1IX6A

Aspartate aminotransferase active site mutant v39f
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGFYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate Aminotransferase
publication title Conformational change in aspartate aminotransferase on substrate binding induces strain in the catalytic group and enhances catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 131
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1ix6A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1ix6A01
1EQBA 1IJIA 1M0OA 4IXOA 4ZSWA 2D5YA 3K28A 4F5MA 1LS3A 4GSAA 4O6ZA 4GE7A 4F5LA 1VJOA 2R5EA 3G8MA 7AATA 4WXBA 3RBFA 5F9SA 4N0BA 4A6TA 2ZY3A 1M4NA 2BI3A 2ZUKA 2BWPA 5FT6A 4FL0A 4XEWA 1M0PA 1B5PA 3FVXA 3WKRA 1UKJA 1X2AA 4ATPA 3K7YA 3PA9A 4RKDA 1Z7DA 3E6GA 2CSTA 1KMKA 3WX9A 4K2MA 3DR4A 4ZDPA 3DC1A 4ADBA 4A0HA 3AEMA 1M7YA 1ZOBA 3KE3A 1LC7A 1LKCA 3NDNA 4OCAA 5J8QA 3WY7A 4P7YA 3TQXA 3CQ6A 1TATA 4TV7A 1V2DA 2BWOA 1AMSA 1WSTA 3DODA 1WYVA 2EZ1A 1S07A 2YKYA 3CBFA 4LW2A 3EI5A 4WXFA 4Y0HA 5G2QA 2HUIA 3A9ZA 1C7OA 1AMQA 1X29A 3GSBA 4Q31A 2VMRA 4IY7A 3BWOA 1I48A 1AY5A 1AHYA 1AX4A 4RIZA 1B4XA 1G7WA 2D65A 3EI7A 1V2FA 2DGMA 2HORA 4B98A 5EQCA 1ARGA 2CANA 3R4TA 2W8WA 2CTZA 3R9AA 3QN6A 2R2NA 1ASLA 1ASEA 1LW5A 5DX5A 1C0NA 1Y4IA 3D6KA 1JS3A 4BA4A 4RJYA 2BKWA 1OXPA 4PFFA 2AATA 4E77A 2QB2A 4BA5A 2F8JA 2X5DA 4Q76A 5M49A 1KMJA 1M32A 1DJEA 1WYUB 2C7TA 2YCNA 2YKVA 3AEJC 4PVFA 4XJOA 1CQ7A 1H0CA 5DJ1A 1JG8A 4RM1A 1SF2A 3DZZA 3ASAA 5M4BA 1N2TA 4JEVA 2AY3A 4W1WA 2CH2A 1J32A 2FQ6A 1CL1A 4ADCA 1S06A 2VI8A 5E5IA 1PMOA 2W8VA 2WK8A 3BCBA 3BN1A 3JWBA 3MKJA 4MQRA 2E7UA 3VAXA 4XJPA 4WYFA 4RITA 2VGTA 2VGVA 3UE8A 3PD6A 3F9TA 1AAMA 2BWNA 3MAUA 4MKKA 3JWAA 3AEJA 3WKSA 5EFSA 4A6RA 2BI5A 2OGEA 3I16A 4FFCA 3ZZKA 4ADEA 3FQAA 1WYVB 1ELQA 5G4JA 4RLGA 2AY6A 3ECDA 4JE5D 2VGSA 2FNIA 1ASCA 1C9CA 4GDYA 3RUYA 3FVSA 5EIGB 1AMRA 2W8TA 2HZPA 4DBCA 1CS1A 1M6SA 3CQ4A 3RCHA 1TOGA 4BHDA 2HOZA 4BMKA 2WK9A 4UHOA 2HUFA 3I4JA 3FZ7A 4MSOA 1JF9A 3B1DA 3NYUA 3GBXA 2VLFA 5IWQA 1BKGA 3UWCA 4OBUA 3KGWA 2VMUA 3A2BA 1GC4A 4ITGA 3GZCA 1C4KA 1AIAA 4WBTA 5EAAA 4WYAA 2W7MA 5FT4A 4W1XA 3BS8A 1AAWA 4W5KA 1O62A 4UHMA 4WYDA 4AO9A 3BCXA 3NTJA 4E3RA 1KKPA 1M0NA 2R5CA 2X3LA 1D7RA 4F4EA 1TPLA 2DGLA 2BI9A 2O1BA 5BJ4A 1GEYA 3PDXA 4EU1A 1GC0A 3PJ0A 5EUNA 4A00A 1OHVA 4JE5A 3USFA 2BYLA 4ZDLA 4AO4A 3LWSA 2XBNA 2ORDA 4IYOB 2CB1A 3FFHA 2Z61A 1ASDA 2Z67A 3AELA 4GE4A 4CBRA 4F5KA 3PD6B 4ZDOA 1MAQA 4WB0A 3PGYA 2YKXA 1AJSA 2RFVA 1D7UA 1ARTA 1D7SA 4XQ2A 2BIEA 4TN4A 1WYUA 1GEWA 3EI9A 3HBXA 3NNKA 1AMAA 3FCRA 4CXQA 4WYCA 2PB2A 1G7XA 3NRAA 1B9HA 2CY8A 4ZASA 5K8BA 2ZYJA 1OXOA 2O0RA 1TOEA 4J8LA 5DB5A 3HLMA 4A0FA 1ARSA 3E2FA 3RCHB 1D7VA 5FT5A 1N8PA 2D61A 1B5OA 4GE9A 1KKJA 2NMPA 4JF1A 2ZY2A 2W7GA 3FQ8A 3AOVA 3DU4A 3DRDA 4WYEA 1QJ5A 2WKAA 1G4XA 1U08A 1ASGA 2DGKA 3KKIA 1MDOA 9AATA 3ZRRA 5FT8A 3E9KA 1BQDA 3HDOA 4ATQA 1MGVA 4JF0A 1OHWA 4JEWA 2AY1A 1BJ4A 4DQ6A 1WYTB 3E2ZA 4TMRA 1S08A 1ELUA 2ZC0A 3QI6A 2W7EA 3GJUA 1GD9A 2FNUA 1IX6A 1AKBA 2VGZA 3BB8A 4OTLA 4W1VA 2Q7WA 5EIGA 2YRIA 1GDEA 2R5CB 1OHYA 5HDMA 4AZJA 3G7QA 1ZC9A 4OMAA 4B9BA 3JTXA 2FYFA 1RV4A 2ZY5A 2D66A 1S0AA 4J5UA 4A72A 2E7IA 2Z20A 3GETA 5G2PA 4KXKA 1IAYA 3F6TA 4F5FA 1SPAA 1XEYA 2E54A 4LNLA 2CJGA 4WB0B 2ZSLA 3A9YA 1AJSB 3E77A 1W23A 4LNMA 2AY8A 3ZZJA 4ZAHA 1O61A 4M2JA 4EMYA 1W7LA 4WYGA 4HVKA 3BV0A 1BJNA 1DFOA 1RVYA 1YOOA 2BI2A 3QGUA 5TF5A 5C6UA 3N5MA 4R8DA 1YJYA 3ELEA 1TOIA 3M5UA 1YIYA 2VMQA 4WLHA 3TFUA 2BYJA 1RV3A 1X0MA 1E5FA 4KYOA 3EZ1A 2VMOA 3F0HA 1AKAA 2D63A 2W7KA 2GSAA 4GRXA 3P1TA 1W3UA 1C7GA 1MAPA 3FQ7A 3EI6A 2W7JA 4A0GA 2HP2A 4JEYA 2GMSA 2QA3A 4IYOA 3HL2A 1EG5A 3NUIA 3AEOA 4F5IA 4HF8A 1CJ0A 3FDDA 1BQAA 3AATA 2OGAA 2V1PA 1ASMA 5D5SA 4Q6RA 3FVUA 1YAAA 1DJUA 2VGUA 2OQXA 2E7JA 4F5GA 2QBTA 3ACZA 1PFFA 4RAEA 5D95A 1GEXA 2EH6A 2YHKA 3DXVA 3E2ZB 1IX8A 3LVLB 3LVJA 4R2NA 3ZRPA 1LW4A 2BHXA 3AENB 1TOJA 2W8UA 2YRRA 1ASNA 1B9IA 2BIAA 3PPLA 2JGTA 1I41A 2QLRA 3NYTA 1AICA 1E5EA 4RKCA 1Z3ZA 1UU0A 1ASFA 1BS0A 1PMMA 3BWNC 4Y0DA 5M46A 3KGXA 4LNJA 4F5JA 3L44A 2PB0A 3HVYA 3CAIA 3FFRA 1YJZA 2C0RA 4Y0IA 1BJOA 2VGWA 1JS6A 4OC9A 3AV7A 1QIRA 3RQ1A 5AX8A 3HQTA 1S09A 3EI8A 2CJDA 3VK2A 1ASBA 1WYTA 1DGEA 3AEPA 3E2YA 1CL2A 4A0RA 1YJSA 2FM1A 4WLJA 1CZCA 1ARIA 4UQVA 3AOWA 2QB3A 5LH9A 3FTBA 1TOKA 2VYCA 4WXGA 3BWNA 3EUCA 3NU8A 3HT4A 3WCOA 1MLZA 3ISLA 3UAKA 1DJ9A 1GBNA 2VMXA 4MY5A 1AHEA 5EUEA 2AY2A 1AHGA 4A6UA 2ZP7A 3RI6A 1AIBA 4I8AA 3L8AA 4UHNA 3K40A 4ZSYA 2TPLA 3LVKA 1IX7A 2DKBA 3WGCA 3MBBA 2R0TA 1W7NA 1KL2A 1SVVA 3JW9A 5DJ9A 2Z1YA 2YCTA 3COGA 4LW4A 5HXXA 1FC4A 1AHFA 3JU7A 5I92A 2HOYA 1I29A 3T32A 3IHJA 4U2HA 3HMUA 3H14A 2HOXA 3WLXA 2AEVA 4KAMA 2DR1A 3PDBB 4XJMA 2AEUA 3CQ5A 3DXWA 4JEXA 3VK4A 3ZRQA 4IXZA 1W7MA 3JZLA 1BJOB 1QITA 5LHAA 2AY5A 1XI9A 2X8UA 1DKAA 1OATA 1TASA 2XH1A 4E3QA 4ZM4A 1ORDA 4ISYA 2EO5A 3DYDA 2Z9UA 2YCPA 3AENA 4UOYA 3TCMA 1LK9A 1ARHA 3WGBA 3TFTA 4U1TA 4XK1A 1N31A 4F5HA 1IAXA 1KL1A 2EPJA 2OKKA 3MAFA 3GZDC 1D2FA 3NYSA 4K2IA 5EAVA 1B8GA 4CBSA 4QGRA 1ZODA 2VMPA 3TATA 1FG7A 2FN6A 3DR7A 3G0TA 3ATHA 3FZ8A 3NU7A 1H1CA 4BQ0A 1O69A 4ZWMA 1GC3A 3EIAA 1G4VA 4W8IA 2EGYA 3BC8A 1SZUA 1YIZA 2V0YA 2VIAA 3FRKA 3IF2A 4IXSA 1I43A 3EIBA 1QJ3A 2W7IA 3N75A 1UU2A 1T3IA 2D7ZA 3VOMA 2OATA 4Q75A 1SZSA 3B1CA 4ZWVA 3MEBA 1AKCA 3LVMA 3N0LA 3GZDA 5HHYA 3QHXA 3B1EA 3EZSA 1QZ9A 2VLHA 1BW0A 2HP1A 1FG3A 2DKJA 4PFNA 4CVQA 1PG8A 4E1OA 2VI9A 8AATA 4WP0A 1BT4A 2VMNA 3GWPA 4MGRA 4MQQA 1CZEA 3GR9A 4ZLVA 4H51A 1MLYA 2JJFA 2D64A 2EZ2A 1M0QA 2BI1A 3Q8NA 3RBLA 2JJHA 5F8VA 4AOAA 1RVUA 3PIUA 4M2KA 1QGNA 1LC8A 2JISA 4L0OA 2VMYA 3MADA 1DGDA 5G09A 2YOBA 2GQNA 3MC6C 1ECXA 4R5ZA 4RJ0A 2PO3A 5EUDA 5G4IA 3B46A 3VP6A 1AJRA 1WKHA 4XAUA 3OP7A 1J04A 1YNUA 2AY7A 3I5TA 5M4DA 1IUGA 4WD2A 3MAFB 5G0AA 4K2BA 4EB7A 3QM2A 2YKUA 3NUBA 1VP4A 1ASAA 1AY8A 5E3KA 1WKGA 2VIBA 3WCNA 4ITXA 2W7FA 3FZ6A 4DGTA 1V2EA 3PDBA 1P3WA 1AY4A 3B8XA 4OBVA 3FSLA 1X28A 4NOGA 2AY9A 4W91A 4N0WA 4IW7A 3VK3A 4R5FA 4ZM3A 3MC6A 3W1IA 2CJHA 4IX8A 1SZKA 4AZKA 4GEBA 2W7HA 2CFBA 1UU1A 3FDBA 2GB3A 3P6KA 3W1HA 2Z9VA 4P3MA 2ZY4A 2WK7A 2OKJA 1AHXA 1IBJA 1IVRA 3A8UX 4XJLA 3A9XA 1CQ8A 4ADDA 4CXRA 5E4ZA 3LY1A 4JEZA 2JG2A 2X5FA 3NX3A 1VEFA 2VMZA 3LV2A 2JJEA 1BJWA 2DOUA 2BIGA 2Z1ZA 4OT8A 1V72A 1LC5A 2W8JA 3BCAA 3PAAA 3QPGA 2ZSMA 1GC2A 1SFFA 2AY4A 3W1JA 3FD0A 2G6WA 1EJIA 2Z9WA 3LG0A 3FKDA 3H7FA 2VMWA 3WZFA 2Z9XA 1QISA 2CH1A 3OKSA 4OYTA 1GCKA 3ASBA 5JAYA 1CQ6A 1O4SA 2O7CA 4M2MA 4AH3A 2C81A 3II0A 1TARA 2W7DA 4PIWA 4MQPA 2W7LA 2VMTA 1DTYA 1MDZA 3ELPA 5BJ3A 3QBOA 2CINA 4EFFA 2VMVA 2ZJGA 1MDXA 1C7NA 2D7YA 2VMSA 2GMUA 2JJGA 2HUUA 4EB5A 3AEMC 4MKJA 2QMAA 4LC3A 2C44A
