2QLRA

Crystal structure of human kynurenine aminotransferase ii
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
425
structure length
424
Chain Sequence
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase mitochondrial
publication title Crystal Structure of Human Kynurenine Aminotransferase II
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 135
structure length 424
sequence length 425
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2qlrA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2qlrA03
2Z9WA 2OATA 2R0TA 1YJZA 4K2BA 1SF2A 4LW2A 4ADEA 4ZWMA 2FNUA 5DB5A 3WKSA 2OGEA 3ASAA 2VMQA 4A00A 2E7IA 3GBXA 5EAAA 1BS0A 1CS1A 2YKVA 1AKBA 3NX3A 1N31A 3B1EA 3H7FA 1JG8A 1C9CA 1S09A 2HUUA 4XJLA 3AEMC 1CZEA 3LVJA 2WK8A 5EQCA 4W91A 1D7UA 2HZPA 4Q76A 4PFNA 4OCAA 1YNUA 2CSTA 2W7EA 5G4IA 1ARTA 4ZM3A 4F5HA 1AHEA 3HT4A 2AY5A 3AELA 4AOAA 1ASLA 1ASEA 1LC7A 2QA3A 1B9IA 1IX7A 4LNJA 3JZLA 4EB5A 1TASA 5EIGA 4P7YA 2VMVA 2O7CA 1AMAA 1D7SA 2GMSA 1GC4A 3ACZA 3QBOA 3FZ6A 4Y0DA 3WCNA 4JEVA 3GWPA 2HORA 3WY7A 1TOIA 2Z9XA 2VGTA 3FVUA 3WKRA 1JS3A 2VMXA 2YCNA 4WLJA 1M0PA 3I5TA 3A9XA 1TARA 1VP4A 2D66A 4JF1A 4U1TA 4UHMA 3VK4A 3EZ1A 1YOOA 2ZSMA 3QPGA 5EAVA 1ASFA 3BWOA 3W1IA 1FG3A 5K8BA 3K7YA 2JG2A 1YIZA 1M6SA 2D5YA 2YCPA 3QHXA 1AY5A 1AX4A 2FNIA 3WGCA 4GDYA 3WLXA 4RJYA 3FKDA 4OBVA 4W1VA 3G0TA 2VMWA 3K40A 1M7YA 2YCTA 2CANA 2AY1A 4IY7A 4GSAA 1IUGA 1E5EA 2AATA 3ELEA 1O4SA 4F5IA 2BI9A 2VMUA 3ECDA 2Q7WA 1IVRA 4H51A 1SFFA 1SZUA 3CAIA 3F6TA 4XAUA 3AOVA 2CFBA 4IYOB 4EU1A 4AH3A 1EQBA 2VIAA 3PDBB 3FD0A 1WYVB 5AX8A 4TN4A 1ASMA 1QZ9A 4MGRA 2PO3A 4ADBA 2ZP7A 4ADDA 3HLMA 2VGUA 3HQTA 3N0LA 3PD6A 4WXBA 3RCHB 5FT5A 3BCAA 2BIGA 3ZRQA 1G7XA 3B8XA 1M0NA 4DGTA 1TOJA 2GMUA 1G7WA 1ECXA 3MAUA 1DFOA 1S08A 1IBJA 2FN6A 2QBTA 5C6UA 1WYTB 1V2DA 1RVUA 3QN6A 2W7GA 3LWSA 3MADA 3Q8NA 3CQ6A 2D7YA 1N2TA 3E9KA 5FT6A 4N0WA 3HBXA 1W7LA 2ZJGA 4WYEA 3BCXA 4R8DA 3AOWA 5FT8A 4BMKA 4N0BA 2DKJA 4ZLVA 3JW9A 4FL0A 4KXKA 4R2NA 3UWCA 1KL1A 2CJHA 1ASGA 4ZSYA 2EPJA 3IHJA 4UOYA 4WB0B 3RBFA 3TATA 4XJMA 1M0QA 1V72A 3FFRA 4W1WA 2EZ2A 1DGEA 4JE5A 1BQAA 4O6ZA 3WX9A 4P3MA 4W5KA 4ZDLA 3AV7A 4CVQA 4MSOA 4F5KA 1GCKA 3E2FA 1AJSB 2JJFA 2C0RA 2ZYJA 4WYCA 8AATA 3WZFA 2OQXA 2YOBA 1IAYA 3FZ7A 3R9AA 1YIYA 1AKAA 3CBFA 4PFFA 3WCOA 3LVLB 3KGXA 2Z9UA 1AHYA 3DC1A 3PA9A 3VK3A 2YRIA 1LC8A 1MLZA 2DGLA 3QM2A 3W1JA 1B5PA 3GJUA 3NYTA 3VP6A 4A6RA 2CY8A 3FDBA 4F5MA 1YAAA 4DQ6A 1AHFA 5EUEA 