5FT8A

Crystal structure of the complex between the cysteine desulfurase csda and the sulfur-acceptor csde in the persulfurated state at 2.50 angstroem resolution
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
401
structure length
400
Chain Sequence
b'MNVFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATQQFYSLSAGNVHRSQFAEAQRLTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLEAMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHAQPLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTEINE DESULFURASE CSDA
publication title Mechanism of Sulfur Transfer Across Protein-Protein Interfaces: The Cysteine Desulfurase Model System
doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 136
structure length 400
sequence length 401
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature ec 2.8.1.7: Cysteine desulfurase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5ft8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ft8A01
3EI8A 1V72A 2YHKA 3GSBA 4LNLA 1VJOA 2HORA 4UHNA 1M0OA 4F5IA 2ZC0A 2VGSA 4F5MA 4OYTA 2CTZA 4BA5A 4GSAA 4KAMA 3QM2A 1ASBA 3USFA 2D65A 4RM1A 1IUGA 4MQQA 3DXVA 1M4NA 2W7GA 3FZ7A 1ASMA 2GQNA 3LY1A 3OP7A 1CZEA 1ZOBA 2O1BA 2DR1A 3A8UX 3FCRA 3HLMA 2OATA 4TN4A 1SF2A 3DODA 3JWBA 1W7NA 4QGRA 5E3KA 1IX8A 3LVJA 2HP1A 2GB3A 2ZP7A 4HF8A 2R5EA 2JJHA 3HMUA 2E7IA 3G7QA 1SZKA 4GEBA 4PVFA 4XJPA 4EFFA 3R4TA 3WCOA 1GD9A 1X28A 1D7UA 2CSTA 4R5ZA 3NYTA 5M4BA 1LKCA 1B8GA 1QITA 1ASDA 4CXQA 3PJ0A 4K2BA 2YCTA 3A9YA 2W7MA 2E7UA 2AY9A 3HBXA 1S06A 3BB8A 3B8XA 2AY6A 2BI5A 3A2BA 2QB2A 1YIZA 2CANA 1AHEA 5EUDA 4WYEA 5K8BA 3BWOA 1AY5A 1AHFA 1TARA 3W1HA 3RCHA 5M4DA 1MDOA 1GBNA 1IBJA 3FFHA 2FM1A 3M5UA 4A00A 2ZJGA 2CJHA 1W7MA 2Z67A 3LVLB 3NNKA 1P3WA 5BJ3A 3FRKA 3PD6B 2Z9UA 3AOWA 4N0BA 4U1TA 1AKAA 3QBOA 4BQ0A 3DU4A 5C6UA 3LVMA 2BWNA 3PDBA 4PFNA 4UOYA 3MBBA 2QLRA 3NX3A 2CH2A 1J32A 4DQ6A 1SZUA 4W1XA 1CQ6A 1WYUA 2R0TA 1GC4A 1MDXA 4Y0HA 1KKPA 2QA3A 2BHXA 3KGXA 2CJDA 3Q8NA 1LW5A 2CFBA 3K40A 3DR7A 3GJUA 1C0NA 3GBXA 4PFFA 2RFVA 2VLHA 3ISLA 4ITXA 1MAPA 1M0PA 4IXZA 2YCNA 5D95A 2R5CB 1I43A 3UE8A 3F6TA 3P1TA 1YIYA 3NUBA 3WLXA 1EQBA 1V2FA 3HT4A 4GE7A 1G4XA 1ARGA 2ORDA 1AKCA 2AEUA 2DGMA 2GMUA 1KKJA 3EUCA 3DR4A 1H1CA 1IX7A 1TOIA 1FC4A 2AEVA 2YOBA 5G4JA 1SZSA 4JE5D 1O69A 4FL0A 2JGTA 2GSAA 3B46A 2X5FA 4WBTA 1B9HA 4J5UA 1DKAA 3OKSA 4MQPA 1G7WA 3JW9A 3PA9A 3FVXA 2W7DA 2AY3A 2BWOA 3AATA 1VP4A 4MSOA 4O6ZA 4RKDA 1CS1A 3EZSA 1AMSA 1AIAA 1MLZA 3FVSA 4OT8A 1QJ3A 1CQ8A 4IY7A 1M7YA 2JJGA 4RITA 3CQ5A 5DB5A 3FD0A 1BQAA 4WD2A 2EZ1A 2EH6A 2VMRA 3HVYA 3K7YA 1ASNA 4MKJA 1GC3A 4OTLA 5EIGA 1PFFA 1OHYA 4GRXA 3VOMA 2VIBA 4H51A 4F5KA 3R9AA 5HXXA 4RJYA 3BWNC 3JTXA 3KGWA 3TQXA 2AY8A 1YOOA 2D61A 4ZASA 1ELUA 3G0TA 2NMPA 1WYVB 2D66A 3LV2A 4IX8A 3NYUA 2X5DA 1TPLA 3KKIA 4JF1A 3FFRA 2V0YA 4ADCA 3E2ZB 5HDMA 4OC9A 1J04A 4ZM3A 1BS0A 2GMSA 3E6GA 1MGVA 1SPAA 1S07A 3RI6A 1XEYA 4RLGA 4ADDA 2YKUA 2VLFA 4IYOA 3F0HA 1LW4A 2EO5A 4PIWA 3RBFA 2DGLA 1CQ7A 1QISA 8AATA 3IF2A 4E3QA 3PDXA 4UQVA 1AJSA 4Q6RA 3AEJC 1AICA 4XJMA 1LK9A 1LC5A 1M6SA 3P6KA 1C7NA 2BI2A 4WB0B 1MLYA 3UAKA 3VK2A 1JS6A 1X29A 2W8JA 1T3IA 3BN1A 3EIAA 4AH3A 1YJSA 4A6UA 3BC8A 2VMPA 2D7YA 3MEBA 4ISYA 2BI3A 3ASBA 3JU7A 4RIZA 2ZSMA 3RQ1A 3CQ6A 1UKJA 2ZYJA 2BYJA 3FTBA 4M2JA 2CH1A 4P7YA 4XJLA 5E5IA 3E77A 5I92A 1DJ9A 3ZRQA 3BWNA 7AATA 1C9CA 3PPLA 2VMZA 3RUYA 2VMOA 4F5JA 4OBVA 1QJ5A 2OKKA 3N0LA 5DJ1A 5EFSA 4CBRA 2ZY3A 2CINA 3UWCA 5EUEA 4WYDA 3JZLA 5IWQA 4NOGA 1S08A 1LS3A 4Q76A 2CY8A 1AAWA 1VEFA 1C7GA 1S09A 1UU1A 5AX8A 2VI9A 3TFTA 1Z3ZA 2BI1A 3H7FA 1BJNA 1I41A 1KMJA 2CJGA 2WK9A 2ZUKA 4I8AA 4WXBA 1AIBA 2VIAA 4GDYA 1OATA 1IAXA 3B1CA 5EQCA 3F9TA 5M46A 3FDBA 4K2IA 3TFUA 2BKWA 2W8WA 1IAYA 2Z1ZA 2VGUA 4TMRA 4WYGA 2BIAA 1W3UA 2R5CA 3AEJA 5LHAA 4ZDOA 3GZCA 4ZDLA 3LWSA 1ASLA 1XI9A 4IXSA 3NTJA 2YRIA 1MDZA 2E7JA 3GETA 1AAMA 3HQTA 4M2KA 1AX4A 2OKJA 2PB0A 1ARHA 4ZLVA 1N31A 2O7CA 4JEZA 3W1IA 2D7ZA 1O61A 2C44A 3ACZA 2EGYA 2BYLA 4F4EA 2PB2A 3L8AA 5E4ZA 4CBSA 3AV7A 2VGWA 4TV7A 3MAFA 1JF9A 4KYOA 5DJ9A 3N75A 4Y0IA 3I4JA 4A6TA 1YJZA 4AZKA 1TOKA 3MKJA 3RCHB 2C0RA 1W23A 2W7IA 2Z61A 2W7LA 4F5HA 3GWPA 1B4XA 1KL2A 2Z9WA 3BCXA 4A6RA 3NU8A 1QGNA 2X3LA 1DJEA 5FT8A 4EU1A 2PO3A 2HOYA 1ELQA 1GEXA 3FZ8A 3NDNA 4JF0A 1D7RA 1OXOA 4XJOA 1N2TA 4ATQA 3FSLA 3WKRA 4E3RA 3WZFA 5BJ4A 3PDBB 3FQAA 1PG8A 4WXFA 1B5OA 5EAAA 4CVQA 3B1EA 5EUNA 2HUIA 2X8UA 1LC8A 3AEMC 2D64A 1WYUB 1S0AA 1WYTA 4W8IA 4WYFA 1ZC9A 3AEOA 5F8VA 3A9XA 4WYCA 1Z7DA 2YRRA 3N5MA 1AMAA 3AENA 3WY7A 5G09A 2JJFA 3FKDA 5FT6A 5TF5A 1ASEA 1OHWA 3DXWA 1E5EA 1EJIA 1IJIA 1U08A 2FNIA 1YNUA 3WX9A 4J8LA 3PAAA 4UHMA 1MAQA 2W7FA 4ADEA 2C7TA 2JG2A 2VMVA 3CBFA 3PIUA 4W1VA 3NYSA 1ARIA 2W7HA 3E2FA 4ADBA 1DJUA 3WKSA 4Y0DA 5G0AA 3NU7A 3ELEA 4K2MA 4Q31A 3QGUA 3LVKA 5G2PA 9AATA 4UHOA 1ASCA 4XQ2A 1RVYA 2BWPA 4OBUA 1I29A 2C81A 2VI8A 5FT4A 4F5FA 1CZCA 3HL2A 4ZDPA 2Z9XA 3FDDA 3QPGA 2VGTA 1TOGA 3ZRPA 4IXOA 4RKCA 3AEMA 4ZWMA 3D6KA 1X2AA 1B5PA 1AMRA 1IVRA 1ARSA 1RVUA 1UU2A 4A72A 2XBNA 3GZDC 4JEYA 4MKKA 1GC2A 4GE4A 2VMWA 3MADA 1DFOA 3VAXA 2CB1A 4XEWA 3II0A 3EI5A 5EIGB 3I16A 4AO4A 1BJOB 2YKXA 3WCNA 3ZZKA 2AY5A 1IX6A 1G7XA 2G6WA 1BJ4A 2JISA 1D7SA 2OQXA 5F9SA 4WLJA 1Y4IA 2AY4A 2W7EA 2WKAA 3T32A 4BA4A 3EI7A 3ELPA 4A0GA 3ZZJA 4DBCA 4ATPA 1WSTA 1KMKA 1C4KA 1OXPA 2YCPA 3K28A 2BIEA 3VK4A 1ASGA 1N8PA 2HOXA 1M32A 4WXGA 1CL2A 1PMMA 2W8VA 2VMXA 2OGAA 3PD6A 1WKHA 3DRDA 3FZ6A 2DGKA 3ASAA 1AJRA 1GEYA 1ORDA 2AY1A 1AHYA 2BIGA 1BKGA 4B9BA 3EZ1A 3EI9A 3QHXA 3DYDA 2VMNA 4IYOB 1UU0A 1AKBA 3I5TA 2AY2A 2DKBA 1TOJA 2WK8A 4MQRA 3BS8A 3H14A 3E2YA 4Q75A 4W1WA 4ZSYA 1AJSB 1ASAA 4N0WA 1M0NA 3JWAA 3LG0A 4KXKA 3BCBA 3RBLA 3ECDA 1DGEA 4JEWA 2VMQA 1BJWA 3GZDA 2BI9A 4W91A 3AOVA 4A0HA 2Z20A 3NUIA 4MGRA 2YKYA 1M0QA 4OMAA 1ASFA 4DGTA 5JAYA 4A0FA 1CJ0A 3CAIA 3AELA 3DZZA 1BW0A 2VMUA 4R8DA 5DX5A 5J8QA 2FN6A 2YKVA 3B1DA 3E9KA 4M2MA 1YAAA 4RJ0A 4LC3A 3WGCA 5G4IA 3W1JA 4XK1A 1JG8A 3COGA 2E54A 