4J5UA

X-ray crystal structure of a serine hydroxymethyltransferase with covalently bound plp from rickettsia rickettsii str. sheila smith
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
420
structure length
419
Chain Sequence
MNIFNNNLHETDKEINEIIKHEKLRQSSVIELIASENFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAHAVTSTTHTLRGPRGGLILSNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNNEDNSALEQQVLNEVTKLIELFPFYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine hydroxymethyltransferase
publication title X-ray crystal structure of a serine hydroxymethyltransferase with covalently bound PLP from Rickettsia rickettsii str. Sheila Smith
rcsb
source organism Rickettsia rickettsii
molecule tags Transferase
total genus 169
structure length 419
sequence length 420
chains with identical sequence B
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2013-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4j5uA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4j5uA01
2D5YA 1QGNA 1RV3A 2JGTA 3E77A 4ZDLA 4UHNA 2W7DA 4AZJA 4R8DA 4A6TA 1BJ4A 3ATHA 2YHKA 1DJUA 1O4SA 4I8AA 1E5FA 1LK9A 5M49A 3BB8A 1AJSB 4WLHA 1G7XA 1G7WA 1IAYA 1B9HA 3LVMA 2BYJA 2E7UA 3VOMA 1WKGA 1C0NA 4XJLA 1PMMA 2YKUA 5EFSA 3AEMC 3G7QA 3FDDA 4M2KA 1ELQA 1D7SA 1V2FA 2CJHA 3JW9A 4QGRA 1CL1A 5EQCA 1O62A 1MLYA 1WYTA 3COGA 3QN6A 3AOWA 3BS8A 4Q6RA 2G6WA 5HHYA 2W7JA 1GEWA 1AAWA 4HVKA 2ZJGA 2AY1A 4HF8A 2CTZA 2WKAA 3MAFA 2EZ2A 5JAYA 3B1CA 1ZODA 2FNUA 1GC4A 3II0A 2DOUA 3A9XA 2HUUA 2VGUA 3GZDC 3AELA 1BQDA 3EIAA 3RQ1A 3FRKA 4GE7A 1ZOBA 3KGWA 3AEOA 5BJ3A 1LW5A 2Z61A 3RBLA 3N5MA 4MQRA 4W5KA 2DR1A 3WCNA 2CH2A 3AEPA 3NTJA 2HUFA 2D7YA 1AAMA 2HUIA 2PB2A 3PD6A 3VK2A 4ZSYA 4F5JA 1AHFA 4BMKA 1LW4A 3HVYA 4NOGA 1M0OA 5FT4A 2W7HA 3WY7A 2ZY2A 1IX8A 4PVFA 1YIYA 2AATA 2QLRA 4ITXA 1AHEA 4CVQA 2W8UA 1BS0A 1RV4A 2FN6A 1B8GA 2ZYJA 4MQPA 2FQ6A 3WCOA 9AATA 2X3LA 5HDMA 2CH1A 3DR7A 1W3UA 2D65A 1ZC9A 4E77A 1V2DA 3P6KA 4UHOA 4GDYA 2OGAA 4WYGA 1PG8A 3NDNA 2Z9UA 4H51A 4TV7A 1XEYA 2YRIA 1EG5A 1KKJA 1QJ3A 2VMNA 3NNKA 3TFUA 5TF5A 1M6SA 4LNMA 3K28A 2CANA 3KKIA 2YCPA 4ADDA 1CQ8A 2Z9XA 2GMSA 1CJ0A 3ZZJA 1I41A 3CAIA 4BQ0A 1CQ6A 1CQ7A 3FVSA 1BJOA 4P7YA 2F8JA 1ASBA 1B5OA 3HBXA 3E2YA 3AATA 3LVKA 1I43A 3NU8A 5G4IA 4MGRA 3AV7A 2OKJA 1IJIA 5G0AA 2DKJA 4EB5A 1ASAA 3QHXA 2OATA 4EFFA 3LWSA 3HL2A 3MC6C 1TPLA 3LG0A 1S07A 1ARHA 4JEZA 4EB7A 2QB2A 1PFFA 1ASDA 3L44A 1PMOA 4W1WA 1GC3A 2BKWA 2JJEA 3ASBA 2CJDA 2CY8A 3FZ8A 1GBNA 2X8UA 3BWNA 4EU1A 2GMUA 3VK3A 1VJOA 1ASNA 1AY8A 2W7FA 3E6GA 4AOAA 2Z1ZA 4JEYA 5M4DA 1AHXA 2ZSMA 2W7GA 2WK8A 4WB0B 1WYUB 2AEUA 4LC3A 1M0NA 1ARGA 2V1PA 2VMPA 5G4JA 4WD2A 4JE5A 1QJ5A 4RITA 1LC7A 4XJMA 1SZUA 1IBJA 2BWPA 4LW2A 1Z3ZA 2C44A 2D66A 1AIAA 2E7IA 4WXBA 3OKSA 4WYEA 4W8IA 2W7MA 4A6RA 7AATA 3LVLB 3NX3A 4ZDPA 1IX6A 2YKXA 4K2MA 2Q7WA 1ELUA 2VMUA 3FQ7A 4M2JA 4XK1A 3UAKA 4F5GA 1GC2A 4XEWA 1P3WA 4UOYA 1OXOA 4GSAA 2X5FA 2YCNA 2YOBA 1ARSA 3EZSA 4MY5A 5D95A 2E7JA 3CQ6A 2AY4A 3PDBB 1C7OA 2D64A 1M7YA 3MKJA 4LW4A 3RCHB 3WX9A 4PFNA 4ADCA 3A9ZA 2JJHA 4WYFA 4F5IA 2AY3A 3FDBA 1AKCA 3H14A 4B9BA 1TATA 1W7LA 5EUDA 3ECDA 3FFRA 1X29A 3GETA 5EUNA 2JJFA 2C81A 1AX4A 2W7EA 4ITGA 4O6ZA 4UHMA 3EZ1A 2BIGA 3ZRQA 2PB0A 4F4EA 3LY1A 3ELPA 4A00A 1RVYA 1W7MA 1C9CA 2VLHA 1AJRA 1W23A 1IAXA 5LHAA 4P3MA 3WKRA 2QB3A 2VMSA 4ZDOA 3QPGA 1JF9A 3DZZA 3PA9A 3QGUA 1Z7DA 4KXKA 1Y4IA 4GE9A 1BW0A 4JF1A 3WGBA 3AEJA 3QBOA 1X2AA 2PO3A 2BWNA 3DU4A 1TOJA 2VI8A 4ZAHA 1OHYA 3PIUA 1LC5A 1ASGA 1BT4A 2YCTA 4OBVA 3GJUA 4U1TA 1CZCA 4AZKA 4CXQA 1YJSA 2VMOA 2VMTA 4K2BA 4IW7A 1O69A 2VMRA 4MKJA 4FFCA 3VAXA 4GRXA 2OGEA 1AIBA 3EUCA 4GEBA 4TN4A 3DODA 3VK4A 1N8PA 2AY2A 2BI3A 2VMYA 1J32A 5DJ9A 2DGLA 2QA3A 3NUBA 4ZM4A 2CFBA 2ZY3A 1JS3A 3FQ8A 3FTBA 4OCAA 2HZPA 3USFA 3W1HA 4DQ6A 3NYUA 4A0GA 3D6KA 3I5TA 3PAAA 1V2EA 1KKPA 4ZWMA 1MAQA 1B4XA 2O1BA 4W91A 3RUYA 3EI6A 1AKAA 3QI6A 3AEMA 4ISYA 1T3IA 5G2QA 1AICA 2EPJA 1GCKA 1H1CA 1C7GA 1SVVA 3F9TA 1M4NA 1MDXA 3E2FA 4ZSWA 3DC1A 3FFHA 2NMPA 1S08A 2Z9WA 3ZZKA 2AY6A 2O0RA 4KAMA 1UU1A 1ORDA 3ZRPA 1B9IA 1AMAA 2GSAA 2VIAA 1RVUA 2ZUKA 3KGXA 2BI1A 2CB1A 2VGWA 1WYUA 1BJNA 2OKKA 5DX5A 5FT8A 3N0LA 1VEFA 3EI7A 3GZDA 2W7LA 2W8JA 1QZ9A 3GSBA 3UE8A 2YKYA 3DXWA 2QMAA 4BA4A 4RJYA 3QM2A 2R2NA 1GDEA 4ZM3A 3WGCA 2CINA 2AY9A 2HOXA 1DJEA 4IX8A 2C0RA 4ZWVA 2HOZA 8AATA 5K8BA 2VMVA 3ASAA 1IX7A 2BYLA 3JWAA 4WLJA 5EUEA 4ZLVA 1TOGA 4JEXA 1OXPA 4JEWA 4F5FA 3KE3A 4F5LA 4OTLA 4F5KA 1DJ9A 1IVRA 4DBCA 4WXFA 4W1XA 2ZY4A 4OBUA 1DKAA 4XQ2A 1GEYA 3HT4A 2Z1YA 1OHWA 3CBFA 4F5MA 2WK7A 4A6UA 4ZASA 3PDBA 3HLMA 1AMSA 1M0PA 3RCHA 3F0HA 2XH1A 1GEXA 4CXRA 2VI9A 4J5UA 1TOIA 4Q75A 3TFTA 1AJSA 3ZRRA 3I4JA 3JTXA 3MBBA 2VMWA 1B5PA 1XI9A 2JG2A 5D5SA 4A72A 3B46A 3GBXA 4RLGA 2BWOA 2CJGA 4B98A 3FVXA 2VMZA 1LS3A 4EMYA 1D7RA 3BCBA 1UKJA 4WYDA 4R5FA 3PJ0A 5C6UA 3HMUA 4ATPA 1FC4A 1ASLA 1DTYA 1CL2A 2QBTA 5F9SA 4R2NA 4XJPA 4E3RA 1OATA 1WSTA 3IF2A 3EIBA 1TOKA 5I92A 3E9KA 5F8VA 2ZY5A 2R5CB 2AY7A 3TCMA 5M46A 4A0RA 2R0TA 2Z20A 1YJZA 2X5DA 3TATA 1S09A 4IYOB 2DGMA 1GD9A 3MEBA 2BHXA 1ASCA 3FD0A 1EJIA 1N31A 4Y0HA 1DGEA 2HORA 3GR9A 1C4KA 3B1EA 3PGYA 1YOOA 1KMKA 3MC6A 5EIGB 3EI9A 4L0OA 4RJ0A 4WYAA 2HOYA 4WXGA 1BJWA 2BI9A 4Y0IA 3RBFA 3I16A 2R5EA 3MADA 2E54A 1AHGA 3CQ4A 3M5UA 2YRRA 4IXZA 4OYTA 2BIAA 4JF0A 4R5ZA 5DJ1A 4RIZA 1KMJA 2AEVA 2DKBA 1WYVB 3GZCA 4FL0A 4M2MA 4BHDA 1MGVA 3LV2A 4N0WA 1W7NA 3L8AA 3UWCA 1ARIA 1QISA 4AO9A 3NRAA 3JWBA 1ASFA 1IUGA 4UQVA 2W8TA 3G8MA 2D7ZA 2JJGA 2VIBA 1ECXA 3A9YA 1TASA 3B1DA 3NUIA 2JISA 5G09A 1MAPA 3WKSA 5IWQA 3TQXA 2BI2A 1AMQA 1M0QA 4XAUA 5E3KA 2WK9A 2RFVA 4U2HA 2EGYA 4LNLA 3ISLA 2TPLA 3BCXA 1D7UA 1S06A 1KL2A 3NYTA 2D63A 5AX8A 1AY5A 1GC0A 3F6TA 3AENB 3CQ5A 3ELEA 4PIWA 1MDOA 3RI6A 1MLZA 1LKCA 3W1JA 3EI8A 1QIRA 4WYCA 4ATQA 3LVJA 1WKHA 3E2ZB 3T32A 1TARA 4Q76A 4A0FA 3DYDA 4Q31A 3DRDA 1C7NA 4N0BA 3FSLA 2FYFA 3PDXA 2DGKA 3A8UX 3DXVA 3FZ7A 2W7KA 4Y0DA 1YIZA 4OT8A 2W8VA 4F5HA 1N2TA 1AKBA 