;  5FT5 A;  1OHY A;  4ADC A;  2YHK A;  3AAT A;  3R4T A;  8AAT A;  2D63 A;  3AV7 A;  4RIT A;  4ZDO A;  2BWP A;  3EI6 A;  2HUU A;  3VK4 A;  5DX5 A;  1N31 A;  2ZC0 A;  5LHA A;  4XK1 A;  1BJ4 A;  4ZLV A;  1KAF A;  3QM2 A;  1YOO A;  1ZC9 A;  2HUF A;  3EUC A;  3E2Z B;  1C7N A;  5AX8 A;  3QGU A;  1S07 A;  2VYC A;  4LNM A;  1N8P A;  3N4S A;  4CBS A; 
#chains in the Genus database with same CATH homology
 4XJL A;  5EIG A;  1AJS A;  2FM1 A;  1CZE A;  3K7Y A;  2O1B A;  2W7K A;  4BHD A;  1E5E A;  1UU0 A;  2E7J A;  1WST A;  4ZSY A;  5HHY A;  1WKG A;  1JS3 A;  5F9S A;  1YJY A;  3E9K A;  3E6G A;  3QHX A;  4W8I A;  4W1X A;  3JW9 A;  1FG3 A;  5I92 A;  1C7O A;  2VMY A;  1IX8 A;  1RV4 A;  1GDE A;  2YRI A;  3HDO A;  4TN4 A;  4W1W A;  2E54 A;  2ZSL A;  3ELE A;  2R5C B;  4ZAS A;  5G09 A;  3FZ8 A;  1W7L A;  2AY4 A;  3UE8 A;  1XEY A;  3USF A;  2JJH A;  4Q31 A;  2O7C A;  3F6T A;  3LVJ A;  3PAA A;  1MDO A;  4U1T A;  2CJG A;  1V2D A;  1KL1 A;  2ZY5 A;  4EMY A;  3EI7 A;  2BWO A;  1DFO A;  1AAM A;  1M6S A;  2EZ1 A;  4EB7 A;  2ZY3 A;  2CFB A;  3KGW A;  2VGW A;  1C0N A;  1ARI A;  1MGV A;  3L8A A;  1TAT A;  2QMA A;  4IYO B;  3DYD A;  1CQ6 A;  3NUB A;  1ZOB A;  3HT4 A;  4Q75 A;  1FC4 A;  5EAV A;  5FT4 A;  1E5F A;  1KKJ A;  1KMJ A;  1MDX A;  1YAA A;  1KL2 A;  4UHN A;  1PMO A;  3ZRQ A;  4A0G A;  5DB5 A;  2W8U A;  2A1V A;  2DOU A;  3NUI A;  2WK7 A;  5E3K A;  1QIS A;  2BIE A;  1TAS A;  2VMP A;  1S09 A;  1C7G A;  9AAT A;  1C4K A;  3DRD A;  1DGD A;  2AAT A;  4HF8 A;  4I8A A;  5DJ1 A;  3KGX A;  2FKI A;  3GJU A;  2W8T A;  1CJ0 A;  2R5E A;  1AIA A;  2VMQ A;  1OXO A;  1RVY A;  2W7H A;  1GC3 A;  1M0P A;  3MKJ A;  2Z1Z A;  1H1C A;  2ZP7 A;  3R9A A;  4ADB A;  1N2T A;  2D5Y A;  4XAU A;  4GRX A;  4L0O A;  4W91 A;  2W8V A;  2W7D A;  3II0 A;  3B8X A;  3COG A;  3AEP A;  2Q7W A;  1CL2 A;  3OP7 A;  4W5K A;  5EQC A;  1ASC A;  1DJU A;  5F8V A;  2X5F A;  4RIZ A;  3E2Y A;  1ART A;  4BA4 A;  3Q8N A;  1BW0 A;  3N0L A;  1DJ9 A;  1AAW A;  2VMZ A;  2YKU A;  3E2F A;  3JWB A;  4JEV A;  4O6Z A;  4IX8 A;  1QJ5 A;  1X2A A;  3DU4 A;  4WLH A;  1S06 A;  2HOZ A;  1WYU B;  4IXS A;  4DBC A;  4F5L A;  5C6U A;  1B9H A;  3HL2 A;  3D6K A;  2QSR A;  4XJO A;  4DQ6 A;  4BA5 A;  2O0R A;  3UWC A;  4WXB A;  3MAU A;  1ASG A;  3BWN C;  3FDB A;  4W1V A;  2OAT A;  4OBU A;  3B1D A;  2HOY A;  1X29 A;  3LV2 A;  1H0C A;  3EIB A;  4WB0 A;  3G7Q A;  1ASE A;  5EFS A;  