1D2FA 1QZ9A 4R2NA 4P3MA 3MC6C 2Q7WA 2XH1A 2Z1YA 3IHJA 4CXRA 4F5LA 4F5GA 5M49A 3KE3A 4L0OA 5D5SA 2R2NA 2ZY4A 1SVVA 3ZRRA 1AMQA 2FNUA 4OCAA 3HDOA 4JEVA 3VK3A 2VGZA 5G2QA 1O4SA 2AY7A 1DGDA 2W8TA 4FFCA 1PMOA 3ATHA 4IW7A 4EMYA 1ECXA 1EG5A 3EI6A 2OGEA 5LH9A 3G8MA 4ZWVA 1RV3A 3AEPA 3TCMA 3L44A 1GDEA 1AHGA 2O0RA 2HUFA 2DOUA 2QBTA 2ZY5A 4LW4A 2VMYA 2D5YA 4BMKA 3FQ8A 2ZY2A 2W7KA 3VP6A 4EB5A 1WYVA 1FG3A 1YJYA 1FG7A 1GEWA 3MAFB 4ZM4A 1AY8A 2V1PA 3E2ZA 4A0RA 4R5FA 1TASA 5EAVA 4LNMA 3FQ7A 2EPJA 2VYCA 2JJEA 2Z9VA 3DC1A 1BT4A 4ZSWA 4WYAA 1JS3A 2HP2A 4MY5A 1GCKA 1V2EA 4JEXA 3MC6A 4AOAA 4W5KA 1G4VA 1AY4A 4U2HA 2QB3A 4XAUA 2VGVA 2EZ2A 1BQDA 2FYFA 3FVUA 1WKGA 1I48A 4AZJA 2ZSLA 1D7VA 3EIBA 1OHVA 3NRAA 3A9ZA 3MAUA 1TOEA 4EB7A 4WB0A 2VMTA 4AO9A 2W8UA 3PGYA 4E77A 4LNJA 1QIRA 3QI6A 5FT5A 4B98A 1ARTA 1DTYA 4WLHA 1BJOA 1WYTB 1O62A 2VMSA 3TATA 2HZPA 4WP0A 1GC0A 2WK7A 2HOZA 4BHDA 2TPLA 1V2DA 2F8JA 3AENB 2FQ6A 4ITGA 1X0MA 1H0CA 2W7JA 1W7LA 1C7OA 5HHYA 3WGBA 4JE5A 4LW2A 3QN6A 2QMAA 1ZODA 2D63A 3CQ4A 4ZAHA 1E5FA 3BCAA 4HVKA 1SFFA 1TATA 2HUUA 2AATA 4RAEA 1AHXA 3GR9A 4GE9A 1CL1A 4E1OA 2DKJA 3BV0A 1KL1A 1LC7A 1B9IA 1RV4A
chains in the Genus database with same CATH superfamily
3EI8A 1V72A 2YHKA 3GSBA 4LNLA 1VJOA 2HORA 4UHNA 1M0OA 4F5IA 2ZC0A 2VGSA 4F5MA 4OYTA 2CTZA 4BA5A 4GSAA 4KAMA 3QM2A 1ASBA 3USFA 2D65A 4RM1A 1IUGA 4MQQA 3DXVA 1M4NA 2W7GA 3FZ7A 1ASMA 2GQNA 3LY1A 3OP7A 1CZEA 1ZOBA 2O1BA 2DR1A 3A8UX 3FCRA 3HLMA 2OATA 4TN4A 1SF2A 3DODA 3JWBA 1W7NA 4QGRA 5E3KA 1IX8A 3LVJA 2HP1A 2GB3A 2ZP7A 4HF8A 2R5EA 2JJHA 3HMUA 2E7IA 3G7QA 1SZKA 4GEBA 4PVFA 4XJPA 4EFFA 3R4TA 3WCOA 1GD9A 1X28A 1D7UA 2CSTA 4R5ZA 4H63Q 3NYTA 5M4BA 1LKCA 1B8GA 1QITA 1ASDA 4CXQA 3PJ0A 4K2BA 2YCTA 3A9YA 2W7MA 2E7UA 2AY9A 3HBXA 1S06A 3BB8A 3B8XA 2AY6A 2BI5A 3A2BA 2QB2A 1YIZA 2CANA 1AHEA 5EUDA 4WYEA 5K8BA 3BWOA 1AY5A 1AHFA 1TARA 3W1HA 3RCHA 5M4DA 1MDOA 3N4RA 1GBNA 1IBJA 3FFHA 2FM1A 3M5UA 4A00A 2ZJGA 2CJHA 1W7MA 2Z67A 3LVLB 3NNKA 1P3WA 5BJ3A 3FRKA 3PD6B 2Z9UA 3AOWA 4N0BA 4U1TA 1AKAA 3QBOA 4BQ0A 3DU4A 5C6UA 3LVMA 2BWNA 3PDBA 4PFNA 4UOYA 3MBBA 2QLRA 3NX3A 2CH2A 1J32A 4DQ6A 1SZUA 4W1XA 1CQ6A 1WYUA 2R0TA 1GC4A 1MDXA 4Y0HA 1KKPA 2QA3A 2BHXA 3KGXA 2CJDA 3Q8NA 1LW5A 2CFBA 3K40A 3DR7A 3GJUA 1C0NA 3GBXA 4PFFA 2RFVA 2VLHA 3ISLA 4ITXA 1MAPA 1M0PA 4IXZA 2YCNA 5D95A 2R5CB 1I43A 3UE8A 3F6TA 2QSRA 3P1TA 1YIYA 3NUBA 3WLXA 1EQBA 1V2FA 3HT4A 4GE7A 1G4XA 1ARGA 2ORDA 1AKCA 2AEUA 2DGMA 2GMUA 1KKJA 3EUCA 3DR4A 1H1CA 1IX7A 1TOIA 1FC4A 2AEVA 2YOBA 5G4JA 1SZSA 4JE5D 1O69A 4FL0A 2JGTA 2GSAA 3B46A 2X5FA 4WBTA 1B9HA 4J5UA 1DKAA 3OKSA 4MQPA 1G7WA 3JW9A 3PA9A 3FVXA 2W7DA 2AY3A 2BWOA 3AATA 1VP4A 4MSOA 4O6ZA 4RKDA 1CS1A 3EZSA 1AMSA 1AIAA 1MLZA 3FVSA 4OT8A 1QJ3A 1CQ8A 4IY7A 1M7YA 2JJGA 4RITA 3CQ5A 5DB5A 3FD0A 2KFPA 1BQAA 4WD2A 2EZ1A 2EH6A 2VMRA 3HVYA 3K7YA 1ASNA 4MKJA 1GC3A 4OTLA 5EIGA 1PFFA 1OHYA 4GRXA 3VOMA 2VIBA 4H51A 4F5KA 3R9AA 5HXXA 4RJYA 3BWNC 3JTXA 3KGWA 3TQXA 2AY8A 1YOOA 2D61A 4ZASA 1ELUA 3G0TA 2NMPA 1WYVB 2D66A 3LV2A 4IX8A 3NYUA 2X5DA 1TPLA 3KKIA 4JF1A 3FFRA 2V0YA 4ADCA 3E2ZB 2WB6A 5HDMA 4OC9A 1J04A 4ZM3A 1BS0A 2GMSA 3E6GA 1MGVA 1SPAA 1S07A 3RI6A 1XEYA 4RLGA 4ADDA 2YKUA 2VLFA 4IYOA 3F0HA 1LW4A 2EO5A 4PIWA 3RBFA 2DGLA 1CQ7A 1QISA 8AATA 3IF2A 4E3QA 3PDXA 4UQVA 1AJSA 4Q6RA 3AEJC 1AICA 4XJMA 1LK9A 1LC5A 1M6SA 3P6KA 1C7NA 2BI2A 4WB0B 1MLYA 3UAKA 3VK2A 1JS6A 1X29A 2W8JA 1T3IA 3BN1A 3EIAA 4AH3A 1YJSA 4A6UA 3BC8A 2VMPA 2D7YA 3MEBA 4ISYA 2BI3A 3ASBA 3JU7A 4RIZA 2ZSMA 3RQ1A 3CQ6A 1UKJA 2ZYJA 2BYJA 3FTBA 4M2JA 2CH1A 4P7YA 4XJLA 5E5IA 3E77A 5I92A 1DJ9A 3ZRQA 3BWNA 7AATA 1C9CA 3PPLA 2VMZA 3RUYA 2VMOA 4F5JA 4OBVA 1QJ5A 2OKKA 3N0LA 5DJ1A 5EFSA 4CBRA 2ZY3A 2CINA 3UWCA 5EUEA 4WYDA 3JZLA 5IWQA 4NOGA 1S08A 1LS3A 4Q76A 2CY8A 1AAWA 1VEFA 1C7GA 1S09A 1UU1A 5AX8A 2VI9A 3TFTA 1Z3ZA 2BI1A 3H7FA 1BJNA 1I41A 1KMJA 2CJGA 2WK9A 2ZUKA 4I8AA 4WXBA 1AIBA 2VIAA 4GDYA 1OATA 1IAXA 3B1CA 5EQCA 3F9TA 5M46A 3FDBA 4K2IA 3TFUA 2BKWA 2W8WA 1IAYA 2EYQA 2Z1ZA 2VGUA 4TMRA 4WYGA 2BIAA 1W3UA 2R5CA 3AEJA 5LHAA 4ZDOA 3GZCA 4ZDLA 3LWSA 1ASLA 1XI9A 4IXSA 3NTJA 2YRIA 1MDZA 2E7JA 3GETA 1AAMA 3HQTA 4M2KA 1AX4A 5KTBA 2OKJA 2PB0A 1ARHA 4ZLVA 1N31A 2O7CA 4JEZA 3W1IA 2D7ZA 1O61A 2C44A 3ACZA 2EGYA 2BYLA 4F4EA 2PB2A 3L8AA 5E4ZA 4CBSA 3AV7A 2VGWA 4TV7A 3MAFA 1JF9A 4KYOA 1KAFA 5DJ9A 3N75A 4Y0IA 3I4JA 4A6TA 1YJZA 4AZKA 1TOKA 3MKJA 3RCHB 2C0RA 1W23A 2W7IA 2Z61A 2W7LA 4F5HA 3GWPA 1B4XA 1KL2A 2Z9WA 3BCXA 4A6RA 3NU8A 1QGNA 2X3LA 1DJEA 5FT8A 4EU1A 2PO3A 2HOYA 1ELQA 1GEXA 3FZ8A 3NDNA 4JF0A 1D7RA 1OXOA 4XJOA 1N2TA 4ATQA 3FSLA 3WKRA 4E3RA 3WZFA 5BJ4A 3PDBB 3FQAA 1PG8A 4WXFA 1B5OA 5EAAA 4CVQA 3B1EA 5EUNA 2HUIA 2X8UA 1LC8A 3AEMC 2D64A 1WYUB 1S0AA 1WYTA 4W8IA 4WYFA 1ZC9A 3AEOA 5F8VA 3A9XA 4WYCA 1Z7DA 2YRRA 3N5MA 1AMAA 3AENA 3WY7A 5G09A 2JJFA 3FKDA 5FT6A 5TF5A 1ASEA 1OHWA 3DXWA 1E5EA 1EJIA 1IJIA 1U08A 2FNIA 1YNUA 3WX9A 4J8LA 3PAAA 4UHMA 1MAQA 2W7FA 4ADEA 2C7TA 2JG2A 2VMVA 3CBFA 3PIUA 4W1VA 3NYSA 1ARIA 2W7HA 3E2FA 4ADBA 1DJUA 3WKSA 4Y0DA 5G0AA 3NU7A 3ELEA 4K2MA 4Q31A 3QGUA 3LVKA 5G2PA 9AATA 4UHOA 1ASCA 4XQ2A 1RVYA 2BWPA 4OBUA 1I29A 2C81A 2VI8A 5FT4A 4F5FA 1CZCA 3HL2A 4ZDPA 2Z9XA 3FDDA 3QPGA 2VGTA 1TOGA 3ZRPA 4IXOA 4RKCA 3N4SA 3AEMA 4ZWMA 3D6KA 1X2AA 1B5PA 1AMRA 1IVRA 1ARSA 1RVUA 1UU2A 4A72A 2XBNA 3GZDC 4JEYA 4MKKA 1GC2A 4GE4A 2VMWA 3MADA 1DFOA 3VAXA 2CB1A 4XEWA 3II0A 3EI5A 5EIGB 3I16A 4AO4A 1BJOB 2YKXA 3WCNA 3ZZKA 2AY5A 1IX6A 1G7XA 2G6WA 1BJ4A 2JISA 1D7SA 2OQXA 5F9SA 4WLJA 1Y4IA 2AY4A 2W7EA 2WKAA 3T32A 4BA4A 3EI7A 3ELPA 4A0GA 4K05A 3ZZJA 4DBCA 4ATPA 1WSTA 1KMKA 1C4KA 1OXPA 2YCPA 3K28A 2BIEA 3VK4A 1ASGA 1N8PA 2HOXA 1M32A 4WXGA 1CL2A 1PMMA 2W8VA 2VMXA 2OGAA 3PD6A 1WKHA 3DRDA 3FZ6A 2DGKA 3ASAA 1AJRA 1GEYA 1ORDA 2AY1A 1AHYA 2BIGA 1BKGA 4B9BA 3EZ1A 3EI9A 3QHXA 3DYDA 2VMNA 4IYOB 1UU0A 1AKBA 3I5TA 2AY2A 2DKBA 1TOJA 2WK8A 4MQRA 3BS8A 3H14A 3E2YA 4Q75A 4W1WA 4ZSYA 3N4XA 1AJSB 1ASAA 4N0WA 1M0NA 3JWAA 3LG0A 4KXKA 3BCBA 