1DFOA 1H0CA 1I29A 2EH6A 1QITA 1YAAA 1V72A 2OQXA 4A0HA 2W7IA 2O7CA 3NYSA 4TMRA 1D2FA 2GB3A 2HP2A 1FG3A 3WLXA 3FKDA 3BCAA 4WBTA 2BI5A 4GE4A 1I48A 3JZLA 4KYOA 2VYCA 3BWOA 3FQAA 1X28A 2C7TA 4CBSA 4PFFA 5G2PA 1SF2A 5EAAA 4BA5A 4MSOA 3K7YA 4MKKA 4DGTA 1WYTB 4AH3A 2Z9VA 1AHYA 3AOVA 5BJ4A 5J8QA 4WB0A 1G4VA 3DR4A 3BWNC 1E5EA 4RM1A 3MAFB 4AO4A 1SFFA 2EO5A 3FCRA 4IXSA 2HP1A 1YNUA 4OC9A 5FT5A 1FG7A 3NU7A 5EAVA 4CBRA 4LNJA 2V0YA 3OP7A 1ASEA 4MQQA 3BV0A 5LH9A 1YJYA 2R5CA 2YKVA 2AY8A 1AY4A 1JS6A 2CSTA 4IYOA 1EQBA 3PD6B 5HXXA 1TOEA 4RKCA 1JG8A 1MDZA 4XJOA 3Q8NA 2AY5A 5EIGA 2VMXA 2BIEA 2VGVA 2VMQA 1D7VA 4OMAA 3A2BA 3BC8A 5E4ZA 1G4XA 2W8WA 1ASMA 2VGZA 3EI5A 2GQNA 4J8LA 2FM1A 4ADBA 1SPAA 1O61A 1J04A 1WYVA 5M4BA 3K40A 1SZKA 3FVUA 5FT6A 3MAUA 1CS1A 2ZP7A 3BN1A 4E1OA 3P1TA 1BKGA 3R9AA 3HQTA 4RAEA 2Z67A 3ACZA 2ORDA 1SZSA 5E5IA 1S0AA 3GWPA 2FNIA 4JE5D 1AMRA 2EZ1A 4E3QA 4IY7A 5DB5A 2XBNA 1UU0A 4K2IA 4IXOA 4W1VA 1ARTA 3IHJA 3WZFA 1U08A 4WP0A 4RKDA 2D61A 1BJOB 3HDOA 4JEVA 2VGTA 4ADEA 3G0TA 3VP6A 2ZSLA 1UU2A 1M32A 3AEJC 3H7FA 1CZEA 1OHVA 3AENA 1KL1A 1LC8A 3PPLA 1BQAA 3FZ6A 3JU7A 1X0MA 3R4TA 3B8XA 2ZC0A 1VP4A 3N75A 2VLFA 3E2ZA 3W1IA 2VGSA 1DGDA
chains in the Genus database with same CATH superfamily
2D5YA 1QGNA 1RV3A 2JGTA 3E77A 4ZDLA 4UHNA 2W7DA 4AZJA 4R8DA 4A6TA 1BJ4A 3ATHA 2YHKA 1DJUA 1O4SA 4I8AA 1E5FA 1LK9A 5M49A 3BB8A 1AJSB 4WLHA 1G7XA 1G7WA 1IAYA 1B9HA 3LVMA 2BYJA 2E7UA 3VOMA 1WKGA 1C0NA 4XJLA 1PMMA 2YKUA 5EFSA 3AEMC 3G7QA 3FDDA 4M2KA 1ELQA 1D7SA 1V2FA 2CJHA 3JW9A 4QGRA 1CL1A 5EQCA 1O62A 1MLYA 1WYTA 3COGA 3QN6A 3AOWA 3BS8A 4Q6RA 2G6WA 5HHYA 2W7JA 1GEWA 1AAWA 4HVKA 2ZJGA 2AY1A 4HF8A 2CTZA 2WKAA 3MAFA 2EZ2A 5JAYA 3B1CA 1ZODA 2FNUA 1GC4A 3II0A 2DOUA 3A9XA 2HUUA 2VGUA 3GZDC 3AELA 1BQDA 3EIAA 3RQ1A 3FRKA 4GE7A 1ZOBA 3KGWA 3AEOA 5BJ3A 1LW5A 2Z61A 3RBLA 3N5MA 4MQRA 4W5KA 2DR1A 3WCNA 2CH2A 3AEPA 3NTJA 2HUFA 2D7YA 1AAMA 2HUIA 2PB2A 3PD6A 3VK2A 4ZSYA 4F5JA 1AHFA 4BMKA 1LW4A 3HVYA 4NOGA 1M0OA 5FT4A 2W7HA 3WY7A 2ZY2A 1IX8A 4PVFA 1YIYA 2AATA 2QLRA 4ITXA 1AHEA 4CVQA 2W8UA 1BS0A 1RV4A 2FN6A 1B8GA 2ZYJA 4MQPA 2FQ6A 3WCOA 9AATA 2X3LA 5HDMA 2CH1A 3DR7A 1W3UA 2D65A 1ZC9A 4E77A 1V2DA 3P6KA 4UHOA 5KTBA 4GDYA 2OGAA 4WYGA 1PG8A 3NDNA 2Z9UA 4H51A 4TV7A 1XEYA 2YRIA 1EG5A 1KKJA 1QJ3A 2VMNA 3NNKA 3TFUA 2QSRA 5TF5A 1M6SA 4LNMA 3K28A 2CANA 3KKIA 2YCPA 4ADDA 1CQ8A 2Z9XA 2GMSA 1CJ0A 3ZZJA 1I41A 3CAIA 4BQ0A 1CQ6A 1CQ7A 3FVSA 1BJOA 4P7YA 2F8JA 1ASBA 1B5OA 3HBXA 3E2YA 3AATA 3LVKA 1I43A 3NU8A 5G4IA 4MGRA 3AV7A 2OKJA 1IJIA 5G0AA 2DKJA 4EB5A 1ASAA 3QHXA 2EYQA 2OATA 4EFFA 3LWSA 3HL2A 3MC6C 1TPLA 3LG0A 1S07A 1ARHA 4JEZA 2G7JA 4EB7A 2QB2A 1PFFA 1ASDA 3L44A 1PMOA 4W1WA 1GC3A 2BKWA 2JJEA 3ASBA 2CJDA 2CY8A 3FZ8A 1GBNA 2X8UA 3BWNA 4EU1A 2GMUA 3VK3A 1VJOA 1ASNA 1AY8A 2W7FA 3E6GA 4AOAA 2Z1ZA 4JEYA 5M4DA 1AHXA 2ZSMA 2W7GA 2WK8A 4WB0B 1WYUB 2AEUA 4LC3A 1M0NA 1ARGA 2V1PA 2VMPA 5G4JA 4WD2A 4JE5A 1QJ5A 4RITA 1LC7A 4XJMA 3N4SA 1SZUA 1IBJA 2BWPA 4LW2A 1Z3ZA 2C44A 2D66A 1AIAA 2E7IA 4WXBA 3OKSA 4WYEA 4W8IA 2W7MA 4A6RA 7AATA 3LVLB 3NX3A 4ZDPA 1IX6A 2YKXA 4K2MA 2Q7WA 1ELUA 2VMUA 3FQ7A 4M2JA 4XK1A 3UAKA 4F5GA 1GC2A 4K05A 4XEWA 1P3WA 4UOYA 1OXOA 4GSAA 2X5FA 2YCNA 2YOBA 1ARSA 3EZSA 4MY5A 5D95A 2E7JA 3CQ6A 2AY4A 3PDBB 1C7OA 2D64A 1M7YA 3MKJA 4LW4A 3RCHB 3WX9A 1KAFA 4PFNA 4ADCA 3A9ZA 2JJHA 4WYFA 4F5IA 2AY3A 3FDBA 1AKCA 3H14A 4B9BA 1TATA 1W7LA 5EUDA 3ECDA 3FFRA 1X29A 3GETA 5EUNA 2JJFA 2C81A 1AX4A 2W7EA 4ITGA 4O6ZA 4UHMA 3EZ1A 2BIGA 3ZRQA 2PB0A 4F4EA 3LY1A 3ELPA 4A00A 1RVYA 1W7MA 1C9CA 2VLHA 1AJRA 1W23A 1IAXA 5LHAA 4P3MA 3WKRA 2QB3A 2VMSA 4ZDOA 3QPGA 1JF9A 3DZZA 3PA9A 3QGUA 1Z7DA 4KXKA 1Y4IA 4GE9A 1BW0A 4JF1A 3WGBA 3AEJA 3QBOA 1X2AA 2PO3A 2BWNA 3DU4A 1TOJA 2VI8A 4ZAHA 3H9XA 1OHYA 3PIUA 1LC5A 3N4XA 1ASGA 1BT4A 2YCTA 4OBVA 3GJUA 4U1TA 1CZCA 4AZKA 4CXQA 1YJSA 2VMOA 2VMTA 4K2BA 4IW7A 1O69A 2VMRA 4MKJA 4FFCA 3VAXA 4GRXA 2OGEA 1AIBA 3EUCA 4GEBA 4TN4A 3DODA 3VK4A 1N8PA 2AY2A 2BI3A 2VMYA 1J32A 5DJ9A 2DGLA 2QA3A 3NUBA 4ZM4A 2CFBA 2ZY3A 1JS3A 3FQ8A 3FTBA 4OCAA 2HZPA 3USFA 3W1HA 4DQ6A 3NYUA 4A0GA 3D6KA 3I5TA 3PAAA 1V2EA 1KKPA 4ZWMA 1MAQA 1B4XA 2O1BA 4W91A 3RUYA 3EI6A 1AKAA 3QI6A 3AEMA 4ISYA 1T3IA 5G2QA 1AICA 2EPJA 1GCKA 1H1CA 3N7NA 1C7GA 1SVVA 3F9TA 1M4NA 1MDXA 3E2FA 4ZSWA 3DC1A 3FFHA 2NMPA 1S08A 2Z9WA 3ZZKA 2AY6A 2O0RA 4KAMA 1UU1A 1ORDA 3ZRPA 1B9IA 1AMAA 2GSAA 2VIAA 1RVUA 2ZUKA 3KGXA 2BI1A 2CB1A 2VGWA 1WYUA 1BJNA 2OKKA 5DX5A 5FT8A 3N0LA 1VEFA 3EI7A 3GZDA 2W7LA 2W8JA 1QZ9A 3GSBA 3UE8A 2YKYA 3DXWA 2QMAA 4BA4A 4RJYA 3QM2A 2R2NA 1GDEA 4ZM3A 3WGCA 2CINA 2AY9A 2HOXA 1DJEA 4IX8A 2C0RA 4ZWVA 2HOZA 8AATA 5K8BA 2VMVA 3ASAA 1IX7A 2BYLA 3JWAA 4WLJA 5EUEA 4ZLVA 1TOGA 4JEXA 1OXPA 4JEWA 4F5FA 3KE3A 4F5LA 4OTLA 4F5KA 1DJ9A 1IVRA 4DBCA 4WXFA 4W1XA 2ZY4A 4OBUA 1DKAA 4XQ2A 1GEYA 3HT4A 2Z1YA 1OHWA 3CBFA 4F5MA 2WK7A 4A6UA 4ZASA 3PDBA 3HLMA 1AMSA 1M0PA 3RCHA 3F0HA 2XH1A 1GEXA 4CXRA 2VI9A 4J5UA 1TOIA 4Q75A 3TFTA 1AJSA 3ZRRA 3I4JA 3JTXA 3MBBA 2VMWA 1B5PA 1XI9A 2JG2A 5D5SA 4A72A 3B46A 3GBXA 4RLGA 2BWOA 2CJGA 4B98A 3FVXA 2VMZA 1LS3A 4EMYA 1D7RA 3BCBA 1UKJA 4WYDA 4R5FA 3PJ0A 5C6UA 3HMUA 4ATPA 1FC4A 1ASLA 1DTYA 1CL2A 2QBTA 5F9SA 4R2NA 4XJPA 4E3RA 2FKIA 1OATA 1WSTA 3IF2A 3EIBA 1TOKA 5I92A 3E9KA 5F8VA 2ZY5A 2R5CB 2AY7A 3TCMA 5M46A 4A0RA 2R0TA 2Z20A 1YJZA 2X5DA 3TATA 1S09A 4IYOB 2DGMA 1GD9A 3MEBA 2BHXA 1ASCA 3FD0A 1EJIA 1N31A 4Y0HA 1DGEA 2HORA 3GR9A 1C4KA 3B1EA 3PGYA 1YOOA 1KMKA 3MC6A 5EIGB 3EI9A 4L0OA 4RJ0A 4WYAA 2HOYA 4WXGA 1BJWA 2BI9A 4Y0IA 3RBFA 3I16A 2R5EA 3MADA 2E54A 1AHGA 3CQ4A 3M5UA 2YRRA 4IXZA 4OYTA 2BIAA 4JF0A 4R5ZA 5DJ1A 4RIZA 1KMJA 2AEVA 2DKBA 1WYVB 3GZCA 4FL0A 4M2MA 4BHDA 1MGVA 3LV2A 4N0WA 1W7NA 3L8AA 3UWCA 1ARIA 1QISA 4AO9A 3NRAA 3JWBA 1ASFA 1IUGA 4UQVA 2W8TA 3G8MA 2D7ZA 2JJGA 2VIBA 1ECXA 3A9YA 1TASA 3B1DA 3NUIA 2JISA 5G09A 1MAPA 3WKSA 5IWQA 3TQXA 2BI2A 1AMQA 1M0QA 4XAUA 5E3KA 2WK9A 2RFVA 4U2HA 2EGYA 4LNLA 3ISLA 2TPLA 3BCXA 1D7UA 1S06A 1KL2A 3NYTA 2D63A 