1W3UA 1MDOA 2YRRA 4WXGA 4EMYA 1LKCA 4JE5D 1MGVA 3A9YA 4IW7A 1MAQA 2CH1A 3AATA 1MAPA 3BS8A 2XH1A 1LW4A 2X8UA 5F8VA 5FT4A 2ZY5A 4F5LA 4RKCA 2D64A 2WK9A 2VMPA 1AMQA 1KL2A 1X0MA 1N8PA 3BWNA 1BQDA 2BIEA 3E2YA 2DR1A 1SPAA 1BJOB 1TPLA 2JJGA 4WLHA 4ITGA 5I92A 2BI2A 1QISA 3F9TA 3PDXA 1OHWA 1OHYA 4R5ZA 4KYOA 1AY4A 2D61A 3AENA 2NMPA 1WYUA 2W7LA 3EIAA 3GR9A 1AHXA 1C4KA 3HL2A 1SZSA 2HP1A 1X28A 4TV7A 1ARIA 4BA4A 3VK2A 4I8AA 1S06A 1E5FA 3HVYA 2ZY2A 1ORDA 2HOXA 3TFTA 3PAAA 2DKBA 3AEPA 3JWBA 4Y0HA 2DOUA 4JEWA 3MAFB 1PMOA 1P3WA 3KGWA 3P6KA 4MQQA 2BIAA 2AEVA 7AATA 2ZC0A 2VMRA 3DU4A 4XEWA 2Z61A 1RVYA 3LVKA 1W7NA 4MKJA 1G4VA 2O1BA 2Z20A 1CQ7A 3W1HA 3E2ZB 3D6KA 4AO9A 4WP0A 4ZDOA 3NU8A 1ASCA 2XBNA 2BWPA 2JGTA 4J8LA 1WSTA 2GSAA 4A0FA 1D7RA 2CINA 3KKIA 5M4BA 3DZZA 2TPLA 4EFFA 2HOYA 2VI8A 2HUIA 4JF0A 1DGDA 2Z9VA 2W8UA 2YHKA 3ZZKA 3EI5A 1IJIA 3QGUA 1SVVA 4WXFA 2FQ6A 5G2QA 2VMNA 4LNMA 1D7VA 4A0RA 4PIWA 3GZDA 1FG7A 2BYLA 3MBBA 2QLRA 1W23A 3EI6A 3JTXA 3TFUA 1X29A 2W8JA 3UAKA 4M2MA 2JJHA 3BN1A 2D7ZA 3HDOA 2F8JA 4K2MA 4A0HA 2V1PA 5E4ZA 3E77A 2HP2A 4CXQA 3EIBA 3G8MA 3GZCA 1LS3A 4AZJA 2W8TA 1AIAA 2R5CB 2ZSLA 3B46A 4IXZA 4MQRA 4EB7A 1GC0A 3DODA 3IF2A 4GE9A 1QGNA 4HF8A 4LW4A 1UU0A 3UE8A 5M49A 4BHDA 5IWQA 2W8WA 1GEYA 3ASBA 2ORDA 1CZCA 3N5MA 2WKAA 3RUYA 2PB0A 3MKJA 2ZUKA 4M2KA 2VIBA 4WBTA 3N75A 4UHNA 1U08A 1AHGA 4LC3A 5G4JA 2WK7A 1VJOA 1ZOBA 1O61A 3G7QA 3FDDA 1KKPA 2W8VA 2EZ1A 1M4NA 4UQVA 4OTLA 3L44A 1DJ9A 1V2EA 2Z1YA 1C7OA 5DX5A 2QB2A 1IX6A 2VMTA 4ZDPA 3NTJA 3F0HA 1FC4A 1V2FA 3AEJA 2BWOA 9AATA 5E5IA 5G09A 4F5FA 1AAWA 4F5GA 4ZWVA 1ASBA 3H14A 5F9SA 2VYCA 5JAYA 2W7FA 1YJYA 1I43A 2W7HA 2YKYA 3EZSA 3NUIA 1ASDA 4BA5A 2EGYA 5EFSA 3II0A 1I29A 3P1TA 2GQNA 3PJ0A 1VEFA 1B8GA 1QJ5A 3PGYA 4Q6RA 5HDMA 1Z7DA 1PFFA 2O0RA 4F4EA 4WYAA 3RI6A 1B4XA 1O69A 5G2PA 2VMZA 3BCBA 1UKJA 1ASAA 4A72A 3LV2A 3MC6A 4ITXA 4K2IA 4GE4A 4IYOA 3AEMA 4OT8A 1YJSA 3PDBA 1WYVA 2AY4A 3LY1A 3WGBA 1QJ3A 4CBRA 3RBLA 1TOKA 3FFHA 2X5FA 1I48A 3VOMA 3NDNA 3DRDA 1S07A 3RCHA 3EUCA 3NRAA 4E1OA 2C7TA 4XJPA 4M2JA 1IX8A 4RITA 1DTYA 1QIRA 3JU7A 1KKJA 4U2HA 2YKUA 5EIGB 2BI3A 1SZKA 4ISYA 4WYGA 2QMAA 2CJGA 2VLFA 3CQ4A 5D95A 4A6UA 2VGSA 4A0GA 4DBCA 1KMJA 1I41A 1WYTA 1ELUA 4GE7A 2OGAA 2CTZA 3FZ8A 3AEJC 3KE3A 5D5SA 3EI7A 1H0CA 2C81A 4JEZA 4RIZA 1ZC9A 3ZRRA 4IXOA 2CB1A 2BI5A 2VGZA 3FCRA 4GRXA 2BI1A 4OBUA 2V0YA 2OKJA 3K28A 1AAMA 1G4XA 3MEBA 1TATA 4E77A 2W7IA 4XJOA 4FFCA 5BJ4A 1AMSA 4J5UA 4WYFA 1C7GA 