3RBLA 3ECDA 1DGEA 4JEWA 2VMQA 1BJWA 3GZDA 2BI9A 4W91A 3AOVA 4A0HA 2Z20A 3NUIA 4MGRA 2YKYA 1M0QA 4OMAA 1ASFA 4DGTA 5JAYA 4A0FA 1CJ0A 3CAIA 2G7JA 3AELA 3DZZA 1BW0A 2VMUA 4R8DA 5DX5A 5J8QA 2FN6A 2YKVA 3B1DA 3E9KA 4M2MA 1YAAA 4RJ0A 3H9XA 4LC3A 3WGCA 5G4IA 3W1JA 4XK1A 1JG8A 3COGA 2E54A 1D2FA 1QZ9A 4R2NA 4P3MA 3MC6C 2Q7WA 2XH1A 2Z1YA 3IHJA 4CXRA 4F5LA 4F5GA 5M49A 3KE3A 4L0OA 5D5SA 2R2NA 2ZY4A 1SVVA 3ZRRA 1AMQA 2FNUA 4OCAA 3HDOA 4JEVA 3VK3A 2VGZA 5G2QA 1O4SA 2AY7A 1DGDA 2W8TA 2A1VA 4FFCA 1PMOA 3ATHA 4IW7A 4EMYA 1ECXA 1EG5A 3EI6A 2OGEA 5LH9A 3G8MA 4ZWVA 1RV3A 3AEPA 3TCMA 3L44A 1GDEA 1AHGA 2O0RA 2HUFA 2DOUA 2QBTA 2ZY5A 4LW4A 2VMYA 2D5YA 4BMKA 3FQ8A 2ZY2A 2W7KA 3VP6A 4EB5A 1WYVA 1FG3A 1YJYA 1FG7A 1GEWA 3MAFB 4ZM4A 1AY8A 2V1PA 3E2ZA 4A0RA 4R5FA 1TASA 5EAVA 4LNMA 3FQ7A 2EPJA 2VYCA 2JJEA 2Z9VA 3DC1A 1BT4A 4ZSWA 4WYAA 1JS3A 2HP2A 4MY5A 1GCKA 1V2EA 4JEXA 3MC6A 4AOAA 4W5KA 1G4VA 1AY4A 4U2HA 2QB3A 4XAUA 2VGVA 2EZ2A 1BQDA 2FYFA 3FVUA 1WKGA 1I48A 4AZJA 2ZSLA 1D7VA 3EIBA 1OHVA 3NRAA 3N7NA 3A9ZA 3MAUA 1TOEA 4EB7A 4WB0A 2VMTA 4AO9A 2W8UA 3PGYA 4E77A 4LNJA 1QIRA 3QI6A 5FT5A 4B98A 1ARTA 1DTYA 4WLHA 1BJOA 1WYTB 1O62A 2VMSA 3TATA 2FKIA 2HZPA 4WP0A 1GC0A 2WK7A 2HOZA 4BHDA 2TPLA 1V2DA 2F8JA 3AENB 2FQ6A 4ITGA 1X0MA 1H0CA 2W7JA 1W7LA 1C7OA 5HHYA 3WGBA 4JE5A 4LW2A 3QN6A 2QMAA 1ZODA 2D63A 3CQ4A 4ZAHA 1E5FA 3BCAA 4HVKA 1SFFA 1TATA 2HUUA 2AATA 4RAEA 1AHXA 3GR9A 4GE9A 1CL1A 4E1OA 2DKJA 3BV0A 1KL1A 1LC7A 1B9IA 1RV4A
chains in the Genus database with same CATH topology
3EI8A 1V72A 2YHKA 3GSBA 4LNLA 1VJOA 2HORA 4UHNA 1M0OA 4F5IA 2ZC0A 2VGSA 4F5MA 4OYTA 2CTZA 4BA5A 4GSAA 4KAMA 3QM2A 1ASBA 3USFA 2D65A 4RM1A 1IUGA 4MQQA 3DXVA 1M4NA 2W7GA 3FZ7A 1ASMA 2GQNA 3LY1A 3OP7A 1CZEA 1ZOBA 2O1BA 2DR1A 3A8UX 3FCRA 3HLMA 2OATA 4TN4A 1SF2A 3DODA 3JWBA 1W7NA 4QGRA 5E3KA 1IX8A 3LVJA 2HP1A 2GB3A 2ZP7A 4HF8A 2R5EA 2JJHA 3HMUA 2E7IA 3G7QA 1SZKA 4GEBA 4PVFA 4XJPA 4EFFA 3R4TA 3WCOA 1GD9A 1X28A 1D7UA 2CSTA 4R5ZA 4H63Q 3NYTA 5M4BA 1LKCA 1B8GA 1QITA 1ASDA 4CXQA 3PJ0A 4K2BA 2YCTA 3A9YA 2W7MA 2E7UA 2AY9A 3HBXA 1S06A 3BB8A 3B8XA 2AY6A 2BI5A 3A2BA 2QB2A 1YIZA 2CANA 1AHEA 5EUDA 4WYEA 5K8BA 3BWOA 1AY5A 1AHFA 1TARA 3W1HA 3RCHA 5M4DA 1MDOA 3N4RA 1GBNA 1IBJA 3FFHA 2FM1A 3M5UA 4A00A 2ZJGA 2CJHA 1W7MA 2Z67A 3LVLB 3NNKA 1P3WA 5BJ3A 3FRKA 3PD6B 2Z9UA 3AOWA 4N0BA 4U1TA 1AKAA 3QBOA 4BQ0A 3DU4A 5C6UA 3LVMA 2BWNA 3PDBA 4PFNA 4UOYA 3MBBA 2QLRA 3NX3A 2CH2A 1J32A 4DQ6A 1SZUA 4W1XA 1CQ6A 1WYUA 2R0TA 1GC4A 1MDXA 4Y0HA 1KKPA 2QA3A 2BHXA 3KGXA 2CJDA 3Q8NA 1LW5A 2CFBA 3K40A 3DR7A 3GJUA 1C0NA 3GBXA 4PFFA 2RFVA 2VLHA 3ISLA 4ITXA 1MAPA 1M0PA 4IXZA 2YCNA 5D95A 2R5CB 1I43A 3UE8A 3F6TA 2QSRA 3P1TA 1YIYA 3NUBA 3WLXA 1EQBA 1V2FA 3HT4A 4GE7A 1G4XA 1ARGA 2ORDA 1AKCA 2AEUA 2DGMA 2GMUA 1KKJA 3EUCA 3DR4A 1H1CA 1IX7A 1TOIA 1FC4A 2AEVA 2YOBA 5G4JA 1SZSA 4JE5D 1O69A 4FL0A 2JGTA 2GSAA 3B46A 2X5FA 4WBTA 1B9HA 4J5UA 1DKAA 3OKSA 4MQPA 1G7WA 3JW9A 3PA9A 3FVXA 2W7DA 2AY3A 2BWOA 3AATA 1VP4A 4MSOA 4O6ZA 4RKDA 1CS1A 3EZSA 1AMSA 1AIAA 1MLZA 3FVSA 4OT8A 1QJ3A 1CQ8A 4IY7A 1M7YA 2JJGA 4RITA 3CQ5A 5DB5A 3FD0A 2KFPA 1BQAA 4WD2A 2EZ1A 2EH6A 2VMRA 3HVYA 3K7YA 1ASNA 4MKJA 1GC3A 4OTLA 5EIGA 1PFFA 1OHYA 4GRXA 3VOMA 2VIBA 4H51A 4F5KA 3R9AA 5HXXA 4RJYA 3BWNC 3JTXA 3KGWA 3TQXA 2AY8A 1YOOA 2D61A 4ZASA 1ELUA 3G0TA 2NMPA 1WYVB 2D66A 3LV2A 4IX8A 3NYUA 2X5DA 1TPLA 3KKIA 4JF1A 3FFRA 2V0YA 4ADCA 3E2ZB 2WB6A 5HDMA 4OC9A 1J04A 4ZM3A 1BS0A 2GMSA 3E6GA 1MGVA 1SPAA 1S07A 3RI6A 1XEYA 4RLGA 4ADDA 2YKUA 2VLFA 4IYOA 3F0HA 1LW4A 2EO5A 4PIWA 3RBFA 2DGLA 1CQ7A 1QISA 8AATA 3IF2A 4E3QA 3PDXA 4UQVA 1AJSA 4Q6RA 3AEJC 1AICA 4XJMA 1LK9A 1LC5A 1M6SA 3P6KA 1C7NA 2BI2A 4WB0B 1MLYA 3UAKA 3VK2A 1JS6A 1X29A 2W8JA 1T3IA 3BN1A 3EIAA 4AH3A 1YJSA 4A6UA 3BC8A 2VMPA 2D7YA 3MEBA 4ISYA 2BI3A 3ASBA 3JU7A 4RIZA 2ZSMA 3RQ1A 3CQ6A 1UKJA 2ZYJA 2BYJA 3FTBA 4M2JA 2CH1A 4P7YA 4XJLA 5E5IA 3E77A 5I92A 1DJ9A 3ZRQA 3BWNA 7AATA 1C9CA 3PPLA 2VMZA 3RUYA 2VMOA 4F5JA 4OBVA 1QJ5A 2OKKA 3N0LA 5DJ1A 5EFSA 4CBRA 2ZY3A 2CINA 3UWCA 5EUEA 4WYDA 3JZLA 5IWQA 4NOGA 1S08A 1LS3A 4Q76A 2CY8A 1AAWA 1VEFA 1C7GA 1S09A 1UU1A 5AX8A 2VI9A 3TFTA 1Z3ZA 2BI1A 3H7FA 1BJNA 1I41A 1KMJA 2CJGA 2WK9A 2ZUKA 4I8AA 4WXBA 1AIBA 2VIAA 4GDYA 1OATA 1IAXA 3B1CA 5EQCA 3F9TA 5M46A 3FDBA 4K2IA 3TFUA 2BKWA 2W8WA 1IAYA 2EYQA 2Z1ZA 2VGUA 4TMRA 4WYGA 2BIAA 1W3UA 2R5CA 3AEJA 5LHAA 4ZDOA 3GZCA 4ZDLA 3LWSA 1ASLA 1XI9A 4IXSA 3NTJA 2YRIA 1MDZA 2E7JA 3GETA 1AAMA 3HQTA 4M2KA 1AX4A 5KTBA 2OKJA 2PB0A 1ARHA 4ZLVA 1N31A 2O7CA 4JEZA 3W1IA 2D7ZA 1O61A 2C44A 3ACZA 2EGYA 2BYLA 4F4EA 2PB2A 3L8AA 5E4ZA 4CBSA 3AV7A 2VGWA 4TV7A 3MAFA 1JF9A 4KYOA 5DJ9A 3N75A 4Y0IA 3I4JA 4A6TA 1YJZA 4AZKA 1TOKA 3MKJA 3RCHB 2C0RA 1W23A 2W7IA 2Z61A 2W7LA 4F5HA 3GWPA 1B4XA 1KL2A 2Z9WA 3BCXA 4A6RA 3NU8A 1QGNA 2X3LA 1DJEA 5FT8A 4EU1A 2PO3A 2HOYA 1ELQA 1GEXA 3FZ8A 3NDNA 4JF0A 1D7RA 1OXOA 4XJOA 1N2TA 4ATQA 3FSLA 3WKRA 4E3RA 3WZFA 5BJ4A 3PDBB 3FQAA 1PG8A 4WXFA 1B5OA 5EAAA 4CVQA 3B1EA 5EUNA 2HUIA 2X8UA 1LC8A 3AEMC 2D64A 1WYUB 1S0AA 1WYTA 4W8IA 4WYFA 1ZC9A 3AEOA 5F8VA 3A9XA 4WYCA 1Z7DA 2YRRA 3N5MA 1AMAA 3AENA 3WY7A 5G09A 2JJFA 3FKDA 5FT6A 5TF5A 1ASEA 1OHWA 3DXWA 1E5EA 1EJIA 1IJIA 1U08A 2FNIA 1YNUA 3WX9A 4J8LA 3PAAA 4UHMA 1MAQA 2W7FA 4ADEA 2C7TA 2JG2A 2VMVA 3CBFA 3PIUA 4W1VA 3NYSA 1ARIA 2W7HA 3E2FA 4ADBA 1DJUA 3WKSA 4Y0DA 5G0AA 3NU7A 3ELEA 4K2MA 4Q31A 3QGUA 3LVKA 5G2PA 9AATA 4UHOA 1ASCA 4XQ2A 1RVYA 2BWPA 4OBUA 1I29A 2C81A 2VI8A 5FT4A 4F5FA 1CZCA 3HL2A 4ZDPA 2Z9XA 3FDDA 3QPGA 2VGTA 1TOGA 3ZRPA 4IXOA 4RKCA 3N4SA 3AEMA 4ZWMA 3D6KA 1X2AA 1B5PA 1AMRA 1IVRA 1ARSA 1RVUA 1UU2A 4A72A 2XBNA 3GZDC 4JEYA 4MKKA 1GC2A 4GE4A 2VMWA 3MADA 1DFOA 3VAXA 2CB1A 4XEWA 3II0A 3EI5A 5EIGB 3I16A 4AO4A 1BJOB 2YKXA 3WCNA 3ZZKA 2AY5A 1IX6A 1G7XA 2G6WA 1BJ4A 2JISA 1D7SA 2OQXA 5F9SA 4WLJA 1Y4IA 2AY4A 2W7EA 2WKAA 3T32A 4BA4A 3EI7A 3ELPA 4A0GA 4K05A 3ZZJA 4DBCA 4ATPA 1WSTA 1KMKA 1C4KA 1OXPA 2YCPA 3K28A 2BIEA 3VK4A 1ASGA 1N8PA 2HOXA 1M32A 4WXGA 1CL2A 