1ARSA

X-ray crystallographic study of pyridoxal 5'-phosphate-type aspartate aminotransferases from escherichia coli in open and closed form
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic study of pyridoxal 5'-phosphate-type aspartate aminotransferases from Escherichia coli in open and closed form.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 138
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1arsA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1arsA01
1TOGA 3QBOA 1TPLA 2X8UA 5E4ZA 2AY2A 2HUIA 4OT8A 2CANA 2HZPA 2JISA 2V0YA 3CQ4A 4ZAHA 2VLHA 3ACZA 4XJOA 4AO9A 2AY9A 3MC6A 4ADBA 3CAIA 3NUBA 3AEMC 1E5FA 3LVMA 1TOJA 3LY1A 3ZZKA 1GBNA 2W8UA 4CXRA 4F5MA 4MQPA 1ARIA 4O6ZA 1D7SA 5DX5A 3MKJA 1Y4IA 2X5DA 1BT4A 5EUNA 2AY5A 3CQ5A 4UQVA 3GJUA 2EH6A 1AMSA 2FNIA 3R4TA 4WYFA 5J8QA 4WB0B 1SZUA 2D7YA 4PIWA 4J8LA 1JS3A 1P3WA 1KKJA 1QJ5A 4JEYA 3G8MA 3VK4A 3EZ1A 1OHYA 3CQ6A 3HVYA 4OBVA 1YIZA 4A0GA 2CJGA 2ZY2A 4P7YA 1MAQA 3NU7A 3B1EA 1O4SA 1AY8A 3MBBA 5K8BA 5HHYA 1IUGA 2CH1A 3WGBA 1TOIA 4JEWA 2BI2A 4F5HA 3DU4A 4R5ZA 2FN6A 1J32A 4GE7A 3EIBA 1E5EA 3LWSA 2X5FA 3PDBB 2BIEA 2VIAA 1EG5A 3PPLA 2R5CA 4Y0IA 2AATA 3USFA 3WGCA 2BWPA 2C81A 2OGAA 4W1VA 3BCBA 3QI6A 3OKSA 3AOVA 4BQ0A 2HP2A 3AENA 3AELA 1C9CA 5IWQA 5G0AA 3DYDA 3EZSA 3RUYA 1B5OA 2AY4A 1KMKA 2FQ6A 2CH2A 3NYSA 2QMAA 4OMAA 4Q6RA 2JJHA 4OTLA 2JJEA 2O1BA 2VI8A 2ZY4A 3N0LA 5G4IA 3DXVA 4RAEA 4B9BA 4DQ6A 2YKYA 1GC0A 1GC4A 3AEMA 3VAXA 2E7JA 1OATA 2DGLA 3GR9A 4IYOB 4U2HA 1LK9A 3A8UX 1QGNA 4Y0DA 2W7IA 2EZ1A 3FKDA 3NUIA 4W1WA 3FZ8A 1O62A 4M2JA 1OHVA 1WYVA 4BHDA 2OKJA 4P3MA 4GEBA 4FFCA 5EIGA 5E5IA 1ASCA 4U1TA 1B9HA 4KYOA 1DJUA 4JE5A 1LC8A 1JF9A 1ASFA 1SZSA 3AEOA 1IBJA 4R5FA 1GDEA 1YJSA 3WCNA 1MLYA 1DKAA 1KMJA 1C4KA 1BW0A 2CINA 2HORA 2VMVA 2Z9XA 4NOGA 3TFTA 1AY5A 2ZUKA 3HT4A 4JE5D 3PIUA 3L8AA 1CQ8A 1LC7A 3L44A 1GEYA 2ZY5A 2BWOA 2R5EA 1N2TA 3QGUA 4LNJA 4B98A 1GEXA 2Q7WA 3FFHA 4MSOA 1TOKA 1C7OA 1I43A 1LW4A 1CZCA 3DC1A 1RVUA 3GSBA 1ARGA 3DR7A 3VOMA 4WYGA 1YJZA 4ADEA 2WK7A 3B1CA 4JEXA 1UKJA 2BIGA 1D7VA 1UU0A 2HOYA 3FDBA 2DKJA 2OATA 3BB8A 3ASBA 4RIZA 1AIAA 3HBXA 3AATA 3WZFA 4BA5A 2EPJA 1BJOB 3ATHA 3E2ZA 3HDOA 3WY7A 3EI6A 4K2IA 1FG7A 4A6TA 2W7HA 2E7IA 1MLZA 2HP1A 4GE9A 3QM2A 2ORDA 3ASAA 3BC8A 1BJNA 5FT8A 3NTJA 3F6TA 3T32A 4ZSYA 2XBNA 1MDOA 2W7EA 2PB0A 4BMKA 2CFBA 5G4JA 3FQAA 4LNMA 4XK1A 1S09A 1SPAA 1WKGA 1M32A 3NNKA 2VMWA 1AMQA 1LC5A 1MDZA 1X2AA 2DGMA 3LVLB 4OCAA 1AICA 2DR1A 2Z9WA 2JJGA 4PFNA 4TMRA 3ZRQA 4A00A 4MQRA 1Z3ZA 4F5KA 4TN4A 4AZKA 1N8PA 5M49A 4RJ0A 1ZOBA 2ZJGA 5TF5A 3E2YA 1VEFA 1XI9A 1DJEA 3LV2A 5G09A 3FFRA 4MKKA 4ATQA 3A9ZA 3K7YA 2O7CA 2HOXA 3A9YA 3E6GA 5G2QA 1WSTA 3GZDA 4LW2A 3FZ7A 4GE4A 3QPGA 5EQCA 3NDNA 3EI5A 2VGSA 3PJ0A 2W7LA 2YCNA 1WYUB 3JU7A 5DB5A 4EU1A 5M4BA 2BI5A 1AKBA 3PD6B 4AZJA 3LG0A 2V1PA 1G7WA 1BKGA 2YHKA 1EJIA 2QB3A 1H1CA 1MDXA 4IX8A 2Z9UA 4K2BA 3RCHB 1YJYA 2PO3A 4ZSWA 2R0TA 1YOOA 1ZC9A 3TATA 2E54A 3PA9A 3FRKA 4LNLA 1AJSA 1M0NA 2NMPA 1ECXA 1SVVA 3NRAA 5FT6A 3GBXA 2W8TA 4WXBA 4F5LA 4BA4A 2D7ZA 2XH1A 1BJ4A 1U08A 1G7XA 2Z1YA 1QZ9A 4JEVA 5D95A 1OHWA 3TFUA 2AY6A 3LVKA 1B9IA 5EAVA 3AV7A 4DGTA 2YOBA 3ELPA 1ASAA 2ZY3A 4XEWA 2VMUA 1ARHA 1CL2A 4LW4A 1AHEA 3E9KA 5AX8A 1IVRA 4LC3A 1MGVA 1XEYA 3MAFA 3JWBA 4F5FA 1CQ6A 2FNUA 4ZM4A 1AAWA 2VMTA 4L0OA 4E3QA 1I29A 3IHJA 3WX9A 2D63A 3B46A 4EB7A 2YKXA 2HUUA 2E7UA 1WYTA 4WLHA 1AKCA 1M0PA 1V2FA 2OQXA 4WXGA 2VMNA 2TPLA 4WBTA 2W8WA 1ASDA 2C7TA 3II0A 5HDMA 1CZEA 2OGEA 3K28A 5G2PA 2W7GA 1IX6A 4JF1A 1GD9A 2QB2A 4F4EA 2D61A 3E2FA 2Z1ZA 3VK2A 1ARSA 1ORDA 2BIAA 1AKAA 2JGTA 1IAXA 2AY8A 1DFOA 3BV0A 1BQAA 5BJ4A 1M7YA 4W8IA 2VMQA 4AOAA 4IY7A 2VYCA 3RQ1A 3F9TA 1X29A 1DJ9A 3HQTA 4CVQA 4A0RA 1QITA 4A72A 1CJ0A 3HL2A 2W8VA 4KXKA 4Q31A 2W7MA 2FYFA 3FVUA 4ITGA 3RI6A 3DR4A 3UE8A 2AY3A 1MAPA 1SF2A 2Z61A 2W7FA 3BN1A 5M4DA 1LKCA 1YNUA 3BWNC 2VMRA 1KL1A 2RFVA 2DGKA 1ASBA 3AEJC 3I4JA 3P6KA 2X3LA 4WB0A 1D7UA 4K2MA 2QA3A 2W8JA 2JJFA 2VGWA 4RJYA 1QJ3A 2W7KA 1Z7DA 1JS6A 3W1IA 3NU8A 2HOZA 4MKJA 4F5IA 3JTXA 4WYEA 1AHYA 2AEUA 1TARA 4EFFA 2FM1A 2BI9A 2GMSA 3G0TA 3FVXA 3QN6A 4RKCA 2W7JA 1B5PA 1X28A 1PFFA 3FSLA 4R2NA 1AJRA 2DOUA 4OYTA 2ZP7A 2AY1A 4E77A 3H7FA 1BS0A 1AMAA 1PMOA 3PDBA 5DJ1A 2OKKA 1M6SA 3EUCA 3BWNA 1FC4A 3RBLA 2R5CB 4A6UA 4OBUA 3MC6C 3FQ8A 4N0WA 3AEJA 3EI7A 3MEBA 4WLJA 1KKPA 5EAAA 2GSAA 3AENB 4ZASA 3JWAA 1GC3A 2YCTA 3D6KA 4WXFA 4IXOA 5EFSA 4N0BA 2EZ2A 3UAKA 1D2FA 1FG3A 4M2MA 3UWCA 2QBTA 3COGA 1T3IA 4KAMA 1V2EA 5EUEA 3FQ7A 1GC2A 1PG8A 2Z9VA 3R9AA 1TOEA 1G4VA 1AIBA 3DODA 2Z67A 4GRXA 5FT4A 5JAYA 3KE3A 1ASNA 4IYOA 2D65A 2W7DA 4DBCA 4UHNA 1W7NA 3JZLA 1EQBA 2VLFA 4ZWMA 1B8GA 1RVYA 2GB3A 4ZLVA 4F5JA 3BS8A 3EI8A 3GETA 4ZWVA 1AHGA 2EGYA 1WYVB 2YCPA 5EIGB 4UOYA 3ELEA 1ASEA 2VMYA 4GSAA 1DGEA 1SFFA 3BCAA 3G7QA 4FL0A 3PGYA 4IW7A 2DKBA 3WKSA 3H14A 3ZRPA 3LVJA 4ZDLA 1D7RA 5HXXA 3TQXA 5I92A 4ZDOA 1B4XA 1AX4A 2VMSA 3GWPA 4IXZA 5D5SA 1LW5A 4ISYA 1O69A 5EUDA 4RITA 3FD0A 2QLRA 3KGWA 3FTBA 3TCMA 4RLGA 1WKHA 1C7GA 1W7LA 1ASGA 1S07A 4XQ2A 3GZCA 4ZDPA 4AO4A 3VK3A 1IX7A 3BWOA 2YKUA 1S06A 1C7NA 3MADA 3W1HA 3AEPA 4A0FA 4ADDA 1AHXA 4PVFA 8AATA 1DTYA 2D66A 3FCRA 3JW9A 4ZM3A 1GCKA 3M5UA 4WYAA 2VMZA 4XJLA 2AY7A 2G6WA 1BQDA 1AMRA 4F5GA 3B8XA 3DRDA 2PB2A 1I41A 3QHXA 1S0AA 2VGTA 1UU2A 2CJHA 5E3KA 5M46A 4IXSA 3ZZJA 3DXWA 1VJOA 1OXOA 1ASMA 1QISA 4HVKA 3P1TA 1BJOA 2WKAA 3EIAA 3WLXA 3E2ZB 5C6UA 1M0OA 2F8JA 1W23A 1W3UA 3CBFA 4H51A 2VIBA 7AATA 3NX3A 4XAUA 1RV4A 1VP4A 1AY4A 2JG2A 1IX8A 2ZSLA 5F8VA 3PAAA 3N5MA 1TATA 4J5UA 4XJMA 3ISLA 1G4XA 4ATPA 1AAMA 3Q8NA 2BKWA 4GDYA 4EMYA 1ELUA 3OP7A 5FT5A 1ASLA 1CQ7A 1UU1A 1ELQA 4E1OA 5LH9A 2D5YA 4Y0HA 4CXQA 3WKRA 1TASA 3ZRRA 1LS3A 2BYLA 2VGVA 4OC9A 3FZ6A 3NYTA 3RBFA 1N31A 4XJPA 1M0QA 2BHXA 3PDXA 4MY5A 4CBRA 2BI3A 2O0RA 2VGZA 1CL1A 3HLMA 3I5TA 4Q75A 3F0HA 1J04A 4RM1A 5F9SA 4JF0A 2D64A 3NYUA 1V2DA 4CBSA 1X0MA 1WYUA 2CY8A 1DGDA 3PD6A 4ADCA 4EB5A 2ZC0A 3A9XA 2Z20A 2VI9A 3MAUA 3B1DA 4HF8A 4UHMA 1GEWA 1OXPA 2HUFA 3FVSA 1KL2A 2GMUA 4M2KA 2YRRA 3RCHA 4UHOA 2R2NA 2VMXA 3DZZA 3IF2A 2ZYJA 2WK9A 3N75A 2CSTA 4I8AA 5LHAA 1AJSB 4JEZA 4R8DA 3BCXA 2VMOA 1H0CA 5DJ9A 4QGRA 4PFFA 2YKVA 4MGRA 4WP0A 2EO5A 1YAAA 4W5KA 1M4NA 2CB1A 3EI9A 1JG8A 3A2BA 1BJWA 1RV3A 3K40A 2AEVA 4Q76A 4WD2A 1O61A 4ITXA 4MQQA 2ZSMA 3MAFB 1W7MA 1QIRA 1SZKA 2VGUA 3WCOA 9AATA 3ECDA 1I48A 1ZODA 2BYJA 1IAYA 5BJ3A 2CTZA 1YIYA 1PMMA 1WYTB 2C0RA 2VMPA 4A0HA 2CJDA 3HMUA 3E77A 4WYCA 1C0NA 3GZDC 3FDDA 2C44A 2YRIA 1S08A 2BWNA 3KGXA 3KKIA 1V72A 3W1JA 3I16A 1CS1A 1AHFA 3AOWA 4RKDA 4W1XA 4W91A 4A6RA 1ARTA 2WK8A 3VP6A 4E3RA 4AH3A 2BI1A 4WYDA 2GQNA 4TV7A 1IJIA
