4J5UA

X-ray crystal structure of a serine hydroxymethyltransferase with covalently bound plp from rickettsia rickettsii str. sheila smith
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
420
structure length
419
Chain Sequence
MNIFNNNLHETDKEINEIIKHEKLRQSSVIELIASENFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAHAVTSTTHTLRGPRGGLILSNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNNEDNSALEQQVLNEVTKLIELFPFYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine hydroxymethyltransferase
publication title X-ray crystal structure of a serine hydroxymethyltransferase with covalently bound PLP from Rickettsia rickettsii str. Sheila Smith
rcsb
source organism Rickettsia rickettsii
molecule tags Transferase
total genus 169
structure length 419
sequence length 420
chains with identical sequence B
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2013-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4j5uA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4j5uA01
1IAXA 1W7LA 3MEBA 4WLHA 4RITA 4OBVA 1UKJA 1EQBA 1O69A 5EQCA 5HXXA 1ASBA 4K2IA 4WD2A 2VMQA 4Y0DA 3FFHA 4OCAA 4E3QA 1JG8A 3BN1A 5E3KA 2E7IA 3VAXA 1TPLA 2E7JA 1BJ4A 2QMAA 3PPLA 2VMPA 3G7QA 1W23A 1GC2A 1WYVB 3EIAA 1Z3ZA 2BIGA 2YCNA 1M0PA 1TOGA 3EI6A 4MGRA 3MBBA 1ARHA 3QBOA 4PFFA 3WY7A 3IF2A 3BWOA 3AEMA 3KGXA 1X2AA 1I29A 4AO9A 1LK9A 1BJOB 2YCTA 1PFFA 2CJHA 4W1XA 3WX9A 3AEMC 3EI8A 4KAMA 2R5CB 5FT4A 3RI6A 4KXKA 1WSTA 2DKJA 3FD0A 2VMNA 4OMAA 3WZFA 1D7VA 2CJDA 2AY3A 1IJIA 4CBRA 4IXOA 1SZSA 3F9TA 3E77A 3WGBA 1OXPA 4ADBA 1AMSA 3RCHA 3NNKA 3QM2A 4RAEA 3D6KA 1QZ9A 5HDMA 3PDBB 1VJOA 3KGWA 3DRDA 1V72A 1OHWA 2VMYA 3LVMA 4DBCA 1ARGA 4F5GA 1OATA 3CAIA 3PAAA 3PIUA 4EB5A 3BC8A 3BCAA 2OKJA 2WK9A 5HHYA 1AKCA 2Z67A 1N8PA 1QITA 2V1PA 4MQPA 1TOEA 1YNUA 3GBXA 3LWSA 4ZDLA 2YCPA 4I8AA 1UU1A 1ZC9A 4IYOB 4F5IA 3FSLA 1MDXA 5IWQA 3EIBA 1S06A 4JE5D 4XAUA 1X28A 2W7KA 5LH9A 3WKSA 1AAWA 4AH3A 5BJ3A 2O0RA 3OKSA 4WYCA 5EIGA 2Z20A 2HZPA 5EUEA 5FT8A 5EFSA 2OGEA 5LHAA 3A9XA 2Z9WA 1B9IA 2BYLA 1S0AA 2EZ2A 4MKKA 2E54A 4ZWVA 2VMVA 4AO4A 3R4TA 3NX3A 1RV3A 1DKAA 4XK1A 4A0GA 3A2BA 1KL1A 4CBSA 4XJLA 2AATA 3RBLA 4A00A 3PJ0A 4WB0B 3BV0A 1MLZA 3MC6A 4IX8A 1YJYA 2BWOA 2D7YA 4UHNA 1AJSB 1FC4A 1JS3A 2CFBA 3ECDA 4ZSYA 3MC6C 2OKKA 4LNMA 1EJIA 3AELA 3VOMA 2BIEA 4GEBA 1AHEA 2Z9XA 2W8TA 3DODA 3RBFA 5G4IA 1GEWA 1IUGA 4WYDA 4WYAA 1D7RA 1SF2A 4ZLVA 1H1CA 1YAAA 3TQXA 2QBTA 3P1TA 2HUUA 3GWPA 3NU8A 1IVRA 1P3WA 4WBTA 3FQ7A 1LW5A 2CJGA 2VGUA 2ZSMA 3AEOA 3BB8A 3EI9A 3RUYA 4A6UA 2GMUA 3BWNA 4RKDA 3ZZKA 2QB2A 1EG5A 2ZY4A 3HMUA 3COGA 1M4NA 1AICA 2C44A 3N5MA 4WYEA 5M49A 1U08A 3NYUA 4ZDOA 3BWNC 4M2KA 1AKAA 1LW4A 2VYCA 3B1CA 2DGKA 2ORDA 4JE5A 3PDXA 2EPJA 3E2FA 1GC4A 4A6RA 2AY5A 2ZY3A 3L8AA 2EO5A 1D7SA 1DJEA 1MLYA 3LY1A 3WLXA 4P3MA 4EB7A 4RLGA 1X0MA 1G7WA 2R0TA 3Q8NA 4Q31A 4F4EA 1W3UA 2OATA 2VGVA 1AMAA 2FN6A 4HVKA 4F5KA 4N0WA 5E5IA 4H51A 4ZWMA 1GC0A 1GDEA 4TN4A 1RV4A 4IY7A 3QI6A 2W8VA 1B9HA 1LC8A 3DXWA 3EZSA 4MY5A 4E3RA 8AATA 4MSOA 2AY6A 2VGSA 2VGWA 1G4XA 2D7ZA 3ASBA 4UHMA 2CY8A 3WGCA 4LNLA 2GSAA 1MGVA 2AEUA 2OGAA 4KYOA 2HP2A 4OYTA 2BI9A 4GE4A 5EAAA 1ARTA 1PMMA 2YKYA 5EUDA 3CQ4A 3LVKA 3JZLA 1S08A 3EI7A 3GR9A 3NYSA 4IXSA 1N2TA 4M2MA 4TMRA 3OP7A 4W5KA 3FQAA 2X3LA 4PVFA 3FFRA 3I5TA 1M0OA 2TPLA 3W1HA 2W7MA 4R8DA 4PFNA 2PO3A 2X5DA 3LVLB 5M4DA 3ZRPA 2DGMA 1CZCA 4CXRA 4MQRA 1AIBA 1M0NA 3AOWA 1GD9A 4NOGA 4XEWA 3WKRA 3QN6A 1C9CA 4GDYA 1BS0A 2WK8A 1IX8A 1KMJA 2ZUKA 2W7GA 3VP6A 3B8XA 1MAPA 3PD6A 4ZM3A 1LC5A 3HBXA 4GRXA 4J5UA 1ELUA 2AY2A 3AENB 1LC7A 2W7DA 1WYTA 2V0YA 4OTLA 3DXVA 4CXQA 2G6WA 3NUIA 4A72A 4ZSWA 2HUIA 3E2ZA 2ZP7A 5F9SA 1IX6A 1I41A 4EFFA 2RFVA 3ELEA 3E6GA 2FNUA 1WYUB 1CQ6A 2BKWA 4JF1A 4RJYA 1GBNA 1ORDA 1SZUA 3E9KA 4F5HA 1M0QA 1QIRA 2BI2A 3MAFA 1ASDA 1S09A 2CTZA 3FVSA 3HQTA 1YJSA 3HT4A 4IW7A 4BMKA 2FQ6A 2CINA 5DJ9A 1XEYA 2PB2A 1WKHA 1N31A 4XQ2A 5D95A 1BQDA 4U2HA 1V2EA 4MKJA 1Z7DA 2QA3A 1TOJA 2XBNA 3BS8A 1G4VA 2DR1A 2ZSLA 4GE7A 2CH1A 3VK3A 1ELQA 4IXZA 2HUFA 4WP0A 4JEWA 3QPGA 3GSBA 1WYVA 1B8GA 4AZJA 3DYDA 4LW2A 3UAKA 4W1WA 4R5ZA 1BW0A 1PG8A 3GETA 2C7TA 1BJOA 1ASLA 1CQ8A 2BIAA 2HOXA 2YRRA 3JTXA 1B4XA 3QHXA 1VP4A 2W8UA 3NYTA 4RM1A 3G8MA 1QISA 3K40A 3FDDA 1ZODA 1FG7A 2R5CA 3W1JA 5FT5A 4ATPA 4QGRA 4R2NA 5C6UA 2CH2A 2PB0A 3TFTA 2WK7A 4WXGA 2VLHA 1KMKA 4W91A 2DKBA 2HOZA 5G2PA 2ZY5A 1AHYA 1ARIA 5AX8A 2BI5A 4EU1A 2W7JA 1SZKA 3HLMA 3DC1A 3NUBA 2D64A 3AEJA 1D7UA 2CB1A 3AOVA 3FZ6A 1ASNA 1AY4A 2HORA 2YRIA 2JJFA 4JEYA 2W7FA 4ZDPA 3PDBA 2X8UA 4WYFA 4OT8A 2ZJGA 1I48A 4WLJA 3MAUA 1AY8A 3AEJC 4XJPA 2JG2A 3FKDA 2VMOA 3NDNA 3I4JA 1Y4IA 1AMQA 5E4ZA 2D63A 1KKPA 3EI5A 1O62A 4Q6RA 5G0AA 2BHXA 2YKVA 2VIAA 1KKJA 3A9ZA 4UOYA 1XI9A 2Z1ZA 2D65A 1MDZA 1IAYA 4Y0HA 4IYOA 4F5MA 4MQQA 3CQ5A 2JJGA 5I92A 3M5UA 4DGTA 2Z9VA 1V2FA 5K8BA 1PMOA 4W1VA 3GZDA 1ASCA 3R9AA 4UQVA 3UE8A 4CVQA 2CANA 3RCHB 3AV7A 2AY9A 2OQXA 2YKXA 1FG3A 1O4SA 4EMYA 1V2DA 1J04A 4ZM4A 1W7NA 3GZDC 3VK2A 2Z1YA 4P7YA 2W7IA 1BQAA 1ZOBA 2YKUA 2ZC0A 2O1BA 1ASFA 2W7LA 5F8VA 5M46A 3LV2A 5G4JA 5TF5A 1AHGA 1YOOA 2FNIA 4XJOA 3DR7A 3GZCA 4ZASA 3USFA 2VGTA 1LKCA 1C7OA 1VEFA 3QGUA 4F5FA 1X29A 3RQ1A 2JGTA 4B9BA 4WB0A 1DGDA 4ITGA 5DJ1A 2QB3A 2BYJA 5G2QA 4JEXA 2O7CA 1AJSA 1OHYA 3WCNA 4OC9A 5JAYA 3NU7A 5EIGB 2QLRA 4RJ0A 1MDOA 4TV7A 5DB5A 3K28A 4PIWA 1JS6A 3DZZA 4ATQA 1H0CA 1C4KA 1OXOA 2EGYA 4XJMA 2W7HA 3L44A 2W8JA 3GJUA 1BJWA 1AMRA 1QJ5A 2VMUA 4F5LA 1W7MA 4LC3A 2VGZA 4LW4A 4RKCA 2AEVA 3IHJA 1QJ3A 1TARA 2VMTA 2FYFA 1GCKA 3N0LA 1TOIA 3MKJA 3I16A 2YOBA 1AKBA 1C7GA 1DTYA 1UU2A 2C0RA 2BI1A 4JF0A 4ADEA 3LG0A 3VK4A 3AATA 1J32A 1UU0A 1OHVA 1ECXA 1GC3A 3FRKA 3H14A 2ZYJA 4AZKA 2R5EA 2YHKA 1AIAA 1DFOA 3B1DA 1BT4A 2VMSA 4K2MA 4O6ZA 4BQ0A 3WCOA 5FT6A 1CJ0A 1B5PA 3JWBA 2GB3A 1CZEA 4Y0IA 3JW9A 4R5FA 3ATHA 4WXFA 1I43A 4GSAA 4M2JA 3II0A 2VIBA 5EAVA 2HP1A 3B1EA 3DU4A 2Z61A 3BCBA 1E5FA 3W1IA 4AOAA 1WKGA 3HDOA 3NRAA 1DGEA 2Q7WA 3FZ8A 1S07A 9AATA 3ZRRA 