5AX8A 1AY5A 1GC0A 3F6TA 3AENB 3CQ5A 3ELEA 4PIWA 1MDOA 2KFPA 3RI6A 1MLZA 1LKCA 3W1JA 3EI8A 1QIRA 4WYCA 4ATQA 3LVJA 1WKHA 3E2ZB 3T32A 1TARA 4Q76A 4A0FA 3DYDA 4Q31A 3DRDA 1C7NA 4N0BA 3FSLA 2FYFA 3PDXA 2DGKA 3A8UX 3DXVA 3FZ7A 2W7KA 4Y0DA 1YIZA 4OT8A 2W8VA 4F5HA 1N2TA 1AKBA 1DFOA 1H0CA 1I29A 2EH6A 1QITA 1YAAA 1V72A 2OQXA 4A0HA 2W7IA 2O7CA 3NYSA 4TMRA 1D2FA 2GB3A 2HP2A 1FG3A 3WLXA 3FKDA 3BCAA 4WBTA 2BI5A 4GE4A 1I48A 3JZLA 4KYOA 2VYCA 3BWOA 3FQAA 1X28A 2C7TA 4CBSA 4PFFA 5G2PA 1SF2A 5EAAA 4BA5A 4MSOA 3K7YA 4MKKA 4DGTA 1WYTB 4AH3A 2Z9VA 1AHYA 3AOVA 5BJ4A 5J8QA 4WB0A 1G4VA 3DR4A 3BWNC 1E5EA 4RM1A 3MAFB 4AO4A 1SFFA 3N4RA 2EO5A 3FCRA 4IXSA 2HP1A 1YNUA 4OC9A 5FT5A 1FG7A 3NU7A 5EAVA 4H63Q 4CBRA 4LNJA 2V0YA 3OP7A 1ASEA 4MQQA 3BV0A 5LH9A 1YJYA 2R5CA 2YKVA 2AY8A 1AY4A 1JS6A 2CSTA 4IYOA 1EQBA 3PD6B 5HXXA 1TOEA 4RKCA 1JG8A 1MDZA 4XJOA 2WB6A 3Q8NA 2AY5A 5EIGA 2VMXA 2BIEA 2VGVA 2VMQA 1D7VA 4OMAA 3A2BA 3BC8A 5E4ZA 1G4XA 2W8WA 1ASMA 2VGZA 3EI5A 2GQNA 4J8LA 2FM1A 4ADBA 1SPAA 1O61A 1J04A 1WYVA 5M4BA 3K40A 1SZKA 3FVUA 5FT6A 3MAUA 1CS1A 2ZP7A 3BN1A 4E1OA 3P1TA 1BKGA 3R9AA 3HQTA 4RAEA 2Z67A 3ACZA 2ORDA 1SZSA 5E5IA 1S0AA 3GWPA 2FNIA 4JE5D 1AMRA 2EZ1A 4E3QA 4IY7A 5DB5A 2XBNA 1UU0A 4K2IA 4IXOA 4W1VA 1ARTA 3IHJA 3WZFA 1U08A 4WP0A 4RKDA 2D61A 1BJOB 3HDOA 4JEVA 2VGTA 4ADEA 3G0TA 3VP6A 2ZSLA 1UU2A 1M32A 3AEJC 3H7FA 1CZEA 1OHVA 3AENA 1KL1A 1LC8A 3PPLA 1BQAA 3FZ6A 3JU7A 1X0MA 3R4TA 3B8XA 2ZC0A 1VP4A 3N75A 2VLFA 3E2ZA 3W1IA 2A1VA 2VGSA 1DGDA
chains in the Genus database with same CATH topology
2D5YA 1QGNA 1RV3A 2JGTA 3E77A 4ZDLA 4UHNA 2W7DA 4AZJA 4R8DA 4A6TA 1BJ4A 3ATHA 2YHKA 1DJUA 1O4SA 4I8AA 1E5FA 1LK9A 5M49A 3BB8A 1AJSB 4WLHA 1G7XA 1G7WA 1IAYA 1B9HA 3LVMA 2BYJA 2E7UA 3VOMA 1WKGA 1C0NA 4XJLA 1PMMA 2YKUA 5EFSA 3AEMC 3G7QA 3FDDA 4M2KA 1ELQA 1D7SA 1V2FA 2CJHA 3JW9A 4QGRA 1CL1A 5EQCA 1O62A 1MLYA 1WYTA 3COGA 3QN6A 3AOWA 3BS8A 4Q6RA 2G6WA 5HHYA 2W7JA 1GEWA 1AAWA 4HVKA 2ZJGA 2AY1A 4HF8A 2CTZA 2WKAA 3MAFA 2EZ2A 5JAYA 3B1CA 1ZODA 2FNUA 1GC4A 3II0A 2DOUA 3A9XA 2HUUA 2VGUA 3GZDC 3AELA 1BQDA 3EIAA 3RQ1A 3FRKA 4GE7A 1ZOBA 3KGWA 3AEOA 5BJ3A 1LW5A 2Z61A 3RBLA 3N5MA 4MQRA 4W5KA 2DR1A 3WCNA 2CH2A 3AEPA 3NTJA 2HUFA 2D7YA 1AAMA 2HUIA 2PB2A 3PD6A 3VK2A 4ZSYA 4F5JA 1AHFA 4BMKA 1LW4A 3HVYA 4NOGA 1M0OA 5FT4A 2W7HA 3WY7A 2ZY2A 1IX8A 4PVFA 1YIYA 2AATA 2QLRA 4ITXA 1AHEA 4CVQA 2W8UA 1BS0A 1RV4A 2FN6A 1B8GA 2ZYJA 4MQPA 2FQ6A 3WCOA 9AATA 2X3LA 5HDMA 2CH1A 3DR7A 1W3UA 2D65A 1ZC9A 4E77A 1V2DA 3P6KA 4UHOA 5KTBA 4GDYA 2OGAA 4WYGA 1PG8A 3NDNA 2Z9UA 4H51A 4TV7A 1XEYA 2YRIA 1EG5A 1KKJA 1QJ3A 2VMNA 3NNKA 3TFUA 2QSRA 5TF5A 1M6SA 4LNMA 3K28A 2CANA 3KKIA 2YCPA 4ADDA 1CQ8A 2Z9XA 2GMSA 1CJ0A 3ZZJA 1I41A 3CAIA 4BQ0A 1CQ6A 1CQ7A 3FVSA 1BJOA 4P7YA 2F8JA 1ASBA 1B5OA 3HBXA 3E2YA 3AATA 3LVKA 1I43A 3NU8A 5G4IA 4MGRA 3AV7A 2OKJA 1IJIA 5G0AA 2DKJA 4EB5A 1ASAA 3QHXA 2EYQA 2OATA 4EFFA 3LWSA 3HL2A 3MC6C 1TPLA 3LG0A 1S07A 1ARHA 4JEZA 2G7JA 4EB7A 2QB2A 1PFFA 1ASDA 3L44A 1PMOA 4W1WA 1GC3A 2BKWA 2JJEA 3ASBA 2CJDA 2CY8A 3FZ8A 1GBNA 2X8UA 3BWNA 4EU1A 2GMUA 3VK3A 1VJOA 1ASNA 1AY8A 2W7FA 3E6GA 4AOAA 2Z1ZA 4JEYA 5M4DA 1AHXA 2ZSMA 2W7GA 2WK8A 4WB0B 1WYUB 2AEUA 4LC3A 1M0NA 1ARGA 2V1PA 2VMPA 5G4JA 4WD2A 4JE5A 1QJ5A 4RITA 1LC7A 4XJMA 3N4SA 1SZUA 1IBJA 2BWPA 4LW2A 1Z3ZA 2C44A 2D66A 1AIAA 2E7IA 4WXBA 3OKSA 4WYEA 4W8IA 2W7MA 4A6RA 7AATA 3LVLB 3NX3A 4ZDPA 1IX6A 2YKXA 4K2MA 2Q7WA 1ELUA 2VMUA 3FQ7A 4M2JA 4XK1A 3UAKA 4F5GA 1GC2A 4K05A 4XEWA 1P3WA 4UOYA 1OXOA 4GSAA 2X5FA 2YCNA 2YOBA 1ARSA 3EZSA 4MY5A 5D95A 2E7JA 3CQ6A 2AY4A 3PDBB 1C7OA 2D64A 1M7YA 3MKJA 4LW4A 3RCHB 3WX9A 4PFNA 4ADCA 3A9ZA 2JJHA 4WYFA 4F5IA 2AY3A 3FDBA 1AKCA 3H14A 4B9BA 1TATA 1W7LA 5EUDA 3ECDA 3FFRA 1X29A 3GETA 5EUNA 2JJFA 2C81A 1AX4A 2W7EA 4ITGA 4O6ZA 4UHMA 3EZ1A 2BIGA 3ZRQA 2PB0A 4F4EA 3LY1A 3ELPA 4A00A 1RVYA 1W7MA 1C9CA 2VLHA 1AJRA 1W23A 1IAXA 5LHAA 4P3MA 3WKRA 2QB3A 2VMSA 4ZDOA 3QPGA 1JF9A 3DZZA 3PA9A 3QGUA 1Z7DA 4KXKA 1Y4IA 4GE9A 1BW0A 4JF1A 3WGBA 3AEJA 3QBOA 1X2AA 2PO3A 2BWNA 3DU4A 1TOJA 2VI8A 4ZAHA 3H9XA 1OHYA 3PIUA 1LC5A 3N4XA 1ASGA 1BT4A 2YCTA 4OBVA 3GJUA 4U1TA 1CZCA 4AZKA 4CXQA 1YJSA 2VMOA 2VMTA 4K2BA 4IW7A 1O69A 2VMRA 4MKJA 4FFCA 3VAXA 4GRXA 2OGEA 1AIBA 3EUCA 4GEBA 4TN4A 3DODA 3VK4A 1N8PA 2AY2A 2BI3A 2VMYA 1J32A 5DJ9A 2DGLA 2QA3A 3NUBA 4ZM4A 2CFBA 2ZY3A 1JS3A 3FQ8A 3FTBA 4OCAA 2HZPA 3USFA 3W1HA 4DQ6A 3NYUA 4A0GA 3D6KA 3I5TA 3PAAA 1V2EA 1KKPA 4ZWMA 1MAQA 1B4XA 2O1BA 4W91A 3RUYA 3EI6A 1AKAA 3QI6A 3AEMA 4ISYA 1T3IA 5G2QA 1AICA 2EPJA 1GCKA 1H1CA 3N7NA 1C7GA 1SVVA 3F9TA 1M4NA 1MDXA 3E2FA 4ZSWA 3DC1A 3FFHA 2NMPA 1S08A 2Z9WA 3ZZKA 2AY6A 2O0RA 4KAMA 1UU1A 1ORDA 3ZRPA 1B9IA 1AMAA 2GSAA 2VIAA 1RVUA 2ZUKA 3KGXA 2BI1A 2CB1A 2VGWA 1WYUA 1BJNA 2OKKA 5DX5A 5FT8A 3N0LA 1VEFA 3EI7A 3GZDA 2W7LA 2W8JA 1QZ9A 3GSBA 3UE8A 2YKYA 3DXWA 2QMAA 4BA4A 4RJYA 3QM2A 2R2NA 1GDEA 4ZM3A 3WGCA 2CINA 2AY9A 2HOXA 1DJEA 4IX8A 2C0RA 4ZWVA 2HOZA 8AATA 5K8BA 2VMVA 3ASAA 1IX7A 2BYLA 3JWAA 4WLJA 5EUEA 4ZLVA 1TOGA 4JEXA 1OXPA 4JEWA 4F5FA 3KE3A 4F5LA 4OTLA 4F5KA 1DJ9A 1IVRA 4DBCA 4WXFA 4W1XA 2ZY4A 4OBUA 1DKAA 4XQ2A 1GEYA 3HT4A 2Z1YA 1OHWA 3CBFA 4F5MA 2WK7A 4A6UA 4ZASA 3PDBA 3HLMA 1AMSA 1M0PA 3RCHA 3F0HA 2XH1A 1GEXA 4CXRA 2VI9A 4J5UA 1TOIA 4Q75A 3TFTA 1AJSA 3ZRRA 3I4JA 3JTXA 3MBBA 2VMWA 1B5PA 1XI9A 2JG2A 5D5SA 4A72A 3B46A 3GBXA 4RLGA 2BWOA 2CJGA 4B98A 3FVXA 2VMZA 1LS3A 4EMYA 1D7RA 3BCBA 1UKJA 4WYDA 4R5FA 3PJ0A 5C6UA 3HMUA 4ATPA 1FC4A 1ASLA 1DTYA 1CL2A 2QBTA 5F9SA 4R2NA 4XJPA 4E3RA 2FKIA 1OATA 1WSTA 3IF2A 3EIBA 1TOKA 5I92A 3E9KA 5F8VA 2ZY5A 2R5CB 2AY7A 3TCMA 5M46A 4A0RA 2R0TA 2Z20A 1YJZA 2X5DA 3TATA 1S09A 4IYOB 2DGMA 1GD9A 3MEBA 2BHXA 1ASCA 3FD0A 1EJIA 1N31A 4Y0HA 1DGEA 2HORA 3GR9A 1C4KA 3B1EA 3PGYA 1YOOA 1KMKA 3MC6A 5EIGB 3EI9A 4L0OA 4RJ0A 4WYAA 2HOYA 4WXGA 1BJWA 2BI9A 4Y0IA 3RBFA 3I16A 2R5EA 3MADA 2E54A 1AHGA 3CQ4A 3M5UA 2YRRA 4IXZA 4OYTA 2BIAA 4JF0A 4R5ZA 5DJ1A 4RIZA 1KMJA 2AEVA 2DKBA 1WYVB 3GZCA 4FL0A 4M2MA 4BHDA 1MGVA 