chains in the Genus database with same CATH superfamily
1TOGA 3QBOA 1TPLA 2X8UA 5E4ZA 2AY2A 2HUIA 4OT8A 2CANA 2HZPA 2JISA 2V0YA 3CQ4A 4ZAHA 2VLHA 3ACZA 4XJOA 4AO9A 2AY9A 3MC6A 4ADBA 3CAIA 3NUBA 3AEMC 1E5FA 3LVMA 1TOJA 3LY1A 3ZZKA 1GBNA 2W8UA 4CXRA 4F5MA 4MQPA 1ARIA 4O6ZA 1D7SA 5DX5A 3MKJA 1Y4IA 2X5DA 1BT4A 5EUNA 2AY5A 3CQ5A 4UQVA 3GJUA 2EH6A 1AMSA 2FNIA 3R4TA 4WYFA 5J8QA 4WB0B 1SZUA 2D7YA 4PIWA 4J8LA 1JS3A 1P3WA 1KKJA 1QJ5A 4JEYA 3G8MA 3VK4A 3EZ1A 1OHYA 3CQ6A 3HVYA 4OBVA 1YIZA 4A0GA 2CJGA 2ZY2A 4P7YA 1MAQA 3NU7A 3B1EA 1O4SA 1AY8A 3MBBA 5K8BA 5HHYA 1IUGA 2CH1A 3WGBA 1TOIA 4JEWA 2BI2A 4F5HA 3DU4A 4R5ZA 2FN6A 1J32A 4GE7A 3EIBA 1E5EA 3LWSA 2X5FA 3PDBB 2BIEA 2VIAA 1EG5A 3PPLA 3N4RA 2R5CA 4Y0IA 2AATA 3USFA 3WGCA 2BWPA 2C81A 2OGAA 4W1VA 3BCBA 3QI6A 3OKSA 3AOVA 4BQ0A 2HP2A 3AENA 3AELA 1C9CA 5IWQA 5G0AA 3DYDA 3EZSA 3RUYA 1B5OA 2AY4A 1KMKA 2FQ6A 2CH2A 3NYSA 2QMAA 4OMAA 4Q6RA 2JJHA 4OTLA 2JJEA 2O1BA 2VI8A 2ZY4A 3N0LA 5G4IA 3DXVA 4RAEA 4B9BA 4DQ6A 2YKYA 1GC0A 1GC4A 3AEMA 3VAXA 2E7JA 1OATA 2DGLA 3GR9A 4IYOB 4U2HA 1LK9A 3A8UX 1QGNA 4Y0DA 2W7IA 2EZ1A 3FKDA 3NUIA 4W1WA 3FZ8A 1O62A 4M2JA 1OHVA 1WYVA 4BHDA 2OKJA 4P3MA 4GEBA 4FFCA 5EIGA 5E5IA 1ASCA 4U1TA 1B9HA 4KYOA 1DJUA 4JE5A 1LC8A 1JF9A 4H63Q 1ASFA 1SZSA 3AEOA 1IBJA 4R5FA 1GDEA 1YJSA 3WCNA 1MLYA 1DKAA 1KMJA 1C4KA 1BW0A 2CINA 2HORA 2VMVA 2Z9XA 2FKIA 4NOGA 3TFTA 1AY5A 2ZUKA 3HT4A 4JE5D 3PIUA 3L8AA 1CQ8A 1LC7A 3L44A 1GEYA 2ZY5A 2BWOA 2R5EA 1N2TA 3QGUA 4LNJA 4B98A 1GEXA 2Q7WA 3FFHA 4MSOA 1TOKA 1C7OA 1I43A 1LW4A 1CZCA 3DC1A 1RVUA 3GSBA 1ARGA 3DR7A 3VOMA 3H9XA 4WYGA 1YJZA 4ADEA 2WK7A 3B1CA 4JEXA 1UKJA 2BIGA 1D7VA 1UU0A 2HOYA 3FDBA 2DKJA 2OATA 3BB8A 3ASBA 4RIZA 1AIAA 3HBXA 3AATA 3WZFA 4BA5A 2EPJA 1BJOB 3ATHA 3E2ZA 3HDOA 3WY7A 3EI6A 4K2IA 1FG7A 4A6TA 2W7HA 2E7IA 1MLZA 2HP1A 4GE9A 3QM2A 2ORDA 3ASAA 3BC8A 1BJNA 5FT8A 3NTJA 3F6TA 3T32A 4ZSYA 2XBNA 1MDOA 2W7EA 2PB0A 4BMKA 2CFBA 5G4JA 3FQAA 4LNMA 4XK1A 1S09A 1SPAA 1WKGA 1M32A 3NNKA 2VMWA 1AMQA 1LC5A 1MDZA 1X2AA 2DGMA 3LVLB 4OCAA 1AICA 2DR1A 2Z9WA 2JJGA 4PFNA 4TMRA 3ZRQA 4A00A 4MQRA 1Z3ZA 4F5KA 4TN4A 4AZKA 1N8PA 5M49A 4RJ0A 1ZOBA 2ZJGA 5TF5A 3E2YA 1VEFA 1XI9A 1DJEA 3LV2A 5G09A 3FFRA 4MKKA 4ATQA 3A9ZA 3K7YA 2O7CA 2HOXA 3A9YA 3E6GA 5G2QA 1WSTA 3GZDA 4LW2A 3FZ7A 4GE4A 3QPGA 5EQCA 3NDNA 3EI5A 2VGSA 3PJ0A 2W7LA 2YCNA 1WYUB 3JU7A 5DB5A 4EU1A 5M4BA 2BI5A 1AKBA 3PD6B 4AZJA 3LG0A 2V1PA 1G7WA 1BKGA 2YHKA 1EJIA 2QB3A 1H1CA 1MDXA 4IX8A 2Z9UA 4K2BA 3RCHB 1YJYA 2PO3A 4ZSWA 2R0TA 1YOOA 1ZC9A 3TATA 2E54A 3PA9A 3FRKA 4LNLA 1AJSA 1M0NA 2NMPA 1ECXA 1SVVA 3NRAA 5FT6A 3GBXA 2W8TA 4WXBA 4F5LA 4BA4A 2D7ZA 2XH1A 1BJ4A 1U08A 3N4XA 1G7XA 2Z1YA 1QZ9A 4JEVA 5D95A 1OHWA 3TFUA 2AY6A 3LVKA 1B9IA 5EAVA 3AV7A 4DGTA 2YOBA 3ELPA 1ASAA 2ZY3A 4XEWA 2VMUA 1ARHA 1CL2A 4LW4A 1AHEA 3E9KA 5AX8A 1IVRA 4LC3A 1MGVA 1XEYA 3MAFA 3JWBA 4F5FA 1CQ6A 2FNUA 4ZM4A 1AAWA 2VMTA 4L0OA 4E3QA 1I29A 3IHJA 3WX9A 2D63A 3B46A 4EB7A 2YKXA 2HUUA 2E7UA 1WYTA 4WLHA 1AKCA 1M0PA 1V2FA 2OQXA 4WXGA 2VMNA 2TPLA 4WBTA 2W8WA 1ASDA 2C7TA 3II0A 5HDMA 1CZEA 2OGEA 3K28A 5G2PA 2W7GA 1IX6A 4JF1A 1GD9A 2QB2A 4F4EA 2D61A 3E2FA 2Z1ZA 3VK2A 1ARSA 1ORDA 2BIAA 1AKAA 2JGTA 1IAXA 2AY8A 1DFOA 3BV0A 1BQAA 5BJ4A 2WB6A 1M7YA 4W8IA 2VMQA 4AOAA 4IY7A 2VYCA 3RQ1A 3F9TA 1X29A 1DJ9A 3HQTA 4CVQA 4A0RA 1QITA 4A72A 1CJ0A 3HL2A 2W8VA 4KXKA 4Q31A 2W7MA 2FYFA 3FVUA 4ITGA 3RI6A 3DR4A 3UE8A 2AY3A 1MAPA 1SF2A 2Z61A 2W7FA 3BN1A 5M4DA 1LKCA 1YNUA 3BWNC 2VMRA 1KL1A 2RFVA 2DGKA 2G7JA 1ASBA 3AEJC 3I4JA 3P6KA 2X3LA 4WB0A 1D7UA 4K2MA 2QA3A 2W8JA 2JJFA 2VGWA 4RJYA 1QJ3A 2W7KA 1Z7DA 1JS6A 3W1IA 3NU8A 2HOZA 4MKJA 4F5IA 3JTXA 4WYEA 1AHYA 2AEUA 1TARA 4EFFA 2FM1A 2BI9A 2GMSA 3G0TA 3FVXA 3QN6A 4RKCA 2W7JA 1B5PA 1X28A 1PFFA 3FSLA 4R2NA 2QSRA 1AJRA 2DOUA 4OYTA 2ZP7A 2AY1A 4E77A 3H7FA 1BS0A 1AMAA 1PMOA 3PDBA 5DJ1A 2OKKA 1M6SA 3EUCA 3BWNA 1FC4A 3RBLA 2R5CB 4A6UA 4OBUA 3MC6C 3FQ8A 4N0WA 3AEJA 3EI7A 3MEBA 4WLJA 1KKPA 5EAAA 2GSAA 3AENB 4ZASA 3JWAA 1GC3A 2YCTA 3D6KA 4WXFA 4IXOA 5EFSA 4N0BA 2EZ2A 3UAKA 1D2FA 1FG3A 4M2MA 3UWCA 2QBTA 3COGA 1T3IA 4KAMA 1V2EA 5EUEA 3FQ7A 1GC2A 1PG8A 2Z9VA 3R9AA 1TOEA 1G4VA 1AIBA 2KFPA 3DODA 2Z67A 4GRXA 5FT4A 5JAYA 3KE3A 1ASNA 4IYOA 2D65A 2W7DA 4DBCA 4UHNA 1W7NA 3JZLA 1EQBA 2VLFA 4ZWMA 1B8GA 1RVYA 2GB3A 4ZLVA 4F5JA 3BS8A 3EI8A 3GETA 4ZWVA 1AHGA 2A1VA 2EGYA 1WYVB 2YCPA 5EIGB 4UOYA 3ELEA 1ASEA 2VMYA 4GSAA 1DGEA 1SFFA 3BCAA 3G7QA 4FL0A 3PGYA 4IW7A 2DKBA 3WKSA 3H14A 3ZRPA 3LVJA 4ZDLA 1D7RA 4K05A 5HXXA 3TQXA 5I92A 4ZDOA 1B4XA 1AX4A 2VMSA 3GWPA 4IXZA 5D5SA 1LW5A 4ISYA 1O69A 5EUDA 4RITA 3FD0A 2QLRA 3KGWA 3FTBA 3TCMA 4RLGA 1WKHA 1C7GA 1W7LA 1ASGA 1S07A 4XQ2A 3GZCA 4ZDPA 4AO4A 3VK3A 1IX7A 3BWOA 2YKUA 1S06A 1C7NA 3MADA 3W1HA 3AEPA 4A0FA 4ADDA 1AHXA 4PVFA 8AATA 1DTYA 2D66A 3FCRA 3JW9A 4ZM3A 1GCKA 3M5UA 4WYAA 2VMZA 4XJLA 2AY7A 2G6WA 1BQDA 1AMRA 5KTBA 4F5GA 3B8XA 3DRDA 2PB2A 1I41A 3QHXA 1S0AA 2VGTA 1UU2A 2CJHA 5E3KA 5M46A 4IXSA 3ZZJA 3DXWA 1VJOA 1OXOA 1ASMA 1QISA 4HVKA 3P1TA 1BJOA 2WKAA 3EIAA 3WLXA 3E2ZB 5C6UA 1M0OA 2F8JA 1W23A 1W3UA 3CBFA 4H51A 2VIBA 7AATA 3NX3A 4XAUA 1RV4A 1VP4A 1AY4A 2JG2A 1IX8A 2ZSLA 5F8VA 3PAAA 3N5MA 1TATA 4J5UA 4XJMA 3ISLA 