5FT8A

Crystal structure of the complex between the cysteine desulfurase csda and the sulfur-acceptor csde in the persulfurated state at 2.50 angstroem resolution
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
401
structure length
400
Chain Sequence
MNVFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATQQFYSLSAGNVHRSQFAEAQRLTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLEAMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHAQPLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTEINE DESULFURASE CSDA
publication title Mechanism of Sulfur Transfer Across Protein-Protein Interfaces: The Cysteine Desulfurase Model System
doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 136
structure length 400
sequence length 401
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature ec 2.8.1.7: Cysteine desulfurase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5ft8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5ft8A01
1X2AA 1X28A 3AOVA 1ASFA 4GE9A 3ELEA 2X8UA 1T3IA 4OBVA 1AJRA 1W23A 3E77A 2QLRA 2W7HA 4ATQA 1MLYA 2VMTA 1BQDA 4GRXA 3P1TA 3RI6A 2Z9UA 3KE3A 2CFBA 4QGRA 1WYVA 2CH2A 3AV7A 3AENB 5C6UA 2X3LA 2F8JA 1C0NA 4EU1A 1DTYA 3A9ZA 1IX6A 4RM1A 1D7UA 2AY1A 4Y0HA 4BMKA 4EFFA 4JF1A 2W7IA 1SZUA 3I5TA 4HVKA 1DGDA 1V2FA 2PB0A 3CBFA 3KGWA 3GWPA 1OHVA 4R5ZA 1GC0A 4XJLA 2YHKA 2E7JA 2X5DA 1EQBA 2ZSLA 3IF2A 1ASGA 3VAXA 1LS3A 2DGMA 3WX9A 4KAMA 2CY8A 3W1IA 3II0A 4AOAA 3FZ7A 3NUIA 1I48A 4K2MA 3FQ8A 2GB3A 3JWAA 4ZDPA 3PA9A 1J32A 2W8VA 1KKPA 3MAUA 3AENA 3AEJC 1GC2A 4IXZA 4F5MA 4Q76A 1UU2A 1BT4A 2BKWA 1TOGA 4P3MA 4BQ0A 1ZC9A 1AIAA 1CZCA 1LK9A 3BWNA 2E54A 3QM2A 1Z3ZA 4WYDA 3NYUA 1EJIA 1DFOA 4OT8A 1AJSB 1SVVA 3BN1A 3NYTA 5EIGB 1TARA 2GQNA 2EZ2A 2VLFA 1X0MA 1LC5A 3ATHA 2CJHA 3BV0A 2CJGA 1CL1A 2AY8A 1S0AA 3Q8NA 1KMKA 1OHWA 3PIUA 1O62A 4GSAA 1S08A 4GE4A 4IXSA 4ATPA 1ASDA 3K7YA 1B8GA 3GZCA 4Y0IA 1S06A 2JG2A 2VMPA 1M0PA 4R5FA 4ZSYA 2D66A 2FNUA 5DJ9A 4RJYA 3NNKA 2VMYA 2PO3A 4N0BA 4W1WA 3BCXA 2JISA 3R4TA 4JF0A 4AO4A 1AAMA 1CJ0A 1ARGA 5G4JA 4ZM3A 3EZ1A 1AJSA 5EQCA 3L8AA 2Z1YA 5EIGA 1YNUA 1O61A 5FT5A 4E3QA 4HF8A 4RJ0A 2ZYJA 2PB2A 2D65A 4MQQA 3VK4A 4L0OA 2VGUA 1OXPA 3PPLA 3LWSA 3RQ1A 3EUCA 1BJ4A 2BWPA 4LC3A 1M0QA 1N2TA 1WYUB 3NX3A 1JS6A 4IXOA 4A00A 1TOKA 4GEBA 1GC4A 1RVUA 3A8UX 1MLZA 2QMAA 2Z9VA 2ZJGA 2W7EA 4ADBA 4DQ6A 1YAAA 1M32A 4IY7A 4K2BA 4F5GA 2FN6A 1J04A 3IHJA 3CQ4A 4JEZA 4XEWA 3TCMA 1D7VA 3H7FA 5BJ4A 1ASMA 4PVFA 1PMMA 1IBJA 8AATA 1G4XA 3ACZA 3WGCA 2VI9A 4ZAHA 2AEUA 2YKVA 1IJIA 3ASBA 2ZSMA 3FVSA 3LG0A 3ELPA 1B9HA 3LV2A 4OYTA 5M49A 1ASBA 2W7FA 4Q31A 1G4VA 3WKSA 1D7RA 2C0RA 3FCRA 1WYUA 4MKJA 5I92A 2EZ1A 3DXVA 4ZDLA 2TPLA 5JAYA 2HUIA 2GMSA 2JJEA 2VI8A 1DGEA 3N0LA 1YIZA 4B9BA 2YRIA 4WYEA 2VMSA 3WCOA 3E2YA 1VEFA 1B5OA 2E7IA 2JJGA 4A6TA 1CL2A 2VGWA 4J8LA 2AY5A 2BI2A 3LVLB 3HMUA 1LC7A 4U2HA 2YKXA 2Q7WA 3W1JA 3B1DA 3BWOA 1FG3A 4OCAA 1QZ9A 2VGTA 2HOZA 3MEBA 4MY5A 1ELUA 4RKCA 4BA5A 3HT4A 1H1CA 5HXXA 1MDOA 4P7YA 3FSLA 5DJ1A 4XJOA 3FVXA 1GEYA 4I8AA 4M2JA 4WYCA 2EH6A 4MSOA 3RBFA 3ZZKA 1M4NA 2Z61A 3RBLA 4AZJA 3NU7A 1MAPA 2JGTA 2CB1A 3N5MA 4PIWA 4ZSWA 2HP2A 5G09A 2YCPA 2DKBA 3DR4A 3JW9A 4A0GA 4F4EA 2YKUA 2Z67A 1MDXA 2D61A 3HLMA 2V1PA 5HDMA 2CJDA 3BWNC 1AHXA 2CH1A 1AKCA 3GR9A 1WKGA 2DKJA 4F5HA 2FM1A 4WYFA 3NUBA 4XK1A 3TFUA 1GDEA 1W7LA 4E77A 1I29A 1N8PA 3MAFB 2HUUA 1AY8A 1OATA 5BJ3A 4R2NA 2HORA 5EAAA 3EI6A 4CVQA 1AMRA 1TATA 3VK2A 3GJUA 4XAUA 3EI8A 3FTBA 3G7QA 3HBXA 5F8VA 3A9YA 1RVYA 1D2FA 5IWQA 4H51A 4F5KA 5E5IA 1W7NA 1GEXA 4A0FA 3UE8A 1AKBA 2D5YA 1IX8A 2VIAA 2WKAA 2O7CA 4U1TA 1TASA 3PDBB 2VMWA 3HVYA 1PFFA 1LC8A 2DGLA 2HZPA 4W91A 2R5CB 3EI9A 3WY7A 1XI9A 3MADA 2BI3A 1WSTA 3GSBA 3MAFA 2C7TA 4RIZA 4ZM4A 5K8BA 1ORDA 2VMOA 2W7JA 5M4BA 1SF2A 4AH3A 5M46A 3F0HA 2W7MA 4BA4A 1YJYA 3LY1A 5EUEA 2O0RA 1IX7A 4W5KA 3NU8A 1WKHA 2E7UA 1ASNA 3PDBA 1CS1A 1M0NA 1V2EA 1IVRA 1TOJA 4ISYA 3AEMA 2R5CA 1AAWA 1CQ8A 1CQ6A 2VGZA 1UKJA 3LVKA 3NDNA 3TFTA 3MC6A 4R8DA 3WCNA 2D64A 2C44A 3JZLA 1AIBA 3QBOA 3NRAA 2VLHA 2YCTA 4F5LA 1B4XA 5AX8A 3I4JA 4Q75A 1KL2A 2OATA 3CQ6A 1X29A 4M2MA 5FT6A 2VMRA 1SFFA 1QGNA 1SZSA 3DU4A 1ARTA 1IAXA 3AELA 3DODA 1ASEA 2VGVA 1P3WA 2ZY5A 2EGYA 4LNLA 3JWBA 4RKDA 3M5UA 2W8JA 3PDXA 1S09A 4DGTA 1G7XA 2X5FA 2ZY3A 3KKIA 2AY7A 3VK3A 3HQTA 3B1CA 4RLGA 2AEVA 1G7WA 4UHOA 4DBCA 4W1VA 3ASAA 5E4ZA 3COGA 3EIAA 4RITA 1EG5A 2CTZA 4TMRA 4IW7A 1M0OA 5M4DA 3WGBA 3RUYA 2JJHA 3FD0A 1W3UA 2R2NA 4LNMA 1JF9A 2BI1A 4WBTA 3NTJA 1Z7DA 1AHYA 2AATA 3TATA 2OQXA 3HL2A 3MKJA 4ITXA 1PG8A 1DKAA 1GD9A 5HHYA 1S07A 4FL0A 2VIBA 3G0TA 3WLXA 2ZY4A 2V0YA 1QJ3A 4LNJA 4XJPA 5EFSA 4CBRA 1BJOB 2Z20A 2W7LA 1AMSA 1DJ9A 3AATA 2Z9XA 1ZODA 2BWOA 1PMOA 4EB5A 5G2QA 4UOYA 2HP1A 1BS0A 4MGRA 2EO5A 3PGYA 3QHXA 1KL1A 3BB8A 2QB3A 2OKKA 5EUDA 2BHXA 2W7DA 2ZC0A 4OBUA 4WYAA 1GC3A 2AY4A 3EI7A 2BI9A 3FKDA 2Z9WA 3OKSA 3FDBA 3ZRPA 2GSAA 3L44A 3CQ5A 1QISA 2D7ZA 3E9KA 3B1EA 4ITGA 4ZLVA 2BIGA 3DYDA 3EI5A 1I41A 3FZ8A 1UU1A 2HOYA 5D5SA 5J8QA 4A72A 1BJOA 2BI5A 1C9CA 3PJ0A 1AX4A 4NOGA 4WB0B 1AHFA 1VJOA 2R5EA 2HUFA 1AMQA 3VOMA 2EPJA 2OKJA 2W8WA 3B46A 4CBSA 1V72A 1CQ7A 3JU7A 1ELQA 1KMJA 4XJMA 2VMQA 3I16A 2YKYA 1GCKA 1MAQA 3TQXA 1V2DA 3B8XA 3QGUA 2AY6A 1ARHA 1YJSA 4WXGA 5FT8A 3GZDA 1E5EA 3LVMA 3A9XA 2VYCA 3DR7A 1ARIA 4JEYA 4JE5D 3ZRRA 3ZRQA 4CXQA 3FDDA 1ASAA 1SPAA 3A2BA 1AKAA 5DB5A 3HDOA 4PFFA 1TOIA 4WP0A 2WK8A 4N0WA 2ZP7A 2DGKA 1ARSA 4MQPA 4WB0A 3W1HA 4A6RA 2HOXA 4EMYA 3FVUA 1M6SA 5EUNA 4EB7A 3LVJA 4O6ZA 3DC1A 3GETA 1WYTB 1BJWA 2FYFA 3AEMC 2JJFA 3FFRA 3P6KA 1ASCA 4BHDA 1GBNA 1D7SA 5G0AA 5FT4A 1ECXA 3MC6C 4ZDOA 4UQVA 1QJ5A 2OGAA 4LW4A 3WKRA 2VMNA 3ISLA 4MKKA 2VMUA 1OXOA 1TPLA 3E6GA 4WD2A 2VMVA 1E5FA 1B5PA 2BIAA 1C4KA 1KKJA 2ZY2A 2YRRA 1UU0A 3PAAA 3ECDA 1BKGA 1N31A 2BYJA 3FFHA 1MGVA 4M2KA 2OGEA 4ZASA 5TF5A 1WYTA 2D7YA 1YOOA 3QI6A 4F5FA 4ADDA 1CZEA 3NYSA 1C7OA 1AHGA 4GE7A 4F5IA 1O69A 2NMPA 5G4IA 1ZOBA 3E2ZB 4JEWA 3GBXA 4JE5A 4OTLA 4Q6RA 