chains in the Genus database with same CATH superfamily
1EQBA 1IJIA 1M0OA 4IXOA 4ZSWA 2D5YA 3K28A 4F5MA 1LS3A 4GSAA 4O6ZA 4GE7A 4F5LA 1VJOA 2R5EA 3G8MA 7AATA 4WXBA 3RBFA 5F9SA 4N0BA 4A6TA 2ZY3A 1M4NA 2BI3A 2ZUKA 2BWPA 5FT6A 4FL0A 4XEWA 1M0PA 1B5PA 3FVXA 3WKRA 1UKJA 1X2AA 4ATPA 3K7YA 3PA9A 4RKDA 1Z7DA 3E6GA 2CSTA 1KMKA 3WX9A 4K2MA 3DR4A 4ZDPA 3DC1A 4ADBA 4A0HA 3AEMA 1M7YA 1ZOBA 3KE3A 1LC7A 1LKCA 3NDNA 4OCAA 5J8QA 3WY7A 4P7YA 3TQXA 3CQ6A 1TATA 4TV7A 1V2DA 2BWOA 1AMSA 1WSTA 3DODA 1WYVA 2EZ1A 1S07A 2YKYA 3CBFA 4LW2A 3EI5A 4WXFA 4Y0HA 5G2QA 2HUIA 3A9ZA 1C7OA 1AMQA 1X29A 3GSBA 4Q31A 2VMRA 4IY7A 3BWOA 1I48A 1AY5A 1AHYA 1AX4A 4RIZA 1B4XA 1G7WA 2D65A 3EI7A 1V2FA 2DGMA 2HORA 4B98A 5EQCA 1ARGA 2CANA 3R4TA 2W8WA 2CTZA 3R9AA 3QN6A 2R2NA 1ASLA 1ASEA 1LW5A 5DX5A 1C0NA 1Y4IA 3D6KA 1JS3A 4BA4A 4RJYA 2BKWA 1OXPA 4PFFA 2AATA 4E77A 2QB2A 4BA5A 2F8JA 2X5DA 4Q76A 5M49A 1KMJA 1M32A 1DJEA 1WYUB 2C7TA 2YCNA 2YKVA 3AEJC 4PVFA 4XJOA 1CQ7A 1H0CA 5DJ1A 1JG8A 4RM1A 1SF2A 3DZZA 3ASAA 5M4BA 1N2TA 4JEVA 2AY3A 4W1WA 2CH2A 1J32A 2FQ6A 1CL1A 4ADCA 1S06A 2VI8A 5E5IA 1PMOA 2W8VA 2WK8A 3BCBA 3BN1A 3JWBA 3MKJA 4MQRA 2E7UA 3VAXA 4XJPA 4WYFA 4RITA 2VGTA 2VGVA 3UE8A 3PD6A 3F9TA 1AAMA 2BWNA 3MAUA 2WB6A 4MKKA 3JWAA 3AEJA 3WKSA 5EFSA 4A6RA 2BI5A 2FKIA 2OGEA 3I16A 4FFCA 3ZZKA 4ADEA 2QSRA 3FQAA 1WYVB 1ELQA 5G4JA 4RLGA 2AY6A 3ECDA 4JE5D 2VGSA 2FNIA 1ASCA 1C9CA 4GDYA 3RUYA 3FVSA 5EIGB 1AMRA 2W8TA 1KAFA 2HZPA 4DBCA 1CS1A 1M6SA 3CQ4A 3RCHA 1TOGA 4BHDA 2HOZA 4BMKA 2WK9A 4UHOA 2HUFA 3I4JA 3FZ7A 4MSOA 1JF9A 3B1DA 3NYUA 3GBXA 2VLFA 5IWQA 1BKGA 2KFPA 3UWCA 4OBUA 3KGWA 2VMUA 3A2BA 1GC4A 4ITGA 4H63Q 3GZCA 1C4KA 1AIAA 4WBTA 5EAAA 4WYAA 2W7MA 5FT4A 4W1XA 3BS8A 1AAWA 4W5KA 1O62A 4UHMA 4WYDA 4AO9A 3BCXA 3NTJA 4E3RA 1KKPA 1M0NA 2R5CA 2X3LA 1D7RA 4F4EA 1TPLA 2DGLA 2BI9A 2O1BA 5BJ4A 1GEYA 3PDXA 4EU1A 1GC0A 3PJ0A 5EUNA 4A00A 1OHVA 4JE5A 3USFA 2BYLA 4ZDLA 4AO4A 3LWSA 2XBNA 2ORDA 3N4RA 4IYOB 2CB1A 3FFHA 2Z61A 1ASDA 2Z67A 3AELA 4GE4A 4CBRA 4F5KA 3PD6B 4ZDOA 1MAQA 4WB0A 3PGYA 2YKXA 1AJSA 2RFVA 1D7UA 1ARTA 1D7SA 4XQ2A 2BIEA 4TN4A 1WYUA 1GEWA 3EI9A 3HBXA 3NNKA 1AMAA 3FCRA 4CXQA 4WYCA 2PB2A 1G7XA 3NRAA 1B9HA 2CY8A 4ZASA 5K8BA 2ZYJA 1OXOA 2O0RA 1TOEA 4J8LA 5DB5A 3HLMA 4A0FA 1ARSA 3E2FA 3RCHB 1D7VA 5FT5A 1N8PA 2D61A 1B5OA 4GE9A 1KKJA 2NMPA 4JF1A 2ZY2A 2W7GA 3FQ8A 3AOVA 3DU4A 3DRDA 4WYEA 1QJ5A 2WKAA 3N4XA 1G4XA 1U08A 1ASGA 2DGKA 3KKIA 1MDOA 9AATA 3ZRRA 5FT8A 3E9KA 1BQDA 3HDOA 4ATQA 1MGVA 4JF0A 1OHWA 4JEWA 2AY1A 1BJ4A 4DQ6A 1WYTB 3E2ZA 4TMRA 1S08A 1ELUA 2ZC0A 3QI6A 2W7EA 3GJUA 1GD9A 2FNUA 1IX6A 1AKBA 2VGZA 3BB8A 4OTLA 4W1VA 2Q7WA 5EIGA 2YRIA 1GDEA 2R5CB 1OHYA 5HDMA 4AZJA 3G7QA 1ZC9A 2G7JA 4OMAA 4B9BA 3JTXA 2FYFA 1RV4A 2ZY5A 2D66A 1S0AA 4J5UA 4A72A 2E7IA 2Z20A 3GETA 5G2PA 4KXKA 1IAYA 3F6TA 4F5FA 1SPAA 1XEYA 2E54A 4LNLA 2CJGA 4WB0B 2ZSLA 3A9YA 1AJSB 3E77A 1W23A 4LNMA 2AY8A 3ZZJA 4ZAHA 1O61A 4M2JA 4EMYA 1W7LA 4WYGA 4HVKA 3BV0A 1BJNA 1DFOA 1RVYA 1YOOA 2BI2A 3QGUA 5TF5A 5C6UA 3N5MA 4R8DA 1YJYA 3ELEA 1TOIA 3M5UA 1YIYA 2VMQA 4WLHA 3TFUA 2BYJA 1RV3A 1X0MA 1E5FA 4KYOA 3EZ1A 2EYQA 2VMOA 3F0HA 1AKAA 2D63A 2W7KA 2GSAA 4GRXA 3P1TA 1W3UA 1C7GA 1MAPA 3FQ7A 3EI6A 2W7JA 4A0GA 2HP2A 4JEYA 2GMSA 2QA3A 4IYOA 3HL2A 1EG5A 3NUIA 3AEOA 4F5IA 4HF8A 1CJ0A 3FDDA 1BQAA 3AATA 2OGAA 2V1PA 1ASMA 5D5SA 4Q6RA 3FVUA 1YAAA 1DJUA 2VGUA 2OQXA 2E7JA 4F5GA 2QBTA 3ACZA 1PFFA 4RAEA 5D95A 1GEXA 2EH6A 2YHKA 3DXVA 3E2ZB 1IX8A 3LVLB 3LVJA 4R2NA 3ZRPA 1LW4A 2BHXA 3AENB 1TOJA 2W8UA 2YRRA 1ASNA 1B9IA 2BIAA 3PPLA 2JGTA 1I41A 2QLRA 3NYTA 1AICA 1E5EA 4RKCA 1Z3ZA 1UU0A 1ASFA 1BS0A 1PMMA 3BWNC 4Y0DA 5M46A 3KGXA 4LNJA 4F5JA 3L44A 2PB0A 3HVYA 3CAIA 3FFRA 1YJZA 2C0RA 4Y0IA 1BJOA 2VGWA 1JS6A 4OC9A 3AV7A 1QIRA 3RQ1A 5AX8A 3HQTA 1S09A 3EI8A 2CJDA 3VK2A 1ASBA 1WYTA 1DGEA 3AEPA 3E2YA 1CL2A 4A0RA 1YJSA 2FM1A 4WLJA 1CZCA 1ARIA 4UQVA 3AOWA 2QB3A 5LH9A 3FTBA 1TOKA 2VYCA 4WXGA 3BWNA 3EUCA 3NU8A 3HT4A 3WCOA 1MLZA 3ISLA 3UAKA 1DJ9A 1GBNA 2VMXA 4MY5A 1AHEA 5EUEA 2AY2A 1AHGA 4A6UA 2ZP7A 3RI6A 1AIBA 4I8AA 3L8AA 4UHNA 3K40A 4ZSYA 2TPLA 3LVKA 1IX7A 2DKBA 3WGCA 3MBBA 2R0TA 1W7NA 1KL2A 1SVVA 3JW9A 5DJ9A 2Z1YA 2YCTA 3COGA 4LW4A 5HXXA 1FC4A 1AHFA 3JU7A 5I92A 2HOYA 1I29A 3T32A 3IHJA 4U2HA 3HMUA 3H14A 2HOXA 3WLXA 2AEVA 4KAMA 2DR1A 3PDBB 4XJMA 3N7NA 2AEUA 3CQ5A 3DXWA 4JEXA 3VK4A 3ZRQA 4IXZA 1W7MA 3JZLA 1BJOB 5KTBA 1QITA 5LHAA 2AY5A 1XI9A 2X8UA 1DKAA 1OATA 1TASA 2XH1A 4E3QA 4ZM4A 1ORDA 4ISYA 2EO5A 3DYDA 2Z9UA 2YCPA 3AENA 4UOYA 3TCMA 1LK9A 1ARHA 3WGBA 3TFTA 4U1TA 4XK1A 1N31A 4F5HA 1IAXA 1KL1A 2EPJA 2OKKA 3MAFA 3GZDC 1D2FA 3NYSA 4K2IA 5EAVA 1B8GA 4CBSA 4QGRA 1ZODA 2VMPA 3TATA 1FG7A 2FN6A 3DR7A 3G0TA 3ATHA 3FZ8A 3NU7A 1H1CA 3N4SA 4BQ0A 4K05A 1O69A 4ZWMA 1GC3A 3EIAA 1G4VA 4W8IA 2EGYA 3BC8A 1SZUA 1YIZA 2V0YA 2VIAA 3FRKA 3IF2A 4IXSA 1I43A 3EIBA 1QJ3A 2W7IA 3N75A 1UU2A 1T3IA 2D7ZA 3VOMA 2OATA 4Q75A 1SZSA 3B1CA 4ZWVA 3MEBA 1AKCA 3LVMA 3N0LA 3GZDA 5HHYA 3QHXA 3B1EA 3EZSA 1QZ9A 2VLHA 1BW0A 2HP1A 1FG3A 2DKJA 4PFNA 4CVQA 1PG8A 4E1OA 2VI9A 8AATA 4WP0A 1BT4A 2VMNA 3GWPA 4MGRA 4MQQA 1CZEA 3GR9A 4ZLVA 4H51A 1MLYA 3H9XA 2JJFA 2D64A 2EZ2A 1M0QA 2BI1A 3Q8NA 3RBLA 