3LV2A 4N0WA 1W7NA 3L8AA 3UWCA 1ARIA 1QISA 4AO9A 3NRAA 3JWBA 1ASFA 1IUGA 4UQVA 2W8TA 3G8MA 2D7ZA 2JJGA 2VIBA 1ECXA 3A9YA 1TASA 3B1DA 3NUIA 2JISA 5G09A 1MAPA 3WKSA 5IWQA 3TQXA 2BI2A 1AMQA 1M0QA 4XAUA 5E3KA 2WK9A 2RFVA 4U2HA 2EGYA 4LNLA 3ISLA 2TPLA 3BCXA 1D7UA 1S06A 1KL2A 3NYTA 2D63A 5AX8A 1AY5A 1GC0A 3F6TA 3AENB 3CQ5A 3ELEA 4PIWA 1MDOA 2KFPA 3RI6A 1MLZA 1LKCA 3W1JA 3EI8A 1QIRA 4WYCA 4ATQA 3LVJA 1WKHA 3E2ZB 3T32A 1TARA 4Q76A 4A0FA 3DYDA 4Q31A 3DRDA 1C7NA 4N0BA 3FSLA 2FYFA 3PDXA 2DGKA 3A8UX 3DXVA 3FZ7A 2W7KA 4Y0DA 1YIZA 4OT8A 2W8VA 4F5HA 1N2TA 1AKBA 1DFOA 1H0CA 1I29A 2EH6A 1QITA 1YAAA 1V72A 2OQXA 4A0HA 2W7IA 2O7CA 3NYSA 4TMRA 1D2FA 2GB3A 2HP2A 1FG3A 3WLXA 3FKDA 3BCAA 4WBTA 2BI5A 4GE4A 1I48A 3JZLA 4KYOA 2VYCA 3BWOA 3FQAA 1X28A 2C7TA 4CBSA 4PFFA 5G2PA 1SF2A 5EAAA 4BA5A 4MSOA 3K7YA 4MKKA 4DGTA 1WYTB 4AH3A 2Z9VA 1AHYA 3AOVA 5BJ4A 5J8QA 4WB0A 1G4VA 3DR4A 3BWNC 1E5EA 4RM1A 3MAFB 4AO4A 1SFFA 3N4RA 2EO5A 3FCRA 4IXSA 2HP1A 1YNUA 4OC9A 5FT5A 1FG7A 3NU7A 5EAVA 4H63Q 4CBRA 4LNJA 2V0YA 3OP7A 1ASEA 4MQQA 3BV0A 5LH9A 1YJYA 2R5CA 2YKVA 2AY8A 1AY4A 1JS6A 2CSTA 4IYOA 1EQBA 3PD6B 5HXXA 1TOEA 4RKCA 1JG8A 1MDZA 4XJOA 2WB6A 3Q8NA 2AY5A 5EIGA 2VMXA 2BIEA 2VGVA 2VMQA 1D7VA 4OMAA 3A2BA 3BC8A 5E4ZA 1G4XA 2W8WA 1ASMA 2VGZA 3EI5A 2GQNA 4J8LA 2FM1A 4ADBA 1SPAA 1O61A 1J04A 1WYVA 5M4BA 3K40A 1SZKA 3FVUA 5FT6A 3MAUA 1CS1A 2ZP7A 3BN1A 4E1OA 3P1TA 1BKGA 3R9AA 3HQTA 4RAEA 2Z67A 3ACZA 2ORDA 1SZSA 5E5IA 1S0AA 3GWPA 2FNIA 4JE5D 1AMRA 2EZ1A 4E3QA 4IY7A 5DB5A 2XBNA 1UU0A 4K2IA 4IXOA 4W1VA 1ARTA 3IHJA 3WZFA 1U08A 4WP0A 4RKDA 2D61A 1BJOB 3HDOA 4JEVA 2VGTA 4ADEA 3G0TA 3VP6A 2ZSLA 1UU2A 1M32A 3AEJC 3H7FA 1CZEA 1OHVA 3AENA 1KL1A 1LC8A 3PPLA 1BQAA 3FZ6A 3JU7A 1X0MA 3R4TA 3B8XA 2ZC0A 1VP4A 3N75A 2VLFA 3E2ZA 3W1IA 2A1VA 2VGSA 1DGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5Y A;  1QGN A;  1RV3 A;  2JGT A;  3E77 A;  4ZDL A;  4UHN A;  2W7D A;  4AZJ A;  4R8D A;  4A6T A;  1BJ4 A;  3ATH A;  2YHK A;  1DJU A;  1O4S A;  4I8A A;  1E5F A;  1LK9 A;  5M49 A;  3BB8 A;  1AJS B;  4WLH A;  1G7X A;  1G7W A;  1IAY A;  1B9H A;  3LVM A;  2BYJ A;  2E7U A;  3VOM A;  1WKG A;  1C0N A;  4XJL A;  1PMM A;  2YKU A;  5EFS A;  3AEM C;  3G7Q A;  3FDD A;  4M2K A;  1ELQ A;  1D7S A;  1V2F A;  2CJH A;  3JW9 A;  4QGR A;  1CL1 A;  5EQC A;  1O62 A;  1MLY A;  1WYT A;  3COG A;  3QN6 A;  3AOW A;  3BS8 A;  4Q6R A;  2G6W A;  5HHY A;  2W7J A;  1GEW A;  1AAW A;  4HVK A;  2ZJG A;  2AY1 A;  4HF8 A;  2CTZ A;  2WKA A;  3MAF A;  2EZ2 A;  5JAY A;  3B1C A;  1ZOD A;  2FNU A;  1GC4 A;  3II0 A;  2DOU A;  3A9X A;  2HUU A;  2VGU A;  3GZD C;  3AEL A;  1BQD A;  3EIA A;  3RQ1 A;  3FRK A;  4GE7 A;  1ZOB A;  3KGW A;  3AEO A;  5BJ3 A;  1LW5 A;  2Z61 A;  3RBL A;  3N5M A;  4MQR A;  4W5K A;  2DR1 A;  3WCN A;  2CH2 A;  3AEP A;  3NTJ A;  2HUF A;  2D7Y A;  1AAM A;  2HUI A;  2PB2 A;  3PD6 A;  3VK2 A;  4ZSY A;  4F5J A;  1AHF A;  4BMK A;  1LW4 A;  3HVY A;  4NOG A;  1M0O A;  5FT4 A;  2W7H A;  3WY7 A;  2ZY2 A;  1IX8 A;  4PVF A;  1YIY A;  2AAT A;  2QLR A;  4ITX A;  1AHE A;  4CVQ A;  2W8U A;  1BS0 A;  1RV4 A;  2FN6 A;  1B8G A;  2ZYJ A;  4MQP A;  2FQ6 A;  3WCO A;  9AAT A;  2X3L A;  5HDM A;  2CH1 A;  3DR7 A;  1W3U A;  2D65 A;  1ZC9 A;  4E77 A;  1V2D A;  3P6K A;  4UHO A;  4GDY A;  2OGA A;  4WYG A;  1PG8 A;  3NDN A;  2Z9U A;  4H51 A;  4TV7 A;  1XEY A;  2YRI A;  1EG5 A;  1KKJ A;  1QJ3 A;  2VMN A;  3NNK A;  3TFU A;  5TF5 A;  1M6S A;  4LNM A;  3K28 A;  2CAN A;  3KKI A;  2YCP A;  4ADD A;  1CQ8 A;  2Z9X A;  2GMS A;  1CJ0 A;  3ZZJ A;  1I41 A;  3CAI A;  4BQ0 A;  1CQ6 A;  1CQ7 A;  3FVS A;  1BJO A;  4P7Y A;  2F8J A;  1ASB A;  1B5O A;  3HBX A;  3E2Y A;  3AAT A;  3LVK A;  1I43 A;  3NU8 A;  5G4I A;  4MGR A;  3AV7 A;  2OKJ A;  1IJI A;  5G0A A;  2DKJ A;  4EB5 A;  1ASA A;  3QHX A;  2OAT A;  4EFF A;  3LWS A;  3HL2 A;  3MC6 C;  1TPL A;  3LG0 A;  1S07 A;  1ARH A;  4JEZ A;  4EB7 A;  2QB2 A;  1PFF A;  1ASD A;  3L44 A;  1PMO A;  4W1W A;  1GC3 A;  2BKW A;  2JJE A;  3ASB A;  2CJD A;  2CY8 A;  3FZ8 A;  1GBN A;  2X8U A;  3BWN A;  4EU1 A;  2GMU A;  3VK3 A;  1VJO A;  1ASN A;  1AY8 A;  2W7F A;  3E6G A;  4AOA A;  2Z1Z A;  4JEY A;  5M4D A;  1AHX A;  2ZSM A;  2W7G A;  2WK8 A;  4WB0 B;  1WYU B;  2AEU A;  4LC3 A;  1M0N A;  1ARG A;  2V1P A;  2VMP A;  5G4J A;  4WD2 A;  4JE5 A;  1QJ5 A;  4RIT A;  1LC7 A;  4XJM A;  1SZU A;  1IBJ A;  2BWP A;  4LW2 A;  1Z3Z A;  2C44 A;  2D66 A;  1AIA A;  2E7I A;  4WXB A;  3OKS A;  4WYE A;  4W8I A;  2W7M A;  4A6R A;  7AAT A;  3LVL B;  3NX3 A;  4ZDP A;  1IX6 A;  2YKX A;  4K2M A;  2Q7W A;  1ELU A;  2VMU A;  3FQ7 A;  4M2J A;  4XK1 A;  3UAK A;  4F5G A;  1GC2 A;  4XEW A;  1P3W A;  4UOY A;  1OXO A;  4GSA A;  2X5F A;  2YCN A;  2YOB A;  1ARS A;  3EZS A;  4MY5 A;  5D95 A;  2E7J A;  3CQ6 A;  2AY4 A;  3PDB B;  1C7O A;  2D64 A;  1M7Y A;  3MKJ A;  4LW4 A;  3RCH B;  3WX9 A;  4PFN A;  4ADC A;  3A9Z A;  2JJH A;  4WYF A;  4F5I A;  2AY3 A;  3FDB A;  1AKC A;  3H14 A;  4B9B A;  1TAT A;  1W7L A;  5EUD A;  3ECD A;  3FFR A;  1X29 A;  3GET A;  5EUN A;  2JJF A;  2C81 A;  1AX4 A;  2W7E A;  4ITG A;  4O6Z A;  4UHM A;  3EZ1 A;  2BIG A;  3ZRQ A;  2PB0 A;  4F4E A;  3LY1 A;  3ELP A;  4A00 A;  1RVY A;  1W7M A;  1C9C A;  2VLH A;  1AJR A;  1W23 A;  1IAX A;  5LHA A;  4P3M A;  3WKR A;  2QB3 A;  2VMS A;  4ZDO A;  3QPG A;  1JF9 A;  3DZZ A;  3PA9 A;  3QGU A;  1Z7D A;  4KXK A;  1Y4I A;  4GE9 A;  1BW0 A;  4JF1 A;  3WGB A;  3AEJ A;  3QBO A;  1X2A A;  2PO3 A;  2BWN A;  3DU4 A;  1TOJ A;  2VI8 A;  4ZAH A;  1OHY A;  3PIU A;  1LC5 A;  1ASG A;  1BT4 A;  2YCT A;  4OBV A;  3GJU A;  4U1T A;  1CZC A;  4AZK A;  4CXQ A;  1YJS A;  2VMO A;  2VMT A;  4K2B A;  4IW7 A;  1O69 A;  2VMR A;  4MKJ A;  4FFC A;  3VAX A;  4GRX A;  2OGE A;  1AIB A;  3EUC A;  4GEB A;  4TN4 A;  3DOD A;  3VK4 A;  1N8P A;  2AY2 A;  2BI3 A;  2VMY A;  1J32 A;  5DJ9 A;  2DGL A;  2QA3 A;  3NUB A;  4ZM4 A;  2CFB A;  2ZY3 A;  1JS3 A;  3FQ8 A;  3FTB A;  4OCA A;  2HZP