3DXWA 4L0OA 4CXRA 1TOEA 2PB2A 1ZODA 4BQ0A 3DXVA 2HUFA 4OYTA 4WB0A 2BYJA 3NNKA 1WKGA 3ISLA 2D65A 3LG0A 4MQPA 2AY2A 3PIUA 2AEUA 3MC6C 2W7DA 2W7MA 4RM1A 3JWAA 1BJ4A 1AJSA 4CBSA 1DJEA 4W1XA 1AY8A 1GC3A 3HMUA 4ZSWA 1ELQA 5HXXA 2VLHA 2ZY4A 1BJNA 1D2FA 2FYFA 3I4JA 3RQ1A 3LVMA 3TQXA 2AY8A 2AY7A 4B98A 3PD6B 5J8QA 2EO5A 3PPLA 4NOGA 1AJRA 1OATA 3ZRPA 3A9ZA 3OP7A 4RJ0A 2BHXA 1B9HA 1AIBA 1O62A 2BKWA 4TMRA 4Q75A 4AO4A 4IX8A 2CH2A 3COGA 3EI8A 3QI6A 4OC9A 1RV4A 2YKXA 3A2BA 3B1CA 4LNLA 4RKDA 1Z3ZA 1Y4IA 2HOZA 4ATQA 3A8UX 4ZM4A 1AMRA 2VI9A 3BWNC 1DKAA 1EJIA 2OKKA 4JEXA 1LW5A 1XI9A 1BJOA 2GB3A 4E3QA 5DJ9A 2VMYA 1CQ6A 1AICA 4F5JA 4ZASA 1PG8A 4PVFA 3ZZJA 2W7KA 2D63A 4RLGA 3FTBA 5BJ3A 3M5UA 2JISA 1M0OA 2X5DA 3FVXA 1BJWA 3EI9A 5TF5A 4ATPA 1GEWA 1UU1A 2VGWA 1CL1A 3NYSA 2E54A 4E3RA 5LH9A 1BT4A 1C0NA 1EG5A 3MAFA 4OMAA 1ASNA 3B1DA 4MKKA 2DGMA 3E6GA 3R4TA 1H1CA 1RV3A 2G6WA 4WYDA 4A6TA 2AY3A 1B5OA 2BWNA 3E2ZA 1W7MA 5DJ1A 3L8AA 1X2AA 3CQ5A 3USFA 5M46A 1CL2A 1KMKA 1LK9A 5EUNA 1IAXA 5G0AA 3FSLA 4ZAHA 4ADCA 1MLYA 2C44A 3FQ7A 3ATHA 3DR7A 1GDEA 3ELPA 3BB8A 3NYUA 1XEYA 2VMSA 2W7JA 3GZDC 1ARSA 2JJEA 2Z1ZA 3NUBA 1J04A 4KAMA 3NU7A 1T3IA 3AEOA 1GEXA 3OKSA 5LHAA 1ARGA 4Y0IA 3TCMA 1GD9A 4WD2A 2X3LA 4R5FA 1BW0A 1MDZA 2E7UA 1QITA 1OXOA 2Z67A 1JS6A 5E3KA 3GSBA 3DR4A 3FRKA 2AY9A 4XK1A 4RAEA 1WKHA 3BC8A 3DYDA 3BV0A 2R5CA 2CJDA 4GEBA 1JF9A 2DGKA 3FVSA 4QGRA 1GC2A 1MDXA 2E7JA 5HHYA 3AENB 2AY6A 2R2NA 4AZKA 1WYUB 1C7NA 4W8IA 3VAXA 3T32A 5M4DA 1CQ8A 2ZY3A 3I16A 2RFVA 1OXPA 1CJ0A 1LC5A 2FM1A 1PMMA 1UU2A 4Q31A 1BKGA 4UHOA 1J32A 2R5EA 1TOGA 2EH6A 2QB3A 4HVKA 1M32A 1AKCA 1ARHA 3FQ8A 4XQ2A 4B9BA 3GETA 4JEYA 2VGVA 2VMOA 1DJUA 5EUDA 4IXSA 1OHVA 1GBNA 3FQAA 4MY5A 1S0AA
chains in the Genus database with same CATH superfamily
2Z9WA 2OATA 2R0TA 1YJZA 4K2BA 1SF2A 4LW2A 4ADEA 4ZWMA 2FNUA 5DB5A 3WKSA 2OGEA 3ASAA 2VMQA 4A00A 2E7IA 3GBXA 5EAAA 1BS0A 1CS1A 2YKVA 1AKBA 3NX3A 1N31A 3B1EA 3H7FA 1JG8A 1C9CA 1S09A 2HUUA 4XJLA 3AEMC 1CZEA 3LVJA 2WK8A 5EQCA 4W91A 1D7UA 2HZPA 4Q76A 4PFNA 4OCAA 2FKIA 1YNUA 2CSTA 2W7EA 5G4IA 1ARTA 4ZM3A 4F5HA 1AHEA 3HT4A 2AY5A 3AELA 4AOAA 1ASLA 1ASEA 1LC7A 2QA3A 1B9IA 1IX7A 4LNJA 3JZLA 4EB5A 1TASA 5EIGA 4P7YA 2VMVA 2O7CA 1AMAA 1D7SA 2GMSA 1GC4A 3ACZA 3QBOA 3FZ6A 4Y0DA 3WCNA 4JEVA 3GWPA 2HORA 3WY7A 1TOIA 2Z9XA 2VGTA 3FVUA 3WKRA 1JS3A 2VMXA 2YCNA 4WLJA 1M0PA 3I5TA 3A9XA 3N7NA 1TARA 1VP4A 2D66A 4JF1A 4U1TA 4UHMA 3VK4A 3EZ1A 1YOOA 2ZSMA 3QPGA 5EAVA 