2JJHA 5F8VA 4AOAA 1RVUA 3PIUA 4M2KA 1QGNA 1LC8A 2JISA 4L0OA 2VMYA 3MADA 1DGDA 5G09A 2YOBA 2GQNA 3MC6C 1ECXA 4R5ZA 4RJ0A 2PO3A 5EUDA 5G4IA 3B46A 3VP6A 1AJRA 1WKHA 4XAUA 3OP7A 1J04A 1YNUA 2AY7A 3I5TA 5M4DA 1IUGA 4WD2A 3MAFB 5G0AA 4K2BA 4EB7A 3QM2A 2YKUA 3NUBA 1VP4A 1ASAA 1AY8A 5E3KA 1WKGA 2VIBA 3WCNA 4ITXA 2W7FA 3FZ6A 4DGTA 1V2EA 3PDBA 1P3WA 1AY4A 3B8XA 4OBVA 3FSLA 1X28A 4NOGA 2AY9A 4W91A 4N0WA 4IW7A 3VK3A 4R5FA 4ZM3A 3MC6A 3W1IA 2CJHA 4IX8A 1SZKA 4AZKA 2A1VA 4GEBA 2W7HA 2CFBA 1UU1A 3FDBA 2GB3A 3P6KA 3W1HA 2Z9VA 4P3MA 2ZY4A 2WK7A 2OKJA 1AHXA 1IBJA 1IVRA 3A8UX 4XJLA 3A9XA 1CQ8A 4ADDA 4CXRA 5E4ZA 3LY1A 4JEZA 2JG2A 2X5FA 3NX3A 1VEFA 2VMZA 3LV2A 2JJEA 1BJWA 2DOUA 2BIGA 2Z1ZA 4OT8A 1V72A 1LC5A 2W8JA 3BCAA 3PAAA 3QPGA 2ZSMA 1GC2A 1SFFA 2AY4A 3W1JA 3FD0A 2G6WA 1EJIA 2Z9WA 3LG0A 3FKDA 3H7FA 2VMWA 3WZFA 2Z9XA 1QISA 2CH1A 3OKSA 4OYTA 1GCKA 3ASBA 5JAYA 1CQ6A 1O4SA 2O7CA 4M2MA 4AH3A 2C81A 3II0A 1TARA 2W7DA 4PIWA 4MQPA 2W7LA 2VMTA 1DTYA 1MDZA 3ELPA 5BJ3A 3QBOA 2CINA 4EFFA 2VMVA 2ZJGA 1MDXA 1C7NA 2D7YA 2VMSA 2GMUA 2JJGA 2HUUA 4EB5A 3AEMC 4MKJA 2QMAA 4LC3A 2C44A
chains in the Genus database with same CATH topology
1EQBA 1IJIA 1M0OA 4IXOA 4ZSWA 2D5YA 3K28A 4F5MA 1LS3A 4GSAA 4O6ZA 4GE7A 4F5LA 1VJOA 2R5EA 3G8MA 7AATA 4WXBA 3RBFA 5F9SA 4N0BA 4A6TA 2ZY3A 1M4NA 2BI3A 2ZUKA 2BWPA 5FT6A 4FL0A 4XEWA 1M0PA 1B5PA 3FVXA 3WKRA 1UKJA 1X2AA 4ATPA 3K7YA 3PA9A 4RKDA 1Z7DA 3E6GA 2CSTA 1KMKA 3WX9A 4K2MA 3DR4A 4ZDPA 3DC1A 4ADBA 4A0HA 3AEMA 1M7YA 1ZOBA 3KE3A 1LC7A 1LKCA 3NDNA 4OCAA 5J8QA 3WY7A 4P7YA 3TQXA 3CQ6A 1TATA 4TV7A 1V2DA 2BWOA 1AMSA 1WSTA 3DODA 1WYVA 2EZ1A 1S07A 2YKYA 3CBFA 4LW2A 3EI5A 4WXFA 4Y0HA 5G2QA 2HUIA 3A9ZA 1C7OA 1AMQA 1X29A 3GSBA 4Q31A 2VMRA 4IY7A 3BWOA 1I48A 1AY5A 1AHYA 1AX4A 4RIZA 1B4XA 1G7WA 2D65A 3EI7A 1V2FA 2DGMA 2HORA 4B98A 5EQCA 1ARGA 2CANA 3R4TA 2W8WA 2CTZA 3R9AA 3QN6A 2R2NA 1ASLA 1ASEA 1LW5A 5DX5A 1C0NA 1Y4IA 3D6KA 1JS3A 4BA4A 4RJYA 2BKWA 1OXPA 4PFFA 2AATA 4E77A 2QB2A 4BA5A 2F8JA 2X5DA 4Q76A 5M49A 1KMJA 1M32A 1DJEA 1WYUB 2C7TA 2YCNA 2YKVA 3AEJC 4PVFA 4XJOA 1CQ7A 1H0CA 5DJ1A 1JG8A 4RM1A 1SF2A 3DZZA 3ASAA 5M4BA 1N2TA 4JEVA 2AY3A 4W1WA 2CH2A 1J32A 2FQ6A 1CL1A 4ADCA 1S06A 2VI8A 5E5IA 1PMOA 2W8VA 2WK8A 3BCBA 3BN1A 3JWBA 3MKJA 4MQRA 2E7UA 3VAXA 4XJPA 4WYFA 4RITA 2VGTA 2VGVA 3UE8A 3PD6A 3F9TA 1AAMA 2BWNA 3MAUA 2WB6A 4MKKA 3JWAA 3AEJA 3WKSA 5EFSA 4A6RA 2BI5A 2FKIA 2OGEA 3I16A 4FFCA 3ZZKA 4ADEA 2QSRA 3FQAA 1WYVB 1ELQA 5G4JA 4RLGA 2AY6A 3ECDA 4JE5D 2VGSA 2FNIA 1ASCA 1C9CA 4GDYA 3RUYA 3FVSA 5EIGB 1AMRA 2W8TA 2HZPA 4DBCA 1CS1A 1M6SA 3CQ4A 3RCHA 1TOGA 4BHDA 2HOZA 4BMKA 2WK9A 4UHOA 2HUFA 3I4JA 3FZ7A 4MSOA 1JF9A 3B1DA 3NYUA 3GBXA 2VLFA 5IWQA 1BKGA 2KFPA 3UWCA 4OBUA 3KGWA 2VMUA 3A2BA 1GC4A 4ITGA 4H63Q 3GZCA 1C4KA 1AIAA 4WBTA 5EAAA 4WYAA 2W7MA 5FT4A 4W1XA 3BS8A 1AAWA 4W5KA 1O62A 4UHMA 4WYDA 4AO9A 3BCXA 3NTJA 4E3RA 1KKPA 1M0NA 2R5CA 2X3LA 1D7RA 4F4EA 1TPLA 2DGLA 2BI9A 2O1BA 5BJ4A 1GEYA 3PDXA 4EU1A 1GC0A 3PJ0A 5EUNA 4A00A 1OHVA 4JE5A 3USFA 2BYLA 4ZDLA 4AO4A 3LWSA 2XBNA 2ORDA 3N4RA 4IYOB 2CB1A 3FFHA 2Z61A 1ASDA 2Z67A 3AELA 4GE4A 4CBRA 4F5KA 3PD6B 4ZDOA 1MAQA 4WB0A 3PGYA 2YKXA 1AJSA 2RFVA 1D7UA 1ARTA 1D7SA 4XQ2A 2BIEA 4TN4A 1WYUA 1GEWA 3EI9A 3HBXA 3NNKA 1AMAA 3FCRA 4CXQA 4WYCA 2PB2A 1G7XA 3NRAA 1B9HA 2CY8A 4ZASA 5K8BA 2ZYJA 1OXOA 2O0RA 1TOEA 4J8LA 5DB5A 3HLMA 4A0FA 1ARSA 3E2FA 3RCHB 1D7VA 5FT5A 1N8PA 2D61A 1B5OA 4GE9A 1KKJA 2NMPA 4JF1A 2ZY2A 2W7GA 3FQ8A 3AOVA 3DU4A 3DRDA 4WYEA 1QJ5A 2WKAA 3N4XA 1G4XA 1U08A 1ASGA 2DGKA 3KKIA 1MDOA 9AATA 3ZRRA 5FT8A 3E9KA 1BQDA 3HDOA 4ATQA 1MGVA 4JF0A 1OHWA 4JEWA 2AY1A 1BJ4A 4DQ6A 1WYTB 3E2ZA 4TMRA 1S08A 1ELUA 2ZC0A 3QI6A 2W7EA 3GJUA 1GD9A 2FNUA 1IX6A 1AKBA 2VGZA 3BB8A 4OTLA 4W1VA 2Q7WA 5EIGA 2YRIA 1GDEA 2R5CB 1OHYA 5HDMA 4AZJA 3G7QA 1ZC9A 2G7JA 4OMAA 4B9BA 3JTXA 2FYFA 1RV4A 2ZY5A 2D66A 1S0AA 4J5UA 4A72A 2E7IA 2Z20A 3GETA 5G2PA 4KXKA 1IAYA 3F6TA 4F5FA 1SPAA 1XEYA 2E54A 4LNLA 2CJGA 4WB0B 2ZSLA 3A9YA 1AJSB 3E77A 1W23A 4LNMA 2AY8A 3ZZJA 4ZAHA 1O61A 4M2JA 4EMYA 1W7LA 4WYGA 4HVKA 3BV0A 1BJNA 1DFOA 1RVYA 1YOOA 2BI2A 3QGUA 5TF5A 5C6UA 3N5MA 4R8DA 1YJYA 3ELEA 1TOIA 3M5UA 1YIYA 2VMQA 4WLHA 3TFUA 2BYJA 1RV3A 1X0MA 1E5FA 4KYOA 3EZ1A 2EYQA 2VMOA 3F0HA 1AKAA 2D63A 2W7KA 2GSAA 4GRXA 3P1TA 1W3UA 1C7GA 1MAPA 3FQ7A 3EI6A 2W7JA 4A0GA 2HP2A 4JEYA 2GMSA 2QA3A 4IYOA 3HL2A 1EG5A 3NUIA 3AEOA 4F5IA 4HF8A 1CJ0A 3FDDA 1BQAA 3AATA 2OGAA 2V1PA 1ASMA 5D5SA 4Q6RA 3FVUA 1YAAA 1DJUA 2VGUA 2OQXA 2E7JA 4F5GA 2QBTA 3ACZA 1PFFA 4RAEA 5D95A 1GEXA 2EH6A 2YHKA 3DXVA 3E2ZB 1IX8A 3LVLB 3LVJA 4R2NA 3ZRPA 1LW4A 2BHXA 3AENB 1TOJA 2W8UA 2YRRA 1ASNA 1B9IA 2BIAA 3PPLA 2JGTA 1I41A 2QLRA 3NYTA 1AICA 1E5EA 4RKCA 1Z3ZA 1UU0A 1ASFA 1BS0A 1PMMA 3BWNC 4Y0DA 5M46A 3KGXA 4LNJA 4F5JA 3L44A 2PB0A 3HVYA 3CAIA 3FFRA 1YJZA 2C0RA 4Y0IA 1BJOA 2VGWA 1JS6A 4OC9A 3AV7A 1QIRA 3RQ1A 5AX8A 3HQTA 1S09A 3EI8A 2CJDA 3VK2A 1ASBA 1WYTA 1DGEA 3AEPA 3E2YA 1CL2A 4A0RA 1YJSA 2FM1A 4WLJA 1CZCA 1ARIA 4UQVA 3AOWA 2QB3A 5LH9A 3FTBA 1TOKA 2VYCA 4WXGA 3BWNA 3EUCA 3NU8A 3HT4A 3WCOA 1MLZA 3ISLA 3UAKA 1DJ9A 1GBNA 2VMXA 4MY5A 1AHEA 5EUEA 2AY2A 1AHGA 4A6UA 2ZP7A 3RI6A 1AIBA 4I8AA 3L8AA 4UHNA 3K40A 4ZSYA 2TPLA 3LVKA 1IX7A 2DKBA 3WGCA 3MBBA 2R0TA 1W7NA 1KL2A 1SVVA 3JW9A 5DJ9A 2Z1YA 2YCTA 3COGA 4LW4A 5HXXA 1FC4A 1AHFA 3JU7A 5I92A 2HOYA 1I29A 3T32A 3IHJA 4U2HA 3HMUA 3H14A 2HOXA 3WLXA 2AEVA 4KAMA 2DR1A 3PDBB 4XJMA 3N7NA 2AEUA 3CQ5A 3DXWA 4JEXA 3VK4A 3ZRQA 4IXZA 1W7MA 3JZLA 1BJOB 5KTBA 1QITA 5LHAA 2AY5A 1XI9A 2X8UA 1DKAA 1OATA 1TASA 2XH1A 4E3QA 4ZM4A 1ORDA 4ISYA 2EO5A 3DYDA 2Z9UA 2YCPA 3AENA 4UOYA 3TCMA 1LK9A 1ARHA 3WGBA 3TFTA 4U1TA 4XK1A 1N31A 4F5HA 1IAXA 1KL1A 2EPJA 2OKKA 3MAFA 3GZDC 1D2FA 3NYSA 4K2IA 5EAVA 1B8GA 4CBSA 4QGRA 1ZODA 2VMPA 3TATA 1FG7A 2FN6A 3DR7A 3G0TA 3ATHA 3FZ8A 3NU7A 1H1CA 3N4SA 4BQ0A 4K05A 1O69A 4ZWMA 1GC3A 3EIAA 1G4VA 4W8IA 2EGYA 3BC8A 1SZUA 1YIZA 2V0YA 2VIAA 