A;  3USF A;  3W1H A;  4DQ6 A;  3NYU A;  4A0G A;  3D6K A;  3I5T A;  3PAA A;  1V2E A;  1KKP A;  4ZWM A;  1MAQ A;  1B4X A;  2O1B A;  4W91 A;  3RUY A;  3EI6 A;  1AKA A;  3QI6 A;  3AEM A;  4ISY A;  1T3I A;  5G2Q A;  1AIC A;  2EPJ A;  1GCK A;  1H1C A;  1C7G A;  1SVV A;  3F9T A;  1M4N A;  1MDX A;  3E2F A;  4ZSW A;  3DC1 A;  3FFH A;  2NMP A;  1S08 A;  2Z9W A;  3ZZK A;  2AY6 A;  2O0R A;  4KAM A;  1UU1 A;  1ORD A;  3ZRP A;  1B9I A;  1AMA A;  2GSA A;  2VIA A;  1RVU A;  2ZUK A;  3KGX A;  2BI1 A;  2CB1 A;  2VGW A;  1WYU A;  1BJN A;  2OKK A;  5DX5 A;  5FT8 A;  3N0L A;  1VEF A;  3EI7 A;  3GZD A;  2W7L A;  2W8J A;  1QZ9 A;  3GSB A;  3UE8 A;  2YKY A;  3DXW A;  2QMA A;  4BA4 A;  4RJY A;  3QM2 A;  2R2N A;  1GDE A;  4ZM3 A;  3WGC A;  2CIN A;  2AY9 A;  2HOX A;  1DJE A;  4IX8 A;  2C0R A;  4ZWV A;  2HOZ A;  8AAT A;  5K8B A;  2VMV A;  3ASA A;  1IX7 A;  2BYL A;  3JWA A;  4WLJ A;  5EUE A;  4ZLV A;  1TOG A;  4JEX A;  1OXP A;  4JEW A;  4F5F A;  3KE3 A;  4F5L A;  4OTL A;  4F5K A;  1DJ9 A;  1IVR A;  4DBC A;  4WXF A;  4W1X A;  2ZY4 A;  4OBU A;  1DKA A;  4XQ2 A;  1GEY A;  3HT4 A;  2Z1Y A;  1OHW A;  3CBF A;  4F5M A;  2WK7 A;  4A6U A;  4ZAS A;  3PDB A;  3HLM A;  1AMS A;  1M0P A;  3RCH A;  3F0H A;  2XH1 A;  1GEX A;  4CXR A;  2VI9 A;  4J5U A;  1TOI A;  4Q75 A;  3TFT A;  1AJS A;  3ZRR A;  3I4J A;  3JTX A;  3MBB A;  2VMW A;  1B5P A;  1XI9 A;  2JG2 A;  5D5S A;  4A72 A;  3B46 A;  3GBX A;  4RLG A;  2BWO A;  2CJG A;  4B98 A;  3FVX A;  2VMZ A;  1LS3 A;  4EMY A;  1D7R A;  3BCB A;  1UKJ A;  4WYD A;  4R5F A;  3PJ0 A;  5C6U A;  3HMU A;  4ATP A;  1FC4 A;  1ASL A;  1DTY A;  1CL2 A;  2QBT A;  5F9S A;  4R2N A;  4XJP A;  4E3R A;  1OAT A;  1WST A;  3IF2 A;  3EIB A;  1TOK A;  5I92 A;  3E9K A;  5F8V A;  2ZY5 A;  2R5C B;  2AY7 A;  3TCM A;  5M46 A;  4A0R A;  2R0T A;  2Z20 A;  1YJZ A;  2X5D A;  3TAT A;  1S09 A;  4IYO B;  2DGM A;  1GD9 A;  3MEB A;  2BHX A;  1ASC A;  3FD0 A;  1EJI A;  1N31 A;  4Y0H A;  1DGE A;  2HOR A;  3GR9 A;  1C4K A;  3B1E A;  3PGY A;  1YOO A;  1KMK A;  3MC6 A;  5EIG B;  3EI9 A;  4L0O A;  4RJ0 A;  4WYA A;  2HOY A;  4WXG A;  1BJW A;  2BI9 A;  4Y0I A;  3RBF A;  3I16 A;  2R5E A;  3MAD A;  2E54 A;  1AHG A;  3CQ4 A;  3M5U A;  2YRR A;  4IXZ A;  4OYT A;  2BIA A;  4JF0 A;  4R5Z A;  5DJ1 A;  4RIZ A;  1KMJ A;  2AEV A;  2DKB A;  1WYV B;  3GZC A;  4FL0 A;  4M2M A;  4BHD A;  1MGV A;  3LV2 A;  4N0W A;  1W7N A;  3L8A A;  3UWC A;  1ARI A;  1QIS A;  4AO9 A;  3NRA A;  3JWB A;  1ASF A;  1IUG A;  4UQV A;  2W8T A;  3G8M A;  2D7Z A;  2JJG A;  2VIB A;  1ECX A;  3A9Y A;  1TAS A;  3B1D A;  3NUI A;  2JIS A;  5G09 A;  1MAP A;  3WKS A;  5IWQ A;  3TQX A;  2BI2 A;  1AMQ A;  1M0Q A;  4XAU A;  5E3K A;  2WK9 A;  2RFV A;  4U2H A;  2EGY A;  4LNL A;  3ISL A;  2TPL A;  3BCX A;  1D7U A;  1S06 A;  1KL2 A;  3NYT A;  2D63 A;  5AX8 A;  1AY5 A;  1GC0 A;  3F6T A;  3AEN B;  3CQ5 A;  3ELE A;  4PIW A;  1MDO A;  3RI6 A;  1MLZ A;  1LKC A;  3W1J A;  3EI8 A;  1QIR A;  4WYC A;  4ATQ A;  3LVJ A;  1WKH A;  3E2Z B;  3T32 A;  1TAR A;  4Q76 A;  4A0F A;  3DYD A;  4Q31 A;  3DRD A;  1C7N A;  4N0B A;  3FSL A;  2FYF A;  3PDX A;  2DGK A;  3A8U X;  3DXV A;  3FZ7 A;  2W7K A;  4Y0D A;  1YIZ A;  4OT8 A;  2W8V A;  4F5H A;  1N2T A;  1AKB A;  1DFO A;  1H0C A;  1I29 A;  2EH6 A;  1QIT A;  1YAA A;  1V72 A;  2OQX A;  4A0H A;  2W7I A;  2O7C A;  3NYS A;  4TMR A;  1D2F A;  2GB3 A;  2HP2 A;  1FG3 A;  3WLX A;  3FKD A;  3BCA A;  4WBT A;  2BI5 A;  4GE4 A;  1I48 A;  3JZL A;  4KYO A;  2VYC A;  3BWO A;  3FQA A;  1X28 A;  2C7T A;  4CBS A;  4PFF A;  5G2P A;  1SF2 A;  5EAA A;  4BA5 A;  4MSO A;  3K7Y A;  4MKK A;  4DGT A;  1WYT B;  4AH3 A;  2Z9V A;  1AHY A;  3AOV A;  5BJ4 A;  5J8Q A;  4WB0 A;  1G4V A;  3DR4 A;  3BWN C;  1E5E A;  4RM1 A;  3MAF B;  4AO4 A;  1SFF A;  2EO5 A;  3FCR A;  4IXS A;  2HP1 A;  1YNU A;  4OC9 A;  5FT5 A;  1FG7 A;  3NU7 A;  5EAV A;  4CBR A;  4LNJ A;  2V0Y A;  3OP7 A;  1ASE A;  4MQQ A;  3BV0 A;  5LH9 A;  1YJY A;  2R5C A;  2YKV A;  2AY8 A;  1AY4 A;  1JS6 A;  2CST A;  4IYO A;  1EQB A;  3PD6 B;  5HXX A;  1TOE A;  4RKC A;  1JG8 A;  1MDZ A;  4XJO A;  3Q8N A;  2AY5 A;  5EIG A;  2VMX A;  2BIE A;  2VGV A;  2VMQ A;  1D7V A;  4OMA A;  3A2B A;  3BC8 A;  5E4Z A;  1G4X A;  2W8W A;  1ASM A;  2VGZ A;  3EI5 A;  2GQN A;  4J8L A;  2FM1 A;  4ADB A;  1SPA A;  1O61 A;  1J04 A;  1WYV A;  5M4B A;  3K40 A;  1SZK A;  3FVU A;  5FT6 A;  3MAU A;  1CS1 A;  2ZP7 A;  3BN1 A;  4E1O A;  3P1T A;  1BKG A;  3R9A A;  3HQT A;  4RAE A;  2Z67 A;  3ACZ A;  2ORD A;  1SZS A;  5E5I A;  1S0A A;  3GWP A;  2FNI A;  4JE5 D;  1AMR A;  2EZ1 A;  4E3Q A;  4IY7 A;  5DB5 A;  2XBN A;  1UU0 A;  4K2I A;  4IXO A;  4W1V A;  1ART A;  3IHJ A;  3WZF A;  1U08 A;  4WP0 A;  4RKD A;  2D61 A;  1BJO B;  3HDO A;  4JEV A;  2VGT A;  4ADE A;  3G0T A;  3VP6 A;  2ZSL A;  1UU2 A;  1M32 A;  3AEJ C;  3H7F A;  1CZE A;  1OHV A;  3AEN A;  1KL1 A;  1LC8 A;  3PPL A;  1BQA A;  3FZ6 A;  3JU7 A;  1X0M A;  3R4T A;  3B8X A;  2ZC0 A;  1VP4 A;  3N75 A;  2VLF A;  3E2Z A;  3W1I A;  2VGS A;  1DGD A; 
#chains in the Genus database with same CATH topology