3FZ7A 4ADCA 2JISA 4Q75A 1ASGA 1RVYA 2AY1A 3ELPA 4Q76A 2NMPA 3FDBA 4E77A 4BHDA 1SPAA 3CBFA 3ISLA 4E1OA 1D2FA 3F6TA 2W7EA 3PGYA 2XH1A 1T3IA 3N75A 2VMRA 4JEVA 1GEYA 4JEZA 2W8WA 1YIYA 4ZAHA 5G09A 1C0NA 3F0HA 1C7NA 2WKAA 4HF8A 1LS3A 2AY4A 2VMZA 3FVUA 4ADDA 1YJZA 2D61A 2BI3A 3FTBA 1JF9A 3NTJA 3FVXA 4K2BA 1ASMA 2GMSA 3K7YA 4L0OA 3ACZA 4BA5A 4FFCA 4WXBA 3B46A 4UHOA 2EH6A 2JJHA 3JWAA 3T32A 4J8LA 1YIZA 3KKIA 3FQ8A 4W8IA 1M32A 5DX5A 1AHXA 1QGNA 5M4BA 4RIZA 3H7FA 2VMWA 2F8JA 1BKGA 2ZY2A 1GEXA 3AENA 3EZ1A 3TATA 4DQ6A 3A8UX 3EUCA 1SFFA 3TCMA 3LVJA 1M7YA 5J8QA 3CQ6A 5BJ4A 1DJ9A 1BJNA 1AY5A 4F5JA 1E5EA 4U1TA 2FM1A 3JU7A 4A6TA 3ASAA 7AATA 4LNJA 2C81A 1WYUA 2AY8A 2E7UA 3A9YA 2VI8A 5EUNA 1ASEA 2BWNA 3P6KA 3MADA 2R2NA 3FCRA 2D5YA 1CS1A 5D5SA 3HL2A 2VLFA 4ITXA 1KL2A 4A0FA 1AHFA 1ARSA 2VI9A 1TASA 3G0TA 3BCXA 4B98A 3PD6B 4GE9A 3DR4A 3AEPA 1IBJA 1AJRA 1CL2A 4OBUA 1WYTB 2VMXA 3PA9A 2DGLA 1ASAA 3ZRQA 4WYGA 3E2ZB 1RVUA 1MAQA 2EZ1A 3E2YA 1AX4A 3KE3A 4ISYA 2AY7A 2GQNA 1TATA 1AAMA 1G7XA 2Z9UA 4N0BA 1M6SA 1CL1A 1CQ7A 2DOUA 2HOYA 1TOKA 1B5OA 1SVVA 2X5FA 4A0RA 4BA4A 2BWPA 1O61A 3MAFB 2D66A 4FL0A 2CSTA 2JJEA 3HVYA 3UWCA 3TFUA 3ZZJA 1DJUA 4A0HA 1IX7A
chains in the Genus database with same CATH superfamily
1IAXA 1W7LA 3MEBA 4WLHA 4RITA 4OBVA 1UKJA 1EQBA 1O69A 5EQCA 5HXXA 1ASBA 4K2IA 4WD2A 2VMQA 4Y0DA 3FFHA 4OCAA 4E3QA 1JG8A 3BN1A 5E3KA 2E7IA 3VAXA 3N4SA 1TPLA 2E7JA 1BJ4A 2QMAA 3PPLA 2VMPA 3G7QA 1W23A 1GC2A 1WYVB 3EIAA 1Z3ZA 2BIGA 2YCNA 1M0PA 1TOGA 3EI6A 4MGRA 3MBBA 1ARHA 3QBOA 4PFFA 3WY7A 3IF2A 3BWOA 3AEMA 3KGXA 1X2AA 1I29A 4AO9A 1LK9A 1BJOB 2YCTA 1PFFA 2CJHA 4W1XA 3WX9A 3AEMC 3EI8A 4KAMA 2R5CB 5FT4A 3RI6A 4KXKA 1WSTA 2DKJA 3FD0A 2VMNA 4OMAA 3WZFA 1D7VA 2CJDA 2AY3A 1IJIA 4CBRA 4IXOA 1SZSA 3F9TA 3E77A 3WGBA 1OXPA 4ADBA 1AMSA 3RCHA 3NNKA 3QM2A 4RAEA 3D6KA 1QZ9A 5HDMA 3PDBB 1VJOA 3KGWA 3DRDA 1V72A 1OHWA 2VMYA 3LVMA 4DBCA 1ARGA 4F5GA 1OATA 3CAIA 3PAAA 3PIUA 4EB5A 3BC8A 3BCAA 2OKJA 2WK9A 5HHYA 1AKCA 2Z67A 1N8PA 1QITA 2V1PA 4MQPA 1TOEA 1YNUA 3GBXA 3LWSA 4ZDLA 2YCPA 4I8AA 1UU1A 1ZC9A 4IYOB 4F5IA 3FSLA 1MDXA 5IWQA 3EIBA 1S06A 4JE5D 4XAUA 1X28A 2W7KA 5LH9A 3WKSA 1AAWA 4AH3A 5BJ3A 2O0RA 3OKSA 4WYCA 5EIGA 2Z20A 2HZPA 5KTBA 5EUEA 5FT8A 5EFSA 2OGEA 5LHAA 3A9XA 2Z9WA 1B9IA 2BYLA 1S0AA 2EZ2A 4MKKA 2E54A 4ZWVA 2VMVA 4AO4A 3R4TA 3NX3A 1RV3A 1DKAA 4XK1A 4A0GA 3A2BA 1KL1A 4CBSA 4XJLA 2AATA 3RBLA 4A00A 3PJ0A 4WB0B 3BV0A 1MLZA 3MC6A 2EYQA 4IX8A 1YJYA 2BWOA 2D7YA 4UHNA 1AJSB 1FC4A 1JS3A 2CFBA 3ECDA 4ZSYA 3MC6C 2OKKA 4LNMA 1EJIA 3AELA 3VOMA 2BIEA 4GEBA 1AHEA 2Z9XA 2W8TA 3DODA 3RBFA 5G4IA 1GEWA 1IUGA 4WYDA 4WYAA 1D7RA 1SF2A 4ZLVA 1H1CA 1YAAA 3TQXA 2QBTA 3P1TA 2HUUA 3GWPA 3NU8A 1IVRA 1P3WA 4WBTA 3FQ7A 1LW5A 2CJGA 2VGUA 2ZSMA 3AEOA 3BB8A 3EI9A 3RUYA 4A6UA 2GMUA 3BWNA 4RKDA 3ZZKA 2QB2A 1EG5A 2ZY4A 3HMUA 3COGA 1M4NA 1AICA 2C44A 3N5MA 4WYEA 5M49A 1U08A 3NYUA 4ZDOA 3BWNC 4M2KA 1AKAA 1LW4A 2VYCA 3B1CA 2DGKA 2ORDA 4JE5A 3PDXA 2EPJA 3E2FA 1GC4A 4A6RA 2AY5A 2ZY3A 3L8AA 2EO5A 1D7SA 1DJEA 1MLYA 3LY1A 3WLXA 4P3MA 4EB7A 4RLGA 1X0MA 1G7WA 2R0TA 3Q8NA 4Q31A 4F4EA 1W3UA 2OATA 2VGVA 1AMAA 2FN6A 4HVKA 4F5KA 4N0WA 5E5IA 1KAFA 4H51A 4ZWMA 1GC0A 1GDEA 4TN4A 1RV4A 4IY7A 3QI6A 2W8VA 1B9HA 1LC8A 3DXWA 3EZSA 4MY5A 4E3RA 8AATA 4MSOA 2AY6A 2VGSA 2VGWA 1G4XA 2D7ZA 3ASBA 4UHMA 2CY8A 3WGCA 4LNLA 2GSAA 1MGVA 2AEUA 2OGAA 4KYOA 2HP2A 4OYTA 2BI9A 4GE4A 5EAAA 1ARTA 1PMMA 2YKYA 5EUDA 3CQ4A 3LVKA 3JZLA 1S08A 3EI7A 3GR9A 3NYSA 4IXSA 1N2TA 4M2MA 4TMRA 3OP7A 4W5KA 3FQAA 2X3LA 4PVFA 3FFRA 3I5TA 1M0OA 2TPLA 3W1HA 2W7MA 4R8DA 4PFNA 2PO3A 2X5DA 3LVLB 5M4DA 3ZRPA 2DGMA 1CZCA 4CXRA 4MQRA 1AIBA 1M0NA 3AOWA 1GD9A 4NOGA 4XEWA 3WKRA 3QN6A 1C9CA 4GDYA 1BS0A 2WK8A 1IX8A 1KMJA 2ZUKA 2W7GA 3VP6A 3B8XA 1MAPA 3PD6A 4ZM3A 1LC5A 3HBXA 4GRXA 4J5UA 1ELUA 2AY2A 3AENB 1LC7A 2W7DA 1WYTA 2V0YA 4OTLA 3DXVA 4CXQA 2G6WA 3NUIA 4A72A 4ZSWA 2HUIA 3E2ZA 2ZP7A 5F9SA 1IX6A 1I41A 4EFFA 2RFVA 3ELEA 3E6GA 2FNUA 1WYUB 1CQ6A 2BKWA 4JF1A 4RJYA 1GBNA 1ORDA 1SZUA 3E9KA 4F5HA 1M0QA 1QIRA 2BI2A 3MAFA 1ASDA 1S09A 2CTZA 3FVSA 3HQTA 1YJSA 3HT4A 4IW7A 4BMKA 2FQ6A 2CINA 5DJ9A 1XEYA 2PB2A 1WKHA 1N31A 4XQ2A 5D95A 1BQDA 4U2HA 1V2EA 4MKJA 1Z7DA 2QA3A 1TOJA 2XBNA 3BS8A 1G4VA 2DR1A 2ZSLA 4GE7A 2CH1A 3VK3A 1ELQA 4IXZA 2HUFA 4WP0A 4JEWA 3QPGA 3GSBA 1WYVA 1B8GA 4AZJA 3DYDA 4LW2A 3UAKA 4W1WA 4R5ZA 1BW0A 1PG8A 3GETA 2C7TA 1BJOA 1ASLA 1CQ8A 2BIAA 2HOXA 2YRRA 3JTXA 1B4XA 3QHXA 1VP4A 2W8UA 3NYTA 4RM1A 3G8MA 1QISA 3K40A 3FDDA 1ZODA 1FG7A 2R5CA 3W1JA 5FT5A 4ATPA 4QGRA 4R2NA 5C6UA 2CH2A 2PB0A 3TFTA 2WK7A 4WXGA 2VLHA 1KMKA 4W91A 2DKBA 2HOZA 5G2PA 2ZY5A 1AHYA 1ARIA 5AX8A 2BI5A 4EU1A 2W7JA 1SZKA 3HLMA 3DC1A 3NUBA 2D64A 3AEJA 1D7UA 2CB1A 3AOVA 3FZ6A 1ASNA 1AY4A 2HORA 2YRIA 2JJFA 4JEYA 2W7FA 4ZDPA 3PDBA 2X8UA 4WYFA 4OT8A 2ZJGA 1I48A 4WLJA 3MAUA 1AY8A 3AEJC 4XJPA 2JG2A 3FKDA 2VMOA 3NDNA 3I4JA 1Y4IA 1AMQA 5E4ZA 2D63A 1KKPA 3EI5A 1O62A 4Q6RA 5G0AA 2BHXA 2YKVA 2VIAA 1KKJA 3A9ZA 4UOYA 1XI9A 2Z1ZA 2D65A 1MDZA 1IAYA 4Y0HA 4IYOA 4F5MA 4MQQA 3CQ5A 2JJGA 5I92A 3M5UA 4DGTA 2Z9VA 1V2FA 5K8BA 1PMOA 4W1VA 3GZDA 1ASCA 3R9AA 4UQVA 3UE8A 4CVQA 2CANA 3RCHB 3AV7A 2AY9A 2OQXA 2YKXA 1FG3A 1O4SA 4EMYA 1V2DA 1J04A 2A1VA 4ZM4A 1W7NA 3GZDC 3VK2A 2Z1YA 4P7YA 2W7IA 1BQAA 1ZOBA 2YKUA 2ZC0A 2O1BA 1ASFA 2W7LA 5F8VA 5M46A 3LV2A 5G4JA 5TF5A 1AHGA 1YOOA 2FNIA 4XJOA 3DR7A 3GZCA 4ZASA 3USFA 2VGTA 1LKCA 1C7OA 1VEFA 3QGUA 4F5FA 1X29A 3RQ1A 2JGTA 4B9BA 4WB0A 1DGDA 4ITGA 5DJ1A 2QB3A 2BYJA 5G2QA 4JEXA 2O7CA 1AJSA 1OHYA 3WCNA 4OC9A 5JAYA 3NU7A 5EIGB 2QLRA 4RJ0A 1MDOA 4TV7A 5DB5A 3K28A 4PIWA 1JS6A 3DZZA 4ATQA 1H0CA 1C4KA 1OXOA 2EGYA 4XJMA 2W7HA 3N4XA 3L44A 2W8JA 3GJUA 1BJWA 1AMRA 1QJ5A 2VMUA 4F5LA 1W7MA 4LC3A 2VGZA 4LW4A 4RKCA 2AEVA 3IHJA 1QJ3A 1TARA 2VMTA 2FYFA 1GCKA 3N0LA 1TOIA 3MKJA 3I16A 2YOBA 1AKBA 1C7GA 1DTYA 1UU2A 2C0RA 2BI1A 4JF0A 4ADEA 3LG0A 3VK4A 3AATA 1J32A 1UU0A 1OHVA 1ECXA 1GC3A 3FRKA 3H14A 2ZYJA 4AZKA 2R5EA 2YHKA 1AIAA 1DFOA 3B1DA 1BT4A 2VMSA 