3WZF A;  1TPL A;  3W1J A;  3JU7 A;  3H7F A;  3GWP A;  3RQ1 A;  1ASM A;  3GSB A;  3NX3 A;  2QLR A;  3UAK A;  1AKB A;  3GR9 A;  2D66 A;  2VLH A;  1I29 A;  3NU8 A;  1TOK A;  1D7V A;  1QIT A;  1W7M A;  2QBT A;  3W1I A;  3WY7 A;  3N7N A;  1VEF A;  2D65 A;  3AEO A;  1B9I A;  4FFC A;  3N4R A;  3A8U X;  1GEX A;  2VMR A;  1SZU A;  3FVX A;  2VGS A;  4OTL A;  3NDN A;  5HXX A;  1VP4 A;  3GZD A;  3HVY A;  1I48 A;  2NMP A;  1KKP A;  1IUG A;  1M0Q A;  4ITG A;  1M0O A;  5E4Z A;  1M7Y A;  4Q76 A;  1WYV A;  1AY5 A;  1SZS A;  2ZSM A;  1J04 A;  2X3L A;  4U2H A;  3FFR A;  3AOW A;  1YNU A;  4BMK A;  2YOB A;  2YRR A;  5M4B A;  1DKA A;  2CST A;  3LY1 A;  3WLX A;  2HP2 A;  3VK3 A;  5EIG B;  1AJS B;  3FCR A;  2VMV A;  1B8G A;  2VMX A;  1IAX A;  4R5F A;  4Y0H A;  1V2F A;  4E3R A;  3BCA A;  4ATQ A;  2F8J A;  2JJG A;  3IF2 A;  3KKI A;  1AJR A;  4ZWM A;  3ACZ A;  2VGV A;  1D2F A;  3LVM A;  1UU1 A;  2V1P A;  3BWN A;  3TFU A;  1BQD A;  3I16 A;  4M2K A;  4LC3 A;  1LKC A;  2C81 A;  3B1E A;  1FG7 A;  1ASF A;  2CAN A;  2VI8 A;  4OCA A;  4F4E A;  2DGK A;  3TQX A;  3OKS A;  4AO4 A;  1G7W A;  1VJO A;  3AEM C;  3ASB A;  2EH6 A;  2TPL A;  2VGZ A;  1BQA A;  3ATH A;  2ORD A;  1AMA A;  1BJW A;  2JGT A;  4ISY A;  4WYG A;  4F5J A;  1LS3 A;  1ELQ A;  3EIA A;  2D64 A;  4H63 Q;  1UU2 A;  4J5U A;  1YIZ A;  4N0B A;  1YIY A;  2C7T A;  1LK9 A;  1SPA A;  1DGE A;  5LH9 A;  2JJF A;  4QGR A;  3EI9 A;  1GEW A;  2YKV A;  4WLJ A;  4A6R A;  2ZUK A;  2AY3 A;  4A0H A;  2DKJ A;  4ATP A;  3TAT A;  2XBN A;  3JWA A;  1AMR A;  1I41 A;  3ASA A;  3A2B A;  2AY8 A;  2FYF A;  3EI8 A;  1MLZ A;  4XEW A;  3W1H A;  3CAI A;  4KXK A;  2GSA A;  1D7S A;  2AEV A;  3QPG A;  4RLG A;  1ELU A;  3ECD A;  1MAP A;  5FT8 A;  1AHX A;  1BKG A;  2CY8 A;  1JG8 A;  2KFP A;  5KTB A;  2HZP A;  2Z9X A;  2Z1Y A;  2VMS A;  4KAM A;  3CQ5 A;  2R2N A;  3FTB A;  4R2N A;  4RKD A;  3LVL B;  1CL1 A;  1CZC A;  1M0N A;  4XJP A;  4AO9 A;  4CXQ A;  3N4X A;  3GBX A;  3FRK A;  2G7J A;  3PA9 A;  2CB1 A;  4CBR A;  1DTY A;  3HLM A;  2GB3 A;  1MAQ A;  3BN1 A;  4F5M A;  1OXP A;  1BJN A;  1V2E A;  4AZJ A;  4XQ2 A;  2Z9W A;  2W7E A;  3NU7 A;  1O69 A;  3B46 A;  2GQN A;  1O4S A;  1AKC A;  2BIG A;  3DXV A;  4J8L A;  1XI9 A;  2CJH A;  3BB8 A;  1Z3Z A;  5D5S A;  5G2P A;  2Z9U A;  4GE9 A;  5TF5 A;  4A0F A;  3GZD C;  3PGY A;  4MQQ A;  3VP6 A;  4GE7 A;  1ASD A;  3DZZ A;  3AEN A;  4K2M A;  1DJE A;  3AEM