1ASFA 3BWOA 3W1IA 1FG3A 5K8BA 3K7YA 2JG2A 1YIZA 1M6SA 2D5YA 2YCPA 3QHXA 1AY5A 1AX4A 2FNIA 3WGCA 4GDYA 3WLXA 4RJYA 3FKDA 4OBVA 4W1VA 2EYQA 3G0TA 2VMWA 3K40A 5KTBA 1M7YA 2YCTA 2CANA 2AY1A 4IY7A 4GSAA 1IUGA 1E5EA 2AATA 3ELEA 1O4SA 4F5IA 2BI9A 2VMUA 3ECDA 2Q7WA 1IVRA 4H51A 1SFFA 1SZUA 3CAIA 3F6TA 4XAUA 3AOVA 2CFBA 4IYOB 4EU1A 4AH3A 1EQBA 2VIAA 3N4SA 4K05A 3PDBB 3FD0A 1WYVB 5AX8A 4TN4A 1ASMA 1QZ9A 4MGRA 2PO3A 4ADBA 2ZP7A 4ADDA 3HLMA 2VGUA 3HQTA 3N0LA 3PD6A 4WXBA 3RCHB 5FT5A 3BCAA 2BIGA 3ZRQA 1G7XA 3B8XA 1M0NA 4DGTA 1TOJA 2GMUA 1G7WA 1ECXA 3MAUA 1DFOA 1S08A 1IBJA 2FN6A 2QBTA 5C6UA 1WYTB 1V2DA 1RVUA 3QN6A 2W7GA 3LWSA 3MADA 3Q8NA 3CQ6A 2D7YA 1N2TA 3E9KA 5FT6A 4N0WA 3HBXA 1W7LA 2ZJGA 4WYEA 3BCXA 4R8DA 3AOWA 5FT8A 4BMKA 4N0BA 2DKJA 4ZLVA 3JW9A 4FL0A 4KXKA 4R2NA 3UWCA 1KL1A 2CJHA 1ASGA 4ZSYA 2EPJA 3IHJA 4UOYA 4WB0B 3RBFA 2WB6A 3TATA 4XJMA 1M0QA 1V72A 3FFRA 4W1WA 2EZ2A 1DGEA 4JE5A 1BQAA 4O6ZA 3WX9A 4P3MA 4W5KA 4ZDLA 3AV7A 4CVQA 4MSOA 4F5KA 1GCKA 3E2FA 1AJSB 2JJFA 2C0RA 2ZYJA 4WYCA 8AATA 3WZFA 2OQXA 2YOBA 1IAYA 3FZ7A 3R9AA 1YIYA 1AKAA 3CBFA 4PFFA 3WCOA 3LVLB 3KGXA 2Z9UA 4H63Q 1AHYA 3DC1A 3PA9A 3VK3A 2YRIA 1LC8A 1MLZA 2DGLA 3QM2A 3W1JA 1B5PA 3GJUA 3NYTA 3VP6A 4A6RA 2CY8A 3FDBA 4F5MA 1YAAA 4DQ6A 1AHFA 5EUEA 1W3UA 1MDOA 2YRRA 4WXGA 4EMYA 1LKCA 4JE5D 1MGVA 3A9YA 4IW7A 1MAQA 2CH1A 3AATA 1MAPA 3BS8A 2XH1A 1LW4A 2X8UA 5F8VA 5FT4A 2ZY5A 4F5LA 4RKCA 2D64A 2WK9A 2VMPA 1AMQA 1KL2A 1X0MA 1N8PA 3BWNA 1BQDA 2BIEA 3E2YA 2DR1A 1SPAA 1BJOB 1TPLA 2JJGA 4WLHA 4ITGA 5I92A 2BI2A 1QISA 3F9TA 3PDXA 1OHWA 1OHYA 4R5ZA 4KYOA 1AY4A 2D61A 3AENA 2NMPA 1WYUA 2W7LA 3EIAA 3GR9A 1AHXA 1C4KA 3HL2A 1SZSA 2HP1A 1X28A 4TV7A 1ARIA 4BA4A 3VK2A 4I8AA 1S06A 1E5FA 3HVYA 2ZY2A 1ORDA 2HOXA 3TFTA 3PAAA 2DKBA 3AEPA 3JWBA 4Y0HA 2DOUA 4JEWA 3MAFB 1PMOA 1P3WA 3KGWA 3P6KA 4MQQA 2BIAA 2AEVA 7AATA 2ZC0A 2VMRA 3DU4A 4XEWA 2Z61A 1RVYA 3LVKA 1W7NA 4MKJA 1G4VA 2O1BA 2Z20A 1CQ7A 3W1HA 3E2ZB 3D6KA 4AO9A 4WP0A 4ZDOA 3NU8A 1ASCA 2XBNA 2BWPA 2JGTA 4J8LA 1WSTA 2GSAA 4A0FA 1D7RA 2CINA 3KKIA 5M4BA 3DZZA 2TPLA 4EFFA 2HOYA 2VI8A 2HUIA 4JF0A 1DGDA 2Z9VA 2W8UA 2YHKA 3ZZKA 3EI5A 1IJIA 3QGUA 1SVVA 4WXFA 2FQ6A 5G2QA 2VMNA 4LNMA 1D7VA 4A0RA 4PIWA 3GZDA 1FG7A 1KAFA 2BYLA 3MBBA 2QLRA 1W23A 3EI6A 3JTXA 3TFUA 1X29A 2W8JA 3UAKA 4M2MA 2JJHA 3BN1A 2D7ZA 3HDOA 2F8JA 4K2MA 4A0HA 2V1PA 5E4ZA 3E77A 2HP2A 4CXQA 3EIBA 3G8MA 3GZCA 1LS3A 4AZJA 2W8TA 1AIAA 2R5CB 2ZSLA 3B46A 4IXZA 4MQRA 4EB7A 1GC0A 