3FRKA 3IF2A 4IXSA 1I43A 3EIBA 1QJ3A 2W7IA 3N75A 1UU2A 1T3IA 2D7ZA 3VOMA 2OATA 4Q75A 1SZSA 3B1CA 4ZWVA 3MEBA 1AKCA 3LVMA 3N0LA 3GZDA 5HHYA 3QHXA 3B1EA 3EZSA 1QZ9A 2VLHA 1BW0A 2HP1A 1FG3A 2DKJA 4PFNA 4CVQA 1PG8A 4E1OA 2VI9A 8AATA 4WP0A 1BT4A 2VMNA 3GWPA 4MGRA 4MQQA 1CZEA 3GR9A 4ZLVA 4H51A 1MLYA 3H9XA 2JJFA 2D64A 2EZ2A 1M0QA 2BI1A 3Q8NA 3RBLA 2JJHA 5F8VA 4AOAA 1RVUA 3PIUA 4M2KA 1QGNA 1LC8A 2JISA 4L0OA 2VMYA 3MADA 1DGDA 5G09A 2YOBA 2GQNA 3MC6C 1ECXA 4R5ZA 4RJ0A 2PO3A 5EUDA 5G4IA 3B46A 3VP6A 1AJRA 1WKHA 4XAUA 3OP7A 1J04A 1YNUA 2AY7A 3I5TA 5M4DA 1IUGA 4WD2A 3MAFB 5G0AA 4K2BA 4EB7A 3QM2A 2YKUA 3NUBA 1VP4A 1ASAA 1AY8A 5E3KA 1WKGA 2VIBA 3WCNA 4ITXA 2W7FA 3FZ6A 4DGTA 1V2EA 3PDBA 1P3WA 1AY4A 3B8XA 4OBVA 3FSLA 1X28A 4NOGA 2AY9A 4W91A 4N0WA 4IW7A 3VK3A 4R5FA 4ZM3A 3MC6A 3W1IA 2CJHA 4IX8A 1SZKA 4AZKA 2A1VA 4GEBA 2W7HA 2CFBA 1UU1A 3FDBA 2GB3A 3P6KA 3W1HA 2Z9VA 4P3MA 2ZY4A 2WK7A 2OKJA 1AHXA 1IBJA 1IVRA 3A8UX 4XJLA 3A9XA 1CQ8A 4ADDA 4CXRA 5E4ZA 3LY1A 4JEZA 2JG2A 2X5FA 3NX3A 1VEFA 2VMZA 3LV2A 2JJEA 1BJWA 2DOUA 2BIGA 2Z1ZA 4OT8A 1V72A 1LC5A 2W8JA 3BCAA 3PAAA 3QPGA 2ZSMA 1GC2A 1SFFA 2AY4A 3W1JA 3FD0A 2G6WA 1EJIA 2Z9WA 3LG0A 3FKDA 3H7FA 2VMWA 3WZFA 2Z9XA 1QISA 2CH1A 3OKSA 4OYTA 1GCKA 3ASBA 5JAYA 1CQ6A 1O4SA 2O7CA 4M2MA 4AH3A 2C81A 3II0A 1TARA 2W7DA 4PIWA 4MQPA 2W7LA 2VMTA 1DTYA 1MDZA 3ELPA 5BJ3A 3QBOA 2CINA 4EFFA 2VMVA 2ZJGA 1MDXA 1C7NA 2D7YA 2VMSA 2GMUA 2JJGA 2HUUA 4EB5A 3AEMC 4MKJA 2QMAA 4LC3A 2C44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQB A;  1IJI A;  1M0O A;  4IXO A;  4ZSW A;  2D5Y A;  3K28 A;  4F5M A;  1LS3 A;  4GSA A;  4O6Z A;  4GE7 A;  4F5L A;  1VJO A;  2R5E A;  3G8M A;  7AAT A;  4WXB A;  3RBF A;  5F9S A;  4N0B A;  4A6T A;  2ZY3 A;  1M4N A;  2BI3 A;  2ZUK A;  2BWP A;  5FT6 A;  4FL0 A;  4XEW A;  1M0P A;  1B5P A;  3FVX A;  3WKR A;  1UKJ A;  1X2A A;  4ATP A;  3K7Y A;  3PA9 A;  4RKD A;  1Z7D A;  3E6G A;  2CST A;  1KMK A;  3WX9 A;  4K2M A;  3DR4 A;  4ZDP A;  3DC1 A;  4ADB A;  4A0H A;  3AEM A;  1M7Y A;  1ZOB A;  3KE3 A;  1LC7 A;  1LKC A;  3NDN A;  4OCA A;  5J8Q A;  3WY7 A;  4P7Y A;  3TQX A;  3CQ6 A;  1TAT A;  4TV7 A;  1V2D A;  2BWO A;  1AMS A;  1WST A;  3DOD A;  1WYV A;  2EZ1 A;  1S07 A;  2YKY A;  3CBF A;  4LW2 A;  3EI5 A;  4WXF A;  4Y0H A;  5G2Q A;  2HUI A;  3A9Z A;  1C7O A;  1AMQ A;  1X29 A;  3GSB A;  4Q31 A;  2VMR A;  4IY7 A;  3BWO A;  1I48 A;  1AY5 A;  1AHY A;  1AX4 A;  4RIZ A;  1B4X A;  1G7W A;  2D65 A;  3EI7 A;  1V2F A;  2DGM A;  2HOR A;  4B98 A;  5EQC A;  1ARG A;  2CAN A;  3R4T A;  2W8W A;  2CTZ A;  3R9A A;  3QN6 A;  2R2N A;  1ASL A;  1ASE A;  1LW5 A;  5DX5 A;  1C0N A;  1Y4I A;  3D6K A;  1JS3 A;  4BA4 A;  4RJY A;  2BKW A;  1OXP A;  4PFF A;  2AAT A;  4E77 A;  2QB2 A;  4BA5 A;  2F8J A;  2X5D A;  4Q76 A;  5M49 A;  1KMJ A;  1M32 A;  1DJE A;  1WYU B;  2C7T A;  2YCN A;  2YKV A;  3AEJ C;  4PVF A;  4XJO A;  1CQ7 A;  1H0C A;  5DJ1 A;  1JG8 A;  4RM1 A;  1SF2 A;  3DZZ A;  3ASA A;  5M4B A;  1N2T A;  4JEV A;  2AY3 A;  4W1W A;  2CH2 A;  1J32 A;  2FQ6 A;  1CL1 A;  4ADC A;  1S06 A;  2VI8 A;  5E5I A;  1PMO A;  2W8V A;  2WK8 A;  3BCB A;  3BN1 A;  3JWB A;  3MKJ A;  4MQR A;  2E7U A;  3VAX A;  4XJP A;  4WYF A;  4RIT A;  2VGT A;  2VGV A;  3UE8 A;  3PD6 A;  3F9T A;  1AAM A;  2BWN A;  3MAU A;  4MKK A;  3JWA A;  3AEJ A;  3WKS A;  5EFS A;  4A6R A;  2BI5 A;  2OGE A;  3I16 A;  4FFC A;  3ZZK A;  4ADE A;  3FQA A;  1WYV B;  1ELQ A;  5G4J A;  4RLG A;  2AY6 A;  3ECD A;  4JE5 D;  2VGS A;  2FNI A;  1ASC A;  1C9C A;  4GDY A;  3RUY A;  3FVS A;  5EIG B;  1AMR A;  2W8T A;  2HZP A;  4DBC A;  1CS1 A;  1M6S A;  3CQ4 A;  3RCH A;  1TOG A;  4BHD A;  2HOZ A;  4BMK A;  2WK9 A;  4UHO A;  2HUF A;  3I4J A;  3FZ7 A;  4MSO A;  1JF9 A;  3B1D A;  3NYU A;  3GBX A;  2VLF A;  5IWQ A;  1BKG A;  3UWC A;  4OBU A;  3KGW A;  2VMU A;  3A2B A;  1GC4 A;  4ITG A;  3GZC A;  1C4K A;  1AIA A;  4WBT A;  5EAA A;  4WYA A;  2W7M A;  5FT4 A;  4W1X A;  3BS8 A;  1AAW A;  4W5K A;  1O62 A;  4UHM A;  4WYD A;  4AO9 A;  3BCX A;  3NTJ A;  4E3R A;  1KKP A;  1M0N A;  2R5C A;  2X3L A;  1D7R A;  4F4E A;  1TPL A;  2DGL A;  2BI9 A;  2O1B A;  5BJ4 A;  1GEY A;  3PDX A;  4EU1 A;  1GC0 A;  3PJ0 A;  5EUN A;  4A00 A;  1OHV A;  4JE5 A;  3USF A;  2BYL A;  4ZDL A;  4AO4 A;  3LWS A;  2XBN A;  2ORD A;  4IYO B;  2CB1 A;  3FFH A;  2Z61 A;  1ASD A;  2Z67 A;  3AEL A;  4GE4 A;  4CBR A;  4F5K A;  3PD6 B;  4ZDO A;  1MAQ A;  4WB0 A;  3PGY A;  2YKX A;  1AJS A;  2RFV A;  1D7U A;  1ART A;  1D7S A;  4XQ2 A;  2BIE A;  4TN4 A;  1WYU A;  1GEW A;  3EI9 A;  3HBX A;  3NNK A;  1AMA A;  3FCR A;  4CXQ A;  4WYC A;  2PB2 A;  1G7X A;  3NRA A;  1B9H A;  2CY8 A;  4ZAS A;  5K8B A;  2ZYJ A;  1OXO A;  2O0R A;  1TOE A;  4J8L A;  5DB5 A;  3HLM A;  4A0F A;  1ARS A;  3E2F A;  3RCH B;  1D7V A;  5FT5 A;  1N8P A;  2D61 A;  1B5O A;  4GE9 A;  1KKJ A;  2NMP A;  4JF1 A;  2ZY2 A;  2W7G A;  3FQ8 A;  3AOV A;  3DU4 A;  3DRD A;  4WYE A;  1QJ5 A;  2WKA A;  1G4X A;  1U08 A;  1ASG A;  2DGK A;  3KKI A;  1MDO A;  9AAT A;  3ZRR A;  5FT8 A;  3E9K A;  1BQD A;  3HDO A;  4ATQ A;  1MGV A;  4JF0 A;  1OHW A;  4JEW A;  2AY1 A;  1BJ4 A;  4DQ6 A;  1WYT B;  3E2Z A;  4TMR A;  1S08 A;  1ELU A;  2ZC0 A;  3QI6 A;  2W7E A;  3GJU A;  1GD9 A;  2FNU A;  1IX6 A;  1AKB A;  2VGZ A;  3BB8 A;  4OTL A;  4W1V A;  2Q7W A;  5EIG A;  2YRI A;  1GDE A;  2R5C B;  1OHY A;  5HDM A;  4AZJ A;  3G7Q A;  1ZC9 A;  4OMA A;  4B9B A;  3JTX A;  2FYF A;  1RV4 A;  2ZY5 A;  2D66 A;  1S0A A;  4J5U A;  4A72 A;  2E7I A;  2Z20 A;  3GET A;  5G2P A;  4KXK A;  1IAY A;  3F6T A;  4F5F A;  1SPA A;  1XEY A;  2E54 A;  4LNL A;  2CJG A;  4WB0 B;  2ZSL A;  3A9Y A;  1AJS B;  3E77 A;  1W23 A;  4LNM A;  2AY8 A;  3ZZJ A;  4ZAH A;  1O61 A;  4M2J A;  4EMY A;  1W7L A;  4WYG A;  4HVK A;  3BV0 A;  1BJN A;  1DFO A;  1RVY A;  1YOO A;  2BI2 A;  3QGU A;  5TF5 A;  5C6U A;  3N5M A;  4R8D A;  1YJY A;  3ELE