1PMMA 2W8VA 2VMXA 2OGAA 3PD6A 1WKHA 3DRDA 3FZ6A 2DGKA 3ASAA 1AJRA 1GEYA 1ORDA 2AY1A 1AHYA 2BIGA 1BKGA 4B9BA 3EZ1A 3EI9A 3QHXA 3DYDA 2VMNA 4IYOB 1UU0A 1AKBA 3I5TA 2AY2A 2DKBA 1TOJA 2WK8A 4MQRA 3BS8A 3H14A 3E2YA 4Q75A 4W1WA 4ZSYA 3N4XA 1AJSB 1ASAA 4N0WA 1M0NA 3JWAA 3LG0A 4KXKA 3BCBA 3RBLA 3ECDA 1DGEA 4JEWA 2VMQA 1BJWA 3GZDA 2BI9A 4W91A 3AOVA 4A0HA 2Z20A 3NUIA 4MGRA 2YKYA 1M0QA 4OMAA 1ASFA 4DGTA 5JAYA 4A0FA 1CJ0A 3CAIA 2G7JA 3AELA 3DZZA 1BW0A 2VMUA 4R8DA 5DX5A 5J8QA 2FN6A 2YKVA 3B1DA 3E9KA 4M2MA 1YAAA 4RJ0A 3H9XA 4LC3A 3WGCA 5G4IA 3W1JA 4XK1A 1JG8A 3COGA 2E54A 1D2FA 1QZ9A 4R2NA 4P3MA 3MC6C 2Q7WA 2XH1A 2Z1YA 3IHJA 4CXRA 4F5LA 4F5GA 5M49A 3KE3A 4L0OA 5D5SA 2R2NA 2ZY4A 1SVVA 3ZRRA 1AMQA 2FNUA 4OCAA 3HDOA 4JEVA 3VK3A 2VGZA 5G2QA 1O4SA 2AY7A 1DGDA 2W8TA 2A1VA 4FFCA 1PMOA 3ATHA 4IW7A 4EMYA 1ECXA 1EG5A 3EI6A 2OGEA 5LH9A 3G8MA 4ZWVA 1RV3A 3AEPA 3TCMA 3L44A 1GDEA 1AHGA 2O0RA 2HUFA 2DOUA 2QBTA 2ZY5A 4LW4A 2VMYA 2D5YA 4BMKA 3FQ8A 2ZY2A 2W7KA 3VP6A 4EB5A 1WYVA 1FG3A 1YJYA 1FG7A 1GEWA 3MAFB 4ZM4A 1AY8A 2V1PA 3E2ZA 4A0RA 4R5FA 1TASA 5EAVA 4LNMA 3FQ7A 2EPJA 2VYCA 2JJEA 2Z9VA 3DC1A 1BT4A 4ZSWA 4WYAA 1JS3A 2HP2A 4MY5A 1GCKA 1V2EA 4JEXA 3MC6A 4AOAA 4W5KA 1G4VA 1AY4A 4U2HA 2QB3A 4XAUA 2VGVA 2EZ2A 1BQDA 2FYFA 3FVUA 1WKGA 1I48A 4AZJA 2ZSLA 1D7VA 3EIBA 1OHVA 3NRAA 3N7NA 3A9ZA 3MAUA 1TOEA 4EB7A 4WB0A 2VMTA 4AO9A 2W8UA 3PGYA 4E77A 4LNJA 1QIRA 3QI6A 5FT5A 4B98A 1ARTA 1DTYA 4WLHA 1BJOA 1WYTB 1O62A 2VMSA 3TATA 2FKIA 2HZPA 4WP0A 1GC0A 2WK7A 2HOZA 4BHDA 2TPLA 1V2DA 2F8JA 3AENB 2FQ6A 4ITGA 1X0MA 1H0CA 2W7JA 1W7LA 1C7OA 5HHYA 3WGBA 4JE5A 4LW2A 3QN6A 2QMAA 1ZODA 2D63A 3CQ4A 4ZAHA 1E5FA 3BCAA 4HVKA 1SFFA 1TATA 2HUUA 2AATA 4RAEA 1AHXA 3GR9A 4GE9A 1CL1A 4E1OA 2DKJA 3BV0A 1KL1A 1LC7A 1B9IA 1RV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI8 A;  1V72 A;  2YHK A;  3GSB A;  4LNL A;  1VJO A;  2HOR A;  4UHN A;  1M0O A;  4F5I A;  2ZC0 A;  2VGS A;  4F5M A;  4OYT A;  2CTZ A;  4BA5 A;  4GSA A;  4KAM A;  3QM2 A;  1ASB A;  3USF A;  2D65 A;  4RM1 A;  1IUG A;  4MQQ A;  3DXV A;  1M4N A;  2W7G A;  3FZ7 A;  1ASM A;  2GQN A;  3LY1 A;  3OP7 A;  1CZE A;  1ZOB A;  2O1B A;  2DR1 A;  3A8U X;  3FCR A;  3HLM A;  2OAT A;  4TN4 A;  1SF2 A;  3DOD A;  3JWB A;  1W7N A;  4QGR A;  5E3K A;  1IX8 A;  3LVJ A;  2HP1 A;  2GB3 A;  2ZP7 A;  4HF8 A;  2R5E A;  2JJH A;  3HMU A;  2E7I A;  3G7Q A;  1SZK A;  4GEB A;  4PVF A;  4XJP A;  4EFF A;  3R4T A;  3WCO A;  1GD9 A;  1X28 A;  1D7U A;  2CST A;  4R5Z A;  3NYT A;  5M4B A;  1LKC A;  1B8G A;  1QIT A;  1ASD A;  4CXQ A;  3PJ0 A;  4K2B A;  2YCT A;  3A9Y A;  2W7M A;  2E7U A;  2AY9 A;  3HBX A;  1S06 A;  3BB8 A;  3B8X A;  2AY6 A;  2BI5 A;  3A2B A;  2QB2 A;  1YIZ A;  2CAN A;  1AHE A;  5EUD A;  4WYE A;  5K8B A;  3BWO A;  1AY5 A;  1AHF A;  1TAR A;  3W1H A;  3RCH A;  5M4D A;  1MDO A;  1GBN A;  1IBJ A;  3FFH A;  2FM1 A;  3M5U A;  4A00 A;  2ZJG A;  2CJH A;  1W7M A;  2Z67 A;  3LVL B;  3NNK A;  1P3W A;  5BJ3 A;  3FRK A;  3PD6 B;  2Z9U A;  3AOW A;  4N0B A;  4U1T A;  1AKA A;  3QBO A;  4BQ0 A;  3DU4 A;  5C6U A;  3LVM A;  2BWN A;  3PDB A;  4PFN A;  4UOY A;  3MBB A;  2QLR A;  3NX3 A;  2CH2 A;  1J32 A;  4DQ6 A;  1SZU A;  4W1X A;  1CQ6 A;  1WYU A;  2R0T A;  1GC4 A;  1MDX A;  4Y0H A;  1KKP A;  2QA3 A;  2BHX A;  3KGX A;  2CJD A;  3Q8N A;  1LW5 A;  2CFB A;  3K40 A;  3DR7 A;  3GJU A;  1C0N A;  3GBX A;  4PFF A;  2RFV A;  2VLH A;  3ISL A;  4ITX A;  1MAP A;  1M0P A;  4IXZ A;  2YCN A;  5D95 A;  2R5C B;  1I43 A;  3UE8 A;  3F6T A;  3P1T A;  1YIY A;  3NUB A;  3WLX A;  1EQB A;  1V2F A;  3HT4 A;  4GE7 A;  1G4X A;  1ARG A;  2ORD A;  1AKC A;  2AEU A;  2DGM A;  2GMU A;  1KKJ A;  3EUC A;  3DR4 A;  1H1C A;  1IX7 A;  1TOI A;  1FC4 A;  2AEV A;  2YOB A;  5G4J A;  1SZS A;  4JE5 D;  1O69 A;  4FL0 A;  2JGT A;  2GSA A;  3B46 A;  2X5F A;  4WBT A;  1B9H A;  4J5U A;  1DKA A;  3OKS A;  4MQP A;  1G7W A;  3JW9 A;  3PA9 A;  3FVX A;  2W7D A;  2AY3 A;  2BWO A;  3AAT A;  1VP4 A;  4MSO A;  4O6Z A;  4RKD A;  1CS1 A;  3EZS A;  1AMS A;  1AIA A;  1MLZ A;  3FVS A;  4OT8 A;  1QJ3 A;  1CQ8 A;  4IY7 A;  1M7Y A;  2JJG A;  4RIT A;  3CQ5 A;  5DB5 A;  3FD0 A;  1BQA A;  4WD2 A;  2EZ1 A;  2EH6 A;  2VMR A;  3HVY A;  3K7Y A;  1ASN A;  4MKJ A;  1GC3 A;  4OTL A;  5EIG A;  1PFF A;  1OHY A;  4GRX A;  3VOM A;  2VIB A;  4H51 A;  4F5K A;  3R9A A;  5HXX A;  4RJY A;  3BWN C;  3JTX A;  3KGW A;  3TQX A;  2AY8 A;  1YOO A;  2D61 A;  4ZAS A;  1ELU A;  3G0T A;  2NMP A;  1WYV B;  2D66 A;  3LV2 A;  4IX8 A;  3NYU A;  2X5D A;  1TPL A;  3KKI A;  4JF1 A;  3FFR A;  2V0Y A;  4ADC A;  3E2Z B;  5HDM A;  4OC9 A;  1J04 A;  4ZM3 A;  1BS0 A;  2GMS A;  3E6G A;  1MGV A;  1SPA A;  1S07 A;  3RI6 A;  1XEY A;  4RLG A;  4ADD A;  2YKU A;  2VLF A;  4IYO A;  3F0H A;  1LW4 A;  2EO5 A;  4PIW A;  3RBF A;  2DGL A;  1CQ7 A;  1QIS A;  8AAT A;  3IF2 A;  4E3Q A;  3PDX A;  4UQV A;  1AJS A;  4Q6R A;  3AEJ C;  1AIC A;  4XJM A;  1LK9 A;  1LC5 A;  1M6S A;  3P6K A;  1C7N A;  2BI2 A;  4WB0 B;  1MLY A;  3UAK A;  3VK2 A;  1JS6 A;  1X29 A;  2W8J A;  1T3I A;  3BN1 A;  3EIA A;  4AH3 A;  1YJS A;  4A6U A;  3BC8 A;  2VMP A;  2D7Y A;  3MEB A;  4ISY A;  2BI3 A;  3ASB A;  3JU7 A;  4RIZ A;  2ZSM A;  3RQ1 A;  3CQ6 A;  1UKJ A;  2ZYJ A;  2BYJ A;  3FTB A;  4M2J A;  2CH1 A;  4P7Y A;  4XJL A;  5E5I A;  3E77 A;  5I92 A;  1DJ9 A;  3ZRQ A;  3BWN A;  7AAT A;  1C9C A;  3PPL A;  2VMZ A;  3RUY A;  2VMO A;  4F5J A;  4OBV A;  1QJ5 A;  2OKK A;  3N0L A;  5DJ1 A;  5EFS A;  4CBR A;  2ZY3 A;  2CIN A;  3UWC A;  5EUE A;  4WYD A;  3JZL A;  5IWQ A;  4NOG A;  1S08 A;  1LS3 A;  4Q76 A;  2CY8 A;  1AAW A;  1VEF A;  1C7G A;  1S09 A;  1UU1 A;  5AX8 A;  2VI9 A;  3TFT A;  1Z3Z A;  2BI1 A;  3H7F A;  1BJN A;  1I41 A;  1KMJ A;  2CJG A;  2WK9 A;  2ZUK A;  4I8A A;  4WXB A;  1AIB A;  2VIA A;  4GDY A;  1OAT A;  1IAX A;  3B1C A;  5EQC A;  3F9T A;  5M46 A;  3FDB A;  4K2I A;  3TFU A;  2BKW A;  2W8W A;  1IAY A;  2Z1Z A;  2VGU A;  4TMR A;  4WYG