3DODA 3IF2A 4GE9A 1QGNA 4HF8A 4LW4A 1UU0A 3UE8A 5M49A 4BHDA 5IWQA 2W8WA 1GEYA 3ASBA 2ORDA 1CZCA 3N5MA 2WKAA 3RUYA 2PB0A 3MKJA 2ZUKA 4M2KA 2VIBA 4WBTA 3N75A 4UHNA 1U08A 1AHGA 4LC3A 5G4JA 2WK7A 1VJOA 1ZOBA 1O61A 3G7QA 3FDDA 1KKPA 2W8VA 2EZ1A 1M4NA 4UQVA 4OTLA 3L44A 1DJ9A 1V2EA 2Z1YA 1C7OA 5DX5A 2QB2A 1IX6A 2VMTA 2QSRA 4ZDPA 3NTJA 3F0HA 1FC4A 1V2FA 3AEJA 2BWOA 9AATA 5E5IA 5G09A 4F5FA 1AAWA 4F5GA 4ZWVA 1ASBA 3H14A 5F9SA 2VYCA 5JAYA 2W7FA 1YJYA 1I43A 2W7HA 2YKYA 3EZSA 3NUIA 1ASDA 4BA5A 2EGYA 5EFSA 3II0A 1I29A 3P1TA 2GQNA 3PJ0A 1VEFA 1B8GA 1QJ5A 3PGYA 4Q6RA 5HDMA 1Z7DA 1PFFA 2O0RA 4F4EA 4WYAA 3RI6A 1B4XA 1O69A 5G2PA 2VMZA 3BCBA 1UKJA 1ASAA 4A72A 3LV2A 3MC6A 4ITXA 4K2IA 4GE4A 4IYOA 3AEMA 4OT8A 1YJSA 3PDBA 1WYVA 2AY4A 3LY1A 3WGBA 1QJ3A 4CBRA 3RBLA 1TOKA 3FFHA 2G7JA 2X5FA 1I48A 3VOMA 3NDNA 3DRDA 1S07A 3RCHA 3EUCA 3NRAA 4E1OA 2C7TA 4XJPA 4M2JA 1IX8A 4RITA 1DTYA 1QIRA 3JU7A 1KKJA 4U2HA 2YKUA 5EIGB 2BI3A 1SZKA 4ISYA 4WYGA 2QMAA 2CJGA 2VLFA 3CQ4A 5D95A 4A6UA 2VGSA 4A0GA 4DBCA 3N4RA 1KMJA 1I41A 1WYTA 1ELUA 4GE7A 2OGAA 2CTZA 3FZ8A 3AEJC 3KE3A 5D5SA 3EI7A 1H0CA 2C81A 4JEZA 4RIZA 1ZC9A 3ZRRA 4IXOA 2CB1A 2BI5A 2VGZA 3FCRA 4GRXA 2BI1A 4OBUA 2V0YA 2OKJA 3K28A 1AAMA 1G4XA 3MEBA 1TATA 4E77A 2W7IA 4XJOA 4FFCA 5BJ4A 1AMSA 4J5UA 4WYFA 1C7GA 3DXWA 4L0OA 4CXRA 1TOEA 2PB2A 1ZODA 4BQ0A 3DXVA 2HUFA 4OYTA 4WB0A 2BYJA 3NNKA 1WKGA 3ISLA 2D65A 3LG0A 4MQPA 2AY2A 3PIUA 2AEUA 3MC6C 2W7DA 2W7MA 4RM1A 3JWAA 1BJ4A 1AJSA 4CBSA 1DJEA 4W1XA 1AY8A 1GC3A 3HMUA 4ZSWA 1ELQA 5HXXA 2VLHA 2ZY4A 1BJNA 1D2FA 2FYFA 3I4JA 3RQ1A 3LVMA 3TQXA 2AY8A 2AY7A 4B98A 3PD6B 5J8QA 2EO5A 3PPLA 4NOGA 1AJRA 1OATA 3ZRPA 3A9ZA 3OP7A 4RJ0A 2BHXA 1B9HA 1AIBA 1O62A 2BKWA 4TMRA 4Q75A 4AO4A 3N4XA 4IX8A 2CH2A 3COGA 3EI8A 3QI6A 4OC9A 1RV4A 2YKXA 3A2BA 3B1CA 4LNLA 4RKDA 1Z3ZA 1Y4IA 2HOZA 4ATQA 3A8UX 4ZM4A 1AMRA 2VI9A 2A1VA 3BWNC 1DKAA 1EJIA 2OKKA 4JEXA 1LW5A 1XI9A 1BJOA 2GB3A 4E3QA 5DJ9A 2VMYA 1CQ6A 1AICA 4F5JA 4ZASA 1PG8A 4PVFA 3ZZJA 2W7KA 2D63A 4RLGA 3FTBA 5BJ3A 3M5UA 2JISA 1M0OA 2X5DA 3FVXA 1BJWA 3H9XA 3EI9A 5TF5A 4ATPA 1GEWA 1UU1A 2VGWA 1CL1A 3NYSA 2E54A 4E3RA 5LH9A 1BT4A 1C0NA 1EG5A 3MAFA 4OMAA 1ASNA 3B1DA 4MKKA 2DGMA 3E6GA 3R4TA 1H1CA 1RV3A 2G6WA 4WYDA 4A6TA 2AY3A 1B5OA 2BWNA 3E2ZA 1W7MA 5DJ1A 3L8AA 1X2AA 3CQ5A 3USFA 5M46A 1CL2A 1KMKA 1LK9A 5EUNA 1IAXA 5G0AA 3FSLA 4ZAHA 4ADCA 1MLYA 2C44A 3FQ7A 3ATHA 3DR7A 1GDEA 3ELPA 3BB8A 3NYUA 1XEYA 2VMSA 2W7JA 3GZDC 1ARSA 2JJEA 