A;  1TOI A;  3M5U A;  1YIY A;  2VMQ A;  4WLH A;  3TFU A;  2BYJ A;  1RV3 A;  1X0M A;  1E5F A;  4KYO A;  3EZ1 A;  2VMO A;  3F0H A;  1AKA A;  2D63 A;  2W7K A;  2GSA A;  4GRX A;  3P1T A;  1W3U A;  1C7G A;  1MAP A;  3FQ7 A;  3EI6 A;  2W7J A;  4A0G A;  2HP2 A;  4JEY A;  2GMS A;  2QA3 A;  4IYO A;  3HL2 A;  1EG5 A;  3NUI A;  3AEO A;  4F5I A;  4HF8 A;  1CJ0 A;  3FDD A;  1BQA A;  3AAT A;  2OGA A;  2V1P A;  1ASM A;  5D5S A;  4Q6R A;  3FVU A;  1YAA A;  1DJU A;  2VGU A;  2OQX A;  2E7J A;  4F5G A;  2QBT A;  3ACZ A;  1PFF A;  4RAE A;  5D95 A;  1GEX A;  2EH6 A;  2YHK A;  3DXV A;  3E2Z B;  1IX8 A;  3LVL B;  3LVJ A;  4R2N A;  3ZRP A;  1LW4 A;  2BHX A;  3AEN B;  1TOJ A;  2W8U A;  2YRR A;  1ASN A;  1B9I A;  2BIA A;  3PPL A;  2JGT A;  1I41 A;  2QLR A;  3NYT A;  1AIC A;  1E5E A;  4RKC A;  1Z3Z A;  1UU0 A;  1ASF A;  1BS0 A;  1PMM A;  3BWN C;  4Y0D A;  5M46 A;  3KGX A;  4LNJ A;  4F5J A;  3L44 A;  2PB0 A;  3HVY A;  3CAI A;  3FFR A;  1YJZ A;  2C0R A;  4Y0I A;  1BJO A;  2VGW A;  1JS6 A;  4OC9 A;  3AV7 A;  1QIR A;  3RQ1 A;  5AX8 A;  3HQT A;  1S09 A;  3EI8 A;  2CJD A;  3VK2 A;  1ASB A;  1WYT A;  1DGE A;  3AEP A;  3E2Y A;  1CL2 A;  4A0R A;  1YJS A;  2FM1 A;  4WLJ A;  1CZC A;  1ARI A;  4UQV A;  3AOW A;  2QB3 A;  5LH9 A;  3FTB A;  1TOK A;  2VYC A;  4WXG A;  3BWN A;  3EUC A;  3NU8 A;  3HT4 A;  3WCO A;  1MLZ A;  3ISL A;  3UAK A;  1DJ9 A;  1GBN A;  2VMX A;  4MY5 A;  1AHE A;  5EUE A;  2AY2 A;  1AHG A;  4A6U A;  2ZP7 A;  3RI6 A;  1AIB A;  4I8A A;  3L8A A;  4UHN A;  3K40 A;  4ZSY A;  2TPL A;  3LVK A;  1IX7 A;  2DKB A;  3WGC A;  3MBB A;  2R0T A;  1W7N A;  1KL2 A;  1SVV A;  3JW9 A;  5DJ9 A;  2Z1Y A;  2YCT A;  3COG A;  4LW4 A;  5HXX A;  1FC4 A;  1AHF A;  3JU7 A;  5I92 A;  2HOY A;  1I29 A;  3T32 A;  3IHJ A;  4U2H A;  3HMU A;  3H14 A;  2HOX A;  3WLX A;  2AEV A;  4KAM A;  2DR1 A;  3PDB B;  4XJM A;  2AEU A;  3CQ5 A;  3DXW A;  4JEX A;  3VK4 A;  3ZRQ A;  4IXZ A;  1W7M A;  3JZL A;  1BJO B;  1QIT A;  5LHA A;  2AY5 A;  1XI9 A;  2X8U A;  1DKA A;  1OAT A;  1TAS A;  2XH1 A;  4E3Q A;  4ZM4 A;  1ORD A;  4ISY A;  2EO5 A;  3DYD A;  2Z9U A;  2YCP A;  3AEN A;  4UOY A;  3TCM A;  1LK9 A;  1ARH A;  3WGB A;  3TFT A;  4U1T A;  4XK1 A;  1N31 A;  4F5H A;  1IAX A;  1KL1 A;  2EPJ A;  2OKK A;  3MAF A;  3GZD C;  1D2F A;  3NYS A;  4K2I A;  5EAV A;  1B8G A;  4CBS A;  4QGR A;  1ZOD A;  2VMP A;  3TAT A;  1FG7 A;  2FN6 A;  3DR7 A;  3G0T A;  3ATH A;  3FZ8 A;  3NU7 A;  1H1C A;  4BQ0 A;  1O69 A;  4ZWM A;  1GC3 A;  3EIA A;  1G4V A;  4W8I A;  2EGY A;  3BC8 A;  1SZU A;  1YIZ A;  2V0Y A;  2VIA A;  3FRK A;  3IF2 A;  4IXS A;  1I43 A;  3EIB A;  1QJ3 A;  2W7I A;  3N75 A;  1UU2 A;  1T3I A;  2D7Z A;  3VOM A;  2OAT A;  4Q75 A;  1SZS A;  3B1C A;  4ZWV A;  3MEB A;  1AKC A;  3LVM A;  3N0L A;  3GZD A;  5HHY A;  3QHX A;  3B1E A;  3EZS A;  1QZ9 A;  2VLH A;  1BW0 A;  2HP1 A;  1FG3 A;  2DKJ A;  4PFN A;  4CVQ A;  1PG8 A;  4E1O A;  2VI9 A;  8AAT A;  4WP0 A;  1BT4 A;  2VMN A;  3GWP A;  4MGR A;  4MQQ A;  1CZE A;  3GR9 A;  4ZLV A;  4H51 A;  1MLY A;  2JJF A;  2D64 A;  2EZ2 A;  1M0Q A;  2BI1 A;  3Q8N A;  3RBL A;  2JJH A;  5F8V A;  4AOA A;  1RVU A;  3PIU A;  4M2K A;  1QGN A;  1LC8 A;  2JIS A;  4L0O A;  2VMY A;  3MAD A;  1DGD A;  5G09 A;  2YOB A;  2GQN A;  3MC6 C;  1ECX A;  4R5Z A;  4RJ0 A;  2PO3 A;  5EUD A;  5G4I A;  3B46 A;  3VP6 A;  1AJR A;  1WKH A;  4XAU A;  3OP7 A;  1J04 A;  1YNU A;  2AY7 A;  3I5T A;  5M4D A;  1IUG A;  4WD2 A;  3MAF B;  5G0A A;  4K2B A;  4EB7 A;  3QM2 A;  2YKU A;  3NUB A;  1VP4 A;  1ASA A;  1AY8 A;  5E3K A;  1WKG A;  2VIB A;  3WCN A;  4ITX A;  2W7F A;  3FZ6 A;  4DGT A;  1V2E A;  3PDB A;  1P3W A;  1AY4 A;  3B8X A;  4OBV A;  3FSL A;  1X28 A;  4NOG A;  2AY9 A;  4W91 A;  4N0W A;  4IW7 A;  3VK3 A;  4R5F A;  4ZM3 A;  3MC6 A;  3W1I A;  2CJH A;  4IX8 A;  1SZK A;  4AZK A;  4GEB A;  2W7H A;  2CFB A;  1UU1 A;  3FDB A;  2GB3 A;  3P6K A;  3W1H A;  2Z9V A;  4P3M A;  2ZY4 A;  2WK7 A;  2OKJ A;  1AHX A;  1IBJ A;  1IVR A;  3A8U X;  4XJL A;  3A9X A;  1CQ8 A;  4ADD A;  4CXR A;  5E4Z A;  3LY1 A;  4JEZ A;  2JG2 A;  2X5F A;  3NX3 A;  1VEF A;  2VMZ A;  3LV2 A;  2JJE A;  1BJW A;  2DOU A;  2BIG A;  2Z1Z A;  4OT8 A;  1V72 A;  1LC5 A;  2W8J A;  3BCA A;  3PAA A;  3QPG A;  2ZSM A;  1GC2 A;  1SFF A;  2AY4 A;  3W1J A;  3FD0 A;  2G6W A;  1EJI A;  2Z9W A;  3LG0 A;  3FKD A;  3H7F A;  2VMW A;  3WZF A;  2Z9X A;  1QIS A;  2CH1 A;  3OKS A;  4OYT A;  1GCK A;  3ASB A;  5JAY A;  1CQ6 A;  1O4S A;  2O7C A;  4M2M A;  4AH3 A;  2C81 A;  3II0 A;  1TAR A;  2W7D A;  4PIW A;  4MQP A;  2W7L A;  2VMT A;  1DTY A;  1MDZ A;  3ELP A;  5BJ3 A;  3QBO A;  2CIN A;  4EFF A;  2VMV A;  2ZJG A;  1MDX A;  1C7N A;  2D7Y A;  2VMS A;  2GMU A;  2JJG A;  2HUU A;  4EB5 A;  3AEM C;  4MKJ A;  2QMA A;  4LC3 A;  2C44 A; 
#chains in the Genus database with same CATH topology
 1EQB A;  1IJI A;  1M0O A;  4IXO A;  4ZSW A;  2D5Y A;  3K28 A;  4F5M A;  1LS3 A;  4GSA A;  4O6Z A;  4GE7 A;  4F5L A;  1VJO A;  2R5E A;  3G8M A;  7AAT A;  4WXB A;  3RBF A;  5F9S A;  4N0B A;  4A6T A;  2ZY3 A;  1M4N A;  2BI3 A;  2ZUK A;  2BWP A;  5FT6 A;  4FL0 A;  4XEW A;  1M0P A;  1B5P A;  3FVX A;  3WKR A;  1UKJ A;  1X2A A;  4ATP A;  3K7Y A;  3PA9 A;  4RKD A;  1Z7D A;  3E6G A;  2CST A;  1KMK A;  3WX9 A;  4K2M A;  3DR4 A;  4ZDP A;  3DC1 A;  4ADB A;  4A0H A;  3AEM A;  1M7Y A;  1ZOB A;  3KE3 A;  1LC7 A;  1LKC A;  3NDN A;  4OCA A;  5J8Q A;  3WY7 A;  4P7Y A;  3TQX A;  3CQ6 A;  1TAT A;  4TV7 A;  1V2D A;  2BWO A;  1AMS A;  1WST A;  3DOD A;  1WYV A;  2EZ1 A;  1S07 A;  2YKY A;  3CBF A;  4LW2 A;  3EI5 A;  4WXF A;  4Y0H A;  5G2Q A;  2HUI A;  3A9Z A;  1C7O A;  1AMQ A;  1X29 A;  3GSB A;  4Q31 A;  2VMR A;  4IY7 A;  3BWO A;  1I48 A;  1AY5 A;  1AHY A;  1AX4 A;  4RIZ A;  1B4X A;  1G7W A;  2D65 A;  3EI7 A;  1V2F A;  2DGM A;  2HOR A;  4B98 A;  5EQC A;  1ARG A;  2CAN A;  3R4T A;  2W8W A;  2CTZ A;  3R9A A;  3QN6 A;  2R2N A;  1ASL A;  1ASE A;  1LW5 A;  5DX5 A;  1C0N A;  1Y4I A;  3D6K A;  1JS3 A;  4BA4 A;  4RJY A;  2BKW A;  1OXP A;  4PFF A;  2AAT A;  4E77 A;  2QB2 A;  4BA5 A;  2F8J A;  2X5D A;  4Q76 A;  5M49 A;  1KMJ A;  1M32 A;  1DJE A;  1WYU B;  2C7T A;  2YCN A;  2YKV A;  3AEJ C;  4PVF A;  4XJO A;  1CQ7 A;  1H0C A;  5DJ1 A;  1JG8 A;  4RM1 A;  1SF2 A;  3DZZ A;  3ASA A;  5M4B A;  1N2T A;  4JEV A;  2AY3 A;  4W1W A;  2CH2 A;  1J32 A;  2FQ6 A;  1CL1 A;  4ADC A;  1S06 A;  2VI8 A;  5E5I A;  1PMO A;  2W8V A;  2WK8 A;  3BCB A;  3BN1 A;  3JWB A;  3MKJ A;  4MQR A;  2E7U A;  3VAX A;  4XJP A;  4WYF A;  4RIT A;  2VGT A;  2VGV A;  3UE8 A;  3PD6 A;  3F9T A;  1AAM A;  2BWN A;  3MAU A;  2WB6 A;  4MKK A;  3JWA A;  3AEJ A;  3WKS A;  5EFS A;  4A6R A;  2BI5 A;  2FKI A;  2OGE A;  3I16 A;  4FFC A;  3ZZK A;  4ADE A;  2QSR A;  3FQA A;  1WYV B;  1ELQ A;  5G4J A;  4RLG A;  2AY6 A;  3ECD A;  4JE5 D;  2VGS A;  2FNI A;  1ASC A;  1C9C A;  4GDY A;  3RUY A;  3FVS A;  5EIG B;  1AMR A;  2W8T A;  1KAF A;  2HZP A;  4DBC A;  1CS1 A;  1M6S A;  3CQ4 A;  3RCH A;  1TOG A;  4BHD A;  2HOZ A;  4BMK A;  2WK9 A;  4UHO A;  2HUF A;  3I4J A;  3FZ7 A;  4MSO A;  1JF9 A;  3B1D A;  3NYU A;  3GBX A;  2VLF A;  5IWQ A;  1BKG A;  2KFP A;  3UWC A;  4OBU A;  3KGW A;  2VMU A;  3A2B A;  1GC4 A;  4ITG A;  4H63 Q;  3GZC A;  1C4K A;  1AIA A;  4WBT A;  5EAA A;  4WYA A;  2W7M A;  5FT4 A;  4W1X A;  3BS8 A;  1AAW A;  4W5K A;  1O62 A;  4UHM A;  4WYD A;  4AO9 A;  3BCX A;  3NTJ A;  4E3R A;  1KKP A;  1M0N A;  2R5C A;  2X3L A;  1D7R A;  4F4E A;  1TPL A;  2DGL A;  2BI9 A;  2O1B A;  5BJ4 A;  1GEY A;  3PDX A;  4EU1 A;  1GC0 A;  3PJ0 A;  5EUN A;  4A00 A;  1OHV A;  4JE5 A;  3USF A;  2BYL A;  4ZDL A;  4AO4 A;  3LWS A;  2XBN A;  2ORD A;  3N4R A;  4IYO B;  2CB1 A;  3FFH A;  2Z61 A;  1ASD A;  2Z67 A;  3AEL A;  4GE4 A;  4CBR A;  4F5K A;  3PD6 B;  4ZDO A;  1MAQ A;  4WB0 A;  3PGY A;  2YKX A;  1AJS A;  2RFV A;  1D7U A;  1ART A;  1D7S A;  4XQ2 A;  2BIE A;  4TN4 A;  1WYU A;  1GEW A;  3EI9 A;  3HBX A;  3NNK A;  1AMA A;  3FCR A;  4CXQ A;  4WYC A;  2PB2 A;  1G7X A;  3NRA A;  1B9H A;  2CY8 A;  4ZAS A;  5K8B A;  2ZYJ A;  1OXO A;  2O0R A;  1TOE A;  4J8L A;  5DB5 A;  3HLM A;  4A0F A;  1ARS A;  3E2F A;  3RCH B;  1D7V A;  5FT5 A;  1N8P A;  2D61 A;  1B5O A;  4GE9 A;  1KKJ A;  2NMP A;  4JF1 A;  2ZY2 A;  2W7G A;  3FQ8 A;  3AOV A;  3DU4 A;  3DRD A;  4WYE A;  1QJ5 A;  2WKA A;  3N4X A;  1G4X A;  1U08 A;  1ASG A;  2DGK A;  3KKI A;  1MDO A;  9AAT A;  3ZRR A;  5FT8 A;  3E9K A;  1BQD A;  3HDO A;  4ATQ A;  1MGV A;  4JF0 A;  1OHW A;  4JEW A;  2AY1 A;  1BJ4 A;  4DQ6 A;  1WYT B;  3E2Z A;  4TMR A;  1S08 A;  1ELU A;  2ZC0 A;  3QI6 A;  2W7E A;  3GJU A;  1GD9 A;  2FNU A;  1IX6 A;  1AKB A;  2VGZ A;  3BB8 A;  4OTL A;  4W1V A;  2Q7W A;  5EIG A;  2YRI A;  1GDE A;  2R5C B;  1OHY A;  5HDM A;  4AZJ A;  3G7Q A;  1ZC9 A;  2G7J A;  4OMA A;  4B9B A;  3JTX A;  2FYF A;  1RV4 A;  2ZY5 A;  2D66 A;  1S0A A;  4J5U A;  4A72 A;  2E7I A;  2Z20 A;  3GET A;  5G2P A;  4KXK A;  1IAY A;  3F6T A;  4F5F A;  1SPA A;  1XEY A;  2E54 A;  4LNL A;  2CJG A;  4WB0 B;  2ZSL A;  3A9Y A;  1AJS B;  3E77 A;  1W23 A;  4LNM A;  2AY8 A;  3ZZJ A;  4ZAH A;  1O61 A;  4M2J A;  4EMY A;  1W7L A;  4WYG A;  4HVK A;  3BV0 A;  1BJN A;  1DFO A;  1RVY A;  1YOO A;  2BI2 A;  3QGU A;  5TF5 A;  5C6U A;  3N5M A;  4R8D A;  1YJY A;  3ELE A;  1TOI A;  3M5U A;  1YIY A;  2VMQ A;  4WLH A;  3TFU A;  2BYJ A;  1RV3 A;  1X0M A;  1E5F A;  4KYO A;  3EZ1 A;  2EYQ A;  2VMO A;  3F0H A;  1AKA A;  2D63 A;  2W7K A;  2GSA A;  4GRX A;  3P1T A;  1W3U A;  1C7G A;  1MAP A;  3FQ7 A;  3EI6 A;  2W7J A;  4A0G A;  2HP2 A;  4JEY A;  2GMS A;  2QA3 A;  4IYO A;  3HL2 A;  1EG5 A;  3NUI A;  3AEO A;  4F5I A;  4HF8 A;  1CJ0 A;  3FDD A;  1BQA A;  3AAT A;  2OGA A;  2V1P A;  1ASM A;  5D5S A;  4Q6R A;  3FVU A;  1YAA A;  1DJU A;  2VGU A;  2OQX A;  2E7J A;  4F5G A;  2QBT A;  3ACZ A;  1PFF A;  4RAE A;  5D95 A;  1GEX A;  2EH6 A;  2YHK A;  3DXV A;  3E2Z B;  1IX8 A;  3LVL B;  3LVJ A;  4R2N A;  3ZRP A;  1LW4 A;  2BHX A;  3AEN B;  1TOJ A;  2W8U A;  2YRR A;  1ASN A;  1B9I A;  2BIA A;  3PPL A;  2JGT A;  1I41 A;  2QLR A;  3NYT A;  1AIC A;  1E5E A;  4RKC A;  1Z3Z A;  1UU0 A;  1ASF A;  1BS0 A;  1PMM A;  3BWN C;  4Y0D A;  5M46 A;  3KGX A;  4LNJ A;  4F5J A;  3L44 A;  2PB0 A;  3HVY A;  3CAI A;  3FFR A;  1YJZ A;  2C0R A;  4Y0I A;  1BJO A;  2VGW A;  1JS6 A;  4OC9 A;  3AV7 A;  1QIR A;  3RQ1 A;  5AX8 A;  3HQT A;  1S09 A;  3EI8 A;  2CJD A;  3VK2 A;  1ASB A;  1WYT A;  1DGE A;  3AEP A;  3E2Y A;  1CL2 A;  4A0R A;  1YJS A;  2FM1 A;  4WLJ A;  1CZC A;  1ARI A;  4UQV A;  3AOW A;  2QB3 A;  5LH9 A;  3FTB A;  1TOK A;  2VYC A;  4WXG A;  3BWN A;  3EUC A;  3NU8 A;  3HT4 A;  3WCO A;  1MLZ A;  3ISL A;  3UAK A;  1DJ9 A;  1GBN A;  2VMX A;  4MY5 A;  1AHE A;  5EUE A;  2AY2 A;  1AHG A;  4A6U A;  2ZP7 A;  3RI6 A;  1AIB A;  4I8A A;  3L8A A;  4UHN A;  3K40 A;  4ZSY A;  2TPL A;  3LVK A;  1IX7 A;  2DKB A;  3WGC A;  3MBB A;  2R0T A;  1W7N A;  1KL2 A;  1SVV A;  3JW9 A;  5DJ9 A;  2Z1Y A;  2YCT A;  3COG A;  4LW4 A;  5HXX A;  1FC4 A;  1AHF A;  3JU7 A;  5I92 A;  2HOY A;  1I29 A;  3T32 A;  3IHJ A;  4U2H A;  3HMU A;  3H14 A;  2HOX A;  3WLX A;  2AEV A;  4KAM A;  2DR1 A;  3PDB B;  4XJM A;  3N7N A;  2AEU A;  3CQ5 A;  3DXW A;  4JEX A;  3VK4 A;  3ZRQ A;  4IXZ A;  1W7M A;  3JZL A;  1BJO B;  5KTB A;  1QIT A;  5LHA A;  2AY5 A;  1XI9 A;  2X8U A;  1DKA A;  1OAT A;  1TAS A;  2XH1 A;  4E3Q A;  4ZM4 A;  1ORD A;  4ISY A;  2EO5 A;  3DYD A;  2Z9U A;  2YCP A;  3AEN A;  4UOY A;  3TCM A;  1LK9 A;  1ARH A;  3WGB A;  3TFT A;  4U1T A;  4XK1 A;  1N31 A;  4F5H A;  1IAX A;  1KL1 A;  2EPJ A;  2OKK A;  3MAF A;  3GZD C;  1D2F A;  3NYS A;  4K2I A;  5EAV A;  1B8G A;  4CBS A;  4QGR A;  1ZOD A;  2VMP A;  3TAT A;  1FG7 A;  2FN6 A;  3DR7 A;  3G0T A;  3ATH A;  3FZ8 A;  3NU7 