A;  2BIA A;  1W3U A;  2R5C A;  3AEJ A;  5LHA A;  4ZDO A;  3GZC A;  4ZDL A;  3LWS A;  1ASL A;  1XI9 A;  4IXS A;  3NTJ A;  2YRI A;  1MDZ A;  2E7J A;  3GET A;  1AAM A;  3HQT A;  4M2K A;  1AX4 A;  2OKJ A;  2PB0 A;  1ARH A;  4ZLV A;  1N31 A;  2O7C A;  4JEZ A;  3W1I A;  2D7Z A;  1O61 A;  2C44 A;  3ACZ A;  2EGY A;  2BYL A;  4F4E A;  2PB2 A;  3L8A A;  5E4Z A;  4CBS A;  3AV7 A;  2VGW A;  4TV7 A;  3MAF A;  1JF9 A;  4KYO A;  5DJ9 A;  3N75 A;  4Y0I A;  3I4J A;  4A6T A;  1YJZ A;  4AZK A;  1TOK A;  3MKJ A;  3RCH B;  2C0R A;  1W23 A;  2W7I A;  2Z61 A;  2W7L A;  4F5H A;  3GWP A;  1B4X A;  1KL2 A;  2Z9W A;  3BCX A;  4A6R A;  3NU8 A;  1QGN A;  2X3L A;  1DJE A;  5FT8 A;  4EU1 A;  2PO3 A;  2HOY A;  1ELQ A;  1GEX A;  3FZ8 A;  3NDN A;  4JF0 A;  1D7R A;  1OXO A;  4XJO A;  1N2T A;  4ATQ A;  3FSL A;  3WKR A;  4E3R A;  3WZF A;  5BJ4 A;  3PDB B;  3FQA A;  1PG8 A;  4WXF A;  1B5O A;  5EAA A;  4CVQ A;  3B1E A;  5EUN A;  2HUI A;  2X8U A;  1LC8 A;  3AEM C;  2D64 A;  1WYU B;  1S0A A;  1WYT A;  4W8I A;  4WYF A;  1ZC9 A;  3AEO A;  5F8V A;  3A9X A;  4WYC A;  1Z7D A;  2YRR A;  3N5M A;  1AMA A;  3AEN A;  3WY7 A;  5G09 A;  2JJF A;  3FKD A;  5FT6 A;  5TF5 A;  1ASE A;  1OHW A;  3DXW A;  1E5E A;  1EJI A;  1IJI A;  1U08 A;  2FNI A;  1YNU A;  3WX9 A;  4J8L A;  3PAA A;  4UHM A;  1MAQ A;  2W7F A;  4ADE A;  2C7T A;  2JG2 A;  2VMV A;  3CBF A;  3PIU A;  4W1V A;  3NYS A;  1ARI A;  2W7H A;  3E2F A;  4ADB A;  1DJU A;  3WKS A;  4Y0D A;  5G0A A;  3NU7 A;  3ELE A;  4K2M A;  4Q31 A;  3QGU A;  3LVK A;  5G2P A;  9AAT A;  4UHO A;  1ASC A;  4XQ2 A;  1RVY A;  2BWP A;  4OBU A;  1I29 A;  2C81 A;  2VI8 A;  5FT4 A;  4F5F A;  1CZC A;  3HL2 A;  4ZDP A;  2Z9X A;  3FDD A;  3QPG A;  2VGT A;  1TOG A;  3ZRP A;  4IXO A;  4RKC A;  3AEM A;  4ZWM A;  3D6K A;  1X2A A;  1B5P A;  1AMR A;  1IVR A;  1ARS A;  1RVU A;  1UU2 A;  4A72 A;  2XBN A;  3GZD C;  4JEY A;  4MKK A;  1GC2 A;  4GE4 A;  2VMW A;  3MAD A;  1DFO A;  3VAX A;  2CB1 A;  4XEW A;  3II0 A;  3EI5 A;  5EIG B;  3I16 A;  4AO4 A;  1BJO B;  2YKX A;  3WCN A;  3ZZK A;  2AY5 A;  1IX6 A;  1G7X A;  2G6W A;  1BJ4 A;  2JIS A;  1D7S A;  2OQX A;  5F9S A;  4WLJ A;  1Y4I A;  2AY4 A;  2W7E A;  2WKA A;  3T32 A;  4BA4 A;  3EI7 A;  3ELP A;  4A0G A;  3ZZJ A;  4DBC A;  4ATP A;  1WST A;  1KMK A;  1C4K A;  1OXP A;  2YCP A;  3K28 A;  2BIE A;  3VK4 A;  1ASG A;  1N8P A;  2HOX A;  1M32 A;  4WXG A;  1CL2 A;  1PMM A;  2W8V A;  2VMX A;  2OGA A;  3PD6 A;  1WKH A;  3DRD A;  3FZ6 A;  2DGK A;  3ASA A;  1AJR A;  1GEY A;  1ORD A;  2AY1 A;  1AHY A;  2BIG A;  1BKG A;  4B9B A;  3EZ1 A;  3EI9 A;  3QHX A;  3DYD A;  2VMN A;  4IYO B;  1UU0 A;  1AKB A;  3I5T A;  2AY2 A;  2DKB A;  1TOJ A;  2WK8 A;  4MQR A;  3BS8 A;  3H14 A;  3E2Y A;  4Q75 A;  4W1W A;  4ZSY A;  1AJS B;  1ASA A;  4N0W A;  1M0N A;  3JWA A;  3LG0 A;  4KXK A;  3BCB A;  3RBL A;  3ECD A;  1DGE A;  4JEW A;  2VMQ A;  1BJW A;  3GZD A;  2BI9 A;  4W91 A;  3AOV A;  4A0H A;  2Z20 A;  3NUI A;  4MGR A;  2YKY A;  1M0Q A;  4OMA A;  1ASF A;  4DGT A;  5JAY A;  4A0F A;  1CJ0 A;  3CAI A;  3AEL A;  3DZZ A;  1BW0 A;  2VMU A;  4R8D A;  5DX5 A;  5J8Q A;  2FN6 A;  2YKV A;  3B1D A;  3E9K A;  4M2M A;  1YAA A;  4RJ0 A;  4LC3 A;  3WGC A;  5G4I A;  3W1J A;  4XK1 A;  1JG8 A;  3COG A;  2E54 A;  1D2F A;  1QZ9 A;  4R2N A;  4P3M A;  3MC6 C;  2Q7W A;  2XH1 A;  2Z1Y A;  3IHJ A;  4CXR A;  4F5L A;  4F5G A;  5M49 A;  3KE3 A;  4L0O A;  5D5S A;  2R2N A;  2ZY4 A;  1SVV A;  3ZRR A;  1AMQ A;  2FNU A;  4OCA A;  3HDO A;  4JEV A;  3VK3 A;  2VGZ A;  5G2Q A;  1O4S A;  2AY7 A;  1DGD A;  2W8T A;  4FFC A;  1PMO A;  3ATH A;  4IW7 A;  4EMY A;  1ECX A;  1EG5 A;  3EI6 A;  2OGE A;  5LH9 A;  3G8M A;  4ZWV A;  1RV3 A;  3AEP A;  3TCM A;  3L44 A;  1GDE A;  1AHG A;  2O0R A;  2HUF A;  2DOU A;  2QBT A;  2ZY5 A;  4LW4 A;  2VMY A;  2D5Y A;  4BMK A;  3FQ8 A;  2ZY2 A;  2W7K A;  3VP6 A;  4EB5 A;  1WYV A;  1FG3 A;  1YJY A;  1FG7 A;  1GEW A;  3MAF B;  4ZM4 A;  1AY8 A;  2V1P A;  3E2Z A;  4A0R A;  4R5F A;  1TAS A;  5EAV A;  4LNM A;  3FQ7 A;  2EPJ A;  2VYC A;  2JJE A;  2Z9V A;  3DC1 A;  1BT4 A;  4ZSW A;  4WYA A;  1JS3 A;  2HP2 A;  4MY5 A;  1GCK A;  1V2E A;  4JEX A;  3MC6 A;  4AOA A;  4W5K A;  1G4V A;  1AY4 A;  4U2H A;  2QB3 A;  4XAU A;  2VGV A;  2EZ2 A;  1BQD A;  2FYF A;  3FVU A;  1WKG A;  1I48 A;  4AZJ A;  2ZSL A;  1D7V A;  3EIB A;  1OHV A;  3NRA A;  3A9Z A;  3MAU A;  1TOE A;  4EB7 A;  4WB0 A;  2VMT A;  4AO9 A;  2W8U A;  3PGY A;  4E77 A;  4LNJ A;  1QIR A;  3QI6 A;  5FT5 A;  4B98 A;  1ART A;  1DTY A;  4WLH A;  1BJO A;  1WYT B;  1O62 A;  2VMS A;  3TAT A;  2HZP A;  4WP0 A;  1GC0 A;  2WK7 A;  2HOZ A;  4BHD A;  2TPL A;  1V2D A;  2F8J A;  3AEN B;  2FQ6 A;  4ITG A;  1X0M A;  1H0C A;  2W7J A;  1W7L A;  1C7O A;  5HHY A;  3WGB A;  4JE5 A;  4LW2 A;  3QN6 A;  2QMA A;  1ZOD A;  2D63 A;  3CQ4 A;  4ZAH A;  1E5F A;  3BCA A;  4HVK A;  1SFF A;  1TAT A;  2HUU A;  2AAT A;  4RAE A;  1AHX A;  3GR9 A;  4GE9 A;  1CL1 A;  4E1O A;  2DKJ A;  3BV0 A;  1KL1 A;  1LC7 A;  1B9I A;  1RV4 A; 
#chains in the Genus database with same CATH topology