4K2MA 4O6ZA 4BQ0A 3WCOA 5FT6A 1CJ0A 1B5PA 3JWBA 2GB3A 1CZEA 4Y0IA 3JW9A 4R5FA 3ATHA 4WXFA 1I43A 4GSAA 3N7NA 4M2JA 3II0A 2VIBA 5EAVA 2HP1A 3B1EA 3DU4A 2Z61A 3N4RA 3BCBA 1E5FA 3W1IA 4AOAA 1WKGA 3HDOA 3NRAA 1DGEA 2Q7WA 3FZ8A 1S07A 9AATA 3ZRRA 3FZ7A 4ADCA 2JISA 2KFPA 4Q75A 2WB6A 1ASGA 1RVYA 2AY1A 4K05A 3ELPA 4Q76A 2NMPA 2QSRA 3FDBA 4E77A 4BHDA 1SPAA 3CBFA 3ISLA 4E1OA 1D2FA 2FKIA 3F6TA 2W7EA 3PGYA 2XH1A 1T3IA 3N75A 2VMRA 4JEVA 1GEYA 4JEZA 2W8WA 1YIYA 4ZAHA 5G09A 1C0NA 3F0HA 1C7NA 2WKAA 4HF8A 1LS3A 2AY4A 2VMZA 3FVUA 4ADDA 1YJZA 2D61A 4H63Q 2BI3A 3FTBA 1JF9A 3NTJA 3FVXA 4K2BA 1ASMA 2GMSA 3K7YA 4L0OA 3ACZA 4BA5A 4FFCA 4WXBA 3B46A 4UHOA 2EH6A 2JJHA 3JWAA 3T32A 4J8LA 1YIZA 3KKIA 3FQ8A 4W8IA 1M32A 5DX5A 1AHXA 1QGNA 5M4BA 4RIZA 3H7FA 2VMWA 2F8JA 1BKGA 2ZY2A 1GEXA 3AENA 3EZ1A 3TATA 4DQ6A 3A8UX 3EUCA 1SFFA 3TCMA 3LVJA 1M7YA 5J8QA 3CQ6A 5BJ4A 1DJ9A 1BJNA 1AY5A 4F5JA 1E5EA 4U1TA 2FM1A 3JU7A 4A6TA 3ASAA 7AATA 4LNJA 2C81A 1WYUA 2AY8A 2E7UA 3A9YA 2VI8A 5EUNA 1ASEA 2BWNA 3P6KA 3MADA 2R2NA 3FCRA 2D5YA 1CS1A 5D5SA 3HL2A 2VLFA 4ITXA 1KL2A 4A0FA 1AHFA 1ARSA 2VI9A 1TASA 3G0TA 3BCXA 4B98A 3PD6B 4GE9A 3DR4A 3AEPA 1IBJA 1AJRA 1CL2A 4OBUA 1WYTB 2VMXA 3PA9A 3H9XA 2DGLA 1ASAA 3ZRQA 4WYGA 3E2ZB 1RVUA 1MAQA 2EZ1A 3E2YA 1AX4A 3KE3A 4ISYA 2AY7A 2GQNA 1TATA 1AAMA 1G7XA 2G7JA 2Z9UA 4N0BA 1M6SA 1CL1A 1CQ7A 2DOUA 2HOYA 1TOKA 1B5OA 1SVVA 2X5FA 4A0RA 4BA4A 2BWPA 1O61A 3MAFB 2D66A 4FL0A 2CSTA 2JJEA 3HVYA 3UWCA 3TFUA 3ZZJA 1DJUA 4A0HA 1IX7A
chains in the Genus database with same CATH topology
1IAXA 1W7LA 3MEBA 4WLHA 4RITA 4OBVA 1UKJA 1EQBA 1O69A 5EQCA 5HXXA 1ASBA 4K2IA 4WD2A 2VMQA 4Y0DA 3FFHA 4OCAA 4E3QA 1JG8A 3BN1A 5E3KA 2E7IA 3VAXA 3N4SA 1TPLA 2E7JA 1BJ4A 2QMAA 3PPLA 2VMPA 3G7QA 1W23A 1GC2A 1WYVB 3EIAA 1Z3ZA 2BIGA 2YCNA 1M0PA 1TOGA 3EI6A 4MGRA 3MBBA 1ARHA 3QBOA 4PFFA 3WY7A 3IF2A 3BWOA 3AEMA 3KGXA 1X2AA 1I29A 4AO9A 1LK9A 1BJOB 2YCTA 1PFFA 2CJHA 4W1XA 3WX9A 3AEMC 3EI8A 4KAMA 2R5CB 5FT4A 3RI6A 4KXKA 1WSTA 2DKJA 3FD0A 2VMNA 4OMAA 3WZFA 1D7VA 2CJDA 2AY3A 1IJIA 4CBRA 4IXOA 1SZSA 3F9TA 3E77A 3WGBA 1OXPA 4ADBA 1AMSA 3RCHA 3NNKA 3QM2A 4RAEA 3D6KA 1QZ9A 5HDMA 3PDBB 1VJOA 3KGWA 3DRDA 1V72A 1OHWA 2VMYA 3LVMA 4DBCA 1ARGA 4F5GA 1OATA 3CAIA 3PAAA 3PIUA 4EB5A 3BC8A 3BCAA 2OKJA 2WK9A 5HHYA 1AKCA 2Z67A 1N8PA 1QITA 2V1PA 4MQPA 1TOEA 1YNUA 3GBXA 3LWSA 4ZDLA 2YCPA 4I8AA 1UU1A 1ZC9A 4IYOB 4F5IA 3FSLA 1MDXA 5IWQA 3EIBA 1S06A 4JE5D 4XAUA 1X28A 2W7KA 5LH9A 3WKSA 1AAWA 4AH3A 5BJ3A 2O0RA 3OKSA 4WYCA 5EIGA 2Z20A 2HZPA 5KTBA 5EUEA 5FT8A 5EFSA 2OGEA 5LHAA 3A9XA 2Z9WA 1B9IA 2BYLA 1S0AA 2EZ2A 4MKKA 2E54A 4ZWVA 2VMVA 4AO4A 3R4TA 3NX3A 1RV3A 1DKAA 4XK1A 4A0GA 3A2BA 1KL1A 4CBSA 4XJLA 2AATA 3RBLA 4A00A 3PJ0A 4WB0B 3BV0A 1MLZA 3MC6A 2EYQA 4IX8A 1YJYA 2BWOA 2D7YA 4UHNA 1AJSB 1FC4A 1JS3A 2CFBA 3ECDA 4ZSYA 3MC6C 2OKKA 4LNMA 1EJIA 3AELA 3VOMA 2BIEA 4GEBA 1AHEA 2Z9XA 2W8TA 3DODA 3RBFA 5G4IA 1GEWA 1IUGA 4WYDA 4WYAA 1D7RA 1SF2A 4ZLVA 1H1CA 1YAAA 3TQXA 2QBTA 3P1TA 2HUUA 3GWPA 3NU8A 1IVRA 1P3WA 4WBTA 3FQ7A 1LW5A 2CJGA 2VGUA 2ZSMA 3AEOA 3BB8A 3EI9A 3RUYA 4A6UA 2GMUA 3BWNA 4RKDA 3ZZKA 2QB2A 1EG5A 2ZY4A 3HMUA 3COGA 1M4NA 1AICA 2C44A 3N5MA 4WYEA 5M49A 1U08A 3NYUA 4ZDOA 3BWNC 4M2KA 1AKAA 1LW4A 2VYCA 3B1CA 2DGKA 2ORDA 4JE5A 3PDXA 2EPJA 3E2FA 1GC4A 4A6RA 2AY5A 2ZY3A 3L8AA 2EO5A 1D7SA 1DJEA 1MLYA 3LY1A 3WLXA 4P3MA 4EB7A 4RLGA 1X0MA 1G7WA 2R0TA 3Q8NA 4Q31A 4F4EA 1W3UA 2OATA 2VGVA 1AMAA 2FN6A 4HVKA 4F5KA 4N0WA 5E5IA 4H51A 4ZWMA 1GC0A 1GDEA 4TN4A 1RV4A 4IY7A 3QI6A 2W8VA 1B9HA 1LC8A 3DXWA 3EZSA 4MY5A 4E3RA 8AATA 4MSOA 2AY6A 2VGSA 2VGWA 1G4XA 2D7ZA 3ASBA 4UHMA 2CY8A 3WGCA 4LNLA 2GSAA 1MGVA 2AEUA 2OGAA 4KYOA 2HP2A 4OYTA 2BI9A 4GE4A 5EAAA 1ARTA 1PMMA 2YKYA 5EUDA 3CQ4A 3LVKA 3JZLA 1S08A 3EI7A 3GR9A 3NYSA 4IXSA 1N2TA 4M2MA 4TMRA 3OP7A 4W5KA 3FQAA 2X3LA 4PVFA 3FFRA 3I5TA 1M0OA 2TPLA 3W1HA 2W7MA 4R8DA 4PFNA 2PO3A 2X5DA 3LVLB 5M4DA 3ZRPA 2DGMA 1CZCA 4CXRA 4MQRA 1AIBA 1M0NA 3AOWA 1GD9A 4NOGA 4XEWA 3WKRA 3QN6A 1C9CA 4GDYA 1BS0A 2WK8A 1IX8A 1KMJA 2ZUKA 2W7GA 3VP6A 3B8XA 1MAPA 3PD6A 4ZM3A 1LC5A 3HBXA 4GRXA 4J5UA 1ELUA 2AY2A 3AENB 1LC7A 2W7DA 1WYTA 2V0YA 4OTLA 3DXVA 4CXQA 2G6WA 3NUIA 4A72A 4ZSWA 2HUIA 3E2ZA 2ZP7A 5F9SA 1IX6A 1I41A 4EFFA 2RFVA 3ELEA 3E6GA 2FNUA 1WYUB 1CQ6A 2BKWA 4JF1A 4RJYA 1GBNA 1ORDA 1SZUA 3E9KA 4F5HA 1M0QA 1QIRA 2BI2A 3MAFA 1ASDA 1S09A 2CTZA 3FVSA 3HQTA 1YJSA 3HT4A 4IW7A 4BMKA 2FQ6A 2CINA 5DJ9A 1XEYA 2PB2A 1WKHA 1N31A 4XQ2A 5D95A 1BQDA 4U2HA 1V2EA 4MKJA 1Z7DA 2QA3A 1TOJA 2XBNA 3BS8A 1G4VA 2DR1A 2ZSLA 4GE7A 2CH1A 3VK3A 1ELQA 4IXZA 2HUFA 4WP0A 4JEWA 3QPGA 3GSBA 1WYVA 1B8GA 4AZJA 3DYDA 4LW2A 3UAKA 4W1WA 4R5ZA 1BW0A 1PG8A 3GETA 2C7TA 1BJOA 1ASLA 1CQ8A 2BIAA 2HOXA 2YRRA 3JTXA 1B4XA 3QHXA 1VP4A 2W8UA 3NYTA 4RM1A 3G8MA 1QISA 3K40A 3FDDA 1ZODA 1FG7A 2R5CA 3W1JA 5FT5A 4ATPA 4QGRA 4R2NA 5C6UA 2CH2A 2PB0A 3TFTA 2WK7A 4WXGA 2VLHA 1KMKA 4W91A 2DKBA 2HOZA 5G2PA 2ZY5A 1AHYA 1ARIA 5AX8A 2BI5A 4EU1A 2W7JA 1SZKA 3HLMA 3DC1A 3NUBA 2D64A 3AEJA 1D7UA 2CB1A 3AOVA 3FZ6A 1ASNA 1AY4A 2HORA 2YRIA 2JJFA 4JEYA 2W7FA 4ZDPA 3PDBA 2X8UA 4WYFA 4OT8A 2ZJGA 1I48A 4WLJA 3MAUA 1AY8A 3AEJC 4XJPA 2JG2A 3FKDA 2VMOA 3NDNA 3I4JA 1Y4IA 1AMQA 5E4ZA 2D63A 1KKPA 3EI5A 1O62A 4Q6RA 5G0AA 2BHXA 2YKVA 2VIAA 1KKJA 3A9ZA 4UOYA 1XI9A 2Z1ZA 2D65A 1MDZA 1IAYA 4Y0HA 4IYOA 4F5MA 4MQQA 3CQ5A 2JJGA 5I92A 3M5UA 4DGTA 2Z9VA 1V2FA 5K8BA 1PMOA 4W1VA 3GZDA 1ASCA 3R9AA 4UQVA 3UE8A 4CVQA 2CANA 3RCHB 3AV7A 2AY9A 2OQXA 2YKXA 1FG3A 1O4SA 4EMYA 1V2DA 1J04A 2A1VA 4ZM4A 1W7NA 3GZDC 3VK2A 2Z1YA 4P7YA 2W7IA 1BQAA 1ZOBA 2YKUA 2ZC0A 2O1BA 1ASFA 2W7LA 5F8VA 5M46A 3LV2A 5G4JA 5TF5A 1AHGA 1YOOA 2FNIA 4XJOA 3DR7A 3GZCA 4ZASA 3USFA 2VGTA 1LKCA 1C7OA 1VEFA 3QGUA 4F5FA 1X29A 3RQ1A 2JGTA 4B9BA 4WB0A 1DGDA 4ITGA 5DJ1A 2QB3A 2BYJA 5G2QA 4JEXA 2O7CA 1AJSA 1OHYA 3WCNA 4OC9A 5JAYA 3NU7A 5EIGB 2QLRA 4RJ0A 1MDOA 4TV7A 5DB5A 3K28A 4PIWA 1JS6A 3DZZA 4ATQA 1H0CA 1C4KA 1OXOA 2EGYA 4XJMA 2W7HA 3N4XA 3L44A 2W8JA 3GJUA 1BJWA 