2Z1ZA 3NUBA 1J04A 4KAMA 3NU7A 1T3IA 3AEOA 1GEXA 3OKSA 5LHAA 1ARGA 4Y0IA 3TCMA 1GD9A 4WD2A 2X3LA 4R5FA 1BW0A 1MDZA 2E7UA 1QITA 1OXOA 2Z67A 1JS6A 5E3KA 3GSBA 3DR4A 3FRKA 2AY9A 4XK1A 4RAEA 1WKHA 3BC8A 3DYDA 3BV0A 2R5CA 2CJDA 4GEBA 1JF9A 2DGKA 3FVSA 4QGRA 1GC2A 1MDXA 2E7JA 5HHYA 3AENB 2AY6A 2R2NA 4AZKA 1WYUB 1C7NA 4W8IA 3VAXA 3T32A 5M4DA 1CQ8A 2ZY3A 3I16A 2RFVA 1OXPA 1CJ0A 1LC5A 2FM1A 1PMMA 1UU2A 4Q31A 1BKGA 4UHOA 1J32A 2R5EA 1TOGA 2EH6A 2QB3A 4HVKA 1M32A 1AKCA 1ARHA 3FQ8A 4XQ2A 4B9BA 3GETA 4JEYA 2KFPA 2VGVA 2VMOA 1DJUA 5EUDA 4IXSA 1OHVA 1GBNA 3FQAA 4MY5A 1S0AA
chains in the Genus database with same CATH topology
2Z9WA 2OATA 2R0TA 1YJZA 4K2BA 1SF2A 4LW2A 4ADEA 4ZWMA 2FNUA 5DB5A 3WKSA 2OGEA 3ASAA 2VMQA 4A00A 2E7IA 3GBXA 5EAAA 1BS0A 1CS1A 2YKVA 1AKBA 3NX3A 1N31A 3B1EA 3H7FA 1JG8A 1C9CA 1S09A 2HUUA 4XJLA 3AEMC 1CZEA 3LVJA 2WK8A 5EQCA 4W91A 1D7UA 2HZPA 4Q76A 4PFNA 4OCAA 2FKIA 1YNUA 2CSTA 2W7EA 5G4IA 1ARTA 4ZM3A 4F5HA 1AHEA 3HT4A 2AY5A 3AELA 4AOAA 1ASLA 1ASEA 1LC7A 2QA3A 1B9IA 1IX7A 4LNJA 3JZLA 4EB5A 1TASA 5EIGA 4P7YA 2VMVA 2O7CA 1AMAA 1D7SA 2GMSA 1GC4A 3ACZA 3QBOA 3FZ6A 4Y0DA 3WCNA 4JEVA 3GWPA 2HORA 3WY7A 1TOIA 2Z9XA 2VGTA 3FVUA 3WKRA 1JS3A 2VMXA 2YCNA 4WLJA 1M0PA 3I5TA 3A9XA 3N7NA 1TARA 1VP4A 2D66A 4JF1A 4U1TA 4UHMA 3VK4A 3EZ1A 1YOOA 2ZSMA 3QPGA 5EAVA 1ASFA 3BWOA 3W1IA 1FG3A 5K8BA 3K7YA 2JG2A 1YIZA 1M6SA 2D5YA 2YCPA 3QHXA 1AY5A 1AX4A 2FNIA 3WGCA 4GDYA 3WLXA 4RJYA 3FKDA 4OBVA 4W1VA 2EYQA 3G0TA 2VMWA 3K40A 5KTBA 1M7YA 2YCTA 2CANA 2AY1A 4IY7A 4GSAA 1IUGA 1E5EA 2AATA 3ELEA 1O4SA 4F5IA 2BI9A 2VMUA 3ECDA 2Q7WA 1IVRA 4H51A 1SFFA 1SZUA 3CAIA 3F6TA 4XAUA 3AOVA 2CFBA 4IYOB 4EU1A 4AH3A 1EQBA 2VIAA 3N4SA 4K05A 3PDBB 3FD0A 1WYVB 5AX8A 4TN4A 1ASMA 1QZ9A 4MGRA 2PO3A 4ADBA 2ZP7A 4ADDA 3HLMA 2VGUA 3HQTA 3N0LA 3PD6A 4WXBA 3RCHB 5FT5A 3BCAA 2BIGA 3ZRQA 1G7XA 3B8XA 1M0NA 4DGTA 1TOJA 2GMUA 1G7WA 1ECXA 3MAUA 1DFOA 1S08A 1IBJA 2FN6A 2QBTA 5C6UA 1WYTB 1V2DA 1RVUA 3QN6A 2W7GA 3LWSA 3MADA 3Q8NA 3CQ6A 2D7YA 1N2TA 3E9KA 5FT6A 4N0WA 3HBXA 1W7LA 2ZJGA 4WYEA 3BCXA 4R8DA 3AOWA 5FT8A 4BMKA 4N0BA 2DKJA 4ZLVA 3JW9A 4FL0A 4KXKA 4R2NA 3UWCA 1KL1A 2CJHA 1ASGA 4ZSYA 2EPJA 3IHJA 4UOYA 4WB0B 3RBFA 2WB6A 3TATA 4XJMA 1M0QA 1V72A 3FFRA 4W1WA 2EZ2A 1DGEA 4JE5A 1BQAA 4O6ZA 3WX9A 4P3MA 4W5KA 4ZDLA 3AV7A 4CVQA 4MSOA 4F5KA 1GCKA 3E2FA 1AJSB 2JJFA 2C0RA 2ZYJA 4WYCA 8AATA 3WZFA 2OQXA 2YOBA 1IAYA 3FZ7A 3R9AA 1YIYA 1AKAA 3CBFA 4PFFA 3WCOA 3LVLB 3KGXA 2Z9UA 