1QIRA 1W7MA 2W7KA 4UHNA 4WXFA 2R0TA 3F6TA 3AEOA 2BYLA 3DRDA 3F9TA 1AMAA 5G2PA 1DJUA 4TN4A 2VGSA 4AZKA 4MQRA 2GMUA 2VMZA 3KGXA 5EAVA 4AO9A 2QA3A 1B9IA 1AICA 2XBNA 3VP6A 4IYOB 1H0CA 4OMAA 3K40A 4WYGA 2AY2A 1AY4A 3BS8A 4JEVA 3BC8A 3CAIA 2O1BA 3OP7A 2ZUKA 2G6WA 4WLJA 3ZZJA 1RV3A 4TV7A 9AATA 1BW0A 4W8IA 2QBTA 1C7NA 1I43A 2ORDA 3E2FA 3E2ZA 1LW4A 5LHAA 4A0RA 3QN6A 3PD6B 3BCBA 4W1XA 2CANA 3FQAA 1DJEA 3FQ7A 2RFVA 4KYOA 4PFNA 4WLHA 3WZFA 1JS3A 1O4SA 3AEJA 3N75A 1XEYA 2W8TA 2C81A 3DXWA 4LW2A 2YOBA 1YJZA 2FNIA 4IYOA 1SZKA 3UWCA 4CXRA 2WK9A 2Z1ZA 4F5JA 3RCHB 3FZ6A 1BJNA 4XQ2A 1AY5A 2BIEA 3AEPA 1ASLA 5DX5A 3K28A 1AHEA 3DZZA 4FFCA 4GDYA 1JG8A 4B98A 3PD6A 4JEXA 3D6KA 4UHMA 7AATA 2WK7A 1BQAA 4ADCA 1FC4A 1QITA 4ZWMA 2DOUA 4A6UA 1YIYA 3GZDC 3USFA 1LKCA 2AY9A 5D95A 5F9SA 2AY3A 2YCNA 4J5UA 2BWNA 5E3KA 4ADEA 3UAKA 4ZWVA 2CSTA 1LW5A 2W7GA 3RCHA 4A0HA 3EIBA 1GEWA 3H14A 2XH1A 3BCAA 1TOEA 3R9AA 3T32A 3G8MA 2CINA 2DR1A 1IAYA 2FQ6A 2QB2A 1M7YA 3JTXA 5LH9A 3MBBA 4E3RA 4K2IA 4OC9A 2W8UA 3AOWA 4RAEA 4E1OA 4KXKA 1RV4A 1FG7A 1WYVB 3EZSA 1VP4A 2VMXA 1Y4IA 2D63A 3FRKA 4WXBA 4Y0DA 1IUGA 1C7GA 1MDZA 1U08A 3QPGA 4IX8A 1OHYA
chains in the Genus database with same CATH superfamily
1X2AA 1X28A 3AOVA 1ASFA 4GE9A 3ELEA 2X8UA 1T3IA 4OBVA 1AJRA 1W23A 3E77A 2QLRA 2W7HA 4ATQA 1MLYA 2VMTA 1BQDA 4GRXA 3P1TA 3RI6A 2Z9UA 3KE3A 2CFBA 4QGRA 1WYVA 2CH2A 3AV7A 3AENB 5C6UA 2X3LA 2F8JA 1C0NA 4EU1A 1DTYA 3A9ZA 1IX6A 4RM1A 1D7UA 2AY1A 4Y0HA 4BMKA 4EFFA 4JF1A 2W7IA 1SZUA 3I5TA 4HVKA 1DGDA 1V2FA 2PB0A 3CBFA 3KGWA 3GWPA 1OHVA 4R5ZA 1GC0A 4XJLA 2YHKA 2E7JA 2X5DA 1EQBA 2ZSLA 3IF2A 1ASGA 3VAXA 1LS3A 2DGMA 3WX9A 4KAMA 2CY8A 3W1IA 3II0A 4AOAA 3FZ7A 3NUIA 1I48A 4K2MA 3FQ8A 2GB3A 3JWAA 4ZDPA 3PA9A 1J32A 2W8VA 1KKPA 3MAUA 3AENA 3AEJC 1GC2A 4IXZA 4F5MA 2FKIA 4Q76A 1UU2A 1BT4A 2BKWA 1TOGA 4P3MA 4BQ0A 1ZC9A 1AIAA 1CZCA 1LK9A 3BWNA 2E54A 3QM2A 1Z3ZA 4WYDA 3NYUA 1EJIA 1DFOA 4OT8A 1AJSB 1SVVA 3BN1A 3NYTA 5EIGB 1TARA 2GQNA 2EZ2A 2VLFA 1X0MA 1LC5A 3ATHA 2CJHA 3BV0A 2CJGA 1CL1A 2AY8A 1S0AA 3Q8NA 1KMKA 1OHWA 3PIUA 1O62A 4GSAA 1S08A 4GE4A 4IXSA 4ATPA 1ASDA 3K7YA 1B8GA 3GZCA 4Y0IA 1S06A 2JG2A 2VMPA 1M0PA 4R5FA 4ZSYA 2D66A 2FNUA 5DJ9A 4RJYA 3NNKA 2VMYA 2PO3A 4N0BA 4W1WA 3BCXA 2JISA 3R4TA 4JF0A 4AO4A 1AAMA 1CJ0A 1ARGA 5G4JA 4ZM3A 3EZ1A 1AJSA 5EQCA 3L8AA 2Z1YA 5EIGA 1YNUA 1O61A 5FT5A 4E3QA 4HF8A 4RJ0A 2ZYJA 2PB2A 2D65A 4MQQA 3VK4A 4L0OA 2VGUA 1OXPA 3PPLA 3LWSA 3RQ1A 3EUCA 1BJ4A 2BWPA 4LC3A 1M0QA 1N2TA 1WYUB 3NX3A 1JS6A 4IXOA 4A00A 1TOKA 4GEBA 1GC4A 1RVUA 3A8UX 1MLZA 2QMAA 2Z9VA 2ZJGA 2W7EA 4ADBA 4DQ6A 1YAAA 1M32A 4IY7A 4K2BA 4F5GA 2FN6A 1J04A 3IHJA 3CQ4A 4JEZA 4XEWA 3TCMA 1D7VA 3H7FA 5BJ4A 1ASMA 4PVFA 1PMMA 1IBJA 8AATA 1G4XA 3ACZA 3WGCA 2VI9A 4ZAHA 2AEUA 2YKVA 1IJIA 3ASBA 2ZSMA 3FVSA 3LG0A 3ELPA 1B9HA 3LV2A 4OYTA 5M49A 1ASBA 2W7FA 4Q31A 1G4VA 3WKSA 1D7RA 2C0RA 3FCRA 1WYUA 4MKJA 5I92A 2EZ1A 3DXVA 4ZDLA 2TPLA 5JAYA 2KFPA 2HUIA 2GMSA 2JJEA 2VI8A 1DGEA 3N0LA 1YIZA 4B9BA 2YRIA 4WYEA 2VMSA 3WCOA 3E2YA 1VEFA 1B5OA 2E7IA 2JJGA 4A6TA 1CL2A 2VGWA 4J8LA 2AY5A 1KAFA 2BI2A 3LVLB 3HMUA 1LC7A 4U2HA 2YKXA 2Q7WA 3W1JA 2EYQA 3B1DA 3BWOA 1FG3A 4OCAA 4H63Q 1QZ9A 2VGTA 2HOZA 3MEBA 4MY5A 1ELUA 4RKCA 4BA5A 3HT4A 1H1CA 5HXXA 1MDOA 4P7YA 3FSLA 5DJ1A 4XJOA 3FVXA 1GEYA 4I8AA 4M2JA 4WYCA 2EH6A 4MSOA 3RBFA 3ZZKA 1M4NA 2Z61A 3RBLA 4AZJA 3NU7A 1MAPA 2JGTA 2CB1A 3N5MA 4PIWA 4ZSWA 2HP2A 5G09A 2YCPA 2DKBA 3DR4A 3JW9A 4A0GA 4F4EA 2YKUA 2Z67A 1MDXA 2D61A 3HLMA 2V1PA 5HDMA 2CJDA 3BWNC 1AHXA 2CH1A 1AKCA 3GR9A 1WKGA 2DKJA 4F5HA 2FM1A 4WYFA 3NUBA 4XK1A 3TFUA 1GDEA 1W7LA 4E77A 1I29A 1N8PA 3MAFB 2HUUA 1AY8A 1OATA 5BJ3A 4R2NA 2HORA 5EAAA 3EI6A 4CVQA 1AMRA 1TATA 3VK2A 3GJUA 4XAUA 3EI8A 3FTBA 3G7QA 3HBXA 2QSRA 5F8VA 3A9YA 1RVYA 1D2FA 5IWQA 4H51A 4F5KA 5E5IA 1W7NA 1GEXA 4A0FA 5KTBA 3UE8A 1AKBA 2D5YA 1IX8A 2VIAA 2WKAA 2O7CA 4U1TA 1TASA 3PDBB 2VMWA 3HVYA 1PFFA 1LC8A 2DGLA 2HZPA 4W91A 2R5CB 3EI9A 3WY7A 1XI9A 3MADA 2BI3A 1WSTA 3GSBA 3MAFA 2C7TA 4RIZA 4ZM4A 5K8BA 1ORDA 2VMOA 2W7JA 5M4BA 1SF2A 4AH3A 5M46A 3F0HA 2G7JA 2W7MA 4BA4A 1YJYA 3LY1A 5EUEA 2O0RA 1IX7A 4W5KA 3NU8A 1WKHA 2E7UA 1ASNA 3PDBA 1CS1A 1M0NA 1V2EA 1IVRA 1TOJA 4ISYA 3AEMA 2R5CA 1AAWA 1CQ8A 1CQ6A 2VGZA 1UKJA 3LVKA 3NDNA 3TFTA 3MC6A 4R8DA 3WCNA 2D64A 2A1VA 4K05A 2C44A 3JZLA 1AIBA 3QBOA 3NRAA 2VLHA 2YCTA 4F5LA 1B4XA 5AX8A 3I4JA 4Q75A 1KL2A 2OATA 3CQ6A 1X29A 4M2MA 5FT6A 2VMRA 1SFFA 1QGNA 1SZSA 3DU4A 1ARTA 1IAXA 3AELA 3DODA 1ASEA 2VGVA 1P3WA 2ZY5A 2EGYA 4LNLA 3JWBA 4RKDA 3M5UA 2W8JA 3PDXA 1S09A 4DGTA 1G7XA 2X5FA 2ZY3A 3KKIA 2AY7A 3VK3A 3HQTA 3B1CA 4RLGA 2AEVA 1G7WA 4UHOA 4DBCA 4W1VA 3ASAA 5E4ZA 3COGA 3EIAA 4RITA 1EG5A 2CTZA 4TMRA 4IW7A 1M0OA 5M4DA 3WGBA 3RUYA 2JJHA 3FD0A 1W3UA 2R2NA 4LNMA 1JF9A 2BI1A 4WBTA 3NTJA 1Z7DA 1AHYA 2AATA 3TATA 2OQXA 3HL2A 3MKJA 4ITXA 1PG8A 1DKAA 1GD9A 5HHYA 1S07A 4FL0A 2VIBA 3G0TA 3WLXA 2ZY4A 2V0YA 1QJ3A 4LNJA 4XJPA 5EFSA 4CBRA 1BJOB 2Z20A 2W7LA 1AMSA 1DJ9A 3N7NA 3AATA 2Z9XA 1ZODA 2BWOA 1PMOA 4EB5A 5G2QA 4UOYA 2HP1A 1BS0A 4MGRA 2EO5A 3PGYA 3QHXA 1KL1A 3BB8A 2QB3A 2OKKA 5EUDA 2BHXA 2W7DA 2ZC0A 4OBUA 4WYAA 1GC3A 2AY4A 3EI7A 2BI9A 3FKDA 2Z9WA 3OKSA 3FDBA 3ZRPA 2GSAA 3L44A 3CQ5A 1QISA 2D7ZA 3E9KA 3B1EA 4ITGA 4ZLVA 2BIGA 3DYDA 3EI5A 1I41A 3FZ8A 1UU1A 2HOYA 5D5SA 5J8QA 4A72A 1BJOA 2BI5A 1C9CA 3PJ0A 1AX4A 4NOGA 4WB0B 1AHFA 1VJOA 2R5EA 2HUFA 1AMQA 3VOMA 2EPJA 2OKJA 2W8WA 3B46A 4CBSA 1V72A 1CQ7A 3JU7A 1ELQA 1KMJA 4XJMA 2VMQA 3I16A 2YKYA 1GCKA 1MAQA 3TQXA 1V2DA 3B8XA 3QGUA 2AY6A 1ARHA 1YJSA 4WXGA 5FT8A 3GZDA 1E5EA 3LVMA 3A9XA 2VYCA 3DR7A 1ARIA 4JEYA 4JE5D 3ZRRA 3ZRQA 4CXQA 3FDDA 1ASAA 1SPAA 3A2BA 1AKAA 5DB5A 3HDOA 4PFFA 1TOIA 4WP0A 2WK8A 4N0WA 2ZP7A 2DGKA 3N4SA 1ARSA 4MQPA 4WB0A 3W1HA 4A6RA 2HOXA 4EMYA 3FVUA 1M6SA 5EUNA 4EB7A 3LVJA 4O6ZA 3DC1A 3GETA 1WYTB 1BJWA 2FYFA 3AEMC 2JJFA 3FFRA 3P6KA 1ASCA 4BHDA 1GBNA 1D7SA 5G0AA 5FT4A 1ECXA 3MC6C 4ZDOA 4UQVA 1QJ5A 2OGAA 4LW4A 3WKRA 2VMNA 3ISLA 4MKKA 2VMUA 1OXOA 