1G4XA 4ATPA 1AAMA 3Q8NA 2BKWA 4GDYA 4EMYA 2EYQA 1ELUA 3OP7A 5FT5A 1ASLA 1KAFA 1CQ7A 1UU1A 1ELQA 4E1OA 5LH9A 2D5YA 4Y0HA 4CXQA 3WKRA 1TASA 3ZRRA 1LS3A 2BYLA 2VGVA 4OC9A 3FZ6A 3NYTA 3RBFA 1N31A 4XJPA 1M0QA 2BHXA 3PDXA 4MY5A 4CBRA 2BI3A 2O0RA 2VGZA 1CL1A 3HLMA 3I5TA 4Q75A 3F0HA 1J04A 4RM1A 5F9SA 3N7NA 4JF0A 2D64A 3NYUA 1V2DA 4CBSA 1X0MA 1WYUA 2CY8A 1DGDA 3PD6A 4ADCA 4EB5A 2ZC0A 3A9XA 2Z20A 2VI9A 3MAUA 3B1DA 4HF8A 4UHMA 1GEWA 1OXPA 2HUFA 3FVSA 1KL2A 2GMUA 4M2KA 2YRRA 3RCHA 4UHOA 2R2NA 2VMXA 3DZZA 3IF2A 2ZYJA 2WK9A 3N75A 2CSTA 4I8AA 5LHAA 1AJSB 4JEZA 4R8DA 3BCXA 2VMOA 1H0CA 5DJ9A 4QGRA 4PFFA 2YKVA 4MGRA 4WP0A 2EO5A 1YAAA 4W5KA 1M4NA 2CB1A 3EI9A 1JG8A 3A2BA 1BJWA 1RV3A 3K40A 2AEVA 4Q76A 4WD2A 1O61A 4ITXA 4MQQA 2ZSMA 3MAFB 1W7MA 1QIRA 1SZKA 2VGUA 3WCOA 9AATA 3ECDA 1I48A 1ZODA 3N4SA 2BYJA 1IAYA 5BJ3A 2CTZA 1YIYA 1PMMA 1WYTB 2C0RA 2VMPA 4A0HA 2CJDA 3HMUA 3E77A 4WYCA 1C0NA 3GZDC 3FDDA 2C44A 2YRIA 1S08A 2BWNA 3KGXA 3KKIA 1V72A 3W1JA 3I16A 1CS1A 1AHFA 3AOWA 4RKDA 4W1XA 4W91A 4A6RA 1ARTA 2WK8A 3VP6A 4E3RA 4AH3A 2BI1A 4WYDA 2GQNA 4TV7A 1IJIA
chains in the Genus database with same CATH topology
1TOGA 3QBOA 1TPLA 2X8UA 5E4ZA 2AY2A 2HUIA 4OT8A 2CANA 2HZPA 2JISA 2V0YA 3CQ4A 4ZAHA 2VLHA 3ACZA 4XJOA 4AO9A 2AY9A 3MC6A 4ADBA 3CAIA 3NUBA 3AEMC 1E5FA 3LVMA 1TOJA 3LY1A 3ZZKA 1GBNA 2W8UA 4CXRA 4F5MA 4MQPA 1ARIA 4O6ZA 1D7SA 5DX5A 3MKJA 1Y4IA 2X5DA 1BT4A 5EUNA 2AY5A 3CQ5A 4UQVA 3GJUA 2EH6A 1AMSA 2FNIA 3R4TA 4WYFA 5J8QA 4WB0B 1SZUA 2D7YA 4PIWA 4J8LA 1JS3A 1P3WA 1KKJA 1QJ5A 4JEYA 3G8MA 3VK4A 3EZ1A 1OHYA 3CQ6A 3HVYA 4OBVA 1YIZA 4A0GA 2CJGA 2ZY2A 4P7YA 1MAQA 3NU7A 3B1EA 1O4SA 1AY8A 3MBBA 5K8BA 5HHYA 1IUGA 2CH1A 3WGBA 1TOIA 4JEWA 2BI2A 4F5HA 3DU4A 4R5ZA 2FN6A 1J32A 4GE7A 3EIBA 1E5EA 3LWSA 2X5FA 3PDBB 2BIEA 2VIAA 1EG5A 3PPLA 3N4RA 2R5CA 4Y0IA 2AATA 3USFA 3WGCA 2BWPA 2C81A 2OGAA 4W1VA 3BCBA 3QI6A 3OKSA 3AOVA 4BQ0A 2HP2A 3AENA 3AELA 1C9CA 5IWQA 5G0AA 3DYDA 3EZSA 3RUYA 1B5OA 2AY4A 1KMKA 2FQ6A 2CH2A 3NYSA 2QMAA 4OMAA 4Q6RA 2JJHA 4OTLA 2JJEA 2O1BA 2VI8A 2ZY4A 3N0LA 5G4IA 3DXVA 4RAEA 4B9BA 4DQ6A 2YKYA 1GC0A 1GC4A 3AEMA 3VAXA 2E7JA 1OATA 2DGLA 3GR9A 4IYOB 4U2HA 1LK9A 3A8UX 1QGNA 4Y0DA 2W7IA 2EZ1A 3FKDA 3NUIA 4W1WA 3FZ8A 1O62A 4M2JA 1OHVA 1WYVA 4BHDA 2OKJA 4P3MA 4GEBA 4FFCA 5EIGA 5E5IA 1ASCA 4U1TA 1B9HA 4KYOA 1DJUA 4JE5A 1LC8A 1JF9A 4H63Q 1ASFA 1SZSA 3AEOA 1IBJA 4R5FA 1GDEA 1YJSA 3WCNA 1MLYA 1DKAA 1KMJA 1C4KA 1BW0A 2CINA 2HORA 2VMVA 2Z9XA 2FKIA 4NOGA 3TFTA 1AY5A 2ZUKA 3HT4A 4JE5D 3PIUA 3L8AA 1CQ8A 1LC7A 3L44A 1GEYA 2ZY5A 2BWOA 2R5EA 1N2TA 3QGUA 4LNJA 4B98A 1GEXA 2Q7WA 3FFHA 4MSOA 1TOKA 1C7OA 1I43A 1LW4A 1CZCA 3DC1A 1RVUA 3GSBA 1ARGA 3DR7A 3VOMA 3H9XA 4WYGA 1YJZA 4ADEA 2WK7A 3B1CA 4JEXA 1UKJA 2BIGA 1D7VA 1UU0A 2HOYA 3FDBA 2DKJA 2OATA 3BB8A 3ASBA 4RIZA 1AIAA 3HBXA 3AATA 3WZFA 4BA5A 2EPJA 1BJOB 3ATHA 3E2ZA 3HDOA 3WY7A 3EI6A 4K2IA 1FG7A 4A6TA 2W7HA 2E7IA 1MLZA 2HP1A 4GE9A 3QM2A 2ORDA 3ASAA 3BC8A 1BJNA 5FT8A 3NTJA 3F6TA 3T32A 4ZSYA 2XBNA 1MDOA 2W7EA 2PB0A 4BMKA 2CFBA 5G4JA 3FQAA 4LNMA 4XK1A 1S09A 1SPAA 1WKGA 1M32A 3NNKA 2VMWA 1AMQA 1LC5A 1MDZA 1X2AA 2DGMA 3LVLB 4OCAA 1AICA 2DR1A 2Z9WA 2JJGA 4PFNA 4TMRA 3ZRQA 4A00A 4MQRA 1Z3ZA 4F5KA 4TN4A 4AZKA 1N8PA 5M49A 4RJ0A 1ZOBA 2ZJGA 5TF5A 3E2YA 1VEFA 1XI9A 1DJEA 3LV2A 5G09A 3FFRA 4MKKA 4ATQA 3A9ZA 3K7YA 2O7CA 2HOXA 3A9YA 3E6GA 5G2QA 1WSTA 3GZDA 4LW2A 3FZ7A 4GE4A 3QPGA 5EQCA 3NDNA 3EI5A 2VGSA 3PJ0A 2W7LA 2YCNA 1WYUB 3JU7A 5DB5A 4EU1A 5M4BA 2BI5A 1AKBA 3PD6B 4AZJA 3LG0A 2V1PA 1G7WA 1BKGA 2YHKA 1EJIA 2QB3A 1H1CA 1MDXA 4IX8A 2Z9UA 4K2BA 3RCHB 1YJYA 2PO3A 4ZSWA 2R0TA 1YOOA 1ZC9A 3TATA 2E54A 3PA9A 3FRKA 4LNLA 1AJSA 1M0NA 2NMPA 1ECXA 1SVVA 3NRAA 5FT6A 3GBXA 2W8TA 4WXBA 4F5LA 4BA4A 2D7ZA 2XH1A 1BJ4A 1U08A 3N4XA 1G7XA 2Z1YA 1QZ9A 4JEVA 5D95A 1OHWA 3TFUA 2AY6A 3LVKA 1B9IA 5EAVA 3AV7A 4DGTA 2YOBA 3ELPA 1ASAA 2ZY3A 4XEWA 2VMUA 1ARHA 1CL2A 4LW4A 1AHEA 3E9KA 5AX8A 1IVRA 4LC3A 1MGVA 1XEYA 3MAFA 3JWBA 4F5FA 1CQ6A 2FNUA 4ZM4A 1AAWA 2VMTA 4L0OA 4E3QA 1I29A 3IHJA 3WX9A 2D63A 3B46A 4EB7A 2YKXA 2HUUA 2E7UA 1WYTA 4WLHA 1AKCA 1M0PA 1V2FA 2OQXA 4WXGA 2VMNA 2TPLA 4WBTA 2W8WA 1ASDA 2C7TA 3II0A 5HDMA 1CZEA 2OGEA 3K28A 5G2PA 2W7GA 1IX6A 4JF1A 1GD9A 2QB2A 4F4EA 2D61A 3E2FA 2Z1ZA 3VK2A 1ARSA 1ORDA 2BIAA 1AKAA 2JGTA 1IAXA 2AY8A 1DFOA 3BV0A 1BQAA 5BJ4A 2WB6A 1M7YA 4W8IA 2VMQA 4AOAA 4IY7A 2VYCA 3RQ1A 3F9TA 1X29A 1DJ9A 3HQTA 4CVQA 4A0RA 1QITA 4A72A 1CJ0A 3HL2A 2W8VA 4KXKA 4Q31A 2W7MA 2FYFA 3FVUA 4ITGA 3RI6A 3DR4A 3UE8A 2AY3A 1MAPA 1SF2A 2Z61A 2W7FA 3BN1A 5M4DA 1LKCA 1YNUA 3BWNC 2VMRA 1KL1A 2RFVA 2DGKA 2G7JA 1ASBA 3AEJC 3I4JA 3P6KA 2X3LA 4WB0A 1D7UA 4K2MA 2QA3A 2W8JA 2JJFA 2VGWA 4RJYA 1QJ3A 2W7KA 1Z7DA 1JS6A 3W1IA 3NU8A 2HOZA 4MKJA 4F5IA 3JTXA 4WYEA 1AHYA 2AEUA 1TARA 4EFFA 2FM1A 2BI9A 2GMSA 3G0TA 3FVXA 3QN6A 4RKCA 2W7JA 1B5PA 1X28A 1PFFA 3FSLA 4R2NA 2QSRA 1AJRA 2DOUA 4OYTA 2ZP7A 2AY1A 4E77A 3H7FA 1BS0A 1AMAA 1PMOA 3PDBA 5DJ1A 2OKKA 1M6SA 3EUCA 3BWNA 1FC4A 3RBLA 2R5CB 4A6UA 4OBUA 3MC6C 3FQ8A 4N0WA 3AEJA 3EI7A 3MEBA 4WLJA 1KKPA 5EAAA 2GSAA 3AENB 4ZASA 3JWAA 1GC3A 2YCTA 3D6KA 4WXFA 4IXOA 5EFSA 4N0BA 2EZ2A 3UAKA 1D2FA 1FG3A 4M2MA 3UWCA 2QBTA 3COGA 1T3IA 4KAMA 1V2EA 5EUEA 3FQ7A 1GC2A 1PG8A 2Z9VA 3R9AA 1TOEA 1G4VA 1AIBA 2KFPA 3DODA 2Z67A 4GRXA 5FT4A 5JAYA 3KE3A 1ASNA 4IYOA 2D65A 2W7DA 4DBCA 4UHNA 1W7NA 3JZLA 1EQBA 2VLFA 4ZWMA 1B8GA 1RVYA 2GB3A 4ZLVA 4F5JA 3BS8A 3EI8A 3GETA 4ZWVA 1AHGA 2A1VA 2EGYA 1WYVB 2YCPA 5EIGB 4UOYA 3ELEA 1ASEA 2VMYA 4GSAA 1DGEA 1SFFA 3BCAA 3G7QA 4FL0A 3PGYA 4IW7A 2DKBA 3WKSA 3H14A 3ZRPA 3LVJA 4ZDLA 1D7RA 4K05A 5HXXA 3TQXA 5I92A 4ZDOA 1B4XA 1AX4A 2VMSA 3GWPA 4IXZA 5D5SA 1LW5A 4ISYA 1O69A 5EUDA 4RITA 3FD0A 2QLRA 3KGWA 3FTBA 3TCMA 4RLGA 1WKHA 1C7GA 1W7LA 1ASGA 1S07A 4XQ2A 3GZCA 4ZDPA 4AO4A 3VK3A 1IX7A 3BWOA 2YKUA 1S06A 1C7NA 3MADA 3W1HA 3AEPA 4A0FA 4ADDA 1AHXA 4PVFA 8AATA 1DTYA 2D66A 3FCRA 3JW9A 4ZM3A 1GCKA 3M5UA 4WYAA 2VMZA 4XJLA 2AY7A 2G6WA 1BQDA 1AMRA 5KTBA 4F5GA 3B8XA 3DRDA 2PB2A 1I41A 3QHXA 1S0AA 2VGTA 1UU2A 2CJHA 5E3KA 5M46A 4IXSA 3ZZJA 3DXWA 1VJOA 1OXOA 1ASMA 1QISA 4HVKA 3P1TA 1BJOA 2WKAA 3EIAA 3WLXA 3E2ZB 5C6UA 1M0OA 2F8JA 1W23A 1W3UA 3CBFA 4H51A 2VIBA 7AATA 3NX3A 4XAUA 1RV4A 1VP4A 1AY4A 2JG2A 1IX8A 2ZSLA 5F8VA 3PAAA 3N5MA 1TATA 4J5UA 4XJMA 3ISLA 1G4XA 4ATPA 1AAMA 3Q8NA 2BKWA 4GDYA 4EMYA 2EYQA 1ELUA 3OP7A 5FT5A 1ASLA 1CQ7A 1UU1A 1ELQA 4E1OA 5LH9A 2D5YA 4Y0HA 4CXQA 3WKRA 1TASA 3ZRRA 1LS3A 2BYLA 2VGVA 4OC9A 3FZ6A 3NYTA 3RBFA 1N31A 4XJPA 1M0QA 2BHXA 3PDXA 4MY5A 4CBRA 2BI3A 2O0RA 2VGZA 1CL1A 3HLMA 3I5TA 4Q75A 3F0HA 1J04A 4RM1A 5F9SA 3N7NA 4JF0A 2D64A 3NYUA 1V2DA 4CBSA 1X0MA 1WYUA 2CY8A 1DGDA 3PD6A 4ADCA 4EB5A 2ZC0A 3A9XA 2Z20A 2VI9A 3MAUA 3B1DA 4HF8A 4UHMA 1GEWA 1OXPA 2HUFA 3FVSA 1KL2A 2GMUA 4M2KA 2YRRA 3RCHA 4UHOA 2R2NA 2VMXA 3DZZA 3IF2A 2ZYJA 2WK9A 3N75A 2CSTA 4I8AA 5LHAA 1AJSB 4JEZA 4R8DA 3BCXA 2VMOA 1H0CA 5DJ9A 4QGRA 4PFFA 2YKVA 4MGRA 4WP0A 2EO5A 1YAAA 4W5KA 1M4NA 2CB1A 3EI9A 1JG8A 3A2BA 1BJWA 1RV3A 3K40A 2AEVA 4Q76A 4WD2A 1O61A 4ITXA 4MQQA 2ZSMA 3MAFB 1W7MA 1QIRA 1SZKA 2VGUA 3WCOA 9AATA 3ECDA 1I48A 1ZODA 3N4SA 2BYJA 1IAYA 5BJ3A 2CTZA 1YIYA 1PMMA 1WYTB 2C0RA 2VMPA 4A0HA 2CJDA 3HMUA 3E77A 4WYCA 1C0NA 3GZDC 3FDDA 2C44A 2YRIA 1S08A 2BWNA 3KGXA 3KKIA 1V72A 3W1JA 3I16A 1CS1A 1AHFA 3AOWA 4RKDA 4W1XA 4W91A 4A6RA 1ARTA 2WK8A 3VP6A 4E3RA 4AH3A 2BI1A 4WYDA 2GQNA 4TV7A 1IJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOG A;  3QBO A;  1TPL A;  2X8U A;  5E4Z A;  2AY2 A;  2HUI A;  4OT8 A;  2CAN A;  2HZP A;  2JIS A;  2V0Y A;  3CQ4 A;  4ZAH A;  2VLH A;  3ACZ A;  4XJO A;  4AO9 A;  2AY9 A;  3MC6 A;  4ADB A;  3CAI A;  3NUB A;  3AEM C;  1E5F A;  3LVM A;  1TOJ A;  3LY1 A;  3ZZK A;  1GBN A;  2W8U A;  4CXR A;  4F5M A;  4MQP A;  1ARI A;  4O6Z A;  1D7S A;  5DX5 A;  3MKJ A;  1Y4I A;  2X5D A;  1BT4 A;  5EUN A;  2AY5 A;  3CQ5 A;  4UQV A;  3GJU A;  2EH6 A;  1AMS A;  2FNI A;  3R4T A;  4WYF A;  5J8Q A;  4WB0 B;  1SZU A;  2D7Y A;  4PIW A;  4J8L A;  1JS3 A;  1P3W A;  1KKJ A;  1QJ5 A;  4JEY A;  3G8M A;  3VK4 A;  3EZ1 A;  1OHY A;  3CQ6 A;  3HVY A;  4OBV A;  1YIZ A;  4A0G A;  2CJG A;  2ZY2 A;  4P7Y A;  1MAQ A;  3NU7 A;  3B1E A;  1O4S A;  1AY8 A;  3MBB A;  5K8B A;  5HHY A;  1IUG A;  2CH1 A;  3WGB A;  1TOI A;  4JEW A;  2BI2 A;  4F5H A;  3DU4 A;  4R5Z A;  2FN6 A;  1J32 A;  4GE7 A;  3EIB A;  1E5E A;  3LWS A;  2X5F A;  3PDB B;  2BIE A;  2VIA A;  1EG5 A;  3PPL A;  2R5C A;  4Y0I A;  2AAT A;  3USF A;  3WGC A;  2BWP A;  2C81 A;  2OGA A;  4W1V A;  3BCB A;  3QI6 A;  3OKS A;  3AOV A;  4BQ0 A;  2HP2 A;  3AEN A;  3AEL A;  1C9C A;  5IWQ A;  5G0A A;  3DYD A;  3EZS A;  3RUY A;  1B5O A;  2AY4 A;  1KMK A;  2FQ6 A;  2CH2 A;  3NYS A;  2QMA A;  4OMA A;  4Q6R A;  2JJH A;  4OTL A;  2JJE A;  2O1B A;  2VI8 A;  2ZY4 A;  3N0L A;  5G4I A;  3DXV A;  4RAE A;  4B9B A;  4DQ6 A;  2YKY A;  1GC0 A;  1GC4 A;  3AEM A;  3VAX A;  2E7J A;  1OAT A;  2DGL A;  3GR9 A;  4IYO B;  4U2H A;  1LK9 A;  3A8U X;  1QGN A;  4Y0D A;  2W7I A;  2EZ1 A;  3FKD A;  3NUI A;  4W1W A;  3FZ8 A;  1O62 A;  4M2J A;  1OHV A;  1WYV A;  4BHD A;  2OKJ A;  4P3M A;  4GEB A;  4FFC A;  5EIG A;  5E5I A;  1ASC A;  4U1T A;  1B9H A;  4KYO A;  1DJU A;  4JE5 A;  1LC8 A;  1JF9 A;  1ASF A;  1SZS A;  3AEO A;  1IBJ A;  4R5F A;  1GDE A;  1YJS A;  3WCN A;  1MLY A;  1DKA A;  1KMJ A;  1C4K A;  1BW0 A;  2CIN A;  2HOR A;  2VMV A;  2Z9X A;  4NOG A;  3TFT A;  1AY5 A;  2ZUK A;  3HT4 A;  4JE5 D;  3PIU A;  3L8A A;  1CQ8 A;  1LC7 A;  3L44 A;  1GEY A;  2ZY5 A;  2BWO A;  2R5E A;  1N2T A;  3QGU A;  4LNJ A;  4B98 A;  1GEX A;  2Q7W A;  3FFH A;  4MSO A;  1TOK A;  1C7O A;  1I43 A;  1LW4 A;  1CZC A;  3DC1 A;  1RVU A;  3GSB A;  1ARG A;  3DR7 A;  3VOM A;  4WYG A;  1YJZ A;  4ADE A;  2WK7 A;  3B1C A;  4JEX A;  1UKJ A;  2BIG A;  1D7V A;  1UU0 A;  2HOY A;  3FDB A;  2DKJ A;  2OAT A;  3BB8 A;  3ASB A;  4RIZ A;  1AIA A;  3HBX A;  3AAT A;  3WZF A;  4BA5 A;  2EPJ A;  1BJO B;  3ATH A;  3E2Z A;  3HDO A;  3WY7 A;  3EI6 A;  4K2I A;  1FG7 A;  4A6T A;  2W7H A;  2E7I A;  1MLZ A;  2HP1 A;  4GE9 A;  3QM2 A;  2ORD A;  3ASA A;  3BC8 A;  1BJN A;  5FT8 A;  3NTJ A;  3F6T A;  3T32 A;  4ZSY A;  2XBN A;  1MDO A;  2W7E A;  2PB0 A;  4BMK A;  2CFB A;  5G4J A;  3FQA A;  4LNM A;  4XK1 A;  1S09 A;  1SPA A;  1WKG A;  1M32 A;  3NNK A;  2VMW A;  1AMQ A;  1LC5 A;  1MDZ A;  1X2A A;  2DGM A;  3LVL B;  4OCA A;  1AIC A;  2DR1 A;  2Z9W A;  2JJG A;  4PFN A;  4TMR A;  3ZRQ A;  4A00 A;  4MQR A;  1Z3Z A;  4F5K A;  4TN4 A;  4AZK A;  1N8P A;  5M49 A;  4RJ0 A;  1ZOB A;  2ZJG A;  5TF5 A;  3E2Y A;  1VEF A;  1XI9 A;  1DJE A;  3LV2 A;  5G09 A;  3FFR A;  4MKK A;  4ATQ A;  3A9Z A;  3K7Y A;  2O7C A;  2HOX A;  3A9Y A;  3E6G A;  5G2Q A;  1WST A;  3GZD A;  4LW2 A;  3FZ7 A;  4GE4 A;  3QPG A;  5EQC A;  3NDN A;  3EI5 A;  2VGS A;  3PJ0 A;  2W7L A;  2YCN A;  1WYU B;  3JU7 A;  5DB5 A;  4EU1 A;  5M4B A;  2BI5 A;  1AKB A;  3PD6 B;  4AZJ A;  3LG0 A;  2V1P A;  1G7W A;  1BKG A;  2YHK A;  1EJI A;  2QB3 A;  1H1C A;  1MDX A;  4IX8 A;  2Z9U A;  4K2B A;  3RCH B;  1YJY A;  2PO3 A;  4ZSW A;  2R0T A;  1YOO A;  1ZC9 A;  3TAT A;  2E54 A;  3PA9 A;  3FRK A;  4LNL A;  1AJS A;  1M0N A;  2NMP A;  1ECX A;  1SVV A;  3NRA A;  5FT6 A;  3GBX A;  2W8T A;  4WXB A;  4F5L A;  4BA4 A;  2D7Z A;  2XH1 A;  1BJ4 A;  1U08 A;  1G7X A;  2Z1Y A;  1QZ9 A;  4JEV A;  5D95 A;  1OHW A;  3TFU A;  2AY6 A;  3LVK A;  1B9I A;  5EAV A;  3AV7 A;  4DGT A;  2YOB A;  3ELP A;  1ASA A;  2ZY3 A;  4XEW A;  2VMU A;  1ARH A;  1CL2 A;  4LW4 A;  1AHE A;  3E9K A;  5AX8 A;  1IVR A;  4LC3 A;  1MGV A;  1XEY A;  3MAF A;  3JWB A;  4F5F A;  1CQ6 A;  2FNU A;  4ZM4 A;  1AAW A;  2VMT A;  4L0O A;  4E3Q A;  1I29 A;  3IHJ A;  3WX9 A;  2D63 A;  3B46 A;  4EB7 A;  2YKX A;  2HUU A;  2E7U A;  1WYT A;  4WLH A;  1AKC A;  1M0P A;  1V2F A;  2OQX A;  4WXG A;  