1AMRA 1QJ5A 2VMUA 4F5LA 1W7MA 4LC3A 2VGZA 4LW4A 4RKCA 2AEVA 3IHJA 1QJ3A 1TARA 2VMTA 2FYFA 1GCKA 3N0LA 1TOIA 3MKJA 3I16A 2YOBA 1AKBA 1C7GA 1DTYA 1UU2A 2C0RA 2BI1A 4JF0A 4ADEA 3LG0A 3VK4A 3AATA 1J32A 1UU0A 1OHVA 1ECXA 1GC3A 3FRKA 3H14A 2ZYJA 4AZKA 2R5EA 2YHKA 1AIAA 1DFOA 3B1DA 1BT4A 2VMSA 4K2MA 4O6ZA 4BQ0A 3WCOA 5FT6A 1CJ0A 1B5PA 3JWBA 2GB3A 1CZEA 4Y0IA 3JW9A 4R5FA 3ATHA 4WXFA 1I43A 4GSAA 3N7NA 4M2JA 3II0A 2VIBA 5EAVA 2HP1A 3B1EA 3DU4A 2Z61A 3N4RA 3BCBA 1E5FA 3W1IA 4AOAA 1WKGA 3HDOA 3NRAA 1DGEA 2Q7WA 3FZ8A 1S07A 9AATA 3ZRRA 3FZ7A 4ADCA 2JISA 2KFPA 4Q75A 2WB6A 1ASGA 1RVYA 2AY1A 4K05A 3ELPA 4Q76A 2NMPA 2QSRA 3FDBA 4E77A 4BHDA 1SPAA 3CBFA 3ISLA 4E1OA 1D2FA 2FKIA 3F6TA 2W7EA 3PGYA 2XH1A 1T3IA 3N75A 2VMRA 4JEVA 1GEYA 4JEZA 2W8WA 1YIYA 4ZAHA 5G09A 1C0NA 3F0HA 1C7NA 2WKAA 4HF8A 1LS3A 2AY4A 2VMZA 3FVUA 4ADDA 1YJZA 2D61A 4H63Q 2BI3A 3FTBA 1JF9A 3NTJA 3FVXA 4K2BA 1ASMA 2GMSA 3K7YA 4L0OA 3ACZA 4BA5A 4FFCA 4WXBA 3B46A 4UHOA 2EH6A 2JJHA 3JWAA 3T32A 4J8LA 1YIZA 3KKIA 3FQ8A 4W8IA 1M32A 5DX5A 1AHXA 1QGNA 5M4BA 4RIZA 3H7FA 2VMWA 2F8JA 1BKGA 2ZY2A 1GEXA 3AENA 3EZ1A 3TATA 4DQ6A 3A8UX 3EUCA 1SFFA 3TCMA 3LVJA 1M7YA 5J8QA 3CQ6A 5BJ4A 1DJ9A 1BJNA 1AY5A 4F5JA 1E5EA 4U1TA 2FM1A 3JU7A 4A6TA 3ASAA 7AATA 4LNJA 2C81A 1WYUA 2AY8A 2E7UA 3A9YA 2VI8A 5EUNA 1ASEA 2BWNA 3P6KA 3MADA 2R2NA 3FCRA 2D5YA 1CS1A 5D5SA 3HL2A 2VLFA 4ITXA 1KL2A 4A0FA 1AHFA 1ARSA 2VI9A 1TASA 3G0TA 3BCXA 4B98A 3PD6B 4GE9A 3DR4A 3AEPA 1IBJA 1AJRA 1CL2A 4OBUA 1WYTB 2VMXA 3PA9A 3H9XA 2DGLA 1ASAA 3ZRQA 4WYGA 3E2ZB 1RVUA 1MAQA 2EZ1A 3E2YA 1AX4A 3KE3A 4ISYA 2AY7A 2GQNA 1TATA 1AAMA 1G7XA 2G7JA 2Z9UA 4N0BA 1M6SA 1CL1A 1CQ7A 2DOUA 2HOYA 1TOKA 1B5OA 1SVVA 2X5FA 4A0RA 4BA4A 2BWPA 1O61A 3MAFB 2D66A 4FL0A 2CSTA 2JJEA 3HVYA 3UWCA 3TFUA 3ZZJA 1DJUA 4A0HA 1IX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IAX A;  1W7L A;  3MEB A;  4WLH A;  4RIT A;  4OBV A;  1UKJ A;  1EQB A;  1O69 A;  5EQC A;  5HXX A;  1ASB A;  4K2I A;  4WD2 A;  2VMQ A;  4Y0D A;  3FFH A;  4OCA A;  4E3Q A;  1JG8 A;  3BN1 A;  5E3K A;  2E7I A;  3VAX A;  1TPL A;  2E7J A;  1BJ4 A;  2QMA A;  3PPL A;  2VMP A;  3G7Q A;  1W23 A;  1GC2 A;  1WYV B;  3EIA A;  1Z3Z A;  2BIG A;  2YCN A;  1M0P A;  1TOG A;  3EI6 A;  4MGR A;  3MBB A;  1ARH A;  3QBO A;  4PFF A;  3WY7 A;  3IF2 A;  3BWO A;  3AEM A;  3KGX A;  1X2A A;  1I29 A;  4AO9 A;  1LK9 A;  1BJO B;  2YCT A;  1PFF A;  2CJH A;  4W1X A;  3WX9 A;  3AEM C;  3EI8 A;  4KAM A;  2R5C B;  5FT4 A;  3RI6 A;  4KXK A;  1WST A;  2DKJ A;  3FD0 A;  2VMN A;  4OMA A;  3WZF A;  1D7V A;  2CJD A;  2AY3 A;  1IJI A;  4CBR A;  4IXO A;  1SZS A;  3F9T A;  3E77 A;  3WGB A;  1OXP A;  4ADB A;  1AMS A;  3RCH A;  3NNK A;  3QM2 A;  4RAE A;  3D6K A;  1QZ9 A;  5HDM A;  3PDB B;  1VJO A;  3KGW A;  3DRD A;  1V72 A;  1OHW A;  2VMY A;  3LVM A;  4DBC A;  1ARG A;  4F5G A;  1OAT A;  3CAI A;  3PAA A;  3PIU A;  4EB5 A;  3BC8 A;  3BCA A;  2OKJ A;  2WK9 A;  5HHY A;  1AKC A;  2Z67 A;  1N8P A;  1QIT A;  2V1P A;  4MQP A;  1TOE A;  1YNU A;  3GBX A;  3LWS A;  4ZDL A;  2YCP A;  4I8A A;  1UU1 A;  1ZC9 A;  4IYO B;  4F5I A;  3FSL A;  1MDX A;  5IWQ A;  3EIB A;  1S06 A;  4JE5 D;  4XAU A;  1X28 A;  2W7K A;  5LH9 A;  3WKS A;  1AAW A;  4AH3 A;  5BJ3 A;  2O0R A;  3OKS A;  4WYC A;  5EIG A;  2Z20 A;  2HZP A;  5EUE A;  5FT8 A;  5EFS A;  2OGE A;  5LHA A;  3A9X A;  2Z9W A;  1B9I A;  2BYL A;  1S0A A;  2EZ2 A;  4MKK A;  2E54 A;  4ZWV A;  2VMV A;  4AO4 A;  3R4T A;  3NX3 A;  1RV3 A;  1DKA A;  4XK1 A;  4A0G A;  3A2B A;  1KL1 A;  4CBS A;  4XJL A;  2AAT A;  3RBL A;  4A00 A;  3PJ0 A;  4WB0 B;  3BV0 A;  1MLZ A;  3MC6 A;  4IX8 A;  1YJY A;  2BWO A;  2D7Y A;  4UHN A;  1AJS B;  1FC4 A;  1JS3 A;  2CFB A;  3ECD A;  4ZSY A;  3MC6 C;  2OKK A;  4LNM A;  1EJI A;  3AEL A;  3VOM A;  2BIE A;  4GEB A;  1AHE A;  2Z9X A;  2W8T A;  3DOD A;  3RBF A;  5G4I A;  1GEW A;  1IUG A;  4WYD A;  4WYA A;  1D7R A;  1SF2 A;  4ZLV A;  1H1C A;  1YAA A;  3TQX A;  2QBT A;  3P1T A;  2HUU A;  3GWP A;  3NU8 A;  1IVR A;  1P3W A;  4WBT A;  3FQ7 A;  1LW5 A;  2CJG A;  2VGU A;  2ZSM A;  3AEO A;  3BB8 A;  3EI9 A;  3RUY A;  4A6U A;  2GMU A;  3BWN A;  4RKD A;  3ZZK A;  2QB2 A;  1EG5 A;  2ZY4 A;  3HMU A;  3COG A;  1M4N A;  1AIC A;  2C44 A;  3N5M A;  4WYE A;  5M49 A;  1U08 A;  3NYU A;  4ZDO A;  3BWN C;  4M2K A;  1AKA A;  1LW4 A;  2VYC A;  3B1C A;  2DGK A;  2ORD A;  4JE5 A;  3PDX A;  2EPJ A;  3E2F A;  1GC4 A;  4A6R A;  2AY5 A;  2ZY3 A;  3L8A A;  2EO5 A;  1D7S A;  1DJE A;  1MLY A;  3LY1 A;  3WLX A;  4P3M A;  4EB7 A;  4RLG A;  1X0M A;  1G7W A;  2R0T A;  3Q8N A;  4Q31 A;  4F4E A;  1W3U A;  2OAT A;  2VGV A;  1AMA A;  2FN6 A;  4HVK A;  4F5K A;  4N0W A;  5E5I A;  4H51 A;  4ZWM A;  1GC0 A;  1GDE A;  4TN4 A;  1RV4 A;  4IY7 A;  3QI6 A;  2W8V A;  1B9H A;  1LC8 A;  3DXW A;  3EZS A;  4MY5 A;  4E3R A;  8AAT A;  4MSO A;  2AY6 A;  2VGS A;  2VGW A;  1G4X A;  2D7Z A;  3ASB A;  4UHM A;  2CY8 A;  3WGC A;  4LNL A;  2GSA A;  1MGV A;  2AEU A;  2OGA A;  4KYO A;  2HP2 A;  4OYT A;  2BI9 A;  4GE4 A;  5EAA A;  1ART A;  1PMM A;  2YKY A;  5EUD A;  3CQ4 A;  3LVK A;  3JZL A;  1S08 A;  3EI7 A;  3GR9 A;  3NYS A;  4IXS A;  1N2T A;  4M2M A;  4TMR A;  3OP7 A;  4W5K A;  3FQA A;  2X3L A;  4PVF A;  3FFR A;  3I5T A;  1M0O A;  2TPL A;  3W1H A;  2W7M A;  4R8D A;  4PFN A;  2PO3 A;  2X5D A;  3LVL B;  5M4D A;  3ZRP A;  2DGM A;  1CZC A;  4CXR A;  4MQR A;  1AIB A;  1M0N A;  3AOW A;  1GD9 A;  4NOG A;  4XEW A;  3WKR A;  3QN6 A;  1C9C A;  4GDY A;  1BS0 A;  2WK8 A;  1IX8 A;  1KMJ A;  2ZUK A;  2W7G A;  3VP6 A;  3B8X A;  1MAP A;  3PD6 A;  4ZM3 A;  1LC5 A;  3HBX A;  4GRX A;  4J5U A;  1ELU A;  2AY2 A;  3AEN B;  1LC7 A;  2W7D A;  1WYT A;  2V0Y A;  4OTL A;  3DXV A;  4CXQ A;  2G6W A;  3NUI A;  4A72 A;  4ZSW A;  2HUI A;  3E2Z A;  2ZP7 A;  5F9S A;  1IX6 A;  1I41 A;  4EFF A;  2RFV A;  3ELE A;  3E6G A;  2FNU A;  1WYU B;  1CQ6 A;  2BKW A;  4JF1 A;  4RJY A;  1GBN A;  1ORD A;  1SZU A;  3E9K A;  4F5H A;  1M0Q