1TPLA 3E6GA 4WD2A 2VMVA 1E5FA 1B5PA 2BIAA 1C4KA 1KKJA 2ZY2A 2YRRA 1UU0A 3PAAA 3ECDA 1BKGA 1N31A 2BYJA 3FFHA 1MGVA 4M2KA 2OGEA 4ZASA 5TF5A 1WYTA 2D7YA 1YOOA 3QI6A 4F5FA 4ADDA 1CZEA 3NYSA 1C7OA 1AHGA 4GE7A 4F5IA 1O69A 2NMPA 5G4IA 1ZOBA 3E2ZB 4JEWA 3GBXA 4JE5A 4OTLA 4Q6RA 1QIRA 1W7MA 2W7KA 4UHNA 4WXFA 2R0TA 3F6TA 3AEOA 2BYLA 3DRDA 3F9TA 1AMAA 5G2PA 1DJUA 4TN4A 2VGSA 4AZKA 4MQRA 2GMUA 2VMZA 3KGXA 5EAVA 4AO9A 2QA3A 1B9IA 1AICA 2XBNA 3VP6A 4IYOB 1H0CA 4OMAA 3K40A 4WYGA 2AY2A 1AY4A 3BS8A 4JEVA 3BC8A 3CAIA 2O1BA 3OP7A 2ZUKA 2G6WA 4WLJA 3ZZJA 1RV3A 4TV7A 9AATA 1BW0A 4W8IA 2QBTA 1C7NA 1I43A 2ORDA 3E2FA 3E2ZA 1LW4A 5LHAA 4A0RA 3QN6A 3PD6B 3BCBA 4W1XA 2CANA 3FQAA 1DJEA 3FQ7A 2RFVA 4KYOA 4PFNA 4WLHA 3WZFA 3N4XA 1JS3A 1O4SA 3AEJA 3N75A 1XEYA 2W8TA 2C81A 3DXWA 4LW2A 2YOBA 1YJZA 2FNIA 4IYOA 1SZKA 3UWCA 4CXRA 2WK9A 2Z1ZA 4F5JA 3RCHB 3FZ6A 1BJNA 4XQ2A 1AY5A 2BIEA 3AEPA 1ASLA 5DX5A 3K28A 1AHEA 3DZZA 4FFCA 4GDYA 1JG8A 4B98A 3PD6A 4JEXA 3D6KA 4UHMA 7AATA 3H9XA 2WK7A 3N4RA 1BQAA 4ADCA 1FC4A 1QITA 4ZWMA 2DOUA 4A6UA 1YIYA 3GZDC 3USFA 1LKCA 2AY9A 5D95A 5F9SA 2AY3A 2YCNA 4J5UA 2BWNA 5E3KA 4ADEA 3UAKA 4ZWVA 2CSTA 1LW5A 2W7GA 3RCHA 4A0HA 3EIBA 1GEWA 3H14A 2XH1A 3BCAA 1TOEA 3R9AA 3T32A 3G8MA 2CINA 2DR1A 1IAYA 2FQ6A 2QB2A 1M7YA 3JTXA 5LH9A 3MBBA 2WB6A 4E3RA 4K2IA 4OC9A 2W8UA 3AOWA 4RAEA 4E1OA 4KXKA 1RV4A 1FG7A 1WYVB 3EZSA 1VP4A 2VMXA 1Y4IA 2D63A 3FRKA 4WXBA 4Y0DA 1IUGA 1C7GA 1MDZA 1U08A 3QPGA 4IX8A 1OHYA
chains in the Genus database with same CATH topology
1X2AA 1X28A 3AOVA 1ASFA 4GE9A 3ELEA 2X8UA 1T3IA 4OBVA 1AJRA 1W23A 3E77A 2QLRA 2W7HA 4ATQA 1MLYA 2VMTA 1BQDA 4GRXA 3P1TA 3RI6A 2Z9UA 3KE3A 2CFBA 4QGRA 1WYVA 2CH2A 3AV7A 3AENB 5C6UA 2X3LA 2F8JA 1C0NA 4EU1A 1DTYA 3A9ZA 1IX6A 4RM1A 1D7UA 2AY1A 4Y0HA 4BMKA 4EFFA 4JF1A 2W7IA 1SZUA 3I5TA 4HVKA 1DGDA 1V2FA 2PB0A 3CBFA 3KGWA 3GWPA 1OHVA 4R5ZA 1GC0A 4XJLA 2YHKA 2E7JA 2X5DA 1EQBA 2ZSLA 3IF2A 1ASGA 3VAXA 1LS3A 2DGMA 3WX9A 4KAMA 2CY8A 3W1IA 3II0A 4AOAA 3FZ7A 3NUIA 1I48A 4K2MA 3FQ8A 2GB3A 3JWAA 4ZDPA 3PA9A 1J32A 2W8VA 1KKPA 3MAUA 3AENA 3AEJC 1GC2A 4IXZA 4F5MA 2FKIA 4Q76A 1UU2A 1BT4A 2BKWA 1TOGA 4P3MA 4BQ0A 1ZC9A 1AIAA 1CZCA 1LK9A 3BWNA 2E54A 3QM2A 1Z3ZA 4WYDA 3NYUA 1EJIA 1DFOA 4OT8A 1AJSB 1SVVA 3BN1A 3NYTA 5EIGB 1TARA 2GQNA 2EZ2A 2VLFA 1X0MA 1LC5A 3ATHA 2CJHA 3BV0A 2CJGA 1CL1A 2AY8A 1S0AA 3Q8NA 1KMKA 1OHWA 3PIUA 1O62A 4GSAA 1S08A 4GE4A 4IXSA 4ATPA 1ASDA 3K7YA 1B8GA 3GZCA 4Y0IA 1S06A 2JG2A 2VMPA 1M0PA 4R5FA 4ZSYA 2D66A 2FNUA 5DJ9A 4RJYA 3NNKA 2VMYA 2PO3A 4N0BA 4W1WA 3BCXA 2JISA 3R4TA 4JF0A 4AO4A 1AAMA 1CJ0A 1ARGA 5G4JA 4ZM3A 3EZ1A 1AJSA 5EQCA 3L8AA 2Z1YA 5EIGA 1YNUA 1O61A 5FT5A 4E3QA 4HF8A 4RJ0A 2ZYJA 2PB2A 2D65A 4MQQA 3VK4A 4L0OA 2VGUA 1OXPA 3PPLA 3LWSA 3RQ1A 3EUCA 1BJ4A 2BWPA 4LC3A 1M0QA 1N2TA 1WYUB 3NX3A 1JS6A 4IXOA 4A00A 1TOKA 4GEBA 1GC4A 1RVUA 3A8UX 1MLZA 2QMAA 2Z9VA 2ZJGA 2W7EA 4ADBA 4DQ6A 1YAAA 1M32A 4IY7A 4K2BA 4F5GA 2FN6A 1J04A 3IHJA 3CQ4A 4JEZA 4XEWA 3TCMA 1D7VA 3H7FA 5BJ4A 1ASMA 4PVFA 1PMMA 1IBJA 8AATA 1G4XA 3ACZA 3WGCA 2VI9A 4ZAHA 2AEUA 2YKVA 1IJIA 3ASBA 2ZSMA 3FVSA 3LG0A 3ELPA 1B9HA 3LV2A 4OYTA 5M49A 1ASBA 2W7FA 4Q31A 1G4VA 3WKSA 1D7RA 2C0RA 3FCRA 1WYUA 4MKJA 5I92A 2EZ1A 3DXVA 4ZDLA 2TPLA 5JAYA 2KFPA 2HUIA 2GMSA 2JJEA 2VI8A 1DGEA 3N0LA 1YIZA 4B9BA 2YRIA 4WYEA 2VMSA 3WCOA 3E2YA 1VEFA 1B5OA 2E7IA 2JJGA 4A6TA 1CL2A 2VGWA 4J8LA 2AY5A 2BI2A 3LVLB 3HMUA 1LC7A 4U2HA 2YKXA 2Q7WA 3W1JA 2EYQA 3B1DA 3BWOA 1FG3A 4OCAA 4H63Q 1QZ9A 2VGTA 2HOZA 3MEBA 4MY5A 1ELUA 4RKCA 4BA5A 3HT4A 1H1CA 5HXXA 1MDOA 4P7YA 3FSLA 5DJ1A 4XJOA 3FVXA 1GEYA 4I8AA 4M2JA 4WYCA 2EH6A 4MSOA 3RBFA 3ZZKA 1M4NA 2Z61A 3RBLA 4AZJA 3NU7A 1MAPA 2JGTA 2CB1A 3N5MA 4PIWA 4ZSWA 2HP2A 5G09A 2YCPA 2DKBA 3DR4A 3JW9A 4A0GA 4F4EA 2YKUA 2Z67A 1MDXA 2D61A 3HLMA 2V1PA 5HDMA 2CJDA 3BWNC 1AHXA 2CH1A 1AKCA 3GR9A 1WKGA 2DKJA 4F5HA 2FM1A 4WYFA 3NUBA 4XK1A 3TFUA 1GDEA 1W7LA 4E77A 1I29A 1N8PA 3MAFB 2HUUA 1AY8A 1OATA 5BJ3A 4R2NA 2HORA 5EAAA 3EI6A 4CVQA 1AMRA 1TATA 3VK2A 3GJUA 4XAUA 3EI8A 3FTBA 3G7QA 3HBXA 2QSRA 5F8VA 3A9YA 1RVYA 1D2FA 5IWQA 4H51A 4F5KA 5E5IA 1W7NA 1GEXA 4A0FA 5KTBA 3UE8A 1AKBA 2D5YA 1IX8A 2VIAA 2WKAA 2O7CA 4U1TA 1TASA 3PDBB 2VMWA 3HVYA 1PFFA 1LC8A 2DGLA 2HZPA 4W91A 2R5CB 3EI9A 3WY7A 1XI9A 3MADA 2BI3A 1WSTA 3GSBA 3MAFA 2C7TA 4RIZA 4ZM4A 5K8BA 1ORDA 2VMOA 2W7JA 5M4BA 1SF2A 4AH3A 5M46A 3F0HA 2G7JA 2W7MA 4BA4A 1YJYA 3LY1A 5EUEA 2O0RA 1IX7A 4W5KA 3NU8A 1WKHA 2E7UA 1ASNA 3PDBA 1CS1A 1M0NA 1V2EA 1IVRA 1TOJA 4ISYA 3AEMA 2R5CA 1AAWA 1CQ8A 1CQ6A 2VGZA 1UKJA 3LVKA 3NDNA 3TFTA 3MC6A 4R8DA 3WCNA 2D64A 2A1VA 4K05A 2C44A 3JZLA 1AIBA 3QBOA 3NRAA 2VLHA 2YCTA 4F5LA 1B4XA 5AX8A 3I4JA 4Q75A 1KL2A 2OATA 3CQ6A 1X29A 4M2MA 5FT6A 2VMRA 1SFFA 1QGNA 1SZSA 3DU4A 1ARTA 1IAXA 3AELA 3DODA 1ASEA 2VGVA 1P3WA 2ZY5A 2EGYA 4LNLA 3JWBA 4RKDA 3M5UA 2W8JA 3PDXA 1S09A 4DGTA 1G7XA 2X5FA 2ZY3A 3KKIA 2AY7A 3VK3A 3HQTA 3B1CA 4RLGA 2AEVA 1G7WA 4UHOA 4DBCA 4W1VA 3ASAA 5E4ZA 3COGA 3EIAA 4RITA 1EG5A 2CTZA 4TMRA 4IW7A 1M0OA 5M4DA 3WGBA 3RUYA 2JJHA 3FD0A 1W3UA 2R2NA 4LNMA 1JF9A 2BI1A 4WBTA 3NTJA 1Z7DA 1AHYA 2AATA 3TATA 2OQXA 3HL2A 3MKJA 4ITXA 1PG8A 1DKAA 1GD9A 5HHYA 1S07A 4FL0A 2VIBA 3G0TA 3WLXA 2ZY4A 2V0YA 1QJ3A 4LNJA 4XJPA 5EFSA 4CBRA 1BJOB 2Z20A 2W7LA 1AMSA 1DJ9A 3N7NA 3AATA 2Z9XA 1ZODA 2BWOA 1PMOA 4EB5A 5G2QA 4UOYA 2HP1A 1BS0A 4MGRA 2EO5A 3PGYA 3QHXA 1KL1A 3BB8A 2QB3A 2OKKA 5EUDA 2BHXA 2W7DA 2ZC0A 4OBUA 4WYAA 1GC3A 2AY4A 3EI7A 2BI9A 3FKDA 2Z9WA 3OKSA 3FDBA 3ZRPA 2GSAA 3L44A 3CQ5A 1QISA 2D7ZA 3E9KA 3B1EA 4ITGA 4ZLVA 2BIGA 3DYDA 3EI5A 1I41A 3FZ8A 1UU1A 2HOYA 5D5SA 5J8QA 4A72A 1BJOA 2BI5A 1C9CA 3PJ0A 1AX4A 4NOGA 4WB0B 1AHFA 1VJOA 2R5EA 2HUFA 1AMQA 3VOMA 2EPJA 2OKJA 2W8WA 3B46A 4CBSA 1V72A 1CQ7A 3JU7A 1ELQA 1KMJA 4XJMA 2VMQA 3I16A 2YKYA 1GCKA 1MAQA 3TQXA 1V2DA 3B8XA 3QGUA 2AY6A 1ARHA 1YJSA 4WXGA 5FT8A 3GZDA 1E5EA 3LVMA 3A9XA 2VYCA 3DR7A 1ARIA 4JEYA 4JE5D 3ZRRA 3ZRQA 4CXQA 3FDDA 1ASAA 1SPAA 3A2BA 1AKAA 5DB5A 3HDOA 4PFFA 