 3EI8 A;  1V72 A;  2YHK A;  3GSB A;  4LNL A;  1VJO A;  2HOR A;  4UHN A;  1M0O A;  4F5I A;  2ZC0 A;  2VGS A;  4F5M A;  4OYT A;  2CTZ A;  4BA5 A;  4GSA A;  4KAM A;  3QM2 A;  1ASB A;  3USF A;  2D65 A;  4RM1 A;  1IUG A;  4MQQ A;  3DXV A;  1M4N A;  2W7G A;  3FZ7 A;  1ASM A;  2GQN A;  3LY1 A;  3OP7 A;  1CZE A;  1ZOB A;  2O1B A;  2DR1 A;  3A8U X;  3FCR A;  3HLM A;  2OAT A;  4TN4 A;  1SF2 A;  3DOD A;  3JWB A;  1W7N A;  4QGR A;  5E3K A;  1IX8 A;  3LVJ A;  2HP1 A;  2GB3 A;  2ZP7 A;  4HF8 A;  2R5E A;  2JJH A;  3HMU A;  2E7I A;  3G7Q A;  1SZK A;  4GEB A;  4PVF A;  4XJP A;  4EFF A;  3R4T A;  3WCO A;  1GD9 A;  1X28 A;  1D7U A;  2CST A;  4R5Z A;  4H63 Q;  3NYT A;  5M4B A;  1LKC A;  1B8G A;  1QIT A;  1ASD A;  4CXQ A;  3PJ0 A;  4K2B A;  2YCT A;  3A9Y A;  2W7M A;  2E7U A;  2AY9 A;  3HBX A;  1S06 A;  3BB8 A;  3B8X A;  2AY6 A;  2BI5 A;  3A2B A;  2QB2 A;  1YIZ A;  2CAN A;  1AHE A;  5EUD A;  4WYE A;  5K8B A;  3BWO A;  1AY5 A;  1AHF A;  1TAR A;  3W1H A;  3RCH A;  5M4D A;  1MDO A;  3N4R A;  1GBN A;  1IBJ A;  3FFH A;  2FM1 A;  3M5U A;  4A00 A;  2ZJG A;  2CJH A;  1W7M A;  2Z67 A;  3LVL B;  3NNK A;  1P3W A;  5BJ3 A;  3FRK A;  3PD6 B;  2Z9U A;  3AOW A;  4N0B A;  4U1T A;  1AKA A;  3QBO A;  4BQ0 A;  3DU4 A;  5C6U A;  3LVM A;  2BWN A;  3PDB A;  4PFN A;  4UOY A;  3MBB A;  2QLR A;  3NX3 A;  2CH2 A;  1J32 A;  4DQ6 A;  1SZU A;  4W1X A;  1CQ6 A;  1WYU A;  2R0T A;  1GC4 A;  1MDX A;  4Y0H A;  1KKP A;  2QA3 A;  2BHX A;  3KGX A;  2CJD A;  3Q8N A;  1LW5 A;  2CFB A;  3K40 A;  3DR7 A;  3GJU A;  1C0N A;  3GBX A;  4PFF A;  2RFV A;  2VLH A;  3ISL A;  4ITX A;  1MAP A;  1M0P A;  4IXZ A;  2YCN A;  5D95 A;  2R5C B;  1I43 A;  3UE8 A;  3F6T A;  2QSR A;  3P1T A;  1YIY A;  3NUB A;  3WLX A;  1EQB A;  1V2F A;  3HT4 A;  4GE7 A;  1G4X A;  1ARG A;  2ORD A;  1AKC A;  2AEU A;  2DGM A;  2GMU A;  1KKJ A;  3EUC A;  3DR4 A;  1H1C A;  1IX7 A;  1TOI A;  1FC4 A;  2AEV A;  2YOB A;  5G4J A;  1SZS A;  4JE5 D;  1O69 A;  4FL0 A;  2JGT A;  2GSA A;  3B46 A;  2X5F A;  4WBT A;  1B9H A;  4J5U A;  1DKA A;  3OKS A;  4MQP A;  1G7W A;  3JW9 A;  3PA9 A;  3FVX A;  2W7D A;  2AY3 A;  2BWO A;  3AAT A;  1VP4 A;  4MSO A;  4O6Z A;  4RKD A;  1CS1 A;  3EZS A;  1AMS A;  1AIA A;  1MLZ A;  3FVS A;  4OT8 A;  1QJ3 A;  1CQ8 A;  4IY7 A;  1M7Y A;  2JJG A;  4RIT A;  3CQ5 A;  5DB5 A;  3FD0 A;  2KFP A;  1BQA A;  4WD2 A;  2EZ1 A;  2EH6 A;  2VMR A;  3HVY A;  3K7Y A;  1ASN A;  4MKJ A;  1GC3 A;  4OTL A;  5EIG A;  1PFF A;  1OHY A;  4GRX A;  3VOM A;  2VIB A;  4H51 A;  4F5K A;  3R9A A;  5HXX A;  4RJY A;  3BWN C;  3JTX A;  3KGW A;  3TQX A;  2AY8 A;  1YOO A;  2D61 A;  4ZAS A;  1ELU A;  3G0T A;  2NMP A;  1WYV B;  2D66 A;  3LV2 A;  4IX8 A;  3NYU A;  2X5D A;  1TPL A;  3KKI A;  4JF1 A;  3FFR A;  2V0Y A;  4ADC A;  3E2Z B;  2WB6 A;  5HDM A;  4OC9 A;  1J04 A;  4ZM3 A;  1BS0 A;  2GMS A;  3E6G A;  1MGV A;  1SPA A;  1S07 A;  3RI6 A;  1XEY A;  4RLG A;  4ADD A;  2YKU A;  2VLF A;  4IYO A;  3F0H A;  1LW4 A;  2EO5 A;  4PIW A;  3RBF A;  2DGL A;  1CQ7 A;  1QIS A;  8AAT A;  3IF2 A;  4E3Q A;  3PDX A;  4UQV A;  1AJS A;  4Q6R A;  3AEJ C;  1AIC A;  4XJM A;  1LK9 A;  1LC5 A;  1M6S A;  3P6K A;  1C7N A;  2BI2 A;  4WB0 B;  1MLY A;  3UAK A;  3VK2 A;  1JS6 A;  1X29 A;  2W8J A;  1T3I A;  3BN1 A;  3EIA A;  4AH3 A;  1YJS A;  4A6U A;  3BC8 A;  2VMP A;  2D7Y A;  3MEB A;  4ISY A;  2BI3 A;  3ASB A;  3JU7 A;  4RIZ A;  2ZSM A;  3RQ1 A;  3CQ6 A;  1UKJ A;  2ZYJ A;  2BYJ A;  3FTB A;  4M2J A;  2CH1 A;  4P7Y A;  4XJL A;  5E5I A;  3E77 A;  5I92 A;  1DJ9 A;  3ZRQ A;  3BWN A;  7AAT A;  1C9C A;  3PPL A;  2VMZ A;  3RUY A;  2VMO A;  4F5J A;  4OBV A;  1QJ5 A;  2OKK A;  3N0L A;  5DJ1 A;  5EFS A;  4CBR A;  2ZY3 A;  2CIN A;  3UWC A;  5EUE A;  4WYD A;  3JZL A;  5IWQ A;  4NOG A;  1S08 A;  1LS3 A;  4Q76 A;  2CY8 A;  1AAW A;  1VEF A;  1C7G A;  1S09 A;  1UU1 A;  5AX8 A;  2VI9 A;  3TFT A;  1Z3Z A;  2BI1 A;  3H7F A;  1BJN A;  1I41 A;  1KMJ A;  2CJG A;  2WK9 A;  2ZUK A;  4I8A A;  4WXB A;  1AIB A;  2VIA A;  4GDY A;  1OAT A;  1IAX A;  3B1C A;  5EQC A;  3F9T A;  5M46 A;  3FDB A;  4K2I A;  3TFU A;  2BKW A;  2W8W A;  1IAY A;  2EYQ A;  2Z1Z A;  2VGU A;  4TMR A;  4WYG A;  2BIA A;  1W3U A;  2R5C A;  3AEJ A;  5LHA A;  4ZDO A;  3GZC A;  4ZDL A;  3LWS A;  1ASL A;  1XI9 A;  4IXS A;  3NTJ A;  2YRI A;  1MDZ A;  2E7J A;  3GET A;  1AAM A;  3HQT A;  4M2K A;  1AX4 A;  5KTB A;  2OKJ A;  2PB0 A;  1ARH A;  4ZLV A;  1N31 A;  2O7C A;  4JEZ A;  3W1I A;  2D7Z A;  1O61 A;  2C44 A;  3ACZ A;  2EGY A;  2BYL A;  4F4E A;  2PB2 A;  3L8A A;  5E4Z A;  4CBS A;  3AV7 A;  2VGW A;  4TV7 A;  3MAF A;  1JF9 A;  4KYO A;  1KAF A;  5DJ9 A;  3N75 A;  4Y0I A;  3I4J A;  4A6T A;  1YJZ A;  4AZK A;  1TOK A;  3MKJ A;  3RCH B;  2C0R A;  1W23 A;  2W7I A;  2Z61 A;  2W7L A;  4F5H A;  3GWP A;  1B4X A;  1KL2 A;  2Z9W A;  3BCX A;  4A6R A;  3NU8 A;  1QGN A;  2X3L A;  1DJE A;  5FT8 A;  4EU1 A;  2PO3 A;  2HOY A;  1ELQ A;  1GEX A;  3FZ8 A;  3NDN A;  4JF0 A;  1D7R A;  1OXO A;  4XJO A;  1N2T A;  4ATQ A;  3FSL A;  3WKR A;  4E3R A;  3WZF A;  5BJ4 A;  3PDB B;  3FQA A;  1PG8 A;  4WXF A;  1B5O A;  5EAA A;  4CVQ A;  3B1E A;  5EUN A;  2HUI A;  2X8U A;  1LC8 A;  3AEM C;  2D64 A;  1WYU B;  1S0A A;  1WYT A;  4W8I A;  4WYF A;  1ZC9 A;  3AEO A;  5F8V A;  3A9X A;  4WYC A;  1Z7D A;  2YRR A;  3N5M A;  1AMA A;  3AEN A;  3WY7 A;  5G09 A;  2JJF A;  3FKD A;  5FT6 A;  5TF5 A;  1ASE A;  1OHW A;  3DXW A;  1E5E A;  1EJI A;  1IJI A;  1U08 A;  2FNI A;  1YNU A;  3WX9 A;  4J8L A;  3PAA A;  4UHM A;  1MAQ A;  2W7F A;  4ADE A;  2C7T A;  2JG2 A;  2VMV A;  3CBF A;  3PIU A;  4W1V A;  3NYS A;  1ARI A;  2W7H A;  3E2F A;  4ADB A;  1DJU A;  3WKS A;  4Y0D A;  5G0A A;  3NU7 A;  3ELE A;  4K2M A;  4Q31 A;  3QGU A;  3LVK A;  5G2P A;  9AAT A;  4UHO A;  1ASC A;  4XQ2 A;  1RVY A;  2BWP A;  4OBU A;  1I29 A;  2C81 A;  2VI8 A;  5FT4 A;  4F5F A;  1CZC A;  3HL2 A;  4ZDP A;  2Z9X A;  3FDD A;  3QPG A;  2VGT A;  1TOG A;  3ZRP A;  4IXO A;  4RKC A;  3N4S A;  3AEM A;  4ZWM A;  3D6K A;  1X2A A;  1B5P A;  1AMR A;  1IVR A;  1ARS A;  1RVU A;  1UU2 A;  4A72 A;  2XBN A;  3GZD C;  4JEY A;  4MKK A;  1GC2 A;  4GE4 A;  2VMW A;  3MAD A;  1DFO A;  3VAX A;  2CB1 A;  4XEW A;  3II0 A;  3EI5 A;  5EIG B;  3I16 A;  4AO4 A;  1BJO B;  2YKX A;  3WCN A;  3ZZK A;  2AY5 A;  1IX6 A;  1G7X A;  2G6W A;  1BJ4 A;  2JIS A;  1D7S A;  2OQX A;  5F9S A;  4WLJ A;  1Y4I A;  2AY4 A;  2W7E A;  2WKA A;  3T32 A;  4BA4 A;  3EI7 A;  3ELP A;  4A0G A;  4K05 A;  3ZZJ A;  4DBC A;  4ATP A;  1WST A;  1KMK A;  1C4K A;  1OXP A;  2YCP A;  3K28 A;  2BIE A;  3VK4 A;  1ASG A;  1N8P A;  2HOX A;  1M32 A;  4WXG A;  1CL2 A;  1PMM A;  2W8V A;  2VMX A;  2OGA A;  3PD6 A;  1WKH A;  3DRD A;  3FZ6 A;  2DGK A;  3ASA A;  1AJR A;  1GEY A;  1ORD A;  2AY1 A;  1AHY A;  2BIG A;  1BKG A;  4B9B A;  