A;  1ARH A;  1QJ3 A;  3H14 A;  1AMS A;  1B4X A;  1G4X A;  4B98 A;  3ZZJ A;  4AOA A;  3BCX A;  1IVR A;  2WKA A;  3KE3 A;  3H9X A;  1EQB A;  2AY5 A;  3CQ6 A;  4R8D A;  3WCN A;  4F5I A;  3FFH A;  2FQ6 A;  4JEX A;  4TMR A;  2CTZ A;  3DOD A;  3LWS A;  1GCK A;  2DGL A;  4WB0 B;  1JF9 A;  1W7N A;  2OQX A;  3A9Y A;  4M2M A;  3G8M A;  1GC0 A;  4K2I A;  1WYT A;  3FVU A;  2ZY4 A;  3ELP A;  4IXZ A;  2W7I A;  1OHV A;  2RFV A;  3DR7 A;  2FN6 A;  4UOY A;  2ZYJ A;  4ZWV A;  2AY1 A;  1SVV A;  2YKY A;  3TFT A;  4UHM A;  4M2J A;  4P3M A;  1AMQ A;  3CQ4 A;  2Z61 A;  3MAF A;  3PD6 A;  4LNL A;  4OC9 A;  2AEU A;  5JAY A;  5J8Q A;  4WYC A;  1YJS A;  2BI2 A;  4JF1 A;  4WYA A;  2EZ2 A;  5G0A A;  4A6T A;  2VGT A;  5IWQ A;  2CH1 A;  4MKK A;  1RVU A;  3DXW A;  3IHJ A;  3LG0 A;  1S08 A;  1WYV B;  4LNJ A;  2XH1 A;  4MQR A;  3E77 A;  4WYF A;  2BYL A;  3WGC A;  3RCH A;  1TOJ A;  1GC4 A;  1J32 A;  3P1T A;  1QGN A;  2EPJ A;  3G0T A;  2VLF A;  1RV3 A;  2YCN A;  3JTX A;  2QB2 A;  2E7U A;  1ASL A;  1BJO A;  2BI3 A;  3QBO A;  2VMW A;  4AH3 A;  3TCM A;  2CH2 A;  1OHW A;  2QA3 A;  4E3Q A;  4OYT A;  3QN6 A;  2DKB A;  2FNU A;  3FQA A;  4H51 A;  1AHG A;  4MGR A;  4N0W A;  3BCB A;  4TV7 A;  2W7L A;  4F5G A;  2BI1 A;  1AHY A;  1TOE A;  3DR4 A;  4UQV A;  2HP1 A;  1EG5 A;  3GET A;  5G4I A;  2W8J A;  1ASN A;  4MKJ A;  3CBF A;  3EI5 A;  3AOV A;  4ZDP A;  2W7J A;  4E77 A;  1QIR A;  4IW7 A;  1M32 A;  3PDX A;  3ISL A;  2AY6 A;  3FSL A;  1T3I A;  2X5D A;  3HQT A;  3PIU A;  4WYE A;  5HDM A;  1D7U A;  2OGA A;  1I43 A;  3PDB A;  4P7Y A;  4IY7 A;  4GEB A;  2YCT A;  4ZAH A;  2E7I A;  1ASA A;  5M46 A;  1V72 A;  5G2Q A;  2C0R A;  3VAX A;  2EYQ A;  5K8B A;  2HOX A;  3NTJ A;  3WGB A;  4BQ0 A;  1Z7D A;  2FNI A;  1G7X A;  1SF2 A;  1IAY A;  2VMU A;  1ECX A;  3MC6 C;  4Y0I A;  3RUY A;  3PJ0 A;  2HOR A;  1KMK A;  4JEY A;  1QZ9 A;  3K40 A;  3EZS A;  4HVK A;  2Z20 A;  3K28 A;  4WXF A;  4R5Z A;  4JEZ A;  3E2Z A;  4UHO A;  4FL0 A;  3I4J A;  1EJI A;  2DR1 A;  2BYJ A;  1OAT A;  2BIA A;  1TAR A;  2CIN A;  3LVK A;  2G6W A;  5BJ3 A;  3FKD A;  5M4D A;  1ARG A;  4PFN A;  3MBB A;  4XJM A;  4EB5 A;  5FT6 A;  3BC8 A;  4GE4 A;  3FQ8 A;  1D7R A;  1O61 A;  1AHF A;  3HMU A;  2R0T A;  3M5U A;  3ZRR A;  4KYO A;  2BKW A;  2OGE A;  1ARS A;  3A9X A;  4RM1 A;  3F0H A;  1PG8 A;  4JEW A;  2W7F A;  3ZRP A;  2WB6 A;  4RJ0 A;  2VMN A;  1GBN A;  3AEJ C;  4OT8 A;  2AY9 A;  