1TOIA 4WP0A 2WK8A 4N0WA 2ZP7A 2DGKA 3N4SA 1ARSA 4MQPA 4WB0A 3W1HA 4A6RA 2HOXA 4EMYA 3FVUA 1M6SA 5EUNA 4EB7A 3LVJA 4O6ZA 3DC1A 3GETA 1WYTB 1BJWA 2FYFA 3AEMC 2JJFA 3FFRA 3P6KA 1ASCA 4BHDA 1GBNA 1D7SA 5G0AA 5FT4A 1ECXA 3MC6C 4ZDOA 4UQVA 1QJ5A 2OGAA 4LW4A 3WKRA 2VMNA 3ISLA 4MKKA 2VMUA 1OXOA 1TPLA 3E6GA 4WD2A 2VMVA 1E5FA 1B5PA 2BIAA 1C4KA 1KKJA 2ZY2A 2YRRA 1UU0A 3PAAA 3ECDA 1BKGA 1N31A 2BYJA 3FFHA 1MGVA 4M2KA 2OGEA 4ZASA 5TF5A 1WYTA 2D7YA 1YOOA 3QI6A 4F5FA 4ADDA 1CZEA 3NYSA 1C7OA 1AHGA 4GE7A 4F5IA 1O69A 2NMPA 5G4IA 1ZOBA 3E2ZB 4JEWA 3GBXA 4JE5A 4OTLA 4Q6RA 1QIRA 1W7MA 2W7KA 4UHNA 4WXFA 2R0TA 3F6TA 3AEOA 2BYLA 3DRDA 3F9TA 1AMAA 5G2PA 1DJUA 4TN4A 2VGSA 4AZKA 4MQRA 2GMUA 2VMZA 3KGXA 5EAVA 4AO9A 2QA3A 1B9IA 1AICA 2XBNA 3VP6A 4IYOB 1H0CA 4OMAA 3K40A 4WYGA 2AY2A 1AY4A 3BS8A 4JEVA 3BC8A 3CAIA 2O1BA 3OP7A 2ZUKA 2G6WA 4WLJA 3ZZJA 1RV3A 4TV7A 9AATA 1BW0A 4W8IA 2QBTA 1C7NA 1I43A 2ORDA 3E2FA 3E2ZA 1LW4A 5LHAA 4A0RA 3QN6A 3PD6B 3BCBA 4W1XA 2CANA 3FQAA 1DJEA 3FQ7A 2RFVA 4KYOA 4PFNA 4WLHA 3WZFA 3N4XA 1JS3A 1O4SA 3AEJA 3N75A 1XEYA 2W8TA 2C81A 3DXWA 4LW2A 2YOBA 1YJZA 2FNIA 4IYOA 1SZKA 3UWCA 4CXRA 2WK9A 2Z1ZA 4F5JA 3RCHB 3FZ6A 1BJNA 4XQ2A 1AY5A 2BIEA 3AEPA 1ASLA 5DX5A 3K28A 1AHEA 3DZZA 4FFCA 4GDYA 1JG8A 4B98A 3PD6A 4JEXA 3D6KA 4UHMA 7AATA 3H9XA 2WK7A 3N4RA 1BQAA 4ADCA 1FC4A 1QITA 4ZWMA 2DOUA 4A6UA 1YIYA 3GZDC 3USFA 1LKCA 2AY9A 5D95A 5F9SA 2AY3A 2YCNA 4J5UA 2BWNA 5E3KA 4ADEA 3UAKA 4ZWVA 2CSTA 1LW5A 2W7GA 3RCHA 4A0HA 3EIBA 1GEWA 3H14A 2XH1A 3BCAA 1TOEA 3R9AA 3T32A 3G8MA 2CINA 2DR1A 1IAYA 2FQ6A 2QB2A 1M7YA 3JTXA 5LH9A 3MBBA 2WB6A 4E3RA 4K2IA 4OC9A 2W8UA 3AOWA 4RAEA 4E1OA 4KXKA 1RV4A 1FG7A 1WYVB 3EZSA 1VP4A 2VMXA 1Y4IA 2D63A 3FRKA 4WXBA 4Y0DA 1IUGA 1C7GA 1MDZA 1U08A 3QPGA 4IX8A 1OHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2A A;  1X28 A;  3AOV A;  1ASF A;  4GE9 A;  3ELE A;  2X8U A;  1T3I A;  4OBV A;  1AJR A;  1W23 A;  3E77 A;  2QLR A;  2W7H A;  4ATQ A;  1MLY A;  2VMT A;  1BQD A;  4GRX A;  3P1T A;  3RI6 A;  2Z9U A;  3KE3 A;  2CFB A;  4QGR A;  1WYV A;  2CH2 A;  3AV7 A;  3AEN B;  5C6U A;  2X3L A;  2F8J A;  1C0N A;  4EU1 A;  1DTY A;  3A9Z A;  1IX6 A;  4RM1 A;  1D7U A;  2AY1 A;  4Y0H A;  4BMK A;  4EFF A;  4JF1 A;  2W7I A;  1SZU A;  3I5T A;  4HVK A;  1DGD A;  1V2F A;  2PB0 A;  3CBF A;  3KGW A;  3GWP A;  1OHV A;  4R5Z A;  1GC0 A;  4XJL A;  2YHK A;  2E7J A;  2X5D A;  1EQB A;  2ZSL A;  3IF2 A;  1ASG A;  3VAX A;  1LS3 A;  2DGM A;  3WX9 A;  4KAM A;  2CY8 A;  3W1I A;  3II0 A;  4AOA A;  3FZ7 A;  3NUI A;  1I48 A;  4K2M A;  3FQ8 A;  2GB3 A;  3JWA A;  4ZDP A;  3PA9 A;  1J32 A;  2W8V A;  1KKP A;  3MAU A;  3AEN A;  3AEJ C;  1GC2 A;  4IXZ A;  4F5M A;  4Q76 A;  1UU2 A;  1BT4 A;  2BKW A;  1TOG A;  4P3M A;  4BQ0 A;  1ZC9 A;  1AIA A;  1CZC A;  1LK9 A;  3BWN A;  2E54 A;  3QM2 A;  1Z3Z A;  4WYD A;  3NYU A;  1EJI A;  1DFO A;  4OT8 A;  1AJS B;  1SVV A;  3BN1 A;  3NYT A;  5EIG B;  1TAR A;  2GQN A;  2EZ2 A;  2VLF A;  1X0M A;  1LC5 A;  3ATH A;  2CJH A;  3BV0 A;  2CJG A;  1CL1 A;  2AY8 A;  1S0A A;  3Q8N A;  1KMK A;  1OHW A;  3PIU A;  1O62 A;  4GSA A;  1S08 A;  4GE4 A;  4IXS A;  4ATP A;  1ASD A;  3K7Y A;  1B8G A;  3GZC A;  4Y0I A;  1S06 A;  2JG2 A;  2VMP A;  1M0P A;  4R5F A;  4ZSY A;  2D66 A;  2FNU A;  5DJ9 A;  4RJY A;  3NNK A;  2VMY A;  2PO3 A;  4N0B A;  4W1W A;  3BCX A;  2JIS A;  3R4T A;  4JF0 A;  4AO4 A;  1AAM A;  1CJ0 A;  1ARG A;  5G4J A;  4ZM3 A;  3EZ1 A;  1AJS A;  5EQC A;  3L8A A;  2Z1Y A;  5EIG A;  1YNU A;  1O61 A;  5FT5 A;  4E3Q A;  4HF8 A;  4RJ0 A;  2ZYJ A;  2PB2 A;  2D65 A;  4MQQ A;  3VK4 A;  4L0O A;  2VGU A;  1OXP A;  3PPL A;  3LWS A;  3RQ1 A;  3EUC A;  1BJ4 A;  2BWP A;  4LC3 A;  1M0Q A;  1N2T A;  1WYU B;  3NX3 A;  1JS6 A;  4IXO A;  4A00 A;  1TOK A;  4GEB A;  1GC4 A;  1RVU A;  3A8U X;  1MLZ A;  2QMA A;  2Z9V A;  2ZJG A;  2W7E A;  4ADB A;  4DQ6 A;  1YAA A;  1M32 A;  4IY7 A;  4K2B A;  4F5G A;  2FN6 A;  1J04 A;  3IHJ A;  3CQ4 A;  4JEZ A;  4XEW A;  3TCM A;  1D7V A;  3H7F A;  5BJ4 A;  1ASM A;  4PVF A;  1PMM A;  1IBJ A;  8AAT A;  1G4X A;  3ACZ A;  3WGC A;  2VI9 A;  4ZAH A;  2AEU A;  2YKV A;  1IJI A;  3ASB A;  2ZSM A;  3FVS A;  3LG0 A;  3ELP A;  1B9H A;  3LV2 A;  4OYT A;  5M49 A;  1ASB A;  2W7F A;  4Q31 A;  1G4V A;  3WKS A;  1D7R A;  2C0R A;  3FCR A;  1WYU A;  4MKJ A;  5I92 A;  2EZ1 A;  3DXV A;  4ZDL A;  2TPL A;  5JAY A;  2HUI A;  2GMS A;  2JJE A;  2VI8 A;  1DGE A;  3N0L A;  1YIZ A;  4B9B A;  2YRI A;  4WYE A;  2VMS A;  3WCO A;  3E2Y A;  1VEF A;  1B5O A;  2E7I A;  2JJG A;  4A6T A;  1CL2 A;  2VGW A;  4J8L A;  2AY5 A;  2BI2 A;  3LVL B;  3HMU A;  1LC7 A;  4U2H A;  2YKX A;  2Q7W A;  3W1J A;  3B1D A;  3BWO A;  1FG3 A;  4OCA A;  1QZ9 A;  2VGT A;  2HOZ A;  3MEB A;  4MY5 A;  1ELU A;  4RKC A;  4BA5 A;  3HT4 A;  1H1C A;  5HXX A;  1MDO A;  4P7Y A;  3FSL A;  5DJ1 A;  4XJO A;  3FVX A;  1GEY A;  4I8A A;  4M2J A;  4WYC A;  2EH6 A;  4MSO A;  3RBF A;  3ZZK A;  1M4N A;  2Z61 A;  3RBL A;  4AZJ A;  3NU7 A;  1MAP A;  2JGT A;  2CB1 A;  3N5M A;  4PIW A;  4ZSW A;  2HP2 A;  5G09 A;  2YCP A;  2DKB A;  3DR4 A;  3JW9 A;  4A0G A;  4F4E A;  2YKU A;  2Z67 A;  1MDX A;  2D61 A;  3HLM A;  2V1P A;  5HDM A;  2CJD A;  3BWN C;  1AHX A;  2CH1 A;  1AKC A;  3GR9 A;  1WKG A;  2DKJ A;  4F5H A;  2FM1 A;  4WYF A;  3NUB A;  4XK1 A;  3TFU A;  1GDE A;  1W7L A;  4E77 A;  1I29 A;  1N8P A;  3MAF B;  2HUU A;  1AY8 A;  1OAT A;  5BJ3 A;  4R2N A;  2HOR A;  5EAA A;  3EI6 A;  4CVQ A;  1AMR A;  1TAT A;  3VK2 A;  3GJU A;  4XAU A;  3EI8 A;  3FTB A;  3G7Q A;  3HBX A;  5F8V A;  3A9Y A;  1RVY A;  1D2F A;  5IWQ A;  4H51 A;  4F5K A;  5E5I A;  1W7N A;  1GEX A;  4A0F A;  3UE8 A;  1AKB A;  2D5Y A;  1IX8 A;  2VIA A;  2WKA A;  2O7C A;  4U1T A;  1TAS A;  3PDB B;  2VMW A;  3HVY A;  1PFF A;  1LC8 A;  2DGL A;  2HZP A;  4W91 A;  2R5C B;  3EI9 A;  3WY7 A;  1XI9 A;  3MAD A;  2BI3 A;  1WST A;  3GSB A;  3MAF A;  2C7T A;  4RIZ A;  4ZM4 A;  5K8B A;  1ORD A;  2VMO