3EZ1 A;  3EI9 A;  3QHX A;  3DYD A;  2VMN A;  4IYO B;  1UU0 A;  1AKB A;  3I5T A;  2AY2 A;  2DKB A;  1TOJ A;  2WK8 A;  4MQR A;  3BS8 A;  3H14 A;  3E2Y A;  4Q75 A;  4W1W A;  4ZSY A;  3N4X A;  1AJS B;  1ASA A;  4N0W A;  1M0N A;  3JWA A;  3LG0 A;  4KXK A;  3BCB A;  3RBL A;  3ECD A;  1DGE A;  4JEW A;  2VMQ A;  1BJW A;  3GZD A;  2BI9 A;  4W91 A;  3AOV A;  4A0H A;  2Z20 A;  3NUI A;  4MGR A;  2YKY A;  1M0Q A;  4OMA A;  1ASF A;  4DGT A;  5JAY A;  4A0F A;  1CJ0 A;  3CAI A;  2G7J A;  3AEL A;  3DZZ A;  1BW0 A;  2VMU A;  4R8D A;  5DX5 A;  5J8Q A;  2FN6 A;  2YKV A;  3B1D A;  3E9K A;  4M2M A;  1YAA A;  4RJ0 A;  3H9X A;  4LC3 A;  3WGC A;  5G4I A;  3W1J A;  4XK1 A;  1JG8 A;  3COG A;  2E54 A;  1D2F A;  1QZ9 A;  4R2N A;  4P3M A;  3MC6 C;  2Q7W A;  2XH1 A;  2Z1Y A;  3IHJ A;  4CXR A;  4F5L A;  4F5G A;  5M49 A;  3KE3 A;  4L0O A;  5D5S A;  2R2N A;  2ZY4 A;  1SVV A;  3ZRR A;  1AMQ A;  2FNU A;  4OCA A;  3HDO A;  4JEV A;  3VK3 A;  2VGZ A;  5G2Q A;  1O4S A;  2AY7 A;  1DGD A;  2W8T A;  2A1V A;  4FFC A;  1PMO A;  3ATH A;  4IW7 A;  4EMY A;  1ECX A;  1EG5 A;  3EI6 A;  2OGE A;  5LH9 A;  3G8M A;  4ZWV A;  1RV3 A;  3AEP A;  3TCM A;  3L44 A;  1GDE A;  1AHG A;  2O0R A;  2HUF A;  2DOU A;  2QBT A;  2ZY5 A;  4LW4 A;  2VMY A;  2D5Y A;  4BMK A;  3FQ8 A;  2ZY2 A;  2W7K A;  3VP6 A;  4EB5 A;  1WYV A;  1FG3 A;  1YJY A;  1FG7 A;  1GEW A;  3MAF B;  4ZM4 A;  1AY8 A;  2V1P A;  3E2Z A;  4A0R A;  4R5F A;  1TAS A;  5EAV A;  4LNM A;  3FQ7 A;  2EPJ A;  2VYC A;  2JJE A;  2Z9V A;  3DC1 A;  1BT4 A;  4ZSW A;  4WYA A;  1JS3 A;  2HP2 A;  4MY5 A;  1GCK A;  1V2E A;  4JEX A;  3MC6 A;  4AOA A;  4W5K A;  1G4V A;  1AY4 A;  4U2H A;  2QB3 A;  4XAU A;  2VGV A;  2EZ2 A;  1BQD A;  2FYF A;  3FVU A;  1WKG A;  1I48 A;  4AZJ A;  2ZSL A;  1D7V A;  3EIB A;  1OHV A;  3NRA A;  3N7N A;  3A9Z A;  3MAU A;  1TOE A;  4EB7 A;  4WB0 A;  2VMT A;  4AO9 A;  2W8U A;  3PGY A;  4E77 A;  4LNJ A;  1QIR A;  3QI6 A;  5FT5 A;  4B98 A;  1ART A;  1DTY A;  4WLH A;  1BJO A;  1WYT B;  1O62 A;  2VMS A;  3TAT A;  2FKI A;  2HZP A;  4WP0 A;  1GC0 A;  2WK7 A;  2HOZ A;  4BHD A;  2TPL A;  1V2D A;  2F8J A;  3AEN B;  2FQ6 A;  4ITG A;  1X0M A;  1H0C A;  2W7J A;  1W7L A;  1C7O A;  5HHY A;  3WGB A;  4JE5 A;  4LW2 A;  3QN6 A;  2QMA A;  1ZOD A;  2D63 A;  3CQ4 A;  4ZAH A;  1E5F A;  3BCA A;  4HVK A;  1SFF A;  1TAT A;  2HUU A;  2AAT A;  4RAE A;  1AHX A;  3GR9 A;  4GE9 A;  1CL1 A;  4E1O A;  2DKJ A;  3BV0 A;  1KL1 A;  1LC7 A;  1B9I A;  1RV4 A; 
#chains in the Genus database with same CATH homology
 3EI8 A;  1V72 A;  2YHK A;  3GSB A;  4LNL A;  1VJO A;  2HOR A;  4UHN A;  1M0O A;  4F5I A;  2ZC0 A;  2VGS A;  4F5M A;  4OYT A;  2CTZ A;  4BA5 A;  4GSA A;  4KAM A;  3QM2 A;  1ASB A;  3USF A;  2D65 A;  4RM1 A;  1IUG A;  4MQQ A;  3DXV A;  1M4N A;  2W7G A;  3FZ7 A;  1ASM A;  2GQN A;  3LY1 A;  3OP7 A;  1CZE A;  1ZOB A;  2O1B A;  2DR1 A;  3A8U X;  3FCR A;  3HLM A;  2OAT A;  4TN4 A;  1SF2 A;  3DOD A;  3JWB A;  1W7N A;  4QGR A;  5E3K A;  1IX8 A;  3LVJ A;  2HP1 A;  2GB3 A;  2ZP7 A;  4HF8 A;  2R5E A;  2JJH A;  3HMU A;  2E7I A;  3G7Q A;  1SZK A;  4GEB A;  4PVF A;  4XJP A;  4EFF A;  3R4T A;  3WCO A;  1GD9 A;  1X28 A;  1D7U A;  2CST A;  4R5Z A;  4H63 Q;  3NYT A;  5M4B A;  1LKC A;  1B8G A;  1QIT A;  1ASD A;  4CXQ A;  3PJ0 A;  4K2B A;  2YCT A;  3A9Y A;  2W7M A;  2E7U A;  2AY9 A;  3HBX A;  1S06 A;  3BB8 A;  3B8X A;  2AY6 A;  2BI5 A;  3A2B A;  2QB2 A;  1YIZ A;  2CAN A;  1AHE A;  5EUD A;  4WYE A;  5K8B A;  3BWO A;  1AY5 A;  1AHF A;  1TAR A;  3W1H A;  3RCH A;  5M4D A;  1MDO A;  3N4R A;  1GBN A;  1IBJ A;  3FFH A;  2FM1 A;  3M5U A;  4A00 A;  2ZJG A;  2CJH A;  1W7M A;  2Z67 A;  3LVL B;  3NNK A;  1P3W A;  5BJ3 A;  3FRK A;  3PD6 B;  2Z9U A;  3AOW A;  4N0B A;  4U1T A;  1AKA A;  3QBO A;  4BQ0 A;  3DU4 A;  5C6U A;  3LVM A;  2BWN A;  3PDB A;  4PFN A;  4UOY A;  3MBB A;  2QLR A;  3NX3 A;  2CH2 A;  1J32 A;  4DQ6 A;  1SZU A;  4W1X A;  1CQ6 A;  1WYU A;  2R0T A;  1GC4 A;  1MDX A;  4Y0H A;  1KKP A;  2QA3 A;  2BHX A;  3KGX A;  2CJD A;  3Q8N A;  1LW5 A;  2CFB A;  3K40 A;  3DR7 A;  3GJU A;  1C0N A;  3GBX A;  4PFF A;  2RFV A;  2VLH A;  3ISL A;  4ITX A;  1MAP A;  1M0P A;  4IXZ A;  2YCN A;  5D95 A;  2R5C B;  1I43 A;  3UE8 A;  3F6T A;  2QSR A;  3P1T A;  1YIY A;  3NUB A;  3WLX A;  1EQB A;  1V2F A;  3HT4 A;  4GE7 A;  1G4X A;  1ARG A;  2ORD A;  1AKC A;  2AEU A;  2DGM A;  2GMU A;  1KKJ A;  3EUC A;  3DR4 A;  1H1C A;  1IX7 A;  1TOI A;  1FC4 A;  2AEV A;  2YOB A;  5G4J A;  1SZS A;  4JE5 D;  1O69 A;  4FL0 A;  2JGT A;  2GSA A;  3B46 A;  2X5F A;  4WBT A;  1B9H A;  4J5U A;  1DKA A;  3OKS A;  4MQP A;  1G7W A;  3JW9 A;  3PA9 A;  3FVX A;  2W7D A;  2AY3 A;  2BWO A;  3AAT A;  1VP4 A;  4MSO A;  4O6Z A;  4RKD A;  1CS1 A;  3EZS A;  1AMS A;  1AIA A;  1MLZ A;  3FVS A;  4OT8 A;  1QJ3 A;  1CQ8 A;  4IY7 A;  1M7Y A;  2JJG A;  4RIT A;  3CQ5 A;  5DB5 A;  3FD0 A;  2KFP A;  1BQA A;  4WD2 A;  2EZ1 A;  2EH6 A;  2VMR A;  3HVY A;  3K7Y A;  1ASN A;  4MKJ A;  1GC3 A;  4OTL A;  5EIG A;  1PFF A;  1OHY A;  4GRX A;  3VOM A;  2VIB A;  4H51 A;  4F5K A;  3R9A A;  5HXX A;  4RJY A;  3BWN C;  3JTX A;  3KGW A;  3TQX A;  2AY8 A;  1YOO A;  2D61 A;  4ZAS A;  1ELU A;  3G0T A;  2NMP A;  1WYV B;  2D66 A;  3LV2 A;  4IX8 A;  3NYU A;  2X5D A;  1TPL A;  3KKI A;  4JF1 A;  3FFR A;  2V0Y A;  4ADC A;  3E2Z B;  2WB6 A;  5HDM A;  4OC9 A;  1J04 A;  4ZM3 A;  1BS0 A;  2GMS A;  3E6G A;  1MGV A;  1SPA A;  1S07 A;  3RI6 A;  1XEY A;  4RLG A;  4ADD A;  2YKU A;  2VLF A;  4IYO A;  3F0H A;  1LW4 A;  2EO5 A;  4PIW A;  3RBF A;  2DGL A;  1CQ7 A;  1QIS A;  8AAT A;  3IF2 A;  4E3Q A;  3PDX A;  4UQV A;  1AJS A;  4Q6R A;  3AEJ C;  1AIC A;  4XJM A;  1LK9 A;  1LC5 A;  1M6S A;  3P6K A;  1C7N A;  2BI2 A;  4WB0 B;  1MLY A;  3UAK A;  3VK2 A;  1JS6 A;  1X29 A;  2W8J A;  1T3I A;  3BN1 A;  3EIA A;  4AH3 A;  1YJS A;  4A6U A;  3BC8 A;  2VMP A;  2D7Y A;  3MEB A;  4ISY A;  2BI3 A;  3ASB A;  3JU7 A;  