4H63Q 1AHYA 3DC1A 3PA9A 3VK3A 2YRIA 1LC8A 1MLZA 2DGLA 3QM2A 3W1JA 1B5PA 3GJUA 3NYTA 3VP6A 4A6RA 2CY8A 3FDBA 4F5MA 1YAAA 4DQ6A 1AHFA 5EUEA 1W3UA 1MDOA 2YRRA 4WXGA 4EMYA 1LKCA 4JE5D 1MGVA 3A9YA 4IW7A 1MAQA 2CH1A 3AATA 1MAPA 3BS8A 2XH1A 1LW4A 2X8UA 5F8VA 5FT4A 2ZY5A 4F5LA 4RKCA 2D64A 2WK9A 2VMPA 1AMQA 1KL2A 1X0MA 1N8PA 3BWNA 1BQDA 2BIEA 3E2YA 2DR1A 1SPAA 1BJOB 1TPLA 2JJGA 4WLHA 4ITGA 5I92A 2BI2A 1QISA 3F9TA 3PDXA 1OHWA 1OHYA 4R5ZA 4KYOA 1AY4A 2D61A 3AENA 2NMPA 1WYUA 2W7LA 3EIAA 3GR9A 1AHXA 1C4KA 3HL2A 1SZSA 2HP1A 1X28A 4TV7A 1ARIA 4BA4A 3VK2A 4I8AA 1S06A 1E5FA 3HVYA 2ZY2A 1ORDA 2HOXA 3TFTA 3PAAA 2DKBA 3AEPA 3JWBA 4Y0HA 2DOUA 4JEWA 3MAFB 1PMOA 1P3WA 3KGWA 3P6KA 4MQQA 2BIAA 2AEVA 7AATA 2ZC0A 2VMRA 3DU4A 4XEWA 2Z61A 1RVYA 3LVKA 1W7NA 4MKJA 1G4VA 2O1BA 2Z20A 1CQ7A 3W1HA 3E2ZB 3D6KA 4AO9A 4WP0A 4ZDOA 3NU8A 1ASCA 2XBNA 2BWPA 2JGTA 4J8LA 1WSTA 2GSAA 4A0FA 1D7RA 2CINA 3KKIA 5M4BA 3DZZA 2TPLA 4EFFA 2HOYA 2VI8A 2HUIA 4JF0A 1DGDA 2Z9VA 2W8UA 2YHKA 3ZZKA 3EI5A 1IJIA 3QGUA 1SVVA 4WXFA 2FQ6A 5G2QA 2VMNA 4LNMA 1D7VA 4A0RA 4PIWA 3GZDA 1FG7A 2BYLA 3MBBA 2QLRA 1W23A 3EI6A 3JTXA 3TFUA 1X29A 2W8JA 3UAKA 4M2MA 2JJHA 3BN1A 2D7ZA 3HDOA 2F8JA 4K2MA 4A0HA 2V1PA 5E4ZA 3E77A 2HP2A 4CXQA 3EIBA 3G8MA 3GZCA 1LS3A 4AZJA 2W8TA 1AIAA 2R5CB 2ZSLA 3B46A 4IXZA 4MQRA 4EB7A 1GC0A 3DODA 3IF2A 4GE9A 1QGNA 4HF8A 4LW4A 1UU0A 3UE8A 5M49A 4BHDA 5IWQA 2W8WA 1GEYA 3ASBA 2ORDA 1CZCA 3N5MA 2WKAA 3RUYA 2PB0A 3MKJA 2ZUKA 4M2KA 2VIBA 4WBTA 3N75A 4UHNA 1U08A 1AHGA 4LC3A 5G4JA 2WK7A 1VJOA 1ZOBA 1O61A 3G7QA 3FDDA 1KKPA 2W8VA 2EZ1A 1M4NA 4UQVA 4OTLA 3L44A 1DJ9A 1V2EA 2Z1YA 1C7OA 5DX5A 2QB2A 1IX6A 2VMTA 2QSRA 4ZDPA 3NTJA 3F0HA 1FC4A 1V2FA 3AEJA 2BWOA 9AATA 5E5IA 5G09A 4F5FA 1AAWA 4F5GA 4ZWVA 1ASBA 3H14A 5F9SA 2VYCA 5JAYA 2W7FA 1YJYA 1I43A 2W7HA 2YKYA 3EZSA 3NUIA 1ASDA 4BA5A 2EGYA 5EFSA 3II0A 1I29A 3P1TA 2GQNA 3PJ0A 1VEFA 1B8GA 1QJ5A 3PGYA 4Q6RA 5HDMA 1Z7DA 1PFFA 2O0RA 4F4EA 4WYAA 3RI6A 1B4XA 1O69A 5G2PA 2VMZA 3BCBA 1UKJA 1ASAA 4A72A 3LV2A 3MC6A 4ITXA 4K2IA 4GE4A 4IYOA 3AEMA 4OT8A 1YJSA 3PDBA 1WYVA 2AY4A 3LY1A 3WGBA 1QJ3A 4CBRA 3RBLA 1TOKA 3FFHA 2G7JA 2X5FA 1I48A 3VOMA 3NDNA 3DRDA 1S07A 3RCHA 3EUCA 3NRAA 4E1OA 2C7TA 4XJPA 4M2JA 1IX8A 4RITA 1DTYA 1QIRA 3JU7A 1KKJA 4U2HA 2YKUA 5EIGB 2BI3A 1SZKA 4ISYA 4WYGA 2QMAA 2CJGA 2VLFA 3CQ4A 5D95A 4A6UA 2VGSA 4A0GA 4DBCA 3N4RA 1KMJA 1I41A 1WYTA 1ELUA 4GE7A 2OGAA 2CTZA 3FZ8A 3AEJC 3KE3A 5D5SA 3EI7A 1H0CA 2C81A 4JEZA 4RIZA 