A;  2W7J A;  5M4B A;  1SF2 A;  4AH3 A;  5M46 A;  3F0H A;  2W7M A;  4BA4 A;  1YJY A;  3LY1 A;  5EUE A;  2O0R A;  1IX7 A;  4W5K A;  3NU8 A;  1WKH A;  2E7U A;  1ASN A;  3PDB A;  1CS1 A;  1M0N A;  1V2E A;  1IVR A;  1TOJ A;  4ISY A;  3AEM A;  2R5C A;  1AAW A;  1CQ8 A;  1CQ6 A;  2VGZ A;  1UKJ A;  3LVK A;  3NDN A;  3TFT A;  3MC6 A;  4R8D A;  3WCN A;  2D64 A;  2C44 A;  3JZL A;  1AIB A;  3QBO A;  3NRA A;  2VLH A;  2YCT A;  4F5L A;  1B4X A;  5AX8 A;  3I4J A;  4Q75 A;  1KL2 A;  2OAT A;  3CQ6 A;  1X29 A;  4M2M A;  5FT6 A;  2VMR A;  1SFF A;  1QGN A;  1SZS A;  3DU4 A;  1ART A;  1IAX A;  3AEL A;  3DOD A;  1ASE A;  2VGV A;  1P3W A;  2ZY5 A;  2EGY A;  4LNL A;  3JWB A;  4RKD A;  3M5U A;  2W8J A;  3PDX A;  1S09 A;  4DGT A;  1G7X A;  2X5F A;  2ZY3 A;  3KKI A;  2AY7 A;  3VK3 A;  3HQT A;  3B1C A;  4RLG A;  2AEV A;  1G7W A;  4UHO A;  4DBC A;  4W1V A;  3ASA A;  5E4Z A;  3COG A;  3EIA A;  4RIT A;  1EG5 A;  2CTZ A;  4TMR A;  4IW7 A;  1M0O A;  5M4D A;  3WGB A;  3RUY A;  2JJH A;  3FD0 A;  1W3U A;  2R2N A;  4LNM A;  1JF9 A;  2BI1 A;  4WBT A;  3NTJ A;  1Z7D A;  1AHY A;  2AAT A;  3TAT A;  2OQX A;  3HL2 A;  3MKJ A;  4ITX A;  1PG8 A;  1DKA A;  1GD9 A;  5HHY A;  1S07 A;  4FL0 A;  2VIB A;  3G0T A;  3WLX A;  2ZY4 A;  2V0Y A;  1QJ3 A;  4LNJ A;  4XJP A;  5EFS A;  4CBR A;  1BJO B;  2Z20 A;  2W7L A;  1AMS A;  1DJ9 A;  3AAT A;  2Z9X A;  1ZOD A;  2BWO A;  1PMO A;  4EB5 A;  5G2Q A;  4UOY A;  2HP1 A;  1BS0 A;  4MGR A;  2EO5 A;  3PGY A;  3QHX A;  1KL1 A;  3BB8 A;  2QB3 A;  2OKK A;  5EUD A;  2BHX A;  2W7D A;  2ZC0 A;  4OBU A;  4WYA A;  1GC3 A;  2AY4 A;  3EI7 A;  2BI9 A;  3FKD A;  2Z9W A;  3OKS A;  3FDB A;  3ZRP A;  2GSA A;  3L44 A;  3CQ5 A;  1QIS A;  2D7Z A;  3E9K A;  3B1E A;  4ITG A;  4ZLV A;  2BIG A;  3DYD A;  3EI5 A;  1I41 A;  3FZ8 A;  1UU1 A;  2HOY A;  5D5S A;  5J8Q A;  4A72 A;  1BJO A;  2BI5 A;  1C9C A;  3PJ0 A;  1AX4 A;  4NOG A;  4WB0 B;  1AHF A;  1VJO A;  2R5E A;  2HUF A;  1AMQ A;  3VOM A;  2EPJ A;  2OKJ A;  2W8W A;  3B46 A;  4CBS A;  1V72 A;  1CQ7 A;  3JU7 A;  1ELQ A;  1KMJ A;  4XJM A;  2VMQ A;  3I16 A;  2YKY A;  1GCK A;  1MAQ A;  3TQX A;  1V2D A;  3B8X A;  3QGU A;  2AY6 A;  1ARH A;  1YJS A;  4WXG A;  5FT8 A;  3GZD A;  1E5E A;  3LVM A;  3A9X A;  2VYC A;  3DR7 A;  1ARI A;  4JEY A;  4JE5 D;  3ZRR A;  3ZRQ A;  4CXQ A;  3FDD A;  1ASA A;  1SPA A;  3A2B A;  1AKA A;  5DB5 A;  3HDO A;  4PFF A;  1TOI A;  4WP0 A;  2WK8 A;  4N0W A;  2ZP7 A;  2DGK A;  1ARS A;  4MQP A;  4WB0 A;  3W1H A;  4A6R A;  2HOX A;  4EMY A;  3FVU A;  1M6S A;  5EUN A;  4EB7 A;  3LVJ A;  4O6Z A;  3DC1 A;  3GET A;  1WYT B;  1BJW A;  2FYF A;  3AEM C;  2JJF A;  3FFR A;  3P6K A;  1ASC A;  4BHD A;  1GBN A;  1D7S A;  5G0A A;  5FT4 A;  1ECX A;  3MC6 C;  4ZDO A;  4UQV A;  1QJ5 A;  2OGA A;  4LW4 A;  3WKR A;  2VMN A;  3ISL A;  4MKK A;  2VMU A;  1OXO A;  1TPL A;  3E6G A;  4WD2 A;  2VMV A;  1E5F A;  1B5P A;  2BIA A;  1C4K A;  1KKJ A;  2ZY2 A;  2YRR A;  1UU0 A;  3PAA A;  3ECD A;  1BKG A;  1N31 A;  2BYJ A;  3FFH A;  1MGV A;  4M2K A;  2OGE A;  4ZAS A;  5TF5 A;  1WYT A;  2D7Y A;  1YOO A;  3QI6 A;  4F5F A;  4ADD A;  1CZE A;  3NYS A;  1C7O A;  1AHG A;  4GE7 A;  4F5I A;  1O69 A;  2NMP A;  5G4I A;  1ZOB A;  3E2Z B;  4JEW A;  3GBX A;  4JE5 A;  4OTL A;  4Q6R A;  1QIR A;  1W7M A;  2W7K A;  4UHN A;  4WXF A;  2R0T A;  3F6T A;  3AEO A;  2BYL A;  3DRD A;  3F9T A;  1AMA A;  5G2P A;  1DJU A;  4TN4 A;  2VGS A;  4AZK A;  4MQR A;  2GMU A;  2VMZ A;  3KGX A;  5EAV A;  4AO9 A;  2QA3 A;  1B9I A;  1AIC A;  2XBN A;  3VP6 A;  4IYO B;  1H0C A;  4OMA A;  3K40 A;  4WYG A;  2AY2 A;  1AY4 A;  3BS8 A;  4JEV A;  3BC8 A;  3CAI A;  2O1B A;  3OP7 A;  2ZUK A;  2G6W A;  4WLJ A;  3ZZJ A;  1RV3 A;  4TV7 A;  9AAT A;  1BW0 A;  4W8I A;  2QBT A;  1C7N A;  1I43 A;  2ORD A;  3E2F A;  3E2Z A;  1LW4 A;  5LHA A;  4A0R A;  3QN6 A;  3PD6 B;  3BCB A;  4W1X A;  2CAN A;  3FQA A;  1DJE A;  3FQ7 A;  2RFV A;  4KYO A;  4PFN A;  4WLH A;  3WZF A;  1JS3 A;  1O4S A;  3AEJ A;  3N75 A;  1XEY A;  2W8T A;  2C81 A;  3DXW A;  4LW2 A;  2YOB A;  1YJZ A;  2FNI A;  4IYO A;  1SZK A;  3UWC A;  4CXR A;  2WK9 A;  2Z1Z A;  4F5J A;  3RCH B;  3FZ6 A;  1BJN A;  4XQ2 A;  1AY5 A;  2BIE A;  3AEP A;  1ASL A;  5DX5 A;  3K28 A;  1AHE A;  3DZZ A;  4FFC A;  4GDY A;  1JG8 A;  4B98 A;  3PD6 A;  4JEX A;  3D6K A;  4UHM A;  7AAT A;  2WK7 A;  1BQA A;  4ADC A;  1FC4 A;  1QIT A;  4ZWM A;  2DOU A;  4A6U A;  1YIY A;  3GZD C;  3USF A;  1LKC A;  2AY9 A;  5D95 A;  5F9S A;  2AY3 A;  2YCN A;  4J5U A;  2BWN A;  5E3K A;  4ADE A;  3UAK A;  4ZWV A;  2CST A;  1LW5 A;  2W7G A;  3RCH A;  4A0H A;  3EIB A;  1GEW A;  3H14 A;  2XH1 A;  3BCA A;  1TOE A;  3R9A A;  3T32 A;  3G8M A;  2CIN A;  2DR1 A;  1IAY A;  2FQ6 A;  2QB2 A;  1M7Y A;  3JTX A;  5LH9 A;  3MBB A;  4E3R A;  4K2I A;  4OC9 A;  2W8U A;  3AOW A;  4RAE A;  4E1O A;  4KXK A;  1RV4 A;  1FG7 A;  1WYV B;  3EZS A;  1VP4 A;  2VMX A;  1Y4I A;  2D63 A;  3FRK A;  4WXB A;  4Y0D A;  1IUG A;  1C7G A;  1MDZ A;  1U08 A;  3QPG A;  4IX8 A;  1OHY A; 
#chains in the Genus database with same CATH topology