2VMN A;  2TPL A;  4WBT A;  2W8W A;  1ASD A;  2C7T A;  3II0 A;  5HDM A;  1CZE A;  2OGE A;  3K28 A;  5G2P A;  2W7G A;  1IX6 A;  4JF1 A;  1GD9 A;  2QB2 A;  4F4E A;  2D61 A;  3E2F A;  2Z1Z A;  3VK2 A;  1ARS A;  1ORD A;  2BIA A;  1AKA A;  2JGT A;  1IAX A;  2AY8 A;  1DFO A;  3BV0 A;  1BQA A;  5BJ4 A;  1M7Y A;  4W8I A;  2VMQ A;  4AOA A;  4IY7 A;  2VYC A;  3RQ1 A;  3F9T A;  1X29 A;  1DJ9 A;  3HQT A;  4CVQ A;  4A0R A;  1QIT A;  4A72 A;  1CJ0 A;  3HL2 A;  2W8V A;  4KXK A;  4Q31 A;  2W7M A;  2FYF A;  3FVU A;  4ITG A;  3RI6 A;  3DR4 A;  3UE8 A;  2AY3 A;  1MAP A;  1SF2 A;  2Z61 A;  2W7F A;  3BN1 A;  5M4D A;  1LKC A;  1YNU A;  3BWN C;  2VMR A;  1KL1 A;  2RFV A;  2DGK A;  1ASB A;  3AEJ C;  3I4J A;  3P6K A;  2X3L A;  4WB0 A;  1D7U A;  4K2M A;  2QA3 A;  2W8J A;  2JJF A;  2VGW A;  4RJY A;  1QJ3 A;  2W7K A;  1Z7D A;  1JS6 A;  3W1I A;  3NU8 A;  2HOZ A;  4MKJ A;  4F5I A;  3JTX A;  4WYE A;  1AHY A;  2AEU A;  1TAR A;  4EFF A;  2FM1 A;  2BI9 A;  2GMS A;  3G0T A;  3FVX A;  3QN6 A;  4RKC A;  2W7J A;  1B5P A;  1X28 A;  1PFF A;  3FSL A;  4R2N A;  1AJR A;  2DOU A;  4OYT A;  2ZP7 A;  2AY1 A;  4E77 A;  3H7F A;  1BS0 A;  1AMA A;  1PMO A;  3PDB A;  5DJ1 A;  2OKK A;  1M6S A;  3EUC A;  3BWN A;  1FC4 A;  3RBL A;  2R5C B;  4A6U A;  4OBU A;  3MC6 C;  3FQ8 A;  4N0W A;  3AEJ A;  3EI7 A;  3MEB A;  4WLJ A;  1KKP A;  5EAA A;  2GSA A;  3AEN B;  4ZAS A;  3JWA A;  1GC3 A;  2YCT A;  3D6K A;  4WXF A;  4IXO A;  5EFS A;  4N0B A;  2EZ2 A;  3UAK A;  1D2F A;  1FG3 A;  4M2M A;  3UWC A;  2QBT A;  3COG A;  1T3I A;  4KAM A;  1V2E A;  5EUE A;  3FQ7 A;  1GC2 A;  1PG8 A;  2Z9V A;  3R9A A;  1TOE A;  1G4V A;  1AIB A;  3DOD A;  2Z67 A;  4GRX A;  5FT4 A;  5JAY A;  3KE3 A;  1ASN A;  4IYO A;  2D65 A;  2W7D A;  4DBC A;  4UHN A;  1W7N A;  3JZL A;  1EQB A;  2VLF A;  4ZWM A;  1B8G A;  1RVY A;  2GB3 A;  4ZLV A;  4F5J A;  3BS8 A;  3EI8 A;  3GET A;  4ZWV A;  1AHG A;  2EGY A;  1WYV B;  2YCP A;  5EIG B;  4UOY A;  3ELE A;  1ASE A;  2VMY A;  4GSA A;  1DGE A;  1SFF A;  3BCA A;  3G7Q A;  4FL0 A;  3PGY A;  4IW7 A;  2DKB A;  3WKS A;  3H14 A;  3ZRP A;  3LVJ A;  4ZDL A;  1D7R A;  5HXX A;  3TQX A;  5I92 A;  4ZDO A;  1B4X A;  1AX4 A;  2VMS A;  3GWP A;  4IXZ A;  5D5S A;  1LW5 A;  4ISY A;  1O69 A;  5EUD A;  4RIT A;  3FD0 A;  2QLR A;  3KGW A;  3FTB A;  3TCM A;  4RLG A;  1WKH A;  1C7G A;  1W7L A;  1ASG A;  1S07 A;  4XQ2 A;  3GZC A;  4ZDP A;  4AO4 A;  3VK3 A;  1IX7 A;  3BWO A;  2YKU A;  1S06 A;  1C7N A;  3MAD A;  3W1H A;  3AEP A;  4A0F A;  4ADD A;  1AHX A;  4PVF A;  8AAT A;  1DTY A;  2D66 A;  3FCR A;  3JW9 A;  4ZM3 A;  1GCK A;  3M5U A;  4WYA A;  2VMZ A;  4XJL A;  2AY7 A;  2G6W A;  1BQD A;  1AMR A;  4F5G A;  3B8X A;  3DRD A;  2PB2 A;  1I41 A;  3QHX A;  1S0A A;  2VGT A;  1UU2 A;  2CJH A;  5E3K A;  5M46 A;  4IXS A;  3ZZJ A;  3DXW A;  1VJO A;  1OXO A;  1ASM A;  1QIS A;  4HVK A;  3P1T A;  1BJO A;  2WKA A;  3EIA A;  3WLX A;  3E2Z B;  5C6U A;  1M0O A;  2F8J A;  1W23 A;  1W3U A;  3CBF A;  4H51 A;  2VIB A;  7AAT A;  3NX3 A;  4XAU A;  1RV4 A;  1VP4 A;  1AY4 A;  2JG2 A;  1IX8 A;  2ZSL A;  5F8V A;  3PAA A;  3N5M A;  1TAT A;  4J5U A;  4XJM A;  3ISL A;  1G4X A;  4ATP A;  1AAM A;  3Q8N A;  2BKW A;  4GDY A;  4EMY A;  1ELU A;  3OP7 A;  5FT5 A;  1ASL A;  1CQ7 A;  1UU1 A;  1ELQ A;  4E1O A;  5LH9 A;  2D5Y A;  4Y0H A;  4CXQ A;  3WKR A;  1TAS A;  3ZRR A;  1LS3 A;  2BYL A;  2VGV A;  4OC9 A;  3FZ6 A;  3NYT A;  3RBF A;  1N31 A;  4XJP A;  1M0Q A;  2BHX A;  3PDX A;  4MY5 A;  4CBR A;  2BI3 A;  2O0R A;  2VGZ A;  1CL1 A;  3HLM A;  3I5T A;  4Q75 A;  3F0H A;  1J04 A;  4RM1 A;  5F9S A;  4JF0 A;  2D64 A;  3NYU A;  1V2D A;  4CBS A;  1X0M A;  1WYU A;  2CY8 A;  1DGD A;  3PD6 A;  4ADC A;  4EB5 A;  2ZC0 A;  3A9X A;  2Z20 A;  2VI9 A;  3MAU A;  3B1D A;  4HF8 A;  4UHM A;  1GEW A;  1OXP A;  2HUF A;  3FVS A;  1KL2 A;  2GMU A;  4M2K A;  2YRR A;  3RCH A;  4UHO A;  2R2N A;  2VMX A;  3DZZ A;  3IF2 A;  2ZYJ A;  2WK9 A;  3N75 A;  2CST A;  4I8A A;  5LHA A;  1AJS B;  4JEZ A;  4R8D A;  3BCX A;  2VMO A;  1H0C A;  5DJ9 A;  4QGR A;  4PFF A;  2YKV A;  4MGR A;  4WP0 A;  2EO5 A;  1YAA A;  4W5K A;  1M4N A;  2CB1 A;  3EI9 A;  1JG8 A;  3A2B A;  1BJW A;  1RV3 A;  3K40 A;  2AEV A;  4Q76 A;  4WD2 A;  1O61 A;  4ITX A;  4MQQ A;  2ZSM A;  3MAF B;  1W7M A;  1QIR A;  1SZK A;  2VGU A;  3WCO A;  9AAT A;  3ECD A;  1I48 A;  1ZOD A;  2BYJ A;  1IAY A;  5BJ3 A;  2CTZ A;  1YIY A;  1PMM A;  1WYT B;  2C0R A;  2VMP A;  4A0H A;  2CJD A;  3HMU A;  3E77 A;  4WYC A;  1C0N A;  3GZD C;  3FDD A;  2C44 A;  2YRI A;  1S08 A;  2BWN A;  3KGX A;  3KKI A;  1V72 A;  3W1J A;  3I16 A;  1CS1 A;  1AHF A;  3AOW A;  4RKD A;  4W1X A;  4W91 A;  4A6R A;  1ART A;  2WK8 A;  3VP6 A;  4E3R A;  4AH3 A;  2BI1 A;  4WYD A;  2GQN A;  4TV7 A;  1IJI A; 
#chains in the Genus database with same CATH topology
 1TOG A;  3QBO A;  1TPL A;  2X8U A;  5E4Z A;  2AY2 A;  2HUI A;  4OT8 A;  2CAN A;  2HZP A;  2JIS A;  2V0Y A;  3CQ4 A;  4ZAH A;  2VLH A;  3ACZ A;  4XJO A;  4AO9 A;  2AY9 A;  3MC6 A;  4ADB A;  3CAI A;  3NUB A;  3AEM C;  1E5F A;  3LVM A;  1TOJ A;  3LY1 A;  3ZZK A;  1GBN A;  2W8U A;  4CXR A;  4F5M A;  4MQP A;  1ARI A;  4O6Z A;  1D7S A;  5DX5 A;  3MKJ A;  1Y4I A;  2X5D A;  1BT4 A;  5EUN A;  2AY5 A;  3CQ5 A;  4UQV A;  3GJU A;  2EH6 A;  1AMS A;  2FNI A;  3R4T A;  4WYF A;  5J8Q A;  4WB0 B;  1SZU A;  2D7Y A;  4PIW A;  4J8L A;  1JS3 A;  1P3W A;  1KKJ A;  1QJ5 A;  4JEY A;  3G8M A;  3VK4 A;  3EZ1 A;  1OHY A;  3CQ6 A;  3HVY A;  4OBV A;  1YIZ A;  4A0G A;  2CJG A;  2ZY2 A;  4P7Y A;  1MAQ A;  3NU7 A;  3B1E A;  1O4S A;  1AY8 A;  3MBB A;  5K8B A;  5HHY A;  1IUG A;  2CH1 A;  3WGB A;  1TOI A;  4JEW A;  2BI2 A;  4F5H A;  3DU4 A;  4R5Z A;  2FN6 A;  1J32 A;  4GE7 A;  3EIB A;  1E5E A;  3LWS A;  2X5F A;  3PDB B;  2BIE A;  2VIA A;  1EG5 A;  3PPL A;  3N4R A;  2R5C A;  4Y0I A;  2AAT A;  3USF A;  3WGC A;  2BWP