2GMU A;  3NRA A;  2VIA A;  3JZL A;  3NYS A;  2BI9 A;  3PPL A;  2R5C A;  3RI6 A;  7AAT A;  5E5I A;  2JJE A;  3I5T A;  2Z9V A;  3P6K A;  3FZ7 A;  2V0Y A;  2BHX A;  3AEN B;  3DC1 A;  1MLY A;  4LW4 A;  5EAA A;  3L44 A;  3WKS A;  2W7G A;  4JE5 A;  3FVS A;  3RBL A;  5D95 A;  1YJZ A;  4IYO A;  2CJD A;  2BI5 A;  4LW2 A;  1ORD A;  1W23 A;  2ZJG A;  1WKH A;  3BV0 A;  4ITX A;  4JE5 D;  1IX7 A;  3ZZK A;  2PB2 A;  2WK9 A;  2DGM A;  4A0R A;  1X28 A;  1AX4 A;  3A9Z A;  2OKJ A;  2YCP A;  1AY4 A;  4WXG A;  4NOG A;  3N5M A;  3VK2 A;  3MEB A;  4F5F A;  3MC6 A;  2YKX A;  4ZM3 A;  1BT4 A;  1WYT B;  2JIS A;  5G4J A;  1BS0 A;  2JG2 A;  2PB0 A;  2W8W A;  1AIB A;  3AEL A;  4Q6R A;  1P3W A;  1B5O A;  1O62 A;  4F5H A;  1IX6 A;  2D61 A;  1PFF A;  3QI6 A;  2QB3 A;  2VGU A;  4OBV A;  4MSO A;  1JS6 A;  2D7Z A;  3MAF B;  3PD6 B;  3B1C A;  4EFF A;  1TOI A;  1CQ8 A;  1UKJ A;  4RJY A;  1S0A A;  5DJ9 A;  1PMM A;  1X0M A;  3HBX A;  4WP0 A;  4WBT A;  3FQ7 A;  3NNK A;  1LW4 A;  1IBJ A;  3BWO A;  2W7M A;  3FD0 A;  1AHE A;  2ZY2 A;  3AEJ A;  2Z67 A;  1LC8 A;  3N75 A;  3GZC A;  3WX9 A;  3EZ1 A;  2PO3 A;  1ASB A;  2OKK A;  2WK8 A;  3RCH B;  1U08 A;  1ZOD A;  3RBF A;  1AKA A;  1IJI A;  4ZM4 A;  3F9T A;  1B5P A;  1GD9 A;  2D7Y A;  4A00 A;  2AY7 A;  1W3U A;  1AIC A;  1WYU A;  4PFF A;  4WD2 A;  4A6U A;  4F5K A;  4ZSW A;  4AZK A;  4GDY A;  5EUD A;  1BJO B;  3BS8 A;  2EGY A;  3NYT A;  4PIW A;  2BWN A;  3MAD A;  1CS1 A;  2VMO A;  4ADE A;  2GMS A;  1LC5 A;  4PVF A;  3VOM A;  1TOG A;  4ADD A;  5EUE A;  4MQP A;  1LC7 A;  5M49 A;  3NYU A;  4ZDL A;  3WKR A;  2HUI A;  2X8U A;  1CQ7 A;  4EU1 A;  4RKC A;  1LW5 A;  3T32 A;  4OMA A;  1G4V A;  4GSA A;  5BJ4 A;  1M4N A;  4B9B A;  1MDZ A;  4K2B A;  2AY2 A;  4A72 A;  4CXR A;  4K05 A;  1Y4I A;  1GEY A;  2C44 A;  4DGT A;  2EO5 A;  1SFF A;  4WYD A;  4E1O A;  2VI9 A;  2VMT A;  4JF0 A;  1AY8 A;  4CVQ A;  4RAE A;  4Y0D A;  1GC2 A;  5EUN A;  1C9C A;  3WCO A;  1SZK A;  3FZ6 A;  4IXO A;  3PDB B;  3FDD A;  4MY5 A;  2VIB A;  5FT5 A;  1OHY A;  4ADC A;  2YHK A;  3AAT A;  3R4T A;  8AAT A;  2D63 A;  3AV7 A;  4RIT A;  4ZDO A;  2BWP A;  3EI6 A;  2HUU A;  3VK4 A;  5DX5 A;  1N31 A;  2ZC0 A;  5LHA A;  4XK1 A;  1BJ4 A;  4ZLV A;  3QM2 A;  1YOO A;  1ZC9 A;  2HUF A;  3EUC A;  3E2Z B;  1C7N A;  5AX8 A;  3QGU A;  1S07 A;  2VYC A;  4LNM A;  1N8P A;  3N4S A;  4CBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...