 2D5Y A;  1QGN A;  1RV3 A;  2JGT A;  3E77 A;  4ZDL A;  4UHN A;  2W7D A;  4AZJ A;  4R8D A;  4A6T A;  1BJ4 A;  3ATH A;  2YHK A;  1DJU A;  1O4S A;  4I8A A;  1E5F A;  1LK9 A;  5M49 A;  3BB8 A;  1AJS B;  4WLH A;  1G7X A;  1G7W A;  1IAY A;  1B9H A;  3LVM A;  2BYJ A;  2E7U A;  3VOM A;  1WKG A;  1C0N A;  4XJL A;  1PMM A;  2YKU A;  5EFS A;  3AEM C;  3G7Q A;  3FDD A;  4M2K A;  1ELQ A;  1D7S A;  1V2F A;  2CJH A;  3JW9 A;  4QGR A;  1CL1 A;  5EQC A;  1O62 A;  1MLY A;  1WYT A;  3COG A;  3QN6 A;  3AOW A;  3BS8 A;  4Q6R A;  2G6W A;  5HHY A;  2W7J A;  1GEW A;  1AAW A;  4HVK A;  2ZJG A;  2AY1 A;  4HF8 A;  2CTZ A;  2WKA A;  3MAF A;  2EZ2 A;  5JAY A;  3B1C A;  1ZOD A;  2FNU A;  1GC4 A;  3II0 A;  2DOU A;  3A9X A;  2HUU A;  2VGU A;  3GZD C;  3AEL A;  1BQD A;  3EIA A;  3RQ1 A;  3FRK A;  4GE7 A;  1ZOB A;  3KGW A;  3AEO A;  5BJ3 A;  1LW5 A;  2Z61 A;  3RBL A;  3N5M A;  4MQR A;  4W5K A;  2DR1 A;  3WCN A;  2CH2 A;  3AEP A;  3NTJ A;  2HUF A;  2D7Y A;  1AAM A;  2HUI A;  2PB2 A;  3PD6 A;  3VK2 A;  4ZSY A;  4F5J A;  1AHF A;  4BMK A;  1LW4 A;  3HVY A;  4NOG A;  1M0O A;  5FT4 A;  2W7H A;  3WY7 A;  2ZY2 A;  1IX8 A;  4PVF A;  1YIY A;  2AAT A;  2QLR A;  4ITX A;  1AHE A;  4CVQ A;  2W8U A;  1BS0 A;  1RV4 A;  2FN6 A;  1B8G A;  2ZYJ A;  4MQP A;  2FQ6 A;  3WCO A;  9AAT A;  2X3L A;  5HDM A;  2CH1 A;  3DR7 A;  1W3U A;  2D65 A;  1ZC9 A;  4E77 A;  1V2D A;  3P6K A;  4UHO A;  5KTB A;  4GDY A;  2OGA A;  4WYG A;  1PG8 A;  3NDN A;  2Z9U A;  4H51 A;  4TV7 A;  1XEY A;  2YRI A;  1EG5 A;  1KKJ A;  1QJ3 A;  2VMN A;  3NNK A;  3TFU A;  2QSR A;  5TF5 A;  1M6S A;  4LNM A;  3K28 A;  2CAN A;  3KKI A;  2YCP A;  4ADD A;  1CQ8 A;  2Z9X A;  2GMS A;  1CJ0 A;  3ZZJ A;  1I41 A;  3CAI A;  4BQ0 A;  1CQ6 A;  1CQ7 A;  3FVS A;  1BJO A;  4P7Y A;  2F8J A;  1ASB A;  1B5O A;  3HBX A;  3E2Y A;  3AAT A;  3LVK A;  1I43 A;  3NU8 A;  5G4I A;  4MGR A;  3AV7 A;  2OKJ A;  1IJI A;  5G0A A;  2DKJ A;  4EB5 A;  1ASA A;  3QHX A;  2EYQ A;  2OAT A;  4EFF A;  3LWS A;  3HL2 A;  3MC6 C;  1TPL A;  3LG0 A;  1S07 A;  1ARH A;  4JEZ A;  2G7J A;  4EB7 A;  2QB2 A;  1PFF A;  1ASD A;  3L44 A;  1PMO A;  4W1W A;  1GC3 A;  2BKW A;  2JJE A;  3ASB A;  2CJD A;  2CY8 A;  3FZ8 A;  1GBN A;  2X8U A;  3BWN A;  4EU1 A;  2GMU A;  3VK3 A;  1VJO A;  1ASN A;  1AY8 A;  2W7F A;  3E6G A;  4AOA A;  2Z1Z A;  4JEY A;  5M4D A;  1AHX A;  2ZSM A;  2W7G A;  2WK8 A;  4WB0 B;  1WYU B;  2AEU A;  4LC3 A;  1M0N A;  1ARG A;  2V1P A;  2VMP A;  5G4J A;  4WD2 A;  4JE5 A;  1QJ5 A;  4RIT A;  1LC7 A;  4XJM A;  3N4S A;  1SZU A;  1IBJ A;  2BWP A;  4LW2 A;  1Z3Z A;  2C44 A;  2D66 A;  1AIA A;  2E7I A;  4WXB A;  3OKS A;  4WYE A;  4W8I A;  2W7M A;  4A6R A;  7AAT A;  3LVL B;  3NX3 A;  4ZDP A;  1IX6 A;  2YKX A;  4K2M A;  2Q7W A;  1ELU A;  2VMU A;  3FQ7 A;  4M2J A;  4XK1 A;  3UAK A;  4F5G A;  1GC2 A;  4K05 A;  4XEW A;  1P3W A;  4UOY A;  1OXO A;  4GSA A;  2X5F A;  2YCN A;  2YOB A;  1ARS A;  3EZS A;  4MY5 A;  5D95 A;  2E7J A;  3CQ6 A;  2AY4 A;  3PDB B;  1C7O A;  2D64 A;  1M7Y A;  3MKJ A;  4LW4 A;  3RCH B;  3WX9 A;  1KAF A;  4PFN A;  4ADC A;  3A9Z A;  2JJH A;  4WYF A;  4F5I A;  2AY3 A;  3FDB A;  1AKC A;  3H14 A;  4B9B A;  1TAT A;  1W7L A;  5EUD A;  3ECD A;  3FFR A;  1X29 A;  3GET A;  5EUN A;  2JJF A;  2C81 A;  1AX4 A;  2W7E A;  4ITG A;  4O6Z A;  4UHM A;  3EZ1 A;  2BIG A;  3ZRQ A;  2PB0 A;  4F4E A;  3LY1 A;  3ELP A;  4A00 A;  1RVY A;  1W7M A;  1C9C A;  2VLH A;  1AJR A;  1W23 A;  1IAX A;  5LHA A;  4P3M A;  3WKR A;  2QB3 A;  2VMS A;  4ZDO A;  3QPG A;  1JF9 A;  3DZZ A;  3PA9 A;  3QGU A;  1Z7D A;  4KXK A;  1Y4I A;  4GE9 A;  1BW0 A;  4JF1 A;  3WGB A;  3AEJ A;  3QBO A;  1X2A A;  2PO3 A;  2BWN A;  3DU4 A;  1TOJ A;  2VI8 A;  4ZAH A;  3H9X A;  1OHY A;  3PIU A;  1LC5 A;  3N4X A;  1ASG A;  1BT4 A;  2YCT A;  4OBV A;  3GJU A;  4U1T A;  1CZC A;  4AZK A;  4CXQ A;  1YJS A;  2VMO A;  2VMT A;  4K2B A;  4IW7 A;  1O69 A;  2VMR A;  4MKJ A;  4FFC A;  3VAX A;  4GRX A;  2OGE A;  1AIB A;  3EUC A;  4GEB A;  4TN4 A;  3DOD A;  3VK4 A;  1N8P A;  2AY2 A;  2BI3 A;  2VMY A;  1J32 A;  5DJ9 A;  2DGL A;  2QA3 A;  3NUB A;  4ZM4 A;  2CFB A;  2ZY3 A;  1JS3 A;  3FQ8 A;  3FTB A;  4OCA A;  2HZP A;  3USF A;  3W1H A;  4DQ6 A;  3NYU A;  4A0G A;  3D6K A;  3I5T A;  3PAA A;  1V2E A;  1KKP A;  4ZWM A;  1MAQ A;  1B4X A;  2O1B A;  4W91 A;  3RUY A;  3EI6 A;  1AKA A;  3QI6 A;  3AEM A;  4ISY A;  1T3I A;  5G2Q A;  1AIC A;  2EPJ A;  1GCK A;  1H1C A;  3N7N A;  1C7G A;  1SVV A;  3F9T A;  1M4N A;  1MDX A;  3E2F A;  4ZSW A;  3DC1 A;  3FFH A;  2NMP A;  1S08 A;  2Z9W A;  3ZZK A;  2AY6 A;  2O0R A;  4KAM A;  1UU1 A;  1ORD A;  3ZRP A;  1B9I A;  1AMA A;  2GSA A;  2VIA A;  1RVU A;  2ZUK A;  3KGX A;  2BI1 A;  2CB1 A;  2VGW A;  1WYU A;  1BJN A;  2OKK A;  5DX5 A;  5FT8 A;  3N0L A;  1VEF A;  3EI7 A;  3GZD A;  2W7L A;  2W8J A;  1QZ9 A;  3GSB A;  3UE8 A;  2YKY A;  3DXW A;  2QMA A;  4BA4 A;  4RJY A;  3QM2 A;  2R2N A;  1GDE A;  4ZM3 A;  3WGC A;  2CIN A;  2AY9 A;  2HOX A;  1DJE A;  4IX8 A;  2C0R A;  4ZWV A;  2HOZ A;  8AAT A;  5K8B A;  2VMV A;  3ASA A;  1IX7 A;  2BYL A;  3JWA A;  4WLJ A;  5EUE A;  4ZLV A;  1TOG A;  4JEX A;  1OXP A;  4JEW A;  4F5F A;  3KE3 A;  4F5L A;  4OTL A;  4F5K A;  1DJ9 A;  1IVR A;  4DBC A;  4WXF A;  4W1X A;  2ZY4 A;  4OBU A;  1DKA A;  4XQ2 A;  1GEY A;  3HT4 A;  2Z1Y A;  1OHW A;  3CBF A;  4F5M A;  2WK7 A;  4A6U A;  4ZAS A;  3PDB A;  3HLM A;  1AMS A;  1M0P A;  3RCH A;  3F0H A;  2XH1 A;  1GEX A;  4CXR A;  2VI9 A;  4J5U A;  1TOI A;  4Q75 A;  3TFT A;  1AJS A;  3ZRR A;  3I4J A;  3JTX A;  3MBB A;  2VMW A;  1B5P A;  1XI9 A;  2JG2 A;  5D5S A;  4A72 A;  3B46 A;  3GBX A;  4RLG A;  2BWO A;  2CJG A;  4B98 A;  3FVX A;  2VMZ A;  1LS3 A;  4EMY A;  1D7R A;  3BCB A;  1UKJ A;  4WYD A;  4R5F A;  3PJ0 A;  5C6U A;  3HMU A;  4ATP A;  1FC4 A;  1ASL A;  1DTY A;  1CL2 A;  2QBT A;  5F9S A;  4R2N A;  4XJP A;  4E3R A;  2FKI A;  1OAT A;  1WST A;  3IF2 A;  3EIB A;  1TOK A;  5I92 A;  3E9K A;  5F8V A;  2ZY5 A;  2R5C B;  2AY7 A;  3TCM A;  5M46 A;  4A0R A;  2R0T A;  2Z20 A;  1YJZ A;  2X5D A;  3TAT A;  1S09 A;  4IYO B;  2DGM A;  1GD9 A;  3MEB A;  2BHX A;  1ASC A;  3FD0 A;  1EJI A;  1N31 A;  4Y0H A;  1DGE A;  2HOR A;  3GR9 A;  1C4K A;  3B1E A;  3PGY A;  1YOO A;  1KMK A;  3MC6 A;  5EIG B;  3EI9 A;  4L0O A;  4RJ0 A;  4WYA A;  2HOY A;  4WXG A;  1BJW A;  2BI9 A;  4Y0I A;  3RBF A;  3I16 A;  2R5E A;  3MAD A;  2E54 A;  1AHG A;  3CQ4 A;  3M5U A;  2YRR A;  4IXZ A;  4OYT A;  2BIA A;  4JF0 A;  4R5Z A;  5DJ1 A;  4RIZ A;  1KMJ A;  2AEV A;  2DKB A;  1WYV B;  3GZC A;  4FL0 A;  4M2M A;  4BHD A;  1MGV A;  3LV2 A;  4N0W A;  1W7N A;  3L8A A;  3UWC A;  1ARI A;  1QIS A;  4AO9 A;  3NRA A;  3JWB A;  1ASF A;  1IUG A;  4UQV A;  2W8T A;  3G8M A;  2D7Z A;  2JJG A;  2VIB A;  1ECX A;  3A9Y A;  1TAS A;  