A;  2C81 A;  2OGA A;  4W1V A;  3BCB A;  3QI6 A;  3OKS A;  3AOV A;  4BQ0 A;  2HP2 A;  3AEN A;  3AEL A;  1C9C A;  5IWQ A;  5G0A A;  3DYD A;  3EZS A;  3RUY A;  1B5O A;  2AY4 A;  1KMK A;  2FQ6 A;  2CH2 A;  3NYS A;  2QMA A;  4OMA A;  4Q6R A;  2JJH A;  4OTL A;  2JJE A;  2O1B A;  2VI8 A;  2ZY4 A;  3N0L A;  5G4I A;  3DXV A;  4RAE A;  4B9B A;  4DQ6 A;  2YKY A;  1GC0 A;  1GC4 A;  3AEM A;  3VAX A;  2E7J A;  1OAT A;  2DGL A;  3GR9 A;  4IYO B;  4U2H A;  1LK9 A;  3A8U X;  1QGN A;  4Y0D A;  2W7I A;  2EZ1 A;  3FKD A;  3NUI A;  4W1W A;  3FZ8 A;  1O62 A;  4M2J A;  1OHV A;  1WYV A;  4BHD A;  2OKJ A;  4P3M A;  4GEB A;  4FFC A;  5EIG A;  5E5I A;  1ASC A;  4U1T A;  1B9H A;  4KYO A;  1DJU A;  4JE5 A;  1LC8 A;  1JF9 A;  4H63 Q;  1ASF A;  1SZS A;  3AEO A;  1IBJ A;  4R5F A;  1GDE A;  1YJS A;  3WCN A;  1MLY A;  1DKA A;  1KMJ A;  1C4K A;  1BW0 A;  2CIN A;  2HOR A;  2VMV A;  2Z9X A;  2FKI A;  4NOG A;  3TFT A;  1AY5 A;  2ZUK A;  3HT4 A;  4JE5 D;  3PIU A;  3L8A A;  1CQ8 A;  1LC7 A;  3L44 A;  1GEY A;  2ZY5 A;  2BWO A;  2R5E A;  1N2T A;  3QGU A;  4LNJ A;  4B98 A;  1GEX A;  2Q7W A;  3FFH A;  4MSO A;  1TOK A;  1C7O A;  1I43 A;  1LW4 A;  1CZC A;  3DC1 A;  1RVU A;  3GSB A;  1ARG A;  3DR7 A;  3VOM A;  3H9X A;  4WYG A;  1YJZ A;  4ADE A;  2WK7 A;  3B1C A;  4JEX A;  1UKJ A;  2BIG A;  1D7V A;  1UU0 A;  2HOY A;  3FDB A;  2DKJ A;  2OAT A;  3BB8 A;  3ASB A;  4RIZ A;  1AIA A;  3HBX A;  3AAT A;  3WZF A;  4BA5 A;  2EPJ A;  1BJO B;  3ATH A;  3E2Z A;  3HDO A;  3WY7 A;  3EI6 A;  4K2I A;  1FG7 A;  4A6T A;  2W7H A;  2E7I A;  1MLZ A;  2HP1 A;  4GE9 A;  3QM2 A;  2ORD A;  3ASA A;  3BC8 A;  1BJN A;  5FT8 A;  3NTJ A;  3F6T A;  3T32 A;  4ZSY A;  2XBN A;  1MDO A;  2W7E A;  2PB0 A;  4BMK A;  2CFB A;  5G4J A;  3FQA A;  4LNM A;  4XK1 A;  1S09 A;  1SPA A;  1WKG A;  1M32 A;  3NNK A;  2VMW A;  1AMQ A;  1LC5 A;  1MDZ A;  1X2A A;  2DGM A;  3LVL B;  4OCA A;  1AIC A;  2DR1 A;  2Z9W A;  2JJG A;  4PFN A;  4TMR A;  3ZRQ A;  4A00 A;  4MQR A;  1Z3Z A;  4F5K A;  4TN4 A;  4AZK A;  1N8P A;  5M49 A;  4RJ0 A;  1ZOB A;  2ZJG A;  5TF5 A;  3E2Y A;  1VEF A;  1XI9 A;  1DJE A;  3LV2 A;  5G09 A;  3FFR A;  4MKK A;  4ATQ A;  3A9Z A;  3K7Y A;  2O7C A;  2HOX A;  3A9Y A;  3E6G A;  5G2Q A;  1WST A;  3GZD A;  4LW2 A;  3FZ7 A;  4GE4 A;  3QPG A;  5EQC A;  3NDN A;  3EI5 A;  2VGS A;  3PJ0 A;  2W7L A;  2YCN A;  1WYU B;  3JU7 A;  5DB5 A;  4EU1 A;  5M4B A;  2BI5 A;  1AKB A;  3PD6 B;  4AZJ A;  3LG0 A;  2V1P A;  1G7W A;  1BKG A;  2YHK A;  1EJI A;  2QB3 A;  1H1C A;  1MDX A;  4IX8 A;  2Z9U A;  4K2B A;  3RCH B;  1YJY A;  2PO3 A;  4ZSW A;  2R0T A;  1YOO A;  1ZC9 A;  3TAT A;  2E54 A;  3PA9 A;  3FRK A;  4LNL A;  1AJS A;  1M0N A;  2NMP A;  1ECX A;  1SVV A;  3NRA A;  5FT6 A;  3GBX A;  2W8T A;  4WXB A;  4F5L A;  4BA4 A;  2D7Z A;  2XH1 A;  1BJ4 A;  1U08 A;  3N4X A;  1G7X A;  2Z1Y A;  1QZ9 A;  4JEV A;  5D95 A;  1OHW A;  3TFU A;  2AY6 A;  3LVK A;  1B9I A;  5EAV A;  3AV7 A;  4DGT A;  2YOB A;  3ELP A;  1ASA A;  2ZY3 A;  4XEW A;  2VMU A;  1ARH A;  1CL2 A;  4LW4 A;  1AHE A;  3E9K A;  5AX8 A;  1IVR A;  4LC3 A;  1MGV A;  1XEY A;  3MAF A;  3JWB A;  4F5F A;  1CQ6 A;  2FNU A;  4ZM4 A;  1AAW A;  2VMT A;  4L0O A;  4E3Q A;  1I29 A;  3IHJ A;  3WX9 A;  2D63 A;  3B46 A;  4EB7 A;  2YKX A;  2HUU A;  2E7U A;  1WYT A;  4WLH A;  1AKC A;  1M0P A;  1V2F A;  2OQX A;  4WXG A;  2VMN A;  2TPL A;  4WBT A;  2W8W A;  1ASD A;  2C7T A;  3II0 A;  5HDM A;  1CZE A;  2OGE A;  3K28 A;  5G2P A;  2W7G A;  1IX6 A;  4JF1 A;  1GD9 A;  2QB2 A;  4F4E A;  2D61 A;  3E2F A;  2Z1Z A;  3VK2 A;  1ARS A;  1ORD A;  2BIA A;  1AKA A;  2JGT A;  1IAX A;  2AY8 A;  1DFO A;  3BV0 A;  1BQA A;  5BJ4 A;  2WB6 A;  1M7Y A;  4W8I A;  2VMQ A;  4AOA A;  4IY7 A;  2VYC A;  3RQ1 A;  3F9T A;  1X29 A;  1DJ9 A;  3HQT A;  4CVQ A;  4A0R A;  1QIT A;  4A72 A;  1CJ0 A;  3HL2 A;  2W8V A;  4KXK A;  4Q31 A;  2W7M A;  2FYF A;  3FVU A;  4ITG A;  3RI6 A;  3DR4 A;  3UE8 A;  2AY3 A;  1MAP A;  1SF2 A;  2Z61 A;  2W7F A;  3BN1 A;  5M4D A;  1LKC A;  1YNU A;  3BWN C;  2VMR A;  1KL1 A;  2RFV A;  2DGK A;  2G7J A;  1ASB A;  3AEJ C;  3I4J A;  3P6K A;  2X3L A;  4WB0 A;  1D7U A;  4K2M A;  2QA3 A;  2W8J A;  2JJF A;  2VGW A;  4RJY A;  1QJ3 A;  2W7K A;  1Z7D A;  1JS6 A;  3W1I A;  3NU8 A;  2HOZ A;  4MKJ A;  4F5I A;  3JTX A;  4WYE A;  1AHY A;  2AEU A;  1TAR A;  4EFF A;  2FM1 A;  2BI9 A;  2GMS A;  3G0T A;  3FVX A;  3QN6 A;  4RKC A;  2W7J A;  1B5P A;  1X28 A;  1PFF A;  3FSL A;  4R2N A;  2QSR A;  1AJR A;  2DOU A;  4OYT A;  2ZP7 A;  2AY1 A;  4E77 A;  3H7F A;  1BS0 A;  1AMA A;  1PMO A;  3PDB A;  5DJ1 A;  2OKK A;  1M6S A;  3EUC A;  3BWN A;  1FC4 A;  3RBL A;  2R5C B;  4A6U A;  4OBU A;  3MC6 C;  3FQ8 A;  4N0W A;  3AEJ A;  3EI7 A;  3MEB A;  4WLJ A;  1KKP A;  5EAA A;  2GSA A;  3AEN B;  4ZAS A;  3JWA A;  1GC3 A;  2YCT A;  3D6K A;  4WXF A;  4IXO A;  5EFS A;  4N0B A;  2EZ2 A;  3UAK A;  1D2F A;  1FG3 A;  4M2M A;  3UWC A;  2QBT A;  3COG A;  1T3I A;  4KAM A;  1V2E A;  5EUE A;  3FQ7 A;  1GC2 A;  1PG8 A;  2Z9V A;  3R9A A;  1TOE A;  1G4V A;  1AIB A;  2KFP A;  3DOD A;  2Z67 A;  4GRX A;  5FT4 A;  5JAY A;  3KE3 A;  1ASN A;  4IYO A;  2D65 A;  2W7D A;  4DBC A;  4UHN A;  1W7N A;  3JZL A;  1EQB A;  2VLF A;  4ZWM A;  1B8G A;  1RVY A;  2GB3 A;  4ZLV A;  4F5J A;  3BS8 A;  3EI8 A;  3GET A;  4ZWV A;  1AHG A;  2A1V A;  2EGY A;  1WYV B;  2YCP A;  5EIG B;  4UOY A;  3ELE A;  1ASE A;  2VMY A;  4GSA A;  1DGE A;  1SFF A;  3BCA A;  3G7Q A;  4FL0 A;  3PGY A;  4IW7 A;  2DKB A;  3WKS A;  3H14 A;  3ZRP A;  3LVJ A;  4ZDL A;  1D7R A;  4K05 A;  5HXX A;  3TQX A;  5I92 A;  4ZDO A;  1B4X A;  1AX4 A;  2VMS A;  3GWP A;  4IXZ A;  5D5S A;  1LW5 A;  4ISY A;  1O69 A;  5EUD A;  4RIT A;  3FD0 A;  2QLR A;  3KGW A;  3FTB A;  3TCM A;  4RLG A;  1WKH A;  1C7G A;  1W7L A;  1ASG A;  1S07 A;  4XQ2 A;  3GZC A;  4ZDP A;  4AO4 A;  3VK3 A;  1IX7 A;  3BWO A;  