A;  1H1C A;  3N4S A;  4BQ0 A;  4K05 A;  1O69 A;  4ZWM A;  1GC3 A;  3EIA A;  1G4V A;  4W8I A;  2EGY A;  3BC8 A;  1SZU A;  1YIZ A;  2V0Y A;  2VIA A;  3FRK A;  3IF2 A;  4IXS A;  1I43 A;  3EIB A;  1QJ3 A;  2W7I A;  3N75 A;  1UU2 A;  1T3I A;  2D7Z A;  3VOM A;  2OAT A;  4Q75 A;  1SZS A;  3B1C A;  4ZWV A;  3MEB A;  1AKC A;  3LVM A;  3N0L A;  3GZD A;  5HHY A;  3QHX A;  3B1E A;  3EZS A;  1QZ9 A;  2VLH A;  1BW0 A;  2HP1 A;  1FG3 A;  2DKJ A;  4PFN A;  4CVQ A;  1PG8 A;  4E1O A;  2VI9 A;  8AAT A;  4WP0 A;  1BT4 A;  2VMN A;  3GWP A;  4MGR A;  4MQQ A;  1CZE A;  3GR9 A;  4ZLV A;  4H51 A;  1MLY A;  3H9X A;  2JJF A;  2D64 A;  2EZ2 A;  1M0Q A;  2BI1 A;  3Q8N A;  3RBL A;  2JJH A;  5F8V A;  4AOA A;  1RVU A;  3PIU A;  4M2K A;  1QGN A;  1LC8 A;  2JIS A;  4L0O A;  2VMY A;  3MAD A;  1DGD A;  5G09 A;  2YOB A;  2GQN A;  3MC6 C;  1ECX A;  4R5Z A;  4RJ0 A;  2PO3 A;  5EUD A;  5G4I A;  3B46 A;  3VP6 A;  1AJR A;  1WKH A;  4XAU A;  3OP7 A;  1J04 A;  1YNU A;  2AY7 A;  3I5T A;  5M4D A;  1IUG A;  4WD2 A;  3MAF B;  5G0A A;  4K2B A;  4EB7 A;  3QM2 A;  2YKU A;  3NUB A;  1VP4 A;  1ASA A;  1AY8 A;  5E3K A;  1WKG A;  2VIB A;  3WCN A;  4ITX A;  2W7F A;  3FZ6 A;  4DGT A;  1V2E A;  3PDB A;  1P3W A;  1AY4 A;  3B8X A;  4OBV A;  3FSL A;  1X28 A;  4NOG A;  2AY9 A;  4W91 A;  4N0W A;  4IW7 A;  3VK3 A;  4R5F A;  4ZM3 A;  3MC6 A;  3W1I A;  2CJH A;  4IX8 A;  1SZK A;  4AZK A;  2A1V A;  4GEB A;  2W7H A;  2CFB A;  1UU1 A;  3FDB A;  2GB3 A;  3P6K A;  3W1H A;  2Z9V A;  4P3M A;  2ZY4 A;  2WK7 A;  2OKJ A;  1AHX A;  1IBJ A;  1IVR A;  3A8U X;  4XJL A;  3A9X A;  1CQ8 A;  4ADD A;  4CXR A;  5E4Z A;  3LY1 A;  4JEZ A;  2JG2 A;  2X5F A;  3NX3 A;  1VEF A;  2VMZ A;  3LV2 A;  2JJE A;  1BJW A;  2DOU A;  2BIG A;  2Z1Z A;  4OT8 A;  1V72 A;  1LC5 A;  2W8J A;  3BCA A;  3PAA A;  3QPG A;  2ZSM A;  1GC2 A;  1SFF A;  2AY4 A;  3W1J A;  3FD0 A;  2G6W A;  1EJI A;  2Z9W A;  3LG0 A;  3FKD A;  3H7F A;  2VMW A;  3WZF A;  2Z9X A;  1QIS A;  2CH1 A;  3OKS A;  4OYT A;  1GCK A;  3ASB A;  5JAY A;  1CQ6 A;  1O4S A;  2O7C A;  4M2M A;  4AH3 A;  2C81 A;  3II0 A;  1TAR A;  2W7D A;  4PIW A;  4MQP A;  2W7L A;  2VMT A;  1DTY A;  1MDZ A;  3ELP A;  5BJ3 A;  3QBO A;  2CIN A;  4EFF A;  2VMV A;  2ZJG A;  1MDX A;  1C7N A;  2D7Y A;  2VMS A;  2GMU A;  2JJG A;  2HUU A;  4EB5 A;  3AEM C;  4MKJ A;  2QMA A;  4LC3 A;  2C44 A; 
#chains in the Genus database with same CATH homology
 1EQB A;  1IJI A;  1M0O A;  4IXO A;  4ZSW A;  2D5Y A;  3K28 A;  4F5M A;  1LS3 A;  4GSA A;  4O6Z A;  4GE7 A;  4F5L A;  1VJO A;  2R5E A;  3G8M A;  7AAT A;  4WXB A;  3RBF A;  5F9S A;  4N0B A;  4A6T A;  2ZY3 A;  1M4N A;  2BI3 A;  2ZUK A;  2BWP A;  5FT6 A;  4FL0 A;  4XEW A;  1M0P A;  1B5P A;  3FVX A;  3WKR A;  1UKJ A;  1X2A A;  4ATP A;  3K7Y A;  3PA9 A;  4RKD A;  1Z7D A;  3E6G A;  2CST A;  1KMK A;  3WX9 A;  4K2M A;  3DR4 A;  4ZDP A;  3DC1 A;  4ADB A;  4A0H A;  3AEM A;  1M7Y A;  1ZOB A;  3KE3 A;  1LC7 A;  1LKC A;  3NDN A;  4OCA A;  5J8Q A;  3WY7 A;  4P7Y A;  3TQX A;  3CQ6 A;  1TAT A;  4TV7 A;  1V2D A;  2BWO A;  1AMS A;  1WST A;  3DOD A;  1WYV A;  2EZ1 A;  1S07 A;  2YKY A;  3CBF A;  4LW2 A;  3EI5 A;  4WXF A;  4Y0H A;  5G2Q A;  2HUI A;  3A9Z A;  1C7O A;  1AMQ A;  1X29 A;  3GSB A;  4Q31 A;  2VMR A;  4IY7 A;  3BWO A;  1I48 A;  1AY5 A;  1AHY A;  1AX4 A;  4RIZ A;  1B4X A;  1G7W A;  2D65 A;  3EI7 A;  1V2F A;  2DGM A;  2HOR A;  4B98 A;  5EQC A;  1ARG A;  2CAN A;  3R4T A;  2W8W A;  2CTZ A;  3R9A A;  3QN6 A;  2R2N A;  1ASL A;  1ASE A;  1LW5 A;  5DX5 A;  1C0N A;  1Y4I A;  3D6K A;  1JS3 A;  4BA4 A;  4RJY A;  2BKW A;  1OXP A;  4PFF A;  2AAT A;  4E77 A;  2QB2 A;  4BA5 A;  2F8J A;  2X5D A;  4Q76 A;  5M49 A;  1KMJ A;  1M32 A;  1DJE A;  1WYU B;  2C7T A;  2YCN A;  2YKV A;  3AEJ C;  4PVF A;  4XJO A;  1CQ7 A;  1H0C A;  5DJ1 A;  1JG8 A;  4RM1 A;  1SF2 A;  3DZZ A;  3ASA A;  5M4B A;  1N2T A;  4JEV A;  2AY3 A;  4W1W A;  2CH2 A;  1J32 A;  2FQ6 A;  1CL1 A;  4ADC A;  1S06 A;  2VI8 A;  5E5I A;  1PMO A;  2W8V A;  2WK8 A;  3BCB A;  3BN1 A;  3JWB A;  3MKJ A;  4MQR A;  2E7U A;  3VAX A;  4XJP A;  4WYF A;  4RIT A;  2VGT A;  2VGV A;  3UE8 A;  3PD6 A;  3F9T A;  1AAM A;  2BWN A;  3MAU A;  2WB6 A;  4MKK A;  3JWA A;  3AEJ A;  3WKS A;  5EFS A;  4A6R A;  2BI5 A;  2FKI A;  2OGE A;  3I16 A;  4FFC A;  3ZZK A;  4ADE A;  2QSR A;  3FQA A;  1WYV B;  1ELQ A;  5G4J A;  4RLG A;  2AY6 A;  3ECD A;  4JE5 D;  2VGS A;  2FNI A;  1ASC A;  1C9C A;  4GDY A;  3RUY A;  3FVS A;  5EIG B;  1AMR A;  2W8T A;  2HZP A;  4DBC A;  1CS1 A;  1M6S A;  3CQ4 A;  3RCH A;  1TOG A;  4BHD A;  2HOZ A;  4BMK A;  2WK9 A;  4UHO A;  2HUF A;  3I4J A;  3FZ7 A;  4MSO A;  1JF9 A;  3B1D A;  3NYU A;  3GBX A;  2VLF A;  5IWQ A;  1BKG A;  2KFP A;  3UWC A;  4OBU A;  3KGW A;  2VMU A;  3A2B A;  1GC4 A;  4ITG A;  4H63 Q;  3GZC A;  1C4K A;  1AIA A;  4WBT A;  5EAA A;  4WYA A;  2W7M A;  5FT4 A;  4W1X A;  3BS8 A;  1AAW A;  4W5K A;  1O62 A;  4UHM A;  4WYD A;  4AO9 A;  3BCX A;  3NTJ A;  4E3R A;  1KKP A;  1M0N A;  2R5C A;  2X3L A;  1D7R A;  4F4E A;  1TPL A;  2DGL A;  2BI9 A;  2O1B A;  5BJ4 A;  1GEY A;  3PDX A;  4EU1 A;  1GC0 A;  3PJ0 A;  5EUN A;  4A00 A;  1OHV A;  4JE5 A;  3USF A;  2BYL A;  4ZDL A;  4AO4 A;  3LWS A;  2XBN A;  2ORD A;  3N4R A;  4IYO B;  2CB1 A;  3FFH A;  2Z61 A;  1ASD A;  2Z67 A;  3AEL A;  4GE4 A;  4CBR A;  4F5K A;  3PD6 B;  4ZDO A;  1MAQ A;  4WB0 A;  3PGY A;  2YKX A;  1AJS A;  2RFV A;  1D7U A;  1ART A;  1D7S A;  4XQ2 A;  2BIE A;  4TN4 A;  1WYU A;  1GEW A;  3EI9 A;  3HBX A;  3NNK A;  1AMA A;  3FCR A;  4CXQ A;  4WYC A;  2PB2 A;  1G7X A;  3NRA A;  1B9H A;  2CY8 A;  4ZAS A;  5K8B A;  2ZYJ A;  1OXO A;  2O0R A;  1TOE A;  4J8L A;  5DB5 A;  3HLM A;  4A0F A;  1ARS A;  3E2F A;  3RCH B;  1D7V A;  5FT5 A;  1N8P A;  2D61 A;  1B5O A;  4GE9 A;  1KKJ A;  2NMP A;  4JF1 A;  2ZY2 A;  2W7G A;  3FQ8 A;  3AOV A;  3DU4 A;  3DRD A;  4WYE