A;  1QIR A;  2BI2 A;  3MAF A;  1ASD A;  1S09 A;  2CTZ A;  3FVS A;  3HQT A;  1YJS A;  3HT4 A;  4IW7 A;  4BMK A;  2FQ6 A;  2CIN A;  5DJ9 A;  1XEY A;  2PB2 A;  1WKH A;  1N31 A;  4XQ2 A;  5D95 A;  1BQD A;  4U2H A;  1V2E A;  4MKJ A;  1Z7D A;  2QA3 A;  1TOJ A;  2XBN A;  3BS8 A;  1G4V A;  2DR1 A;  2ZSL A;  4GE7 A;  2CH1 A;  3VK3 A;  1ELQ A;  4IXZ A;  2HUF A;  4WP0 A;  4JEW A;  3QPG A;  3GSB A;  1WYV A;  1B8G A;  4AZJ A;  3DYD A;  4LW2 A;  3UAK A;  4W1W A;  4R5Z A;  1BW0 A;  1PG8 A;  3GET A;  2C7T A;  1BJO A;  1ASL A;  1CQ8 A;  2BIA A;  2HOX A;  2YRR A;  3JTX A;  1B4X A;  3QHX A;  1VP4 A;  2W8U A;  3NYT A;  4RM1 A;  3G8M A;  1QIS A;  3K40 A;  3FDD A;  1ZOD A;  1FG7 A;  2R5C A;  3W1J A;  5FT5 A;  4ATP A;  4QGR A;  4R2N A;  5C6U A;  2CH2 A;  2PB0 A;  3TFT A;  2WK7 A;  4WXG A;  2VLH A;  1KMK A;  4W91 A;  2DKB A;  2HOZ A;  5G2P A;  2ZY5 A;  1AHY A;  1ARI A;  5AX8 A;  2BI5 A;  4EU1 A;  2W7J A;  1SZK A;  3HLM A;  3DC1 A;  3NUB A;  2D64 A;  3AEJ A;  1D7U A;  2CB1 A;  3AOV A;  3FZ6 A;  1ASN A;  1AY4 A;  2HOR A;  2YRI A;  2JJF A;  4JEY A;  2W7F A;  4ZDP A;  3PDB A;  2X8U A;  4WYF A;  4OT8 A;  2ZJG A;  1I48 A;  4WLJ A;  3MAU A;  1AY8 A;  3AEJ C;  4XJP A;  2JG2 A;  3FKD A;  2VMO A;  3NDN A;  3I4J A;  1Y4I A;  1AMQ A;  5E4Z A;  2D63 A;  1KKP A;  3EI5 A;  1O62 A;  4Q6R A;  5G0A A;  2BHX A;  2YKV A;  2VIA A;  1KKJ A;  3A9Z A;  4UOY A;  1XI9 A;  2Z1Z A;  2D65 A;  1MDZ A;  1IAY A;  4Y0H A;  4IYO A;  4F5M A;  4MQQ A;  3CQ5 A;  2JJG A;  5I92 A;  3M5U A;  4DGT A;  2Z9V A;  1V2F A;  5K8B A;  1PMO A;  4W1V A;  3GZD A;  1ASC A;  3R9A A;  4UQV A;  3UE8 A;  4CVQ A;  2CAN A;  3RCH B;  3AV7 A;  2AY9 A;  2OQX A;  2YKX A;  1FG3 A;  1O4S A;  4EMY A;  1V2D A;  1J04 A;  4ZM4 A;  1W7N A;  3GZD C;  3VK2 A;  2Z1Y A;  4P7Y A;  2W7I A;  1BQA A;  1ZOB A;  2YKU A;  2ZC0 A;  2O1B A;  1ASF A;  2W7L A;  5F8V A;  5M46 A;  3LV2 A;  5G4J A;  5TF5 A;  1AHG A;  1YOO A;  2FNI A;  4XJO A;  3DR7 A;  3GZC A;  4ZAS A;  3USF A;  2VGT A;  1LKC A;  1C7O A;  1VEF A;  3QGU A;  4F5F A;  1X29 A;  3RQ1 A;  2JGT A;  4B9B A;  4WB0 A;  1DGD A;  4ITG A;  5DJ1 A;  2QB3 A;  2BYJ A;  5G2Q A;  4JEX A;  2O7C A;  1AJS A;  1OHY A;  3WCN A;  4OC9 A;  5JAY A;  3NU7 A;  5EIG B;  2QLR A;  4RJ0 A;  1MDO A;  4TV7 A;  5DB5 A;  3K28 A;  4PIW A;  1JS6 A;  3DZZ A;  4ATQ A;  1H0C A;  1C4K A;  1OXO A;  2EGY A;  4XJM A;  2W7H A;  3L44 A;  2W8J A;  3GJU A;  1BJW A;  1AMR A;  1QJ5 A;  2VMU A;  4F5L A;  1W7M A;  4LC3 A;  2VGZ A;  4LW4 A;  4RKC A;  2AEV A;  3IHJ A;  1QJ3 A;  1TAR A;  2VMT A;  2FYF A;  1GCK A;  3N0L A;  1TOI A;  3MKJ A;  3I16 A;  2YOB A;  1AKB A;  1C7G A;  1DTY A;  1UU2 A;  2C0R A;  2BI1 A;  4JF0 A;  4ADE A;  3LG0 A;  3VK4 A;  3AAT A;  1J32 A;  1UU0 A;  1OHV A;  1ECX A;  1GC3 A;  3FRK A;  3H14 A;  2ZYJ A;  4AZK A;  2R5E A;  2YHK A;  1AIA A;  1DFO A;  3B1D A;  1BT4 A;  2VMS A;  4K2M A;  4O6Z A;  4BQ0 A;  3WCO A;  5FT6 A;  1CJ0 A;  1B5P A;  3JWB A;  2GB3 A;  1CZE A;  4Y0I A;  3JW9 A;  4R5F A;  3ATH A;  4WXF A;  1I43 A;  4GSA A;  4M2J A;  3II0 A;  2VIB A;  5EAV A;  2HP1 A;  3B1E A;  3DU4 A;  2Z61 A;  3BCB A;  1E5F A;  3W1I A;  4AOA A;  1WKG A;  3HDO A;  3NRA A;  1DGE A;  2Q7W A;  3FZ8 A;  1S07 A;  9AAT A;  3ZRR A;  3FZ7 A;  4ADC A;  2JIS A;  4Q75 A;  1ASG A;  1RVY A;  2AY1 A;  3ELP A;  4Q76 A;  2NMP A;  3FDB A;  4E77 A;  4BHD A;  1SPA A;  3CBF A;  3ISL A;  4E1O A;  1D2F A;  3F6T A;  2W7E A;  3PGY A;  2XH1 A;  1T3I A;  3N75 A;  2VMR A;  4JEV A;  1GEY A;  4JEZ A;  2W8W A;  1YIY A;  4ZAH A;  5G09 A;  1C0N A;  3F0H A;  1C7N A;  2WKA A;  4HF8 A;  1LS3 A;  2AY4 A;  2VMZ A;  3FVU A;  4ADD A;  1YJZ A;  2D61 A;  2BI3 A;  3FTB A;  1JF9 A;  3NTJ A;  3FVX A;  4K2B A;  1ASM A;  2GMS A;  3K7Y A;  4L0O A;  3ACZ A;  4BA5 A;  4FFC A;  4WXB A;  3B46 A;  4UHO A;  2EH6 A;  2JJH A;  3JWA A;  3T32 A;  4J8L A;  1YIZ A;  3KKI A;  3FQ8 A;  4W8I A;  1M32 A;  5DX5 A;  1AHX A;  1QGN A;  5M4B A;  4RIZ A;  3H7F A;  2VMW A;  2F8J A;  1BKG A;  2ZY2 A;  1GEX A;  3AEN A;  3EZ1 A;  3TAT A;  4DQ6 A;  3A8U X;  3EUC A;  1SFF A;  3TCM A;  3LVJ A;  1M7Y A;  5J8Q A;  3CQ6 A;  5BJ4 A;  1DJ9 A;  1BJN A;  1AY5 A;  4F5J A;  1E5E A;  4U1T A;  2FM1 A;  3JU7 A;  4A6T A;  3ASA A;  7AAT A;  4LNJ A;  2C81 A;  1WYU A;  2AY8 A;  2E7U A;  3A9Y A;  2VI8 A;  5EUN A;  1ASE A;  2BWN A;  3P6K A;  3MAD A;  2R2N A;  3FCR A;  2D5Y A;  1CS1 A;  5D5S A;  3HL2 A;  2VLF A;  4ITX A;  1KL2 A;  4A0F A;  1AHF A;  1ARS A;  2VI9 A;  1TAS A;  3G0T A;  3BCX A;  4B98 A;  3PD6 B;  4GE9 A;  3DR4 A;  3AEP A;  1IBJ A;  1AJR A;  1CL2 A;  4OBU A;  1WYT B;  2VMX A;  3PA9 A;  2DGL A;  1ASA A;  3ZRQ A;  4WYG A;  3E2Z B;  1RVU A;  1MAQ A;  2EZ1 A;  3E2Y A;  1AX4 A;  3KE3 A;  4ISY A;  2AY7 A;  2GQN A;  1TAT A;  1AAM A;  1G7X A;  2Z9U A;  4N0B A;  1M6S A;  1CL1 A;  1CQ7 A;  2DOU A;  2HOY A;  1TOK A;  1B5O A;  1SVV A;  2X5F A;  4A0R A;  4BA4 A;  2BWP A;  1O61 A;  3MAF B;  2D66 A;  4FL0 A;  2CST A;  2JJE A;  3HVY A;  3UWC A;  3TFU A;  3ZZJ A;  1DJU A;  4A0H A;  1IX7 A; 
#chains in the Genus database with same CATH topology