2YKU A;  1S06 A;  1C7N A;  3MAD A;  3W1H A;  3AEP A;  4A0F A;  4ADD A;  1AHX A;  4PVF A;  8AAT A;  1DTY A;  2D66 A;  3FCR A;  3JW9 A;  4ZM3 A;  1GCK A;  3M5U A;  4WYA A;  2VMZ A;  4XJL A;  2AY7 A;  2G6W A;  1BQD A;  1AMR A;  5KTB A;  4F5G A;  3B8X A;  3DRD A;  2PB2 A;  1I41 A;  3QHX A;  1S0A A;  2VGT A;  1UU2 A;  2CJH A;  5E3K A;  5M46 A;  4IXS A;  3ZZJ A;  3DXW A;  1VJO A;  1OXO A;  1ASM A;  1QIS A;  4HVK A;  3P1T A;  1BJO A;  2WKA A;  3EIA A;  3WLX A;  3E2Z B;  5C6U A;  1M0O A;  2F8J A;  1W23 A;  1W3U A;  3CBF A;  4H51 A;  2VIB A;  7AAT A;  3NX3 A;  4XAU A;  1RV4 A;  1VP4 A;  1AY4 A;  2JG2 A;  1IX8 A;  2ZSL A;  5F8V A;  3PAA A;  3N5M A;  1TAT A;  4J5U A;  4XJM A;  3ISL A;  1G4X A;  4ATP A;  1AAM A;  3Q8N A;  2BKW A;  4GDY A;  4EMY A;  2EYQ A;  1ELU A;  3OP7 A;  5FT5 A;  1ASL A;  1KAF A;  1CQ7 A;  1UU1 A;  1ELQ A;  4E1O A;  5LH9 A;  2D5Y A;  4Y0H A;  4CXQ A;  3WKR A;  1TAS A;  3ZRR A;  1LS3 A;  2BYL A;  2VGV A;  4OC9 A;  3FZ6 A;  3NYT A;  3RBF A;  1N31 A;  4XJP A;  1M0Q A;  2BHX A;  3PDX A;  4MY5 A;  4CBR A;  2BI3 A;  2O0R A;  2VGZ A;  1CL1 A;  3HLM A;  3I5T A;  4Q75 A;  3F0H A;  1J04 A;  4RM1 A;  5F9S A;  3N7N A;  4JF0 A;  2D64 A;  3NYU A;  1V2D A;  4CBS A;  1X0M A;  1WYU A;  2CY8 A;  1DGD A;  3PD6 A;  4ADC A;  4EB5 A;  2ZC0 A;  3A9X A;  2Z20 A;  2VI9 A;  3MAU A;  3B1D A;  4HF8 A;  4UHM A;  1GEW A;  1OXP A;  2HUF A;  3FVS A;  1KL2 A;  2GMU A;  4M2K A;  2YRR A;  3RCH A;  4UHO A;  2R2N A;  2VMX A;  3DZZ A;  3IF2 A;  2ZYJ A;  2WK9 A;  3N75 A;  2CST A;  4I8A A;  5LHA A;  1AJS B;  4JEZ A;  4R8D A;  3BCX A;  2VMO A;  1H0C A;  5DJ9 A;  4QGR A;  4PFF A;  2YKV A;  4MGR A;  4WP0 A;  2EO5 A;  1YAA A;  4W5K A;  1M4N A;  2CB1 A;  3EI9 A;  1JG8 A;  3A2B A;  1BJW A;  1RV3 A;  3K40 A;  2AEV A;  4Q76 A;  4WD2 A;  1O61 A;  4ITX A;  4MQQ A;  2ZSM A;  3MAF B;  1W7M A;  1QIR A;  1SZK A;  2VGU A;  3WCO A;  9AAT A;  3ECD A;  1I48 A;  1ZOD A;  3N4S A;  2BYJ A;  1IAY A;  5BJ3 A;  2CTZ A;  1YIY A;  1PMM A;  1WYT B;  2C0R A;  2VMP A;  4A0H A;  2CJD A;  3HMU A;  3E77 A;  4WYC A;  1C0N A;  3GZD C;  3FDD A;  2C44 A;  2YRI A;  1S08 A;  2BWN A;  3KGX A;  3KKI A;  1V72 A;  3W1J A;  3I16 A;  1CS1 A;  1AHF A;  3AOW A;  4RKD A;  4W1X A;  4W91 A;  4A6R A;  1ART A;  2WK8 A;  3VP6 A;  4E3R A;  4AH3 A;  2BI1 A;  4WYD A;  2GQN A;  4TV7 A;  1IJI A; 
#chains in the Genus database with same CATH homology
 1TOG A;  3QBO A;  1TPL A;  2X8U A;  5E4Z A;  2AY2 A;  2HUI A;  4OT8 A;  2CAN A;  2HZP A;  2JIS A;  2V0Y A;  3CQ4 A;  4ZAH A;  2VLH A;  3ACZ A;  4XJO A;  4AO9 A;  2AY9 A;  3MC6 A;  4ADB A;  3CAI A;  3NUB A;  3AEM C;  1E5F A;  3LVM A;  1TOJ A;  3LY1 A;  3ZZK A;  1GBN A;  2W8U A;  4CXR A;  4F5M A;  4MQP A;  1ARI A;  4O6Z A;  1D7S A;  5DX5 A;  3MKJ A;  1Y4I A;  2X5D A;  1BT4 A;  5EUN A;  2AY5 A;  3CQ5 A;  4UQV A;  3GJU A;  2EH6 A;  1AMS A;  2FNI A;  3R4T A;  4WYF A;  5J8Q A;  4WB0 B;  1SZU A;  2D7Y A;  4PIW A;  4J8L A;  1JS3 A;  1P3W A;  1KKJ A;  1QJ5 A;  4JEY A;  3G8M A;  3VK4 A;  3EZ1 A;  1OHY A;  3CQ6 A;  3HVY A;  4OBV A;  1YIZ A;  4A0G A;  2CJG A;  2ZY2 A;  4P7Y A;  1MAQ A;  3NU7 A;  3B1E A;  1O4S A;  1AY8 A;  3MBB A;  5K8B A;  5HHY A;  1IUG A;  2CH1 A;  3WGB A;  1TOI A;  4JEW A;  2BI2 A;  4F5H A;  3DU4 A;  4R5Z A;  2FN6 A;  1J32 A;  4GE7 A;  3EIB A;  1E5E A;  3LWS A;  2X5F A;  3PDB B;  2BIE A;  2VIA A;  1EG5 A;  3PPL A;  3N4R A;  2R5C A;  4Y0I A;  2AAT A;  3USF A;  3WGC A;  2BWP A;  2C81 A;  2OGA A;  4W1V A;  3BCB A;  3QI6 A;  3OKS A;  3AOV A;  4BQ0 A;  2HP2 A;  3AEN A;  3AEL A;  1C9C A;  5IWQ A;  5G0A A;  3DYD A;  3EZS A;  3RUY A;  1B5O A;  2AY4 A;  1KMK A;  2FQ6 A;  2CH2 A;  3NYS A;  2QMA A;  4OMA A;  4Q6R A;  2JJH A;  4OTL A;  2JJE A;  2O1B A;  2VI8 A;  2ZY4 A;  3N0L A;  5G4I A;  3DXV A;  4RAE A;  4B9B A;  4DQ6 A;  2YKY A;  1GC0 A;  1GC4 A;  3AEM A;  3VAX A;  2E7J A;  1OAT A;  2DGL A;  3GR9 A;  4IYO B;  4U2H A;  1LK9 A;  3A8U X;  1QGN A;  4Y0D A;  2W7I A;  2EZ1 A;  3FKD A;  3NUI A;  4W1W A;  3FZ8 A;  1O62 A;  4M2J A;  1OHV A;  1WYV A;  4BHD A;  2OKJ A;  4P3M A;  4GEB A;  4FFC A;  5EIG A;  5E5I A;  1ASC A;  4U1T A;  1B9H A;  4KYO A;  1DJU A;  4JE5 A;  1LC8 A;  1JF9 A;  4H63 Q;  1ASF A;  1SZS A;  3AEO A;  1IBJ A;  4R5F A;  1GDE A;  1YJS A;  3WCN A;  1MLY A;  1DKA A;  1KMJ A;  1C4K A;  1BW0 A;  2CIN A;  2HOR A;  2VMV A;  2Z9X A;  2FKI A;  4NOG A;  3TFT A;  1AY5 A;  2ZUK A;  3HT4 A;  4JE5 D;  3PIU A;  3L8A A;  1CQ8 A;  1LC7 A;  3L44 A;  1GEY A;  2ZY5 A;  2BWO A;  2R5E A;  1N2T A;  3QGU A;  4LNJ A;  4B98 A;  1GEX A;  2Q7W A;  3FFH A;  4MSO A;  1TOK A;  1C7O A;  1I43 A;  1LW4 A;  1CZC A;  3DC1 A;  1RVU A;  3GSB A;  1ARG A;  3DR7 A;  3VOM A;  3H9X A;  4WYG A;  1YJZ A;  4ADE A;  2WK7 A;  3B1C A;  4JEX A;  1UKJ A;  2BIG A;  1D7V A;  1UU0 A;  2HOY A;  3FDB A;  2DKJ A;  2OAT A;  3BB8 A;  3ASB A;  4RIZ A;  1AIA A;  3HBX A;  3AAT A;  3WZF A;  4BA5 A;  2EPJ A;  1BJO B;  3ATH A;  3E2Z A;  3HDO A;  3WY7 A;  3EI6 A;  4K2I A;  1FG7 A;  4A6T A;  2W7H A;  2E7I A;  1MLZ A;  2HP1 A;  4GE9 A;  3QM2 A;  2ORD A;  3ASA A;  3BC8 A;  1BJN A;  5FT8 A;  3NTJ A;  3F6T A;  3T32 A;  4ZSY A;  2XBN A;  1MDO A;  2W7E A;  2PB0 A;  4BMK A;  2CFB A;  5G4J A;  3FQA A;  4LNM A;  4XK1 A;  1S09 A;  1SPA A;  1WKG A;  1M32 A;  3NNK A;  2VMW A;  1AMQ A;  1LC5 A;  1MDZ A;  1X2A A;  2DGM A;  3LVL B;  4OCA A;  1AIC A;  2DR1 A;  2Z9W A;  2JJG A;  4PFN A;  4TMR A;  3ZRQ A;  4A00 A;  4MQR A;  1Z3Z A;  4F5K A;  4TN4 A;  4AZK A;  1N8P A;  5M49 A;  4RJ0 A;  1ZOB A;  2ZJG A;  5TF5 A;  3E2Y A;  1VEF A;  1XI9 A;  1DJE A;  3LV2 A;  5G09 A;  3FFR A;  4MKK A;  4ATQ A;  3A9Z A;  3K7Y A;  2O7C A;  2HOX A;  3A9Y A;  3E6G A;  5G2Q A;  1WST A;  3GZD A;  4LW2 A;  3FZ7 A;  4GE4 A;  3QPG A;  5EQC A;  3NDN A;  3EI5 A;  2VGS A;  3PJ0 A;  2W7L A;  2YCN A;  1WYU B;  3JU7 A;  5DB5 A;  4EU1 A;  