3B1D A;  3NUI A;  2JIS A;  5G09 A;  1MAP A;  3WKS A;  5IWQ A;  3TQX A;  2BI2 A;  1AMQ A;  1M0Q A;  4XAU A;  5E3K A;  2WK9 A;  2RFV A;  4U2H A;  2EGY A;  4LNL A;  3ISL A;  2TPL A;  3BCX A;  1D7U A;  1S06 A;  1KL2 A;  3NYT A;  2D63 A;  5AX8 A;  1AY5 A;  1GC0 A;  3F6T A;  3AEN B;  3CQ5 A;  3ELE A;  4PIW A;  1MDO A;  2KFP A;  3RI6 A;  1MLZ A;  1LKC A;  3W1J A;  3EI8 A;  1QIR A;  4WYC A;  4ATQ A;  3LVJ A;  1WKH A;  3E2Z B;  3T32 A;  1TAR A;  4Q76 A;  4A0F A;  3DYD A;  4Q31 A;  3DRD A;  1C7N A;  4N0B A;  3FSL A;  2FYF A;  3PDX A;  2DGK A;  3A8U X;  3DXV A;  3FZ7 A;  2W7K A;  4Y0D A;  1YIZ A;  4OT8 A;  2W8V A;  4F5H A;  1N2T A;  1AKB A;  1DFO A;  1H0C A;  1I29 A;  2EH6 A;  1QIT A;  1YAA A;  1V72 A;  2OQX A;  4A0H A;  2W7I A;  2O7C A;  3NYS A;  4TMR A;  1D2F A;  2GB3 A;  2HP2 A;  1FG3 A;  3WLX A;  3FKD A;  3BCA A;  4WBT A;  2BI5 A;  4GE4 A;  1I48 A;  3JZL A;  4KYO A;  2VYC A;  3BWO A;  3FQA A;  1X28 A;  2C7T A;  4CBS A;  4PFF A;  5G2P A;  1SF2 A;  5EAA A;  4BA5 A;  4MSO A;  3K7Y A;  4MKK A;  4DGT A;  1WYT B;  4AH3 A;  2Z9V A;  1AHY A;  3AOV A;  5BJ4 A;  5J8Q A;  4WB0 A;  1G4V A;  3DR4 A;  3BWN C;  1E5E A;  4RM1 A;  3MAF B;  4AO4 A;  1SFF A;  3N4R A;  2EO5 A;  3FCR A;  4IXS A;  2HP1 A;  1YNU A;  4OC9 A;  5FT5 A;  1FG7 A;  3NU7 A;  5EAV A;  4H63 Q;  4CBR A;  4LNJ A;  2V0Y A;  3OP7 A;  1ASE A;  4MQQ A;  3BV0 A;  5LH9 A;  1YJY A;  2R5C A;  2YKV A;  2AY8 A;  1AY4 A;  1JS6 A;  2CST A;  4IYO A;  1EQB A;  3PD6 B;  5HXX A;  1TOE A;  4RKC A;  1JG8 A;  1MDZ A;  4XJO A;  2WB6 A;  3Q8N A;  2AY5 A;  5EIG A;  2VMX A;  2BIE A;  2VGV A;  2VMQ A;  1D7V A;  4OMA A;  3A2B A;  3BC8 A;  5E4Z A;  1G4X A;  2W8W A;  1ASM A;  2VGZ A;  3EI5 A;  2GQN A;  4J8L A;  2FM1 A;  4ADB A;  1SPA A;  1O61 A;  1J04 A;  1WYV A;  5M4B A;  3K40 A;  1SZK A;  3FVU A;  5FT6 A;  3MAU A;  1CS1 A;  2ZP7 A;  3BN1 A;  4E1O A;  3P1T A;  1BKG A;  3R9A A;  3HQT A;  4RAE A;  2Z67 A;  3ACZ A;  2ORD A;  1SZS A;  5E5I A;  1S0A A;  3GWP A;  2FNI A;  4JE5 D;  1AMR A;  2EZ1 A;  4E3Q A;  4IY7 A;  5DB5 A;  2XBN A;  1UU0 A;  4K2I A;  4IXO A;  4W1V A;  1ART A;  3IHJ A;  3WZF A;  1U08 A;  4WP0 A;  4RKD A;  2D61 A;  1BJO B;  3HDO A;  4JEV A;  2VGT A;  4ADE A;  3G0T A;  3VP6 A;  2ZSL A;  1UU2 A;  1M32 A;  3AEJ C;  3H7F A;  1CZE A;  1OHV A;  3AEN A;  1KL1 A;  1LC8 A;  3PPL A;  1BQA A;  3FZ6 A;  3JU7 A;  1X0M A;  3R4T A;  3B8X A;  2ZC0 A;  1VP4 A;  3N75 A;  2VLF A;  3E2Z A;  3W1I A;  2A1V A;  2VGS A;  1DGD A; 
#chains in the Genus database with same CATH homology
 2D5Y A;  1QGN A;  1RV3 A;  2JGT A;  3E77 A;  4ZDL A;  4UHN A;  2W7D A;  4AZJ A;  4R8D A;  4A6T A;  1BJ4 A;  3ATH A;  2YHK A;  1DJU A;  1O4S A;  4I8A A;  1E5F A;  1LK9 A;  5M49 A;  3BB8 A;  1AJS B;  4WLH A;  1G7X A;  1G7W A;  1IAY A;  1B9H A;  3LVM A;  2BYJ A;  2E7U A;  3VOM A;  1WKG A;  1C0N A;  4XJL A;  1PMM A;  2YKU A;  5EFS A;  3AEM C;  3G7Q A;  3FDD A;  4M2K A;  1ELQ A;  1D7S A;  1V2F A;  2CJH A;  3JW9 A;  4QGR A;  1CL1 A;  5EQC A;  1O62 A;  1MLY A;  1WYT A;  3COG A;  3QN6 A;  3AOW A;  3BS8 A;  4Q6R A;  2G6W A;  5HHY A;  2W7J A;  1GEW A;  1AAW A;  4HVK A;  2ZJG A;  2AY1 A;  4HF8 A;  2CTZ A;  2WKA A;  3MAF A;  2EZ2 A;  5JAY A;  3B1C A;  1ZOD A;  2FNU A;  1GC4 A;  3II0 A;  2DOU A;  3A9X A;  2HUU A;  2VGU A;  3GZD C;  3AEL A;  1BQD A;  3EIA A;  3RQ1 A;  3FRK A;  4GE7 A;  1ZOB A;  3KGW A;  3AEO A;  5BJ3 A;  1LW5 A;  2Z61 A;  3RBL A;  3N5M A;  4MQR A;  4W5K A;  2DR1 A;  3WCN A;  2CH2 A;  3AEP A;  3NTJ A;  2HUF A;  2D7Y A;  1AAM A;  2HUI A;  2PB2 A;  3PD6 A;  3VK2 A;  4ZSY A;  4F5J A;  1AHF A;  4BMK A;  1LW4 A;  3HVY A;  4NOG A;  1M0O A;  5FT4 A;  2W7H A;  3WY7 A;  2ZY2 A;  1IX8 A;  4PVF A;  1YIY A;  2AAT A;  2QLR A;  4ITX A;  1AHE A;  4CVQ A;  2W8U A;  1BS0 A;  1RV4 A;  2FN6 A;  1B8G A;  2ZYJ A;  4MQP A;  2FQ6 A;  3WCO A;  9AAT A;  2X3L A;  5HDM A;  2CH1 A;  3DR7 A;  1W3U A;  2D65 A;  1ZC9 A;  4E77 A;  1V2D A;  3P6K A;  4UHO A;  5KTB A;  4GDY A;  2OGA A;  4WYG A;  1PG8 A;  3NDN A;  2Z9U A;  4H51 A;  4TV7 A;  1XEY A;  2YRI A;  1EG5 A;  1KKJ A;  1QJ3 A;  2VMN A;  3NNK A;  3TFU A;  2QSR A;  5TF5 A;  1M6S A;  4LNM A;  3K28 A;  2CAN A;  3KKI A;  2YCP A;  4ADD A;  1CQ8 A;  2Z9X A;  2GMS A;  1CJ0 A;  3ZZJ A;  1I41 A;  3CAI A;  4BQ0 A;  1CQ6 A;  1CQ7 A;  3FVS A;  1BJO A;  4P7Y A;  2F8J A;  1ASB A;  1B5O A;  3HBX A;  3E2Y A;  3AAT A;  3LVK A;  1I43 A;  3NU8 A;  5G4I A;  4MGR A;  3AV7 A;  2OKJ A;  1IJI A;  5G0A A;  2DKJ A;  4EB5 A;  1ASA A;  3QHX A;  2EYQ A;  2OAT A;  4EFF A;  3LWS A;  3HL2 A;  3MC6 C;  1TPL A;  3LG0 A;  1S07 A;  1ARH A;  4JEZ A;  2G7J A;  4EB7 A;  2QB2 A;  1PFF A;  1ASD A;  3L44 A;  1PMO A;  4W1W A;  1GC3 A;  2BKW A;  2JJE A;  3ASB A;  2CJD A;  2CY8 A;  3FZ8 A;  1GBN A;  2X8U A;  3BWN A;  4EU1 A;  2GMU A;  3VK3 A;  1VJO A;  1ASN A;  1AY8 A;  2W7F A;  3E6G A;  4AOA A;  2Z1Z A;  4JEY A;  5M4D A;  1AHX A;  2ZSM A;  2W7G A;  2WK8 A;  4WB0 B;  1WYU B;  2AEU A;  4LC3 A;  1M0N A;  1ARG A;  2V1P A;  2VMP A;  5G4J A;  4WD2 A;  4JE5 A;  1QJ5 A;  4RIT A;  1LC7 A;  4XJM A;  3N4S A;  1SZU A;  1IBJ A;  2BWP A;  4LW2 A;  1Z3Z A;  2C44 A;  2D66 A;  1AIA A;  2E7I A;  4WXB A;  3OKS A;  4WYE A;  4W8I A;  2W7M A;  4A6R A;  7AAT A;  3LVL B;  3NX3 A;  4ZDP A;  1IX6 A;  2YKX A;  4K2M A;  2Q7W A;  1ELU A;  2VMU A;  3FQ7 A;  4M2J A;  4XK1 A;  3UAK A;  4F5G A;  1GC2 A;  4K05 A;  4XEW A;  1P3W A;  4UOY A;  1OXO A;  4GSA A;  2X5F A;  2YCN A;  2YOB A;  1ARS A;  3EZS A;  4MY5 A;  5D95 A;  2E7J A;  3CQ6 A;  2AY4 A;  3PDB B;  1C7O A;  2D64 A;  1M7Y A;  3MKJ A;  4LW4 A;  3RCH B;  3WX9 A;  4PFN A;  4ADC A;  3A9Z A;  2JJH A;  4WYF A;  4F5I A;  2AY3 A;  3FDB A;  1AKC A;  3H14 A;  4B9B A;  1TAT A;  1W7L A;  5EUD A;  3ECD A;  3FFR A;  1X29 A;  3GET A;  5EUN A;  2JJF A;  2C81 A;  1AX4 A;  2W7E A;  4ITG A;  4O6Z A;  4UHM A;  3EZ1 A;  2BIG A;  3ZRQ A;  2PB0 A;  4F4E A;  3LY1 A;  3ELP A;  4A00 