 1IAX A;  1W7L A;  3MEB A;  4WLH A;  4RIT A;  4OBV A;  1UKJ A;  1EQB A;  1O69 A;  5EQC A;  5HXX A;  1ASB A;  4K2I A;  4WD2 A;  2VMQ A;  4Y0D A;  3FFH A;  4OCA A;  4E3Q A;  1JG8 A;  3BN1 A;  5E3K A;  2E7I A;  3VAX A;  3N4S A;  1TPL A;  2E7J A;  1BJ4 A;  2QMA A;  3PPL A;  2VMP A;  3G7Q A;  1W23 A;  1GC2 A;  1WYV B;  3EIA A;  1Z3Z A;  2BIG A;  2YCN A;  1M0P A;  1TOG A;  3EI6 A;  4MGR A;  3MBB A;  1ARH A;  3QBO A;  4PFF A;  3WY7 A;  3IF2 A;  3BWO A;  3AEM A;  3KGX A;  1X2A A;  1I29 A;  4AO9 A;  1LK9 A;  1BJO B;  2YCT A;  1PFF A;  2CJH A;  4W1X A;  3WX9 A;  3AEM C;  3EI8 A;  4KAM A;  2R5C B;  5FT4 A;  3RI6 A;  4KXK A;  1WST A;  2DKJ A;  3FD0 A;  2VMN A;  4OMA A;  3WZF A;  1D7V A;  2CJD A;  2AY3 A;  1IJI A;  4CBR A;  4IXO A;  1SZS A;  3F9T A;  3E77 A;  3WGB A;  1OXP A;  4ADB A;  1AMS A;  3RCH A;  3NNK A;  3QM2 A;  4RAE A;  3D6K A;  1QZ9 A;  5HDM A;  3PDB B;  1VJO A;  3KGW A;  3DRD A;  1V72 A;  1OHW A;  2VMY A;  3LVM A;  4DBC A;  1ARG A;  4F5G A;  1OAT A;  3CAI A;  3PAA A;  3PIU A;  4EB5 A;  3BC8 A;  3BCA A;  2OKJ A;  2WK9 A;  5HHY A;  1AKC A;  2Z67 A;  1N8P A;  1QIT A;  2V1P A;  4MQP A;  1TOE A;  1YNU A;  3GBX A;  3LWS A;  4ZDL A;  2YCP A;  4I8A A;  1UU1 A;  1ZC9 A;  4IYO B;  4F5I A;  3FSL A;  1MDX A;  5IWQ A;  3EIB A;  1S06 A;  4JE5 D;  4XAU A;  1X28 A;  2W7K A;  5LH9 A;  3WKS A;  1AAW A;  4AH3 A;  5BJ3 A;  2O0R A;  3OKS A;  4WYC A;  5EIG A;  2Z20 A;  2HZP A;  5KTB A;  5EUE A;  5FT8 A;  5EFS A;  2OGE A;  5LHA A;  3A9X A;  2Z9W A;  1B9I A;  2BYL A;  1S0A A;  2EZ2 A;  4MKK A;  2E54 A;  4ZWV A;  2VMV A;  4AO4 A;  3R4T A;  3NX3 A;  1RV3 A;  1DKA A;  4XK1 A;  4A0G A;  3A2B A;  1KL1 A;  4CBS A;  4XJL A;  2AAT A;  3RBL A;  4A00 A;  3PJ0 A;  4WB0 B;  3BV0 A;  1MLZ A;  3MC6 A;  2EYQ A;  4IX8 A;  1YJY A;  2BWO A;  2D7Y A;  4UHN A;  1AJS B;  1FC4 A;  1JS3 A;  2CFB A;  3ECD A;  4ZSY A;  3MC6 C;  2OKK A;  4LNM A;  1EJI A;  3AEL A;  3VOM A;  2BIE A;  4GEB A;  1AHE A;  2Z9X A;  2W8T A;  3DOD A;  3RBF A;  5G4I A;  1GEW A;  1IUG A;  4WYD A;  4WYA A;  1D7R A;  1SF2 A;  4ZLV A;  1H1C A;  1YAA A;  3TQX A;  2QBT A;  3P1T A;  2HUU A;  3GWP A;  3NU8 A;  1IVR A;  1P3W A;  4WBT A;  3FQ7 A;  1LW5 A;  2CJG A;  2VGU A;  2ZSM A;  3AEO A;  3BB8 A;  3EI9 A;  3RUY A;  4A6U A;  2GMU A;  3BWN A;  4RKD A;  3ZZK A;  2QB2 A;  1EG5 A;  2ZY4 A;  3HMU A;  3COG A;  1M4N A;  1AIC A;  2C44 A;  3N5M A;  4WYE A;  5M49 A;  1U08 A;  3NYU A;  4ZDO A;  3BWN C;  4M2K A;  1AKA A;  1LW4 A;  2VYC A;  3B1C A;  2DGK A;  2ORD A;  4JE5 A;  3PDX A;  2EPJ A;  3E2F A;  1GC4 A;  4A6R A;  2AY5 A;  2ZY3 A;  3L8A A;  2EO5 A;  1D7S A;  1DJE A;  1MLY A;  3LY1 A;  3WLX A;  4P3M A;  4EB7 A;  4RLG A;  1X0M A;  1G7W A;  2R0T A;  3Q8N A;  4Q31 A;  4F4E A;  1W3U A;  2OAT A;  2VGV A;  1AMA A;  2FN6 A;  4HVK A;  4F5K A;  4N0W A;  5E5I A;  1KAF A;  4H51 A;  4ZWM A;  1GC0 A;  1GDE A;  4TN4 A;  1RV4 A;  4IY7 A;  3QI6 A;  2W8V A;  1B9H A;  1LC8 A;  3DXW A;  3EZS A;  4MY5 A;  4E3R A;  8AAT A;  4MSO A;  2AY6 A;  2VGS A;  2VGW A;  1G4X A;  2D7Z A;  3ASB A;  4UHM A;  2CY8 A;  3WGC A;  4LNL A;  2GSA A;  1MGV A;  2AEU A;  2OGA A;  4KYO A;  2HP2 A;  4OYT A;  2BI9 A;  4GE4 A;  5EAA A;  1ART A;  1PMM A;  2YKY A;  5EUD A;  3CQ4 A;  3LVK A;  3JZL A;  1S08 A;  3EI7 A;  3GR9 A;  3NYS A;  4IXS A;  1N2T A;  4M2M A;  4TMR A;  3OP7 A;  4W5K A;  3FQA A;  2X3L A;  4PVF A;  3FFR A;  3I5T A;  1M0O A;  2TPL A;  3W1H A;  2W7M A;  4R8D A;  4PFN A;  2PO3 A;  2X5D A;  3LVL B;  5M4D A;  3ZRP A;  2DGM A;  1CZC A;  4CXR A;  4MQR A;  1AIB A;  1M0N A;  3AOW A;  1GD9 A;  4NOG A;  4XEW A;  3WKR A;  3QN6 A;  1C9C A;  4GDY A;  1BS0 A;  2WK8 A;  1IX8 A;  1KMJ A;  2ZUK A;  2W7G A;  3VP6 A;  3B8X A;  1MAP A;  3PD6 A;  4ZM3 A;  1LC5 A;  3HBX A;  4GRX A;  4J5U A;  1ELU A;  2AY2 A;  3AEN B;  1LC7 A;  2W7D A;  1WYT A;  2V0Y A;  4OTL A;  3DXV A;  4CXQ A;  2G6W A;  3NUI A;  4A72 A;  4ZSW A;  2HUI A;  3E2Z A;  2ZP7 A;  5F9S A;  1IX6 A;  1I41 A;  4EFF A;  2RFV A;  3ELE A;  3E6G A;  2FNU A;  1WYU B;  1CQ6 A;  2BKW A;  4JF1 A;  4RJY A;  1GBN A;  1ORD A;  1SZU A;  3E9K A;  4F5H A;  1M0Q A;  1QIR A;  2BI2 A;  3MAF A;  1ASD A;  1S09 A;  2CTZ A;  3FVS A;  3HQT A;  1YJS A;  3HT4 A;  4IW7 A;  4BMK A;  2FQ6 A;  2CIN A;  5DJ9 A;  1XEY A;  2PB2 A;  1WKH A;  1N31 A;  4XQ2 A;  5D95 A;  1BQD A;  4U2H A;  1V2E A;  4MKJ A;  1Z7D A;  2QA3 A;  1TOJ A;  2XBN A;  3BS8 A;  1G4V A;  2DR1 A;  2ZSL A;  4GE7 A;  2CH1 A;  3VK3 A;  1ELQ A;  4IXZ A;  2HUF A;  4WP0 A;  4JEW A;  3QPG A;  3GSB A;  1WYV A;  1B8G A;  4AZJ A;  3DYD A;  4LW2 A;  3UAK A;  4W1W A;  4R5Z A;  1BW0 A;  1PG8 A;  3GET A;  2C7T A;  1BJO A;  1ASL A;  1CQ8 A;  2BIA A;  2HOX A;  2YRR A;  3JTX A;  1B4X A;  3QHX A;  1VP4 A;  2W8U A;  3NYT A;  4RM1 A;  3G8M A;  1QIS A;  3K40 A;  3FDD A;  1ZOD A;  1FG7 A;  2R5C A;  3W1J A;  5FT5 A;  4ATP A;  4QGR A;  4R2N A;  5C6U A;  2CH2 A;  2PB0 A;  3TFT A;  2WK7 A;  4WXG A;  2VLH A;  1KMK A;  4W91 A;  2DKB A;  2HOZ A;  5G2P A;  2ZY5 A;  1AHY A;  1ARI A;  5AX8 A;  2BI5 A;  4EU1 A;  2W7J A;  1SZK A;  3HLM A;  3DC1 A;  3NUB A;  2D64 A;  3AEJ A;  1D7U A;  2CB1 A;  3AOV A;  3FZ6 A;  1ASN A;  1AY4 A;  2HOR A;  2YRI A;  2JJF A;  4JEY A;  2W7F A;  4ZDP A;  3PDB A;  2X8U A;  4WYF A;  4OT8 A;  2ZJG A;  1I48 A;  4WLJ A;  3MAU A;  1AY8 A;  3AEJ C;  4XJP A;  2JG2 A;  3FKD A;  2VMO A;  3NDN A;  3I4J A;  1Y4I A;  1AMQ A;  5E4Z A;  2D63 A;  1KKP A;  3EI5 A;  1O62 A;  4Q6R A;  5G0A A;  2BHX A;  2YKV A;  2VIA A;  1KKJ A;  3A9Z A;  4UOY A;  1XI9 A;  2Z1Z A;  2D65 A;  1MDZ A;  1IAY A;  4Y0H A;  4IYO A;  4F5M A;  4MQQ A;  3CQ5 A;  2JJG A;  5I92 A;  3M5U A;  4DGT A;  2Z9V A;  1V2F A;  5K8B A;  1PMO A;  4W1V A;  3GZD A;  1ASC A;  3R9A A;  4UQV A;  3UE8 A;  4CVQ A;  2CAN A;  3RCH B;  3AV7 A;  2AY9 A;  2OQX A;  2YKX A;  1FG3 A;  1O4S A;  4EMY A;  1V2D A;  1J04 A;  2A1V A;  4ZM4 A;  1W7N A;  3GZD C;  3VK2 A;  2Z1Y A;  4P7Y A;  2W7I A;  1BQA A;  1ZOB A;  2YKU A;  2ZC0 A;  2O1B A;  1ASF A;  2W7L A;  5F8V A;  5M46 A;  3LV2 A;  5G4J A;  5TF5 A;  1AHG A;  1YOO A;  2FNI A;  4XJO A;  3DR7 A;  3GZC A;  4ZAS A;  3USF A;  2VGT A;  1LKC A;  1C7O A;  1VEF A;  3QGU A;  4F5F A;  1X29 A;  3RQ1 A;  2JGT A;  4B9B A;  4WB0 A;  1DGD A;  4ITG A;  5DJ1 A;  2QB3 A;  2BYJ A;  5G2Q A;  4JEX A;  2O7C A;  1AJS A;  1OHY A;  3WCN A;  4OC9 A;  5JAY A;  3NU7 A;  5EIG B;  2QLR A;  4RJ0 A;  1MDO A;  4TV7 A;  5DB5 A;  3K28 A;  4PIW A;  1JS6 A;  3DZZ A;  4ATQ A;  1H0C A;  1C4K A;  1OXO A;  2EGY A;  4XJM A;  2W7H A;  3N4X A;  3L44 A;  2W8J A;  3GJU A;  1BJW A;  1AMR A;  1QJ5 A;  2VMU A;  4F5L A;  1W7M A;  4LC3 A;  2VGZ A;  4LW4 A;  4RKC A;  2AEV A;  3IHJ A;  1QJ3 A;  1TAR A;  2VMT A;  2FYF A;  1GCK A;  3N0L A;  1TOI A;  3MKJ A;  3I16 A;  2YOB A;  