 1X2A A;  1X28 A;  3AOV A;  1ASF A;  4GE9 A;  3ELE A;  2X8U A;  1T3I A;  4OBV A;  1AJR A;  1W23 A;  3E77 A;  2QLR A;  2W7H A;  4ATQ A;  1MLY A;  2VMT A;  1BQD A;  4GRX A;  3P1T A;  3RI6 A;  2Z9U A;  3KE3 A;  2CFB A;  4QGR A;  1WYV A;  2CH2 A;  3AV7 A;  3AEN B;  5C6U A;  2X3L A;  2F8J A;  1C0N A;  4EU1 A;  1DTY A;  3A9Z A;  1IX6 A;  4RM1 A;  1D7U A;  2AY1 A;  4Y0H A;  4BMK A;  4EFF A;  4JF1 A;  2W7I A;  1SZU A;  3I5T A;  4HVK A;  1DGD A;  1V2F A;  2PB0 A;  3CBF A;  3KGW A;  3GWP A;  1OHV A;  4R5Z A;  1GC0 A;  4XJL A;  2YHK A;  2E7J A;  2X5D A;  1EQB A;  2ZSL A;  3IF2 A;  1ASG A;  3VAX A;  1LS3 A;  2DGM A;  3WX9 A;  4KAM A;  2CY8 A;  3W1I A;  3II0 A;  4AOA A;  3FZ7 A;  3NUI A;  1I48 A;  4K2M A;  3FQ8 A;  2GB3 A;  3JWA A;  4ZDP A;  3PA9 A;  1J32 A;  2W8V A;  1KKP A;  3MAU A;  3AEN A;  3AEJ C;  1GC2 A;  4IXZ A;  4F5M A;  2FKI A;  4Q76 A;  1UU2 A;  1BT4 A;  2BKW A;  1TOG A;  4P3M A;  4BQ0 A;  1ZC9 A;  1AIA A;  1CZC A;  1LK9 A;  3BWN A;  2E54 A;  3QM2 A;  1Z3Z A;  4WYD A;  3NYU A;  1EJI A;  1DFO A;  4OT8 A;  1AJS B;  1SVV A;  3BN1 A;  3NYT A;  5EIG B;  1TAR A;  2GQN A;  2EZ2 A;  2VLF A;  1X0M A;  1LC5 A;  3ATH A;  2CJH A;  3BV0 A;  2CJG A;  1CL1 A;  2AY8 A;  1S0A A;  3Q8N A;  1KMK A;  1OHW A;  3PIU A;  1O62 A;  4GSA A;  1S08 A;  4GE4 A;  4IXS A;  4ATP A;  1ASD A;  3K7Y A;  1B8G A;  3GZC A;  4Y0I A;  1S06 A;  2JG2 A;  2VMP A;  1M0P A;  4R5F A;  4ZSY A;  2D66 A;  2FNU A;  5DJ9 A;  4RJY A;  3NNK A;  2VMY A;  2PO3 A;  4N0B A;  4W1W A;  3BCX A;  2JIS A;  3R4T A;  4JF0 A;  4AO4 A;  1AAM A;  1CJ0 A;  1ARG A;  5G4J A;  4ZM3 A;  3EZ1 A;  1AJS A;  5EQC A;  3L8A A;  2Z1Y A;  5EIG A;  1YNU A;  1O61 A;  5FT5 A;  4E3Q A;  4HF8 A;  4RJ0 A;  2ZYJ A;  2PB2 A;  2D65 A;  4MQQ A;  3VK4 A;  4L0O A;  2VGU A;  1OXP A;  3PPL A;  3LWS A;  3RQ1 A;  3EUC A;  1BJ4 A;  2BWP A;  4LC3 A;  1M0Q A;  1N2T A;  1WYU B;  3NX3 A;  1JS6 A;  4IXO A;  4A00 A;  1TOK A;  4GEB A;  1GC4 A;  1RVU A;  3A8U X;  1MLZ A;  2QMA A;  2Z9V A;  2ZJG A;  2W7E A;  4ADB A;  4DQ6 A;  1YAA A;  1M32 A;  4IY7 A;  4K2B A;  4F5G A;  2FN6 A;  1J04 A;  3IHJ A;  3CQ4 A;  4JEZ A;  4XEW A;  3TCM A;  1D7V A;  3H7F A;  5BJ4 A;  1ASM A;  4PVF A;  1PMM A;  1IBJ A;  8AAT A;  1G4X A;  3ACZ A;  3WGC A;  2VI9 A;  4ZAH A;  2AEU A;  2YKV A;  1IJI A;  3ASB A;  2ZSM A;  3FVS A;  3LG0 A;  3ELP A;  1B9H A;  3LV2 A;  4OYT A;  5M49 A;  1ASB A;  2W7F A;  4Q31 A;  1G4V A;  3WKS A;  1D7R A;  2C0R A;  3FCR A;  1WYU A;  4MKJ A;  5I92 A;  2EZ1 A;  3DXV A;  4ZDL A;  2TPL A;  5JAY A;  2KFP A;  2HUI A;  2GMS A;  2JJE A;  2VI8 A;  1DGE A;  3N0L A;  1YIZ A;  4B9B A;  2YRI A;  4WYE A;  2VMS A;  3WCO A;  3E2Y A;  1VEF A;  1B5O A;  2E7I A;  2JJG A;  4A6T A;  1CL2 A;  2VGW A;  4J8L A;  2AY5 A;  1KAF A;  2BI2 A;  3LVL B;  3HMU A;  1LC7 A;  4U2H A;  2YKX A;  2Q7W A;  3W1J A;  2EYQ A;  3B1D A;  3BWO A;  1FG3 A;  4OCA A;  4H63 Q;  1QZ9 A;  2VGT A;  2HOZ A;  3MEB A;  4MY5 A;  1ELU A;  4RKC A;  4BA5 A;  3HT4 A;  1H1C A;  5HXX A;  1MDO A;  4P7Y A;  3FSL A;  5DJ1 A;  4XJO A;  3FVX A;  1GEY A;  4I8A A;  4M2J A;  4WYC A;  2EH6 A;  4MSO A;  3RBF A;  3ZZK A;  1M4N A;  2Z61 A;  3RBL A;  4AZJ A;  3NU7 A;  1MAP A;  2JGT A;  2CB1 A;  3N5M A;  4PIW A;  4ZSW A;  2HP2 A;  5G09 A;  2YCP A;  2DKB A;  3DR4 A;  3JW9 A;  4A0G A;  4F4E A;  2YKU A;  2Z67 A;  1MDX A;  2D61 A;  3HLM A;  2V1P A;  5HDM A;  2CJD A;  3BWN C;  1AHX A;  2CH1 A;  1AKC A;  3GR9 A;  1WKG A;  2DKJ A;  4F5H A;  2FM1 A;  4WYF A;  3NUB A;  4XK1 A;  3TFU A;  1GDE A;  1W7L A;  4E77 A;  1I29 A;  1N8P A;  3MAF B;  2HUU A;  1AY8 A;  1OAT A;  5BJ3 A;  4R2N A;  2HOR A;  5EAA A;  3EI6 A;  4CVQ A;  1AMR A;  1TAT A;  3VK2 A;  3GJU A;  4XAU A;  3EI8 A;  3FTB A;  3G7Q A;  3HBX A;  2QSR A;  5F8V A;  3A9Y A;  1RVY A;  1D2F A;  5IWQ A;  4H51 A;  4F5K A;  5E5I A;  1W7N A;  1GEX A;  4A0F A;  5KTB A;  3UE8 A;  1AKB A;  2D5Y A;  1IX8 A;  2VIA A;  2WKA A;  2O7C A;  4U1T A;  1TAS A;  3PDB B;  2VMW A;  3HVY A;  1PFF A;  1LC8 A;  2DGL A;  2HZP A;  4W91 A;  2R5C B;  3EI9 A;  3WY7 A;  1XI9 A;  3MAD A;  2BI3 A;  1WST A;  3GSB A;  3MAF A;  2C7T A;  4RIZ A;  4ZM4 A;  5K8B A;  1ORD A;  2VMO A;  2W7J A;  5M4B A;  1SF2 A;  4AH3 A;  5M46 A;  3F0H A;  2G7J A;  2W7M A;  4BA4 A;  1YJY A;  3LY1 A;  5EUE A;  2O0R A;  1IX7 A;  4W5K A;  3NU8 A;  1WKH A;  2E7U A;  1ASN A;  3PDB A;  1CS1 A;  1M0N A;  1V2E A;  1IVR A;  1TOJ A;  4ISY A;  3AEM A;  2R5C A;  1AAW A;  1CQ8 A;  1CQ6 A;  2VGZ A;  1UKJ A;  3LVK A;  3NDN A;  3TFT A;  3MC6 A;  4R8D A;  3WCN A;  2D64 A;  2A1V A;  4K05 A;  2C44 A;  3JZL A;  1AIB A;  3QBO A;  3NRA A;  2VLH A;  2YCT A;  4F5L A;  1B4X A;  5AX8 A;  3I4J A;  4Q75 A;  1KL2 A;  2OAT A;  3CQ6 A;  1X29 A;  4M2M A;  5FT6 A;  2VMR A;  1SFF A;  1QGN A;  1SZS A;  3DU4 A;  1ART A;  1IAX A;  3AEL A;  3DOD A;  1ASE A;  2VGV A;  1P3W A;  2ZY5 A;  2EGY A;  4LNL A;  3JWB A;  4RKD A;  3M5U A;  2W8J A;  3PDX A;  1S09 A;  4DGT A;  1G7X A;  2X5F A;  2ZY3 A;  3KKI A;  2AY7 A;  3VK3 A;  3HQT A;  3B1C A;  4RLG A;  2AEV A;  1G7W A;  4UHO A;  4DBC A;  4W1V A;  3ASA A;  5E4Z A;  3COG A;  3EIA A;  4RIT A;  1EG5 A;  2CTZ A;  4TMR A;  4IW7 A;  1M0O A;  5M4D A;  3WGB A;  3RUY A;  2JJH A;  3FD0 A;  1W3U A;  2R2N A;  4LNM A;  1JF9 A;  2BI1 A;  4WBT A;  3NTJ A;  1Z7D A;  1AHY A;  2AAT A;  3TAT A;  2OQX A;  3HL2 A;  3MKJ A;  4ITX A;  1PG8 A;  1DKA A;  1GD9 A;  5HHY A;  1S07 A;  4FL0 A;  2VIB A;  3G0T A;  3WLX A;  2ZY4 A;  2V0Y A;  1QJ3 A;  4LNJ A;  4XJP A;  5EFS A;  4CBR A;  1BJO B;  2Z20 A;  2W7L A;  1AMS A;  1DJ9 A;  3N7N A;  3AAT A;  2Z9X A;  1ZOD A;  2BWO A;  1PMO A;  4EB5 A;  5G2Q A;  4UOY A;  2HP1 A;  1BS0 A;  4MGR A;  2EO5 A;  3PGY A;  3QHX A;  1KL1 A;  3BB8 A;  2QB3 A;  2OKK A;  5EUD A;  2BHX A;  2W7D A;  2ZC0 A;  4OBU A;  4WYA A;  1GC3 A;  2AY4 A;  3EI7 A;  2BI9 A;  3FKD A;  2Z9W A;  3OKS A;  3FDB A;  3ZRP A;  2GSA A;  3L44 A;  3CQ5 A;  1QIS A;  2D7Z A;  3E9K A;  3B1E A;  4ITG A;  4ZLV A;  2BIG A;  3DYD A;  3EI5 A;  1I41 A;  3FZ8 A;  1UU1 A;  2HOY A;  5D5S A;  5J8Q A;  4A72 A;  1BJO A;  2BI5 A;  1C9C A;  3PJ0 A;  1AX4 A;  4NOG A;  4WB0 B;  1AHF A;  1VJO A;  2R5E A;  2HUF A;  1AMQ A;  3VOM A;  2EPJ A;  2OKJ A;  2W8W A;  3B46 A;  4CBS A;  1V72 A;  1CQ7 A;  3JU7 A;  1ELQ A;  1KMJ A;  4XJM A;  2VMQ A;  3I16 A;  2YKY A;  1GCK A;  1MAQ A;  3TQX A;  1V2D A;  3B8X A;  3QGU A;  2AY6 A;  1ARH A;  1YJS A;  4WXG A;  5FT8 A;  3GZD A;  1E5E A;  3LVM A;  3A9X A;  2VYC A;  3DR7 A;  1ARI A;  4JEY A;  4JE5 D;  3ZRR A;  3ZRQ A;  4CXQ A;  3FDD A;  1ASA A;  1SPA A;  3A2B A;  1AKA A;  5DB5 A;  3HDO A;  4PFF A;  1TOI A;  4WP0 A;  2WK8 A;  4N0W A;  2ZP7 A;  2DGK A;  3N4S A;  1ARS A;  4MQP A;  4WB0 A;  3W1H A;  4A6R A;  2HOX A;  4EMY A;  3FVU A;  1M6S A;  5EUN A;  4EB7 A;  