A;  1RVY A;  1W7M A;  1C9C A;  2VLH A;  1AJR A;  1W23 A;  1IAX A;  5LHA A;  4P3M A;  3WKR A;  2QB3 A;  2VMS A;  4ZDO A;  3QPG A;  1JF9 A;  3DZZ A;  3PA9 A;  3QGU A;  1Z7D A;  4KXK A;  1Y4I A;  4GE9 A;  1BW0 A;  4JF1 A;  3WGB A;  3AEJ A;  3QBO A;  1X2A A;  2PO3 A;  2BWN A;  3DU4 A;  1TOJ A;  2VI8 A;  4ZAH A;  3H9X A;  1OHY A;  3PIU A;  1LC5 A;  3N4X A;  1ASG A;  1BT4 A;  2YCT A;  4OBV A;  3GJU A;  4U1T A;  1CZC A;  4AZK A;  4CXQ A;  1YJS A;  2VMO A;  2VMT A;  4K2B A;  4IW7 A;  1O69 A;  2VMR A;  4MKJ A;  4FFC A;  3VAX A;  4GRX A;  2OGE A;  1AIB A;  3EUC A;  4GEB A;  4TN4 A;  3DOD A;  3VK4 A;  1N8P A;  2AY2 A;  2BI3 A;  2VMY A;  1J32 A;  5DJ9 A;  2DGL A;  2QA3 A;  3NUB A;  4ZM4 A;  2CFB A;  2ZY3 A;  1JS3 A;  3FQ8 A;  3FTB A;  4OCA A;  2HZP A;  3USF A;  3W1H A;  4DQ6 A;  3NYU A;  4A0G A;  3D6K A;  3I5T A;  3PAA A;  1V2E A;  1KKP A;  4ZWM A;  1MAQ A;  1B4X A;  2O1B A;  4W91 A;  3RUY A;  3EI6 A;  1AKA A;  3QI6 A;  3AEM A;  4ISY A;  1T3I A;  5G2Q A;  1AIC A;  2EPJ A;  1GCK A;  1H1C A;  3N7N A;  1C7G A;  1SVV A;  3F9T A;  1M4N A;  1MDX A;  3E2F A;  4ZSW A;  3DC1 A;  3FFH A;  2NMP A;  1S08 A;  2Z9W A;  3ZZK A;  2AY6 A;  2O0R A;  4KAM A;  1UU1 A;  1ORD A;  3ZRP A;  1B9I A;  1AMA A;  2GSA A;  2VIA A;  1RVU A;  2ZUK A;  3KGX A;  2BI1 A;  2CB1 A;  2VGW A;  1WYU A;  1BJN A;  2OKK A;  5DX5 A;  5FT8 A;  3N0L A;  1VEF A;  3EI7 A;  3GZD A;  2W7L A;  2W8J A;  1QZ9 A;  3GSB A;  3UE8 A;  2YKY A;  3DXW A;  2QMA A;  4BA4 A;  4RJY A;  3QM2 A;  2R2N A;  1GDE A;  4ZM3 A;  3WGC A;  2CIN A;  2AY9 A;  2HOX A;  1DJE A;  4IX8 A;  2C0R A;  4ZWV A;  2HOZ A;  8AAT A;  5K8B A;  2VMV A;  3ASA A;  1IX7 A;  2BYL A;  3JWA A;  4WLJ A;  5EUE A;  4ZLV A;  1TOG A;  4JEX A;  1OXP A;  4JEW A;  4F5F A;  3KE3 A;  4F5L A;  4OTL A;  4F5K A;  1DJ9 A;  1IVR A;  4DBC A;  4WXF A;  4W1X A;  2ZY4 A;  4OBU A;  1DKA A;  4XQ2 A;  1GEY A;  3HT4 A;  2Z1Y A;  1OHW A;  3CBF A;  4F5M A;  2WK7 A;  4A6U A;  4ZAS A;  3PDB A;  3HLM A;  1AMS A;  1M0P A;  3RCH A;  3F0H A;  2XH1 A;  1GEX A;  4CXR A;  2VI9 A;  4J5U A;  1TOI A;  4Q75 A;  3TFT A;  1AJS A;  3ZRR A;  3I4J A;  3JTX A;  3MBB A;  2VMW A;  1B5P A;  1XI9 A;  2JG2 A;  5D5S A;  4A72 A;  3B46 A;  3GBX A;  4RLG A;  2BWO A;  2CJG A;  4B98 A;  3FVX A;  2VMZ A;  1LS3 A;  4EMY A;  1D7R A;  3BCB A;  1UKJ A;  4WYD A;  4R5F A;  3PJ0 A;  5C6U A;  3HMU A;  4ATP A;  1FC4 A;  1ASL A;  1DTY A;  1CL2 A;  2QBT A;  5F9S A;  4R2N A;  4XJP A;  4E3R A;  2FKI A;  1OAT A;  1WST A;  3IF2 A;  3EIB A;  1TOK A;  5I92 A;  3E9K A;  5F8V A;  2ZY5 A;  2R5C B;  2AY7 A;  3TCM A;  5M46 A;  4A0R A;  2R0T A;  2Z20 A;  1YJZ A;  2X5D A;  3TAT A;  1S09 A;  4IYO B;  2DGM A;  1GD9 A;  3MEB A;  2BHX A;  1ASC A;  3FD0 A;  1EJI A;  1N31 A;  4Y0H A;  1DGE A;  2HOR A;  3GR9 A;  1C4K A;  3B1E A;  3PGY A;  1YOO A;  1KMK A;  3MC6 A;  5EIG B;  3EI9 A;  4L0O A;  4RJ0 A;  4WYA A;  2HOY A;  4WXG A;  1BJW A;  2BI9 A;  4Y0I A;  3RBF A;  3I16 A;  2R5E A;  3MAD A;  2E54 A;  1AHG A;  3CQ4 A;  3M5U A;  2YRR A;  4IXZ A;  4OYT A;  2BIA A;  4JF0 A;  4R5Z A;  5DJ1 A;  4RIZ A;  1KMJ A;  2AEV A;  2DKB A;  1WYV B;  3GZC A;  4FL0 A;  4M2M A;  4BHD A;  1MGV A;  3LV2 A;  4N0W A;  1W7N A;  3L8A A;  3UWC A;  1ARI A;  1QIS A;  4AO9 A;  3NRA A;  3JWB A;  1ASF A;  1IUG A;  4UQV A;  2W8T A;  3G8M A;  2D7Z A;  2JJG A;  2VIB A;  1ECX A;  3A9Y A;  1TAS A;  3B1D A;  3NUI A;  2JIS A;  5G09 A;  1MAP A;  3WKS A;  5IWQ A;  3TQX A;  2BI2 A;  1AMQ A;  1M0Q A;  4XAU A;  5E3K A;  2WK9 A;  2RFV A;  4U2H A;  2EGY A;  4LNL A;  3ISL A;  2TPL A;  3BCX A;  1D7U A;  1S06 A;  1KL2 A;  3NYT A;  2D63 A;  5AX8 A;  1AY5 A;  1GC0 A;  3F6T A;  3AEN B;  3CQ5 A;  3ELE A;  4PIW A;  1MDO A;  2KFP A;  3RI6 A;  1MLZ A;  1LKC A;  3W1J A;  3EI8 A;  1QIR A;  4WYC A;  4ATQ A;  3LVJ A;  1WKH A;  3E2Z B;  3T32 A;  1TAR A;  4Q76 A;  4A0F A;  3DYD A;  4Q31 A;  3DRD A;  1C7N A;  4N0B A;  3FSL A;  2FYF A;  3PDX A;  2DGK A;  3A8U X;  3DXV A;  3FZ7 A;  2W7K A;  4Y0D A;  1YIZ A;  4OT8 A;  2W8V A;  4F5H A;  1N2T A;  1AKB A;  1DFO A;  1H0C A;  1I29 A;  2EH6 A;  1QIT A;  1YAA A;  1V72 A;  2OQX A;  4A0H A;  2W7I A;  2O7C A;  3NYS A;  4TMR A;  1D2F A;  2GB3 A;  2HP2 A;  1FG3 A;  3WLX A;  3FKD A;  3BCA A;  4WBT A;  2BI5 A;  4GE4 A;  1I48 A;  3JZL A;  4KYO A;  2VYC A;  3BWO A;  3FQA A;  1X28 A;  2C7T A;  4CBS A;  4PFF A;  5G2P A;  1SF2 A;  5EAA A;  4BA5 A;  4MSO A;  3K7Y A;  4MKK A;  4DGT A;  1WYT B;  4AH3 A;  2Z9V A;  1AHY A;  3AOV A;  5BJ4 A;  5J8Q A;  4WB0 A;  1G4V A;  3DR4 A;  3BWN C;  1E5E A;  4RM1 A;  3MAF B;  4AO4 A;  1SFF A;  3N4R A;  2EO5 A;  3FCR A;  4IXS A;  2HP1 A;  1YNU A;  4OC9 A;  5FT5 A;  1FG7 A;  3NU7 A;  5EAV A;  4H63 Q;  4CBR A;  4LNJ A;  2V0Y A;  3OP7 A;  1ASE A;  4MQQ A;  3BV0 A;  5LH9 A;  1YJY A;  2R5C A;  2YKV A;  2AY8 A;  1AY4 A;  1JS6 A;  2CST A;  4IYO A;  1EQB A;  3PD6 B;  5HXX A;  1TOE A;  4RKC A;  1JG8 A;  1MDZ A;  4XJO A;  2WB6 A;  3Q8N A;  2AY5 A;  5EIG A;  2VMX A;  2BIE A;  2VGV A;  2VMQ A;  1D7V A;  4OMA A;  3A2B A;  3BC8 A;  5E4Z A;  1G4X A;  2W8W A;  1ASM A;  2VGZ A;  3EI5 A;  2GQN A;  4J8L A;  2FM1 A;  4ADB A;  1SPA A;  1O61 A;  1J04 A;  1WYV A;  5M4B A;  3K40 A;  1SZK A;  3FVU A;  5FT6 A;  3MAU A;  1CS1 A;  2ZP7 A;  3BN1 A;  4E1O A;  3P1T A;  1BKG A;  3R9A A;  3HQT A;  4RAE A;  2Z67 A;  3ACZ A;  2ORD A;  1SZS A;  5E5I A;  1S0A A;  3GWP A;  2FNI A;  4JE5 D;  1AMR A;  2EZ1 A;  4E3Q A;  4IY7 A;  5DB5 A;  2XBN A;  1UU0 A;  4K2I A;  4IXO A;  4W1V A;  1ART A;  3IHJ A;  3WZF A;  1U08 A;  4WP0 A;  4RKD A;  2D61 A;  1BJO B;  3HDO A;  4JEV A;  2VGT A;  4ADE A;  3G0T A;  3VP6 A;  2ZSL A;  1UU2 A;  1M32 A;  3AEJ C;  3H7F A;  1CZE A;  1OHV A;  3AEN A;  1KL1 A;  1LC8 A;  3PPL A;  1BQA A;  3FZ6 A;  3JU7 A;  1X0M A;  3R4T A;  3B8X A;  2ZC0 A;  1VP4 A;  3N75 A;  2VLF A;  3E2Z A;  3W1I A;  2A1V A;  2VGS A;  1DGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...