1AKB A;  1C7G A;  1DTY A;  1UU2 A;  2C0R A;  2BI1 A;  4JF0 A;  4ADE A;  3LG0 A;  3VK4 A;  3AAT A;  1J32 A;  1UU0 A;  1OHV A;  1ECX A;  1GC3 A;  3FRK A;  3H14 A;  2ZYJ A;  4AZK A;  2R5E A;  2YHK A;  1AIA A;  1DFO A;  3B1D A;  1BT4 A;  2VMS A;  4K2M A;  4O6Z A;  4BQ0 A;  3WCO A;  5FT6 A;  1CJ0 A;  1B5P A;  3JWB A;  2GB3 A;  1CZE A;  4Y0I A;  3JW9 A;  4R5F A;  3ATH A;  4WXF A;  1I43 A;  4GSA A;  3N7N A;  4M2J A;  3II0 A;  2VIB A;  5EAV A;  2HP1 A;  3B1E A;  3DU4 A;  2Z61 A;  3N4R A;  3BCB A;  1E5F A;  3W1I A;  4AOA A;  1WKG A;  3HDO A;  3NRA A;  1DGE A;  2Q7W A;  3FZ8 A;  1S07 A;  9AAT A;  3ZRR A;  3FZ7 A;  4ADC A;  2JIS A;  2KFP A;  4Q75 A;  2WB6 A;  1ASG A;  1RVY A;  2AY1 A;  4K05 A;  3ELP A;  4Q76 A;  2NMP A;  2QSR A;  3FDB A;  4E77 A;  4BHD A;  1SPA A;  3CBF A;  3ISL A;  4E1O A;  1D2F A;  2FKI A;  3F6T A;  2W7E A;  3PGY A;  2XH1 A;  1T3I A;  3N75 A;  2VMR A;  4JEV A;  1GEY A;  4JEZ A;  2W8W A;  1YIY A;  4ZAH A;  5G09 A;  1C0N A;  3F0H A;  1C7N A;  2WKA A;  4HF8 A;  1LS3 A;  2AY4 A;  2VMZ A;  3FVU A;  4ADD A;  1YJZ A;  2D61 A;  4H63 Q;  2BI3 A;  3FTB A;  1JF9 A;  3NTJ A;  3FVX A;  4K2B A;  1ASM A;  2GMS A;  3K7Y A;  4L0O A;  3ACZ A;  4BA5 A;  4FFC A;  4WXB A;  3B46 A;  4UHO A;  2EH6 A;  2JJH A;  3JWA A;  3T32 A;  4J8L A;  1YIZ A;  3KKI A;  3FQ8 A;  4W8I A;  1M32 A;  5DX5 A;  1AHX A;  1QGN A;  5M4B A;  4RIZ A;  3H7F A;  2VMW A;  2F8J A;  1BKG A;  2ZY2 A;  1GEX A;  3AEN A;  3EZ1 A;  3TAT A;  4DQ6 A;  3A8U X;  3EUC A;  1SFF A;  3TCM A;  3LVJ A;  1M7Y A;  5J8Q A;  3CQ6 A;  5BJ4 A;  1DJ9 A;  1BJN A;  1AY5 A;  4F5J A;  1E5E A;  4U1T A;  2FM1 A;  3JU7 A;  4A6T A;  3ASA A;  7AAT A;  4LNJ A;  2C81 A;  1WYU A;  2AY8 A;  2E7U A;  3A9Y A;  2VI8 A;  5EUN A;  1ASE A;  2BWN A;  3P6K A;  3MAD A;  2R2N A;  3FCR A;  2D5Y A;  1CS1 A;  5D5S A;  3HL2 A;  2VLF A;  4ITX A;  1KL2 A;  4A0F A;  1AHF A;  1ARS A;  2VI9 A;  1TAS A;  3G0T A;  3BCX A;  4B98 A;  3PD6 B;  4GE9 A;  3DR4 A;  3AEP A;  1IBJ A;  1AJR A;  1CL2 A;  4OBU A;  1WYT B;  2VMX A;  3PA9 A;  3H9X A;  2DGL A;  1ASA A;  3ZRQ A;  4WYG A;  3E2Z B;  1RVU A;  1MAQ A;  2EZ1 A;  3E2Y A;  1AX4 A;  3KE3 A;  4ISY A;  2AY7 A;  2GQN A;  1TAT A;  1AAM A;  1G7X A;  2G7J A;  2Z9U A;  4N0B A;  1M6S A;  1CL1 A;  1CQ7 A;  2DOU A;  2HOY A;  1TOK A;  1B5O A;  1SVV A;  2X5F A;  4A0R A;  4BA4 A;  2BWP A;  1O61 A;  3MAF B;  2D66 A;  4FL0 A;  2CST A;  2JJE A;  3HVY A;  3UWC A;  3TFU A;  3ZZJ A;  1DJU A;  4A0H A;  1IX7 A; 
#chains in the Genus database with same CATH homology
 1IAX A;  1W7L A;  3MEB A;  4WLH A;  4RIT A;  4OBV A;  1UKJ A;  1EQB A;  1O69 A;  5EQC A;  5HXX A;  1ASB A;  4K2I A;  4WD2 A;  2VMQ A;  4Y0D A;  3FFH A;  4OCA A;  4E3Q A;  1JG8 A;  3BN1 A;  5E3K A;  2E7I A;  3VAX A;  3N4S A;  1TPL A;  2E7J A;  1BJ4 A;  2QMA A;  3PPL A;  2VMP A;  3G7Q A;  1W23 A;  1GC2 A;  1WYV B;  3EIA A;  1Z3Z A;  2BIG A;  2YCN A;  1M0P A;  1TOG A;  3EI6 A;  4MGR A;  3MBB A;  1ARH A;  3QBO A;  4PFF A;  3WY7 A;  3IF2 A;  3BWO A;  3AEM A;  3KGX A;  1X2A A;  1I29 A;  4AO9 A;  1LK9 A;  1BJO B;  2YCT A;  1PFF A;  2CJH A;  4W1X A;  3WX9 A;  3AEM C;  3EI8 A;  4KAM A;  2R5C B;  5FT4 A;  3RI6 A;  4KXK A;  1WST A;  2DKJ A;  3FD0 A;  2VMN A;  4OMA A;  3WZF A;  1D7V A;  2CJD A;  2AY3 A;  1IJI A;  4CBR A;  4IXO A;  1SZS A;  3F9T A;  3E77 A;  3WGB A;  1OXP A;  4ADB A;  1AMS A;  3RCH A;  3NNK A;  3QM2 A;  4RAE A;  3D6K A;  1QZ9 A;  5HDM A;  3PDB B;  1VJO A;  3KGW A;  3DRD A;  1V72 A;  1OHW A;  2VMY A;  3LVM A;  4DBC A;  1ARG A;  4F5G A;  1OAT A;  3CAI A;  3PAA A;  3PIU A;  4EB5 A;  3BC8 A;  3BCA A;  2OKJ A;  2WK9 A;  5HHY A;  1AKC A;  2Z67 A;  1N8P A;  1QIT A;  2V1P A;  4MQP A;  1TOE A;  1YNU A;  3GBX A;  3LWS A;  4ZDL A;  2YCP A;  4I8A A;  1UU1 A;  1ZC9 A;  4IYO B;  4F5I A;  3FSL A;  1MDX A;  5IWQ A;  3EIB A;  1S06 A;  4JE5 D;  4XAU A;  1X28 A;  2W7K A;  5LH9 A;  3WKS A;  1AAW A;  4AH3 A;  5BJ3 A;  2O0R A;  3OKS A;  4WYC A;  5EIG A;  2Z20 A;  2HZP A;  5KTB A;  5EUE A;  5FT8 A;  5EFS A;  2OGE A;  5LHA A;  3A9X A;  2Z9W A;  1B9I A;  2BYL A;  1S0A A;  2EZ2 A;  4MKK A;  2E54 A;  4ZWV A;  2VMV A;  4AO4 A;  3R4T A;  3NX3 A;  1RV3 A;  1DKA A;  4XK1 A;  4A0G A;  3A2B A;  1KL1 A;  4CBS A;  4XJL A;  2AAT A;  3RBL A;  4A00 A;  3PJ0 A;  4WB0 B;  3BV0 A;  1MLZ A;  3MC6 A;  2EYQ A;  4IX8 A;  1YJY A;  2BWO A;  2D7Y A;  4UHN A;  1AJS B;  1FC4 A;  1JS3 A;  2CFB A;  3ECD A;  4ZSY A;  3MC6 C;  2OKK A;  4LNM A;  1EJI A;  3AEL A;  3VOM A;  2BIE A;  4GEB A;  1AHE A;  2Z9X A;  2W8T A;  3DOD A;  3RBF A;  5G4I A;  1GEW A;  1IUG A;  4WYD A;  4WYA A;  1D7R A;  1SF2 A;  4ZLV A;  1H1C A;  1YAA A;  3TQX A;  2QBT A;  3P1T A;  2HUU A;  3GWP A;  3NU8 A;  1IVR A;  1P3W A;  4WBT A;  3FQ7 A;  1LW5 A;  2CJG A;  2VGU A;  2ZSM A;  3AEO A;  3BB8 A;  3EI9 A;  3RUY A;  4A6U A;  2GMU A;  3BWN A;  4RKD A;  3ZZK A;  2QB2 A;  1EG5 A;  2ZY4 A;  3HMU A;  3COG A;  1M4N A;  1AIC A;  2C44 A;  3N5M A;  4WYE A;  5M49 A;  1U08 A;  3NYU A;  4ZDO A;  3BWN C;  4M2K A;  1AKA A;  1LW4 A;  2VYC A;  3B1C A;  2DGK A;  2ORD A;  4JE5 A;  3PDX A;  2EPJ A;  3E2F A;  1GC4 A;  4A6R A;  2AY5 A;  2ZY3 A;  3L8A A;  2EO5 A;  1D7S A;  1DJE A;  1MLY A;  3LY1 A;  3WLX A;  4P3M A;  4EB7 A;  4RLG A;  1X0M A;  1G7W A;  2R0T A;  3Q8N A;  4Q31 A;  4F4E A;  1W3U A;  2OAT A;  2VGV A;  1AMA A;  2FN6 A;  4HVK A;  4F5K A;  4N0W A;  5E5I A;  4H51 A;  4ZWM A;  1GC0 A;  1GDE A;  4TN4 A;  1RV4 A;  4IY7 A;  3QI6 A;  2W8V A;  1B9H A;  1LC8 A;  3DXW A;  3EZS A;  4MY5 A;  4E3R A;  8AAT A;  4MSO A;  2AY6 A;  2VGS A;  2VGW A;  1G4X A;  2D7Z A;  3ASB A;  4UHM A;  2CY8 A;  3WGC A;  4LNL A;  2GSA A;  1MGV A;  2AEU A;  2OGA A;  4KYO A;  2HP2 A;  4OYT A;  2BI9 A;  4GE4 A;  5EAA A;  1ART A;  1PMM A;  2YKY A;  5EUD A;  3CQ4 A;  3LVK A;  3JZL A;  1S08 A;  3EI7 A;  3GR9 A;  3NYS A;  4IXS A;  1N2T A;  4M2M A;  4TMR A;  3OP7 A;  4W5K A;  3FQA A;  2X3L A;  4PVF