3LVJ A;  4O6Z A;  3DC1 A;  3GET A;  1WYT B;  1BJW A;  2FYF A;  3AEM C;  2JJF A;  3FFR A;  3P6K A;  1ASC A;  4BHD A;  1GBN A;  1D7S A;  5G0A A;  5FT4 A;  1ECX A;  3MC6 C;  4ZDO A;  4UQV A;  1QJ5 A;  2OGA A;  4LW4 A;  3WKR A;  2VMN A;  3ISL A;  4MKK A;  2VMU A;  1OXO A;  1TPL A;  3E6G A;  4WD2 A;  2VMV A;  1E5F A;  1B5P A;  2BIA A;  1C4K A;  1KKJ A;  2ZY2 A;  2YRR A;  1UU0 A;  3PAA A;  3ECD A;  1BKG A;  1N31 A;  2BYJ A;  3FFH A;  1MGV A;  4M2K A;  2OGE A;  4ZAS A;  5TF5 A;  1WYT A;  2D7Y A;  1YOO A;  3QI6 A;  4F5F A;  4ADD A;  1CZE A;  3NYS A;  1C7O A;  1AHG A;  4GE7 A;  4F5I A;  1O69 A;  2NMP A;  5G4I A;  1ZOB A;  3E2Z B;  4JEW A;  3GBX A;  4JE5 A;  4OTL A;  4Q6R A;  1QIR A;  1W7M A;  2W7K A;  4UHN A;  4WXF A;  2R0T A;  3F6T A;  3AEO A;  2BYL A;  3DRD A;  3F9T A;  1AMA A;  5G2P A;  1DJU A;  4TN4 A;  2VGS A;  4AZK A;  4MQR A;  2GMU A;  2VMZ A;  3KGX A;  5EAV A;  4AO9 A;  2QA3 A;  1B9I A;  1AIC A;  2XBN A;  3VP6 A;  4IYO B;  1H0C A;  4OMA A;  3K40 A;  4WYG A;  2AY2 A;  1AY4 A;  3BS8 A;  4JEV A;  3BC8 A;  3CAI A;  2O1B A;  3OP7 A;  2ZUK A;  2G6W A;  4WLJ A;  3ZZJ A;  1RV3 A;  4TV7 A;  9AAT A;  1BW0 A;  4W8I A;  2QBT A;  1C7N A;  1I43 A;  2ORD A;  3E2F A;  3E2Z A;  1LW4 A;  5LHA A;  4A0R A;  3QN6 A;  3PD6 B;  3BCB A;  4W1X A;  2CAN A;  3FQA A;  1DJE A;  3FQ7 A;  2RFV A;  4KYO A;  4PFN A;  4WLH A;  3WZF A;  3N4X A;  1JS3 A;  1O4S A;  3AEJ A;  3N75 A;  1XEY A;  2W8T A;  2C81 A;  3DXW A;  4LW2 A;  2YOB A;  1YJZ A;  2FNI A;  4IYO A;  1SZK A;  3UWC A;  4CXR A;  2WK9 A;  2Z1Z A;  4F5J A;  3RCH B;  3FZ6 A;  1BJN A;  4XQ2 A;  1AY5 A;  2BIE A;  3AEP A;  1ASL A;  5DX5 A;  3K28 A;  1AHE A;  3DZZ A;  4FFC A;  4GDY A;  1JG8 A;  4B98 A;  3PD6 A;  4JEX A;  3D6K A;  4UHM A;  7AAT A;  3H9X A;  2WK7 A;  3N4R A;  1BQA A;  4ADC A;  1FC4 A;  1QIT A;  4ZWM A;  2DOU A;  4A6U A;  1YIY A;  3GZD C;  3USF A;  1LKC A;  2AY9 A;  5D95 A;  5F9S A;  2AY3 A;  2YCN A;  4J5U A;  2BWN A;  5E3K A;  4ADE A;  3UAK A;  4ZWV A;  2CST A;  1LW5 A;  2W7G A;  3RCH A;  4A0H A;  3EIB A;  1GEW A;  3H14 A;  2XH1 A;  3BCA A;  1TOE A;  3R9A A;  3T32 A;  3G8M A;  2CIN A;  2DR1 A;  1IAY A;  2FQ6 A;  2QB2 A;  1M7Y A;  3JTX A;  5LH9 A;  3MBB A;  2WB6 A;  4E3R A;  4K2I A;  4OC9 A;  2W8U A;  3AOW A;  4RAE A;  4E1O A;  4KXK A;  1RV4 A;  1FG7 A;  1WYV B;  3EZS A;  1VP4 A;  2VMX A;  1Y4I A;  2D63 A;  3FRK A;  4WXB A;  4Y0D A;  1IUG A;  1C7G A;  1MDZ A;  1U08 A;  3QPG A;  4IX8 A;  1OHY A; 
#chains in the Genus database with same CATH homology
 1X2A A;  1X28 A;  3AOV A;  1ASF A;  4GE9 A;  3ELE A;  2X8U A;  1T3I A;  4OBV A;  1AJR A;  1W23 A;  3E77 A;  2QLR A;  2W7H A;  4ATQ A;  1MLY A;  2VMT A;  1BQD A;  4GRX A;  3P1T A;  3RI6 A;  2Z9U A;  3KE3 A;  2CFB A;  4QGR A;  1WYV A;  2CH2 A;  3AV7 A;  3AEN B;  5C6U A;  2X3L A;  2F8J A;  1C0N A;  4EU1 A;  1DTY A;  3A9Z A;  1IX6 A;  4RM1 A;  1D7U A;  2AY1 A;  4Y0H A;  4BMK A;  4EFF A;  4JF1 A;  2W7I A;  1SZU A;  3I5T A;  4HVK A;  1DGD A;  1V2F A;  2PB0 A;  3CBF A;  3KGW A;  3GWP A;  1OHV A;  4R5Z A;  1GC0 A;  4XJL A;  2YHK A;  2E7J A;  2X5D A;  1EQB A;  2ZSL A;  3IF2 A;  1ASG A;  3VAX A;  1LS3 A;  2DGM A;  3WX9 A;  4KAM A;  2CY8 A;  3W1I A;  3II0 A;  4AOA A;  3FZ7 A;  3NUI A;  1I48 A;  4K2M A;  3FQ8 A;  2GB3 A;  3JWA A;  4ZDP A;  3PA9 A;  1J32 A;  2W8V A;  1KKP A;  3MAU A;  3AEN A;  3AEJ C;  1GC2 A;  4IXZ A;  4F5M A;  2FKI A;  4Q76 A;  1UU2 A;  1BT4 A;  2BKW A;  1TOG A;  4P3M A;  4BQ0 A;  1ZC9 A;  1AIA A;  1CZC A;  1LK9 A;  3BWN A;  2E54 A;  3QM2 A;  1Z3Z A;  4WYD A;  3NYU A;  1EJI A;  1DFO A;  4OT8 A;  1AJS B;  1SVV A;  3BN1 A;  3NYT A;  5EIG B;  1TAR A;  2GQN A;  2EZ2 A;  2VLF A;  1X0M A;  1LC5 A;  3ATH A;  2CJH A;  3BV0 A;  2CJG A;  1CL1 A;  2AY8 A;  1S0A A;  3Q8N A;  1KMK A;  1OHW A;  3PIU A;  1O62 A;  4GSA A;  1S08 A;  4GE4 A;  4IXS A;  4ATP A;  1ASD A;  3K7Y A;  1B8G A;  3GZC A;  4Y0I A;  1S06 A;  2JG2 A;  2VMP A;  1M0P A;  4R5F A;  4ZSY A;  2D66 A;  2FNU A;  5DJ9 A;  4RJY A;  3NNK A;  2VMY A;  2PO3 A;  4N0B A;  4W1W A;  3BCX A;  2JIS A;  3R4T A;  4JF0 A;  4AO4 A;  1AAM A;  1CJ0 A;  1ARG A;  5G4J A;  4ZM3 A;  3EZ1 A;  1AJS A;  5EQC A;  3L8A A;  2Z1Y A;  5EIG A;  1YNU A;  1O61 A;  5FT5 A;  4E3Q A;  4HF8 A;  4RJ0 A;  2ZYJ A;  2PB2 A;  2D65 A;  4MQQ A;  3VK4 A;  4L0O A;  2VGU A;  1OXP A;  3PPL A;  3LWS A;  3RQ1 A;  3EUC A;  1BJ4 A;  2BWP A;  4LC3 A;  1M0Q A;  1N2T A;  1WYU B;  3NX3 A;  1JS6 A;  4IXO A;  4A00 A;  1TOK A;  4GEB A;  1GC4 A;  1RVU A;  3A8U X;  1MLZ A;  2QMA A;  2Z9V A;  2ZJG A;  2W7E A;  4ADB A;  4DQ6 A;  1YAA A;  1M32 A;  4IY7 A;  4K2B A;  4F5G A;  2FN6 A;  1J04 A;  3IHJ A;  3CQ4 A;  4JEZ A;  4XEW A;  3TCM A;  1D7V A;  3H7F A;  5BJ4 A;  1ASM A;  4PVF A;  1PMM A;  1IBJ A;  8AAT A;  1G4X A;  3ACZ A;  3WGC A;  2VI9 A;  4ZAH A;  2AEU A;  2YKV A;  1IJI A;  3ASB A;  2ZSM A;  3FVS A;  3LG0 A;  3ELP A;  1B9H A;  3LV2 A;  4OYT A;  5M49 A;  1ASB A;  2W7F A;  4Q31 A;  1G4V A;  3WKS A;  1D7R A;  2C0R A;  3FCR A;  1WYU A;  4MKJ A;  5I92 A;  2EZ1 A;  3DXV A;  4ZDL A;  2TPL A;  5JAY A;  2KFP A;  2HUI A;  2GMS A;  2JJE A;  2VI8 A;  1DGE A;  3N0L A;  1YIZ A;  4B9B A;  2YRI A;  4WYE A;  2VMS A;  3WCO A;  3E2Y A;  1VEF A;  1B5O A;  2E7I A;  2JJG A;  4A6T A;  1CL2 A;  2VGW A;  4J8L A;  2AY5 A;  2BI2 A;  3LVL B;  3HMU A;  1LC7 A;  4U2H A;  2YKX A;  2Q7W A;  3W1J A;  2EYQ A;  3B1D A;  3BWO A;  1FG3 A;  4OCA A;  4H63 Q;  1QZ9 A;  2VGT A;  2HOZ A;  3MEB A;  4MY5 A;  1ELU A;  4RKC A;  4BA5 A;  3HT4 A;  1H1C A;  5HXX A;  1MDO A;  4P7Y A;  3FSL A;  5DJ1 A;  4XJO A;  3FVX A;  1GEY A;  4I8A A;  4M2J A;  4WYC A;  2EH6 A;  4MSO A;  3RBF A;  3ZZK A;  1M4N A;  2Z61 A;  3RBL A;  4AZJ A;  3NU7 A;  1MAP A;  2JGT A;  2CB1 A;  3N5M A;  4PIW A;  4ZSW A;  2HP2 A;  5G09 A;  2YCP A;  2DKB A;  3DR4 A;  3JW9 A;  4A0G A;  4F4E A;  2YKU A;  2Z67 A;  1MDX A;  2D61 A;  3HLM A;  2V1P A;  5HDM A;  