4RIZ A;  2ZSM A;  3RQ1 A;  3CQ6 A;  1UKJ A;  2ZYJ A;  2BYJ A;  3FTB A;  4M2J A;  2CH1 A;  4P7Y A;  4XJL A;  5E5I A;  3E77 A;  5I92 A;  1DJ9 A;  3ZRQ A;  3BWN A;  7AAT A;  1C9C A;  3PPL A;  2VMZ A;  3RUY A;  2VMO A;  4F5J A;  4OBV A;  1QJ5 A;  2OKK A;  3N0L A;  5DJ1 A;  5EFS A;  4CBR A;  2ZY3 A;  2CIN A;  3UWC A;  5EUE A;  4WYD A;  3JZL A;  5IWQ A;  4NOG A;  1S08 A;  1LS3 A;  4Q76 A;  2CY8 A;  1AAW A;  1VEF A;  1C7G A;  1S09 A;  1UU1 A;  5AX8 A;  2VI9 A;  3TFT A;  1Z3Z A;  2BI1 A;  3H7F A;  1BJN A;  1I41 A;  1KMJ A;  2CJG A;  2WK9 A;  2ZUK A;  4I8A A;  4WXB A;  1AIB A;  2VIA A;  4GDY A;  1OAT A;  1IAX A;  3B1C A;  5EQC A;  3F9T A;  5M46 A;  3FDB A;  4K2I A;  3TFU A;  2BKW A;  2W8W A;  1IAY A;  2EYQ A;  2Z1Z A;  2VGU A;  4TMR A;  4WYG A;  2BIA A;  1W3U A;  2R5C A;  3AEJ A;  5LHA A;  4ZDO A;  3GZC A;  4ZDL A;  3LWS A;  1ASL A;  1XI9 A;  4IXS A;  3NTJ A;  2YRI A;  1MDZ A;  2E7J A;  3GET A;  1AAM A;  3HQT A;  4M2K A;  1AX4 A;  5KTB A;  2OKJ A;  2PB0 A;  1ARH A;  4ZLV A;  1N31 A;  2O7C A;  4JEZ A;  3W1I A;  2D7Z A;  1O61 A;  2C44 A;  3ACZ A;  2EGY A;  2BYL A;  4F4E A;  2PB2 A;  3L8A A;  5E4Z A;  4CBS A;  3AV7 A;  2VGW A;  4TV7 A;  3MAF A;  1JF9 A;  4KYO A;  5DJ9 A;  3N75 A;  4Y0I A;  3I4J A;  4A6T A;  1YJZ A;  4AZK A;  1TOK A;  3MKJ A;  3RCH B;  2C0R A;  1W23 A;  2W7I A;  2Z61 A;  2W7L A;  4F5H A;  3GWP A;  1B4X A;  1KL2 A;  2Z9W A;  3BCX A;  4A6R A;  3NU8 A;  1QGN A;  2X3L A;  1DJE A;  5FT8 A;  4EU1 A;  2PO3 A;  2HOY A;  1ELQ A;  1GEX A;  3FZ8 A;  3NDN A;  4JF0 A;  1D7R A;  1OXO A;  4XJO A;  1N2T A;  4ATQ A;  3FSL A;  3WKR A;  4E3R A;  3WZF A;  5BJ4 A;  3PDB B;  3FQA A;  1PG8 A;  4WXF A;  1B5O A;  5EAA A;  4CVQ A;  3B1E A;  5EUN A;  2HUI A;  2X8U A;  1LC8 A;  3AEM C;  2D64 A;  1WYU B;  1S0A A;  1WYT A;  4W8I A;  4WYF A;  1ZC9 A;  3AEO A;  5F8V A;  3A9X A;  4WYC A;  1Z7D A;  2YRR A;  3N5M A;  1AMA A;  3AEN A;  3WY7 A;  5G09 A;  2JJF A;  3FKD A;  5FT6 A;  5TF5 A;  1ASE A;  1OHW A;  3DXW A;  1E5E A;  1EJI A;  1IJI A;  1U08 A;  2FNI A;  1YNU A;  3WX9 A;  4J8L A;  3PAA A;  4UHM A;  1MAQ A;  2W7F A;  4ADE A;  2C7T A;  2JG2 A;  2VMV A;  3CBF A;  3PIU A;  4W1V A;  3NYS A;  1ARI A;  2W7H A;  3E2F A;  4ADB A;  1DJU A;  3WKS A;  4Y0D A;  5G0A A;  3NU7 A;  3ELE A;  4K2M A;  4Q31 A;  3QGU A;  3LVK A;  5G2P A;  9AAT A;  4UHO A;  1ASC A;  4XQ2 A;  1RVY A;  2BWP A;  4OBU A;  1I29 A;  2C81 A;  2VI8 A;  5FT4 A;  4F5F A;  1CZC A;  3HL2 A;  4ZDP A;  2Z9X A;  3FDD A;  3QPG A;  2VGT A;  1TOG A;  3ZRP A;  4IXO A;  4RKC A;  3N4S A;  3AEM A;  4ZWM A;  3D6K A;  1X2A A;  1B5P A;  1AMR A;  1IVR A;  1ARS A;  1RVU A;  1UU2 A;  4A72 A;  2XBN A;  3GZD C;  4JEY A;  4MKK A;  1GC2 A;  4GE4 A;  2VMW A;  3MAD A;  1DFO A;  3VAX A;  2CB1 A;  4XEW A;  3II0 A;  3EI5 A;  5EIG B;  3I16 A;  4AO4 A;  1BJO B;  2YKX A;  3WCN A;  3ZZK A;  2AY5 A;  1IX6 A;  1G7X A;  2G6W A;  1BJ4 A;  2JIS A;  1D7S A;  2OQX A;  5F9S A;  4WLJ A;  1Y4I A;  2AY4 A;  2W7E A;  2WKA A;  3T32 A;  4BA4 A;  3EI7 A;  3ELP A;  4A0G A;  4K05 A;  3ZZJ A;  4DBC A;  4ATP A;  1WST A;  1KMK A;  1C4K A;  1OXP A;  2YCP A;  3K28 A;  2BIE A;  3VK4 A;  1ASG A;  1N8P A;  2HOX A;  1M32 A;  4WXG A;  1CL2 A;  1PMM A;  2W8V A;  2VMX A;  2OGA A;  3PD6 A;  1WKH A;  3DRD A;  3FZ6 A;  2DGK A;  3ASA A;  1AJR A;  1GEY A;  1ORD A;  2AY1 A;  1AHY A;  2BIG A;  1BKG A;  4B9B A;  3EZ1 A;  3EI9 A;  3QHX A;  3DYD A;  2VMN A;  4IYO B;  1UU0 A;  1AKB A;  3I5T A;  2AY2 A;  2DKB A;  1TOJ A;  2WK8 A;  4MQR A;  3BS8 A;  3H14 A;  3E2Y A;  4Q75 A;  4W1W A;  4ZSY A;  3N4X A;  1AJS B;  1ASA A;  4N0W A;  1M0N A;  3JWA A;  3LG0 A;  4KXK A;  3BCB A;  3RBL A;  3ECD A;  1DGE A;  4JEW A;  2VMQ A;  1BJW A;  3GZD A;  2BI9 A;  4W91 A;  3AOV A;  4A0H A;  2Z20 A;  3NUI A;  4MGR A;  2YKY A;  1M0Q A;  4OMA A;  1ASF A;  4DGT A;  5JAY A;  4A0F A;  1CJ0 A;  3CAI A;  2G7J A;  3AEL A;  3DZZ A;  1BW0 A;  2VMU A;  4R8D A;  5DX5 A;  5J8Q A;  2FN6 A;  2YKV A;  3B1D A;  3E9K A;  4M2M A;  1YAA A;  4RJ0 A;  3H9X A;  4LC3 A;  3WGC A;  5G4I A;  3W1J A;  4XK1 A;  1JG8 A;  3COG A;  2E54 A;  1D2F A;  1QZ9 A;  4R2N A;  4P3M A;  3MC6 C;  2Q7W A;  2XH1 A;  2Z1Y A;  3IHJ A;  4CXR A;  4F5L A;  4F5G A;  5M49 A;  3KE3 A;  4L0O A;  5D5S A;  2R2N A;  2ZY4 A;  1SVV A;  3ZRR A;  1AMQ A;  2FNU A;  4OCA A;  3HDO A;  4JEV A;  3VK3 A;  2VGZ A;  5G2Q A;  1O4S A;  2AY7 A;  1DGD A;  2W8T A;  2A1V A;  4FFC A;  1PMO A;  3ATH A;  4IW7 A;  4EMY A;  1ECX A;  1EG5 A;  3EI6 A;  2OGE A;  5LH9 A;  3G8M A;  4ZWV A;  1RV3 A;  3AEP A;  3TCM A;  3L44 A;  1GDE A;  1AHG A;  2O0R A;  2HUF A;  2DOU A;  2QBT A;  2ZY5 A;  4LW4 A;  2VMY A;  2D5Y A;  4BMK A;  3FQ8 A;  2ZY2 A;  2W7K A;  3VP6 A;  4EB5 A;  1WYV A;  1FG3 A;  1YJY A;  1FG7 A;  1GEW A;  3MAF B;  4ZM4 A;  1AY8 A;  2V1P A;  3E2Z A;  4A0R A;  4R5F A;  1TAS A;  5EAV A;  4LNM A;  3FQ7 A;  2EPJ A;  2VYC A;  2JJE A;  2Z9V A;  3DC1 A;  1BT4 A;  4ZSW A;  4WYA A;  1JS3 A;  2HP2 A;  4MY5 A;  1GCK A;  1V2E A;  4JEX A;  3MC6 A;  4AOA A;  4W5K A;  1G4V A;  1AY4 A;  4U2H A;  2QB3 A;  4XAU A;  2VGV A;  2EZ2 A;  1BQD A;  2FYF A;  3FVU A;  1WKG A;  1I48 A;  4AZJ A;  2ZSL A;  1D7V A;  3EIB A;  1OHV A;  3NRA A;  3N7N A;  3A9Z A;  3MAU A;  1TOE A;  4EB7 A;  4WB0 A;  2VMT A;  4AO9 A;  2W8U A;  3PGY A;  4E77 A;  4LNJ A;  1QIR A;  3QI6 A;  5FT5 A;  4B98 A;  1ART A;  1DTY A;  4WLH A;  1BJO A;  1WYT B;  1O62 A;  2VMS A;  3TAT A;  2FKI A;  2HZP A;  4WP0 A;  1GC0 A;  2WK7 A;  2HOZ A;  4BHD A;  2TPL A;  1V2D A;  2F8J A;  3AEN B;  2FQ6 A;  4ITG A;  1X0M A;  1H0C A;  2W7J A;  1W7L A;  1C7O A;  5HHY A;  3WGB A;  4JE5 A;  4LW2 A;  3QN6 A;  2QMA A;  1ZOD A;  2D63 A;  3CQ4 A;  4ZAH A;  1E5F A;  3BCA A;  4HVK A;  1SFF A;  1TAT A;  2HUU A;  2AAT A;  4RAE A;  1AHX A;  3GR9 A;  4GE9 A;  1CL1 A;  4E1O A;  2DKJ A;  3BV0 A;  1KL1 A;  1LC7 A;  1B9I A;  1RV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...