A;  3FFR A;  3I5T A;  1M0O A;  2TPL A;  3W1H A;  2W7M A;  4R8D A;  4PFN A;  2PO3 A;  2X5D A;  3LVL B;  5M4D A;  3ZRP A;  2DGM A;  1CZC A;  4CXR A;  4MQR A;  1AIB A;  1M0N A;  3AOW A;  1GD9 A;  4NOG A;  4XEW A;  3WKR A;  3QN6 A;  1C9C A;  4GDY A;  1BS0 A;  2WK8 A;  1IX8 A;  1KMJ A;  2ZUK A;  2W7G A;  3VP6 A;  3B8X A;  1MAP A;  3PD6 A;  4ZM3 A;  1LC5 A;  3HBX A;  4GRX A;  4J5U A;  1ELU A;  2AY2 A;  3AEN B;  1LC7 A;  2W7D A;  1WYT A;  2V0Y A;  4OTL A;  3DXV A;  4CXQ A;  2G6W A;  3NUI A;  4A72 A;  4ZSW A;  2HUI A;  3E2Z A;  2ZP7 A;  5F9S A;  1IX6 A;  1I41 A;  4EFF A;  2RFV A;  3ELE A;  3E6G A;  2FNU A;  1WYU B;  1CQ6 A;  2BKW A;  4JF1 A;  4RJY A;  1GBN A;  1ORD A;  1SZU A;  3E9K A;  4F5H A;  1M0Q A;  1QIR A;  2BI2 A;  3MAF A;  1ASD A;  1S09 A;  2CTZ A;  3FVS A;  3HQT A;  1YJS A;  3HT4 A;  4IW7 A;  4BMK A;  2FQ6 A;  2CIN A;  5DJ9 A;  1XEY A;  2PB2 A;  1WKH A;  1N31 A;  4XQ2 A;  5D95 A;  1BQD A;  4U2H A;  1V2E A;  4MKJ A;  1Z7D A;  2QA3 A;  1TOJ A;  2XBN A;  3BS8 A;  1G4V A;  2DR1 A;  2ZSL A;  4GE7 A;  2CH1 A;  3VK3 A;  1ELQ A;  4IXZ A;  2HUF A;  4WP0 A;  4JEW A;  3QPG A;  3GSB A;  1WYV A;  1B8G A;  4AZJ A;  3DYD A;  4LW2 A;  3UAK A;  4W1W A;  4R5Z A;  1BW0 A;  1PG8 A;  3GET A;  2C7T A;  1BJO A;  1ASL A;  1CQ8 A;  2BIA A;  2HOX A;  2YRR A;  3JTX A;  1B4X A;  3QHX A;  1VP4 A;  2W8U A;  3NYT A;  4RM1 A;  3G8M A;  1QIS A;  3K40 A;  3FDD A;  1ZOD A;  1FG7 A;  2R5C A;  3W1J A;  5FT5 A;  4ATP A;  4QGR A;  4R2N A;  5C6U A;  2CH2 A;  2PB0 A;  3TFT A;  2WK7 A;  4WXG A;  2VLH A;  1KMK A;  4W91 A;  2DKB A;  2HOZ A;  5G2P A;  2ZY5 A;  1AHY A;  1ARI A;  5AX8 A;  2BI5 A;  4EU1 A;  2W7J A;  1SZK A;  3HLM A;  3DC1 A;  3NUB A;  2D64 A;  3AEJ A;  1D7U A;  2CB1 A;  3AOV A;  3FZ6 A;  1ASN A;  1AY4 A;  2HOR A;  2YRI A;  2JJF A;  4JEY A;  2W7F A;  4ZDP A;  3PDB A;  2X8U A;  4WYF A;  4OT8 A;  2ZJG A;  1I48 A;  4WLJ A;  3MAU A;  1AY8 A;  3AEJ C;  4XJP A;  2JG2 A;  3FKD A;  2VMO A;  3NDN A;  3I4J A;  1Y4I A;  1AMQ A;  5E4Z A;  2D63 A;  1KKP A;  3EI5 A;  1O62 A;  4Q6R A;  5G0A A;  2BHX A;  2YKV A;  2VIA A;  1KKJ A;  3A9Z A;  4UOY A;  1XI9 A;  2Z1Z A;  2D65 A;  1MDZ A;  1IAY A;  4Y0H A;  4IYO A;  4F5M A;  4MQQ A;  3CQ5 A;  2JJG A;  5I92 A;  3M5U A;  4DGT A;  2Z9V A;  1V2F A;  5K8B A;  1PMO A;  4W1V A;  3GZD A;  1ASC A;  3R9A A;  4UQV A;  3UE8 A;  4CVQ A;  2CAN A;  3RCH B;  3AV7 A;  2AY9 A;  2OQX A;  2YKX A;  1FG3 A;  1O4S A;  4EMY A;  1V2D A;  1J04 A;  2A1V A;  4ZM4 A;  1W7N A;  3GZD C;  3VK2 A;  2Z1Y A;  4P7Y A;  2W7I A;  1BQA A;  1ZOB A;  2YKU A;  2ZC0 A;  2O1B A;  1ASF A;  2W7L A;  5F8V A;  5M46 A;  3LV2 A;  5G4J A;  5TF5 A;  1AHG A;  1YOO A;  2FNI A;  4XJO A;  3DR7 A;  3GZC A;  4ZAS A;  3USF A;  2VGT A;  1LKC A;  1C7O A;  1VEF A;  3QGU A;  4F5F A;  1X29 A;  3RQ1 A;  2JGT A;  4B9B A;  4WB0 A;  1DGD A;  4ITG A;  5DJ1 A;  2QB3 A;  2BYJ A;  5G2Q A;  4JEX A;  2O7C A;  1AJS A;  1OHY A;  3WCN A;  4OC9 A;  5JAY A;  3NU7 A;  5EIG B;  2QLR A;  4RJ0 A;  1MDO A;  4TV7 A;  5DB5 A;  3K28 A;  4PIW A;  1JS6 A;  3DZZ A;  4ATQ A;  1H0C A;  1C4K A;  1OXO A;  2EGY A;  4XJM A;  2W7H A;  3N4X A;  3L44 A;  2W8J A;  3GJU A;  1BJW A;  1AMR A;  1QJ5 A;  2VMU A;  4F5L A;  1W7M A;  4LC3 A;  2VGZ A;  4LW4 A;  4RKC A;  2AEV A;  3IHJ A;  1QJ3 A;  1TAR A;  2VMT A;  2FYF A;  1GCK A;  3N0L A;  1TOI A;  3MKJ A;  3I16 A;  2YOB A;  1AKB A;  1C7G A;  1DTY A;  1UU2 A;  2C0R A;  2BI1 A;  4JF0 A;  4ADE A;  3LG0 A;  3VK4 A;  3AAT A;  1J32 A;  1UU0 A;  1OHV A;  1ECX A;  1GC3 A;  3FRK A;  3H14 A;  2ZYJ A;  4AZK A;  2R5E A;  2YHK A;  1AIA A;  1DFO A;  3B1D A;  1BT4 A;  2VMS A;  4K2M A;  4O6Z A;  4BQ0 A;  3WCO A;  5FT6 A;  1CJ0 A;  1B5P A;  3JWB A;  2GB3 A;  1CZE A;  4Y0I A;  3JW9 A;  4R5F A;  3ATH A;  4WXF A;  1I43 A;  4GSA A;  3N7N A;  4M2J A;  3II0 A;  2VIB A;  5EAV A;  2HP1 A;  3B1E A;  3DU4 A;  2Z61 A;  3N4R A;  3BCB A;  1E5F A;  3W1I A;  4AOA A;  1WKG A;  3HDO A;  3NRA A;  1DGE A;  2Q7W A;  3FZ8 A;  1S07 A;  9AAT A;  3ZRR A;  3FZ7 A;  4ADC A;  2JIS A;  2KFP A;  4Q75 A;  2WB6 A;  1ASG A;  1RVY A;  2AY1 A;  4K05 A;  3ELP A;  4Q76 A;  2NMP A;  2QSR A;  3FDB A;  4E77 A;  4BHD A;  1SPA A;  3CBF A;  3ISL A;  4E1O A;  1D2F A;  2FKI A;  3F6T A;  2W7E A;  3PGY A;  2XH1 A;  1T3I A;  3N75 A;  2VMR A;  4JEV A;  1GEY A;  4JEZ A;  2W8W A;  1YIY A;  4ZAH A;  5G09 A;  1C0N A;  3F0H A;  1C7N A;  2WKA A;  4HF8 A;  1LS3 A;  2AY4 A;  2VMZ A;  3FVU A;  4ADD A;  1YJZ A;  2D61 A;  4H63 Q;  2BI3 A;  3FTB A;  1JF9 A;  3NTJ A;  3FVX A;  4K2B A;  1ASM A;  2GMS A;  3K7Y A;  4L0O A;  3ACZ A;  4BA5 A;  4FFC A;  4WXB A;  3B46 A;  4UHO A;  2EH6 A;  2JJH A;  3JWA A;  3T32 A;  4J8L A;  1YIZ A;  3KKI A;  3FQ8 A;  4W8I A;  1M32 A;  5DX5 A;  1AHX A;  1QGN A;  5M4B A;  4RIZ A;  3H7F A;  2VMW A;  2F8J A;  1BKG A;  2ZY2 A;  1GEX A;  3AEN A;  3EZ1 A;  3TAT A;  4DQ6 A;  3A8U X;  3EUC A;  1SFF A;  3TCM A;  3LVJ A;  1M7Y A;  5J8Q A;  3CQ6 A;  5BJ4 A;  1DJ9 A;  1BJN A;  1AY5 A;  4F5J A;  1E5E A;  4U1T A;  2FM1 A;  3JU7 A;  4A6T A;  3ASA A;  7AAT A;  4LNJ A;  2C81 A;  1WYU A;  2AY8 A;  2E7U A;  3A9Y A;  2VI8 A;  5EUN A;  1ASE A;  2BWN A;  3P6K A;  3MAD A;  2R2N A;  3FCR A;  2D5Y A;  1CS1 A;  5D5S A;  3HL2 A;  2VLF A;  4ITX A;  1KL2 A;  4A0F A;  1AHF A;  1ARS A;  2VI9 A;  1TAS A;  3G0T A;  3BCX A;  4B98 A;  3PD6 B;  4GE9 A;  3DR4 A;  3AEP A;  1IBJ A;  1AJR A;  1CL2 A;  4OBU A;  1WYT B;  2VMX A;  3PA9 A;  3H9X A;  2DGL A;  1ASA A;  3ZRQ A;  4WYG A;  3E2Z B;  1RVU A;  1MAQ A;  2EZ1 A;  3E2Y A;  1AX4 A;  3KE3 A;  4ISY A;  2AY7 A;  2GQN A;  1TAT A;  1AAM A;  1G7X A;  2G7J A;  2Z9U A;  4N0B A;  1M6S A;  1CL1 A;  1CQ7 A;  2DOU A;  2HOY A;  1TOK A;  1B5O A;  1SVV A;  2X5F A;  4A0R A;  4BA4 A;  2BWP A;  1O61 A;  3MAF B;  2D66 A;  4FL0 A;  2CST A;  2JJE A;  3HVY A;  3UWC A;  3TFU A;  3ZZJ A;  1DJU A;  4A0H A;  1IX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...