2CJD A;  3BWN C;  1AHX A;  2CH1 A;  1AKC A;  3GR9 A;  1WKG A;  2DKJ A;  4F5H A;  2FM1 A;  4WYF A;  3NUB A;  4XK1 A;  3TFU A;  1GDE A;  1W7L A;  4E77 A;  1I29 A;  1N8P A;  3MAF B;  2HUU A;  1AY8 A;  1OAT A;  5BJ3 A;  4R2N A;  2HOR A;  5EAA A;  3EI6 A;  4CVQ A;  1AMR A;  1TAT A;  3VK2 A;  3GJU A;  4XAU A;  3EI8 A;  3FTB A;  3G7Q A;  3HBX A;  2QSR A;  5F8V A;  3A9Y A;  1RVY A;  1D2F A;  5IWQ A;  4H51 A;  4F5K A;  5E5I A;  1W7N A;  1GEX A;  4A0F A;  5KTB A;  3UE8 A;  1AKB A;  2D5Y A;  1IX8 A;  2VIA A;  2WKA A;  2O7C A;  4U1T A;  1TAS A;  3PDB B;  2VMW A;  3HVY A;  1PFF A;  1LC8 A;  2DGL A;  2HZP A;  4W91 A;  2R5C B;  3EI9 A;  3WY7 A;  1XI9 A;  3MAD A;  2BI3 A;  1WST A;  3GSB A;  3MAF A;  2C7T A;  4RIZ A;  4ZM4 A;  5K8B A;  1ORD A;  2VMO A;  2W7J A;  5M4B A;  1SF2 A;  4AH3 A;  5M46 A;  3F0H A;  2G7J A;  2W7M A;  4BA4 A;  1YJY A;  3LY1 A;  5EUE A;  2O0R A;  1IX7 A;  4W5K A;  3NU8 A;  1WKH A;  2E7U A;  1ASN A;  3PDB A;  1CS1 A;  1M0N A;  1V2E A;  1IVR A;  1TOJ A;  4ISY A;  3AEM A;  2R5C A;  1AAW A;  1CQ8 A;  1CQ6 A;  2VGZ A;  1UKJ A;  3LVK A;  3NDN A;  3TFT A;  3MC6 A;  4R8D A;  3WCN A;  2D64 A;  2A1V A;  4K05 A;  2C44 A;  3JZL A;  1AIB A;  3QBO A;  3NRA A;  2VLH A;  2YCT A;  4F5L A;  1B4X A;  5AX8 A;  3I4J A;  4Q75 A;  1KL2 A;  2OAT A;  3CQ6 A;  1X29 A;  4M2M A;  5FT6 A;  2VMR A;  1SFF A;  1QGN A;  1SZS A;  3DU4 A;  1ART A;  1IAX A;  3AEL A;  3DOD A;  1ASE A;  2VGV A;  1P3W A;  2ZY5 A;  2EGY A;  4LNL A;  3JWB A;  4RKD A;  3M5U A;  2W8J A;  3PDX A;  1S09 A;  4DGT A;  1G7X A;  2X5F A;  2ZY3 A;  3KKI A;  2AY7 A;  3VK3 A;  3HQT A;  3B1C A;  4RLG A;  2AEV A;  1G7W A;  4UHO A;  4DBC A;  4W1V A;  3ASA A;  5E4Z A;  3COG A;  3EIA A;  4RIT A;  1EG5 A;  2CTZ A;  4TMR A;  4IW7 A;  1M0O A;  5M4D A;  3WGB A;  3RUY A;  2JJH A;  3FD0 A;  1W3U A;  2R2N A;  4LNM A;  1JF9 A;  2BI1 A;  4WBT A;  3NTJ A;  1Z7D A;  1AHY A;  2AAT A;  3TAT A;  2OQX A;  3HL2 A;  3MKJ A;  4ITX A;  1PG8 A;  1DKA A;  1GD9 A;  5HHY A;  1S07 A;  4FL0 A;  2VIB A;  3G0T A;  3WLX A;  2ZY4 A;  2V0Y A;  1QJ3 A;  4LNJ A;  4XJP A;  5EFS A;  4CBR A;  1BJO B;  2Z20 A;  2W7L A;  1AMS A;  1DJ9 A;  3N7N A;  3AAT A;  2Z9X A;  1ZOD A;  2BWO A;  1PMO A;  4EB5 A;  5G2Q A;  4UOY A;  2HP1 A;  1BS0 A;  4MGR A;  2EO5 A;  3PGY A;  3QHX A;  1KL1 A;  3BB8 A;  2QB3 A;  2OKK A;  5EUD A;  2BHX A;  2W7D A;  2ZC0 A;  4OBU A;  4WYA A;  1GC3 A;  2AY4 A;  3EI7 A;  2BI9 A;  3FKD A;  2Z9W A;  3OKS A;  3FDB A;  3ZRP A;  2GSA A;  3L44 A;  3CQ5 A;  1QIS A;  2D7Z A;  3E9K A;  3B1E A;  4ITG A;  4ZLV A;  2BIG A;  3DYD A;  3EI5 A;  1I41 A;  3FZ8 A;  1UU1 A;  2HOY A;  5D5S A;  5J8Q A;  4A72 A;  1BJO A;  2BI5 A;  1C9C A;  3PJ0 A;  1AX4 A;  4NOG A;  4WB0 B;  1AHF A;  1VJO A;  2R5E A;  2HUF A;  1AMQ A;  3VOM A;  2EPJ A;  2OKJ A;  2W8W A;  3B46 A;  4CBS A;  1V72 A;  1CQ7 A;  3JU7 A;  1ELQ A;  1KMJ A;  4XJM A;  2VMQ A;  3I16 A;  2YKY A;  1GCK A;  1MAQ A;  3TQX A;  1V2D A;  3B8X A;  3QGU A;  2AY6 A;  1ARH A;  1YJS A;  4WXG A;  5FT8 A;  3GZD A;  1E5E A;  3LVM A;  3A9X A;  2VYC A;  3DR7 A;  1ARI A;  4JEY A;  4JE5 D;  3ZRR A;  3ZRQ A;  4CXQ A;  3FDD A;  1ASA A;  1SPA A;  3A2B A;  1AKA A;  5DB5 A;  3HDO A;  4PFF A;  1TOI A;  4WP0 A;  2WK8 A;  4N0W A;  2ZP7 A;  2DGK A;  3N4S A;  1ARS A;  4MQP A;  4WB0 A;  3W1H A;  4A6R A;  2HOX A;  4EMY A;  3FVU A;  1M6S A;  5EUN A;  4EB7 A;  3LVJ A;  4O6Z A;  3DC1 A;  3GET A;  1WYT B;  1BJW A;  2FYF A;  3AEM C;  2JJF A;  3FFR A;  3P6K A;  1ASC A;  4BHD A;  1GBN A;  1D7S A;  5G0A A;  5FT4 A;  1ECX A;  3MC6 C;  4ZDO A;  4UQV A;  1QJ5 A;  2OGA A;  4LW4 A;  3WKR A;  2VMN A;  3ISL A;  4MKK A;  2VMU A;  1OXO A;  1TPL A;  3E6G A;  4WD2 A;  2VMV A;  1E5F A;  1B5P A;  2BIA A;  1C4K A;  1KKJ A;  2ZY2 A;  2YRR A;  1UU0 A;  3PAA A;  3ECD A;  1BKG A;  1N31 A;  2BYJ A;  3FFH A;  1MGV A;  4M2K A;  2OGE A;  4ZAS A;  5TF5 A;  1WYT A;  2D7Y A;  1YOO A;  3QI6 A;  4F5F A;  4ADD A;  1CZE A;  3NYS A;  1C7O A;  1AHG A;  4GE7 A;  4F5I A;  1O69 A;  2NMP A;  5G4I A;  1ZOB A;  3E2Z B;  4JEW A;  3GBX A;  4JE5 A;  4OTL A;  4Q6R A;  1QIR A;  1W7M A;  2W7K A;  4UHN A;  4WXF A;  2R0T A;  3F6T A;  3AEO A;  2BYL A;  3DRD A;  3F9T A;  1AMA A;  5G2P A;  1DJU A;  4TN4 A;  2VGS A;  4AZK A;  4MQR A;  2GMU A;  2VMZ A;  3KGX A;  5EAV A;  4AO9 A;  2QA3 A;  1B9I A;  1AIC A;  2XBN A;  3VP6 A;  4IYO B;  1H0C A;  4OMA A;  3K40 A;  4WYG A;  2AY2 A;  1AY4 A;  3BS8 A;  4JEV A;  3BC8 A;  3CAI A;  2O1B A;  3OP7 A;  2ZUK A;  2G6W A;  4WLJ A;  3ZZJ A;  1RV3 A;  4TV7 A;  9AAT A;  1BW0 A;  4W8I A;  2QBT A;  1C7N A;  1I43 A;  2ORD A;  3E2F A;  3E2Z A;  1LW4 A;  5LHA A;  4A0R A;  3QN6 A;  3PD6 B;  3BCB A;  4W1X A;  2CAN A;  3FQA A;  1DJE A;  3FQ7 A;  2RFV A;  4KYO A;  4PFN A;  4WLH A;  3WZF A;  3N4X A;  1JS3 A;  1O4S A;  3AEJ A;  3N75 A;  1XEY A;  2W8T A;  2C81 A;  3DXW A;  4LW2 A;  2YOB A;  1YJZ A;  2FNI A;  4IYO A;  1SZK A;  3UWC A;  4CXR A;  2WK9 A;  2Z1Z A;  4F5J A;  3RCH B;  3FZ6 A;  1BJN A;  4XQ2 A;  1AY5 A;  2BIE A;  3AEP A;  1ASL A;  5DX5 A;  3K28 A;  1AHE A;  3DZZ A;  4FFC A;  4GDY A;  1JG8 A;  4B98 A;  3PD6 A;  4JEX A;  3D6K A;  4UHM A;  7AAT A;  3H9X A;  2WK7 A;  3N4R A;  1BQA A;  4ADC A;  1FC4 A;  1QIT A;  4ZWM A;  2DOU A;  4A6U A;  1YIY A;  3GZD C;  3USF A;  1LKC A;  2AY9 A;  5D95 A;  5F9S A;  2AY3 A;  2YCN A;  4J5U A;  2BWN A;  5E3K A;  4ADE A;  3UAK A;  4ZWV A;  2CST A;  1LW5 A;  2W7G A;  3RCH A;  4A0H A;  3EIB A;  1GEW A;  3H14 A;  2XH1 A;  3BCA A;  1TOE A;  3R9A A;  3T32 A;  3G8M A;  2CIN A;  2DR1 A;  1IAY A;  2FQ6 A;  2QB2 A;  1M7Y A;  3JTX A;  5LH9 A;  3MBB A;  2WB6 A;  4E3R A;  4K2I A;  4OC9 A;  2W8U A;  3AOW A;  4RAE A;  4E1O A;  4KXK A;  1RV4 A;  1FG7 A;  1WYV B;  3EZS A;  1VP4 A;  2VMX A;  1Y4I A;  2D63 A;  3FRK A;  4WXB A;  4Y0D A;  1IUG A;  1C7G A;  1MDZ A;  1U08 A;  3QPG A;  4IX8 A;  1OHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...