5M4B A;  2BI5 A;  1AKB A;  3PD6 B;  4AZJ A;  3LG0 A;  2V1P A;  1G7W A;  1BKG A;  2YHK A;  1EJI A;  2QB3 A;  1H1C A;  1MDX A;  4IX8 A;  2Z9U A;  4K2B A;  3RCH B;  1YJY A;  2PO3 A;  4ZSW A;  2R0T A;  1YOO A;  1ZC9 A;  3TAT A;  2E54 A;  3PA9 A;  3FRK A;  4LNL A;  1AJS A;  1M0N A;  2NMP A;  1ECX A;  1SVV A;  3NRA A;  5FT6 A;  3GBX A;  2W8T A;  4WXB A;  4F5L A;  4BA4 A;  2D7Z A;  2XH1 A;  1BJ4 A;  1U08 A;  3N4X A;  1G7X A;  2Z1Y A;  1QZ9 A;  4JEV A;  5D95 A;  1OHW A;  3TFU A;  2AY6 A;  3LVK A;  1B9I A;  5EAV A;  3AV7 A;  4DGT A;  2YOB A;  3ELP A;  1ASA A;  2ZY3 A;  4XEW A;  2VMU A;  1ARH A;  1CL2 A;  4LW4 A;  1AHE A;  3E9K A;  5AX8 A;  1IVR A;  4LC3 A;  1MGV A;  1XEY A;  3MAF A;  3JWB A;  4F5F A;  1CQ6 A;  2FNU A;  4ZM4 A;  1AAW A;  2VMT A;  4L0O A;  4E3Q A;  1I29 A;  3IHJ A;  3WX9 A;  2D63 A;  3B46 A;  4EB7 A;  2YKX A;  2HUU A;  2E7U A;  1WYT A;  4WLH A;  1AKC A;  1M0P A;  1V2F A;  2OQX A;  4WXG A;  2VMN A;  2TPL A;  4WBT A;  2W8W A;  1ASD A;  2C7T A;  3II0 A;  5HDM A;  1CZE A;  2OGE A;  3K28 A;  5G2P A;  2W7G A;  1IX6 A;  4JF1 A;  1GD9 A;  2QB2 A;  4F4E A;  2D61 A;  3E2F A;  2Z1Z A;  3VK2 A;  1ARS A;  1ORD A;  2BIA A;  1AKA A;  2JGT A;  1IAX A;  2AY8 A;  1DFO A;  3BV0 A;  1BQA A;  5BJ4 A;  2WB6 A;  1M7Y A;  4W8I A;  2VMQ A;  4AOA A;  4IY7 A;  2VYC A;  3RQ1 A;  3F9T A;  1X29 A;  1DJ9 A;  3HQT A;  4CVQ A;  4A0R A;  1QIT A;  4A72 A;  1CJ0 A;  3HL2 A;  2W8V A;  4KXK A;  4Q31 A;  2W7M A;  2FYF A;  3FVU A;  4ITG A;  3RI6 A;  3DR4 A;  3UE8 A;  2AY3 A;  1MAP A;  1SF2 A;  2Z61 A;  2W7F A;  3BN1 A;  5M4D A;  1LKC A;  1YNU A;  3BWN C;  2VMR A;  1KL1 A;  2RFV A;  2DGK A;  2G7J A;  1ASB A;  3AEJ C;  3I4J A;  3P6K A;  2X3L A;  4WB0 A;  1D7U A;  4K2M A;  2QA3 A;  2W8J A;  2JJF A;  2VGW A;  4RJY A;  1QJ3 A;  2W7K A;  1Z7D A;  1JS6 A;  3W1I A;  3NU8 A;  2HOZ A;  4MKJ A;  4F5I A;  3JTX A;  4WYE A;  1AHY A;  2AEU A;  1TAR A;  4EFF A;  2FM1 A;  2BI9 A;  2GMS A;  3G0T A;  3FVX A;  3QN6 A;  4RKC A;  2W7J A;  1B5P A;  1X28 A;  1PFF A;  3FSL A;  4R2N A;  2QSR A;  1AJR A;  2DOU A;  4OYT A;  2ZP7 A;  2AY1 A;  4E77 A;  3H7F A;  1BS0 A;  1AMA A;  1PMO A;  3PDB A;  5DJ1 A;  2OKK A;  1M6S A;  3EUC A;  3BWN A;  1FC4 A;  3RBL A;  2R5C B;  4A6U A;  4OBU A;  3MC6 C;  3FQ8 A;  4N0W A;  3AEJ A;  3EI7 A;  3MEB A;  4WLJ A;  1KKP A;  5EAA A;  2GSA A;  3AEN B;  4ZAS A;  3JWA A;  1GC3 A;  2YCT A;  3D6K A;  4WXF A;  4IXO A;  5EFS A;  4N0B A;  2EZ2 A;  3UAK A;  1D2F A;  1FG3 A;  4M2M A;  3UWC A;  2QBT A;  3COG A;  1T3I A;  4KAM A;  1V2E A;  5EUE A;  3FQ7 A;  1GC2 A;  1PG8 A;  2Z9V A;  3R9A A;  1TOE A;  1G4V A;  1AIB A;  2KFP A;  3DOD A;  2Z67 A;  4GRX A;  5FT4 A;  5JAY A;  3KE3 A;  1ASN A;  4IYO A;  2D65 A;  2W7D A;  4DBC A;  4UHN A;  1W7N A;  3JZL A;  1EQB A;  2VLF A;  4ZWM A;  1B8G A;  1RVY A;  2GB3 A;  4ZLV A;  4F5J A;  3BS8 A;  3EI8 A;  3GET A;  4ZWV A;  1AHG A;  2A1V A;  2EGY A;  1WYV B;  2YCP A;  5EIG B;  4UOY A;  3ELE A;  1ASE A;  2VMY A;  4GSA A;  1DGE A;  1SFF A;  3BCA A;  3G7Q A;  4FL0 A;  3PGY A;  4IW7 A;  2DKB A;  3WKS A;  3H14 A;  3ZRP A;  3LVJ A;  4ZDL A;  1D7R A;  4K05 A;  5HXX A;  3TQX A;  5I92 A;  4ZDO A;  1B4X A;  1AX4 A;  2VMS A;  3GWP A;  4IXZ A;  5D5S A;  1LW5 A;  4ISY A;  1O69 A;  5EUD A;  4RIT A;  3FD0 A;  2QLR A;  3KGW A;  3FTB A;  3TCM A;  4RLG A;  1WKH A;  1C7G A;  1W7L A;  1ASG A;  1S07 A;  4XQ2 A;  3GZC A;  4ZDP A;  4AO4 A;  3VK3 A;  1IX7 A;  3BWO A;  2YKU A;  1S06 A;  1C7N A;  3MAD A;  3W1H A;  3AEP A;  4A0F A;  4ADD A;  1AHX A;  4PVF A;  8AAT A;  1DTY A;  2D66 A;  3FCR A;  3JW9 A;  4ZM3 A;  1GCK A;  3M5U A;  4WYA A;  2VMZ A;  4XJL A;  2AY7 A;  2G6W A;  1BQD A;  1AMR A;  5KTB A;  4F5G A;  3B8X A;  3DRD A;  2PB2 A;  1I41 A;  3QHX A;  1S0A A;  2VGT A;  1UU2 A;  2CJH A;  5E3K A;  5M46 A;  4IXS A;  3ZZJ A;  3DXW A;  1VJO A;  1OXO A;  1ASM A;  1QIS A;  4HVK A;  3P1T A;  1BJO A;  2WKA A;  3EIA A;  3WLX A;  3E2Z B;  5C6U A;  1M0O A;  2F8J A;  1W23 A;  1W3U A;  3CBF A;  4H51 A;  2VIB A;  7AAT A;  3NX3 A;  4XAU A;  1RV4 A;  1VP4 A;  1AY4 A;  2JG2 A;  1IX8 A;  2ZSL A;  5F8V A;  3PAA A;  3N5M A;  1TAT A;  4J5U A;  4XJM A;  3ISL A;  1G4X A;  4ATP A;  1AAM A;  3Q8N A;  2BKW A;  4GDY A;  4EMY A;  2EYQ A;  1ELU A;  3OP7 A;  5FT5 A;  1ASL A;  1CQ7 A;  1UU1 A;  1ELQ A;  4E1O A;  5LH9 A;  2D5Y A;  4Y0H A;  4CXQ A;  3WKR A;  1TAS A;  3ZRR A;  1LS3 A;  2BYL A;  2VGV A;  4OC9 A;  3FZ6 A;  3NYT A;  3RBF A;  1N31 A;  4XJP A;  1M0Q A;  2BHX A;  3PDX A;  4MY5 A;  4CBR A;  2BI3 A;  2O0R A;  2VGZ A;  1CL1 A;  3HLM A;  3I5T A;  4Q75 A;  3F0H A;  1J04 A;  4RM1 A;  5F9S A;  3N7N A;  4JF0 A;  2D64 A;  3NYU A;  1V2D A;  4CBS A;  1X0M A;  1WYU A;  2CY8 A;  1DGD A;  3PD6 A;  4ADC A;  4EB5 A;  2ZC0 A;  3A9X A;  2Z20 A;  2VI9 A;  3MAU A;  3B1D A;  4HF8 A;  4UHM A;  1GEW A;  1OXP A;  2HUF A;  3FVS A;  1KL2 A;  2GMU A;  4M2K A;  2YRR A;  3RCH A;  4UHO A;  2R2N A;  2VMX A;  3DZZ A;  3IF2 A;  2ZYJ A;  2WK9 A;  3N75 A;  2CST A;  4I8A A;  5LHA A;  1AJS B;  4JEZ A;  4R8D A;  3BCX A;  2VMO A;  1H0C A;  5DJ9 A;  4QGR A;  4PFF A;  2YKV A;  4MGR A;  4WP0 A;  2EO5 A;  1YAA A;  4W5K A;  1M4N A;  2CB1 A;  3EI9 A;  1JG8 A;  3A2B A;  1BJW A;  1RV3 A;  3K40 A;  2AEV A;  4Q76 A;  4WD2 A;  1O61 A;  4ITX A;  4MQQ A;  2ZSM A;  3MAF B;  1W7M A;  1QIR A;  1SZK A;  2VGU A;  3WCO A;  9AAT A;  3ECD A;  1I48 A;  1ZOD A;  3N4S A;  2BYJ A;  1IAY A;  5BJ3 A;  2CTZ A;  1YIY A;  1PMM A;  1WYT B;  2C0R A;  2VMP A;  4A0H A;  2CJD A;  3HMU A;  3E77 A;  4WYC A;  1C0N A;  3GZD C;  3FDD A;  2C44 A;  2YRI A;  1S08 A;  2BWN A;  3KGX A;  3KKI A;  1V72 A;  3W1J A;  3I16 A;  1CS1 A;  1AHF A;  3AOW A;  4RKD A;  4W1X A;  4W91 A;  4A6R A;  1ART A;  2WK8 A;  3VP6 A;  4E3R A;  4AH3 A;  2BI1 A;  4WYD A;  2GQN A;  4TV7 A;  1IJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...