A;  1QJ5 A;  2WKA A;  3N4X A;  1G4X A;  1U08 A;  1ASG A;  2DGK A;  3KKI A;  1MDO A;  9AAT A;  3ZRR A;  5FT8 A;  3E9K A;  1BQD A;  3HDO A;  4ATQ A;  1MGV A;  4JF0 A;  1OHW A;  4JEW A;  2AY1 A;  1BJ4 A;  4DQ6 A;  1WYT B;  3E2Z A;  4TMR A;  1S08 A;  1ELU A;  2ZC0 A;  3QI6 A;  2W7E A;  3GJU A;  1GD9 A;  2FNU A;  1IX6 A;  1AKB A;  2VGZ A;  3BB8 A;  4OTL A;  4W1V A;  2Q7W A;  5EIG A;  2YRI A;  1GDE A;  2R5C B;  1OHY A;  5HDM A;  4AZJ A;  3G7Q A;  1ZC9 A;  2G7J A;  4OMA A;  4B9B A;  3JTX A;  2FYF A;  1RV4 A;  2ZY5 A;  2D66 A;  1S0A A;  4J5U A;  4A72 A;  2E7I A;  2Z20 A;  3GET A;  5G2P A;  4KXK A;  1IAY A;  3F6T A;  4F5F A;  1SPA A;  1XEY A;  2E54 A;  4LNL A;  2CJG A;  4WB0 B;  2ZSL A;  3A9Y A;  1AJS B;  3E77 A;  1W23 A;  4LNM A;  2AY8 A;  3ZZJ A;  4ZAH A;  1O61 A;  4M2J A;  4EMY A;  1W7L A;  4WYG A;  4HVK A;  3BV0 A;  1BJN A;  1DFO A;  1RVY A;  1YOO A;  2BI2 A;  3QGU A;  5TF5 A;  5C6U A;  3N5M A;  4R8D A;  1YJY A;  3ELE A;  1TOI A;  3M5U A;  1YIY A;  2VMQ A;  4WLH A;  3TFU A;  2BYJ A;  1RV3 A;  1X0M A;  1E5F A;  4KYO A;  3EZ1 A;  2EYQ A;  2VMO A;  3F0H A;  1AKA A;  2D63 A;  2W7K A;  2GSA A;  4GRX A;  3P1T A;  1W3U A;  1C7G A;  1MAP A;  3FQ7 A;  3EI6 A;  2W7J A;  4A0G A;  2HP2 A;  4JEY A;  2GMS A;  2QA3 A;  4IYO A;  3HL2 A;  1EG5 A;  3NUI A;  3AEO A;  4F5I A;  4HF8 A;  1CJ0 A;  3FDD A;  1BQA A;  3AAT A;  2OGA A;  2V1P A;  1ASM A;  5D5S A;  4Q6R A;  3FVU A;  1YAA A;  1DJU A;  2VGU A;  2OQX A;  2E7J A;  4F5G A;  2QBT A;  3ACZ A;  1PFF A;  4RAE A;  5D95 A;  1GEX A;  2EH6 A;  2YHK A;  3DXV A;  3E2Z B;  1IX8 A;  3LVL B;  3LVJ A;  4R2N A;  3ZRP A;  1LW4 A;  2BHX A;  3AEN B;  1TOJ A;  2W8U A;  2YRR A;  1ASN A;  1B9I A;  2BIA A;  3PPL A;  2JGT A;  1I41 A;  2QLR A;  3NYT A;  1AIC A;  1E5E A;  4RKC A;  1Z3Z A;  1UU0 A;  1ASF A;  1BS0 A;  1PMM A;  3BWN C;  4Y0D A;  5M46 A;  3KGX A;  4LNJ A;  4F5J A;  3L44 A;  2PB0 A;  3HVY A;  3CAI A;  3FFR A;  1YJZ A;  2C0R A;  4Y0I A;  1BJO A;  2VGW A;  1JS6 A;  4OC9 A;  3AV7 A;  1QIR A;  3RQ1 A;  5AX8 A;  3HQT A;  1S09 A;  3EI8 A;  2CJD A;  3VK2 A;  1ASB A;  1WYT A;  1DGE A;  3AEP A;  3E2Y A;  1CL2 A;  4A0R A;  1YJS A;  2FM1 A;  4WLJ A;  1CZC A;  1ARI A;  4UQV A;  3AOW A;  2QB3 A;  5LH9 A;  3FTB A;  1TOK A;  2VYC A;  4WXG A;  3BWN A;  3EUC A;  3NU8 A;  3HT4 A;  3WCO A;  1MLZ A;  3ISL A;  3UAK A;  1DJ9 A;  1GBN A;  2VMX A;  4MY5 A;  1AHE A;  5EUE A;  2AY2 A;  1AHG A;  4A6U A;  2ZP7 A;  3RI6 A;  1AIB A;  4I8A A;  3L8A A;  4UHN A;  3K40 A;  4ZSY A;  2TPL A;  3LVK A;  1IX7 A;  2DKB A;  3WGC A;  3MBB A;  2R0T A;  1W7N A;  1KL2 A;  1SVV A;  3JW9 A;  5DJ9 A;  2Z1Y A;  2YCT A;  3COG A;  4LW4 A;  5HXX A;  1FC4 A;  1AHF A;  3JU7 A;  5I92 A;  2HOY A;  1I29 A;  3T32 A;  3IHJ A;  4U2H A;  3HMU A;  3H14 A;  2HOX A;  3WLX A;  2AEV A;  4KAM A;  2DR1 A;  3PDB B;  4XJM A;  3N7N A;  2AEU A;  3CQ5 A;  3DXW A;  4JEX A;  3VK4 A;  3ZRQ A;  4IXZ A;  1W7M A;  3JZL A;  1BJO B;  5KTB A;  1QIT A;  5LHA A;  2AY5 A;  1XI9 A;  2X8U A;  1DKA A;  1OAT A;  1TAS A;  2XH1 A;  4E3Q A;  4ZM4 A;  1ORD A;  4ISY A;  2EO5 A;  3DYD A;  2Z9U A;  2YCP A;  3AEN A;  4UOY A;  3TCM A;  1LK9 A;  1ARH A;  3WGB A;  3TFT A;  4U1T A;  4XK1 A;  1N31 A;  4F5H A;  1IAX A;  1KL1 A;  2EPJ A;  2OKK A;  3MAF A;  3GZD C;  1D2F A;  3NYS A;  4K2I A;  5EAV A;  1B8G A;  4CBS A;  4QGR A;  1ZOD A;  2VMP A;  3TAT A;  1FG7 A;  2FN6 A;  3DR7 A;  3G0T A;  3ATH A;  3FZ8 A;  3NU7 A;  1H1C A;  3N4S A;  4BQ0 A;  4K05 A;  1O69 A;  4ZWM A;  1GC3 A;  3EIA A;  1G4V A;  4W8I A;  2EGY A;  3BC8 A;  1SZU A;  1YIZ A;  2V0Y A;  2VIA A;  3FRK A;  3IF2 A;  4IXS A;  1I43 A;  3EIB A;  1QJ3 A;  2W7I A;  3N75 A;  1UU2 A;  1T3I A;  2D7Z A;  3VOM A;  2OAT A;  4Q75 A;  1SZS A;  3B1C A;  4ZWV A;  3MEB A;  1AKC A;  3LVM A;  3N0L A;  3GZD A;  5HHY A;  3QHX A;  3B1E A;  3EZS A;  1QZ9 A;  2VLH A;  1BW0 A;  2HP1 A;  1FG3 A;  2DKJ A;  4PFN A;  4CVQ A;  1PG8 A;  4E1O A;  2VI9 A;  8AAT A;  4WP0 A;  1BT4 A;  2VMN A;  3GWP A;  4MGR A;  4MQQ A;  1CZE A;  3GR9 A;  4ZLV A;  4H51 A;  1MLY A;  3H9X A;  2JJF A;  2D64 A;  2EZ2 A;  1M0Q A;  2BI1 A;  3Q8N A;  3RBL A;  2JJH A;  5F8V A;  4AOA A;  1RVU A;  3PIU A;  4M2K A;  1QGN A;  1LC8 A;  2JIS A;  4L0O A;  2VMY A;  3MAD A;  1DGD A;  5G09 A;  2YOB A;  2GQN A;  3MC6 C;  1ECX A;  4R5Z A;  4RJ0 A;  2PO3 A;  5EUD A;  5G4I A;  3B46 A;  3VP6 A;  1AJR A;  1WKH A;  4XAU A;  3OP7 A;  1J04 A;  1YNU A;  2AY7 A;  3I5T A;  5M4D A;  1IUG A;  4WD2 A;  3MAF B;  5G0A A;  4K2B A;  4EB7 A;  3QM2 A;  2YKU A;  3NUB A;  1VP4 A;  1ASA A;  1AY8 A;  5E3K A;  1WKG A;  2VIB A;  3WCN A;  4ITX A;  2W7F A;  3FZ6 A;  4DGT A;  1V2E A;  3PDB A;  1P3W A;  1AY4 A;  3B8X A;  4OBV A;  3FSL A;  1X28 A;  4NOG A;  2AY9 A;  4W91 A;  4N0W A;  4IW7 A;  3VK3 A;  4R5F A;  4ZM3 A;  3MC6 A;  3W1I A;  2CJH A;  4IX8 A;  1SZK A;  4AZK A;  2A1V A;  4GEB A;  2W7H A;  2CFB A;  1UU1 A;  3FDB A;  2GB3 A;  3P6K A;  3W1H A;  2Z9V A;  4P3M A;  2ZY4 A;  2WK7 A;  2OKJ A;  1AHX A;  1IBJ A;  1IVR A;  3A8U X;  4XJL A;  3A9X A;  1CQ8 A;  4ADD A;  4CXR A;  5E4Z A;  3LY1 A;  4JEZ A;  2JG2 A;  2X5F A;  3NX3 A;  1VEF A;  2VMZ A;  3LV2 A;  2JJE A;  1BJW A;  2DOU A;  2BIG A;  2Z1Z A;  4OT8 A;  1V72 A;  1LC5 A;  2W8J A;  3BCA A;  3PAA A;  3QPG A;  2ZSM A;  1GC2 A;  1SFF A;  2AY4 A;  3W1J A;  3FD0 A;  2G6W A;  1EJI A;  2Z9W A;  3LG0 A;  3FKD A;  3H7F A;  2VMW A;  3WZF A;  2Z9X A;  1QIS A;  2CH1 A;  3OKS A;  4OYT A;  1GCK A;  3ASB A;  5JAY A;  1CQ6 A;  1O4S A;  2O7C A;  4M2M A;  4AH3 A;  2C81 A;  3II0 A;  1TAR A;  2W7D A;  4PIW A;  4MQP A;  2W7L A;  2VMT A;  1DTY A;  1MDZ A;  3ELP A;  5BJ3 A;  3QBO A;  2CIN A;  4EFF A;  2VMV A;  2ZJG A;  1MDX A;  1C7N A;  2D7Y A;  2VMS A;  2GMU A;  2JJG A;  2HUU A;  4EB5 A;  3AEM C;  4MKJ A;  2QMA A;  4LC3 A;  2C44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...