1ZC9A 3ZRRA 4IXOA 2CB1A 2BI5A 2VGZA 3FCRA 4GRXA 2BI1A 4OBUA 2V0YA 2OKJA 3K28A 1AAMA 1G4XA 3MEBA 1TATA 4E77A 2W7IA 4XJOA 4FFCA 5BJ4A 1AMSA 4J5UA 4WYFA 1C7GA 3DXWA 4L0OA 4CXRA 1TOEA 2PB2A 1ZODA 4BQ0A 3DXVA 2HUFA 4OYTA 4WB0A 2BYJA 3NNKA 1WKGA 3ISLA 2D65A 3LG0A 4MQPA 2AY2A 3PIUA 2AEUA 3MC6C 2W7DA 2W7MA 4RM1A 3JWAA 1BJ4A 1AJSA 4CBSA 1DJEA 4W1XA 1AY8A 1GC3A 3HMUA 4ZSWA 1ELQA 5HXXA 2VLHA 2ZY4A 1BJNA 1D2FA 2FYFA 3I4JA 3RQ1A 3LVMA 3TQXA 2AY8A 2AY7A 4B98A 3PD6B 5J8QA 2EO5A 3PPLA 4NOGA 1AJRA 1OATA 3ZRPA 3A9ZA 3OP7A 4RJ0A 2BHXA 1B9HA 1AIBA 1O62A 2BKWA 4TMRA 4Q75A 4AO4A 3N4XA 4IX8A 2CH2A 3COGA 3EI8A 3QI6A 4OC9A 1RV4A 2YKXA 3A2BA 3B1CA 4LNLA 4RKDA 1Z3ZA 1Y4IA 2HOZA 4ATQA 3A8UX 4ZM4A 1AMRA 2VI9A 2A1VA 3BWNC 1DKAA 1EJIA 2OKKA 4JEXA 1LW5A 1XI9A 1BJOA 2GB3A 4E3QA 5DJ9A 2VMYA 1CQ6A 1AICA 4F5JA 4ZASA 1PG8A 4PVFA 3ZZJA 2W7KA 2D63A 4RLGA 3FTBA 5BJ3A 3M5UA 2JISA 1M0OA 2X5DA 3FVXA 1BJWA 3H9XA 3EI9A 5TF5A 4ATPA 1GEWA 1UU1A 2VGWA 1CL1A 3NYSA 2E54A 4E3RA 5LH9A 1BT4A 1C0NA 1EG5A 3MAFA 4OMAA 1ASNA 3B1DA 4MKKA 2DGMA 3E6GA 3R4TA 1H1CA 1RV3A 2G6WA 4WYDA 4A6TA 2AY3A 1B5OA 2BWNA 3E2ZA 1W7MA 5DJ1A 3L8AA 1X2AA 3CQ5A 3USFA 5M46A 1CL2A 1KMKA 1LK9A 5EUNA 1IAXA 5G0AA 3FSLA 4ZAHA 4ADCA 1MLYA 2C44A 3FQ7A 3ATHA 3DR7A 1GDEA 3ELPA 3BB8A 3NYUA 1XEYA 2VMSA 2W7JA 3GZDC 1ARSA 2JJEA 2Z1ZA 3NUBA 1J04A 4KAMA 3NU7A 1T3IA 3AEOA 1GEXA 3OKSA 5LHAA 1ARGA 4Y0IA 3TCMA 1GD9A 4WD2A 2X3LA 4R5FA 1BW0A 1MDZA 2E7UA 1QITA 1OXOA 2Z67A 1JS6A 5E3KA 3GSBA 3DR4A 3FRKA 2AY9A 4XK1A 4RAEA 1WKHA 3BC8A 3DYDA 3BV0A 2R5CA 2CJDA 4GEBA 1JF9A 2DGKA 3FVSA 4QGRA 1GC2A 1MDXA 2E7JA 5HHYA 3AENB 2AY6A 2R2NA 4AZKA 1WYUB 1C7NA 4W8IA 3VAXA 3T32A 5M4DA 1CQ8A 2ZY3A 3I16A 2RFVA 1OXPA 1CJ0A 1LC5A 2FM1A 1PMMA 1UU2A 4Q31A 1BKGA 4UHOA 1J32A 2R5EA 1TOGA 2EH6A 2QB3A 4HVKA 1M32A 1AKCA 1ARHA 3FQ8A 4XQ2A 4B9BA 3GETA 4JEYA 2KFPA 2VGVA 2VMOA 1DJUA 5EUDA 4IXSA 1OHVA 1GBNA 3FQAA 4MY5A 1S0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z9W A;  2OAT A;  2R0T A;  1YJZ A;  4K2B A;  1SF2 A;  4LW2 A;  4ADE A;  4ZWM A;  2FNU A;  5DB5 A;  3WKS A;  2OGE A;  3ASA A;  2VMQ A;  4A00 A;  2E7I A;  3GBX A;  5EAA A;  1BS0 A;  1CS1 A;  2YKV A;  1AKB A;  3NX3 A;  1N31 A;  3B1E A;  3H7F A;  1JG8 A;  1C9C A;  1S09 A;  2HUU A;  4XJL A;  3AEM C;  1CZE A;  3LVJ A;  2WK8 A;  5EQC A;  4W91 A;  1D7U A;  2HZP A;  4Q76 A;  4PFN A;  4OCA A;  1YNU A;  2CST A;  2W7E A;  5G4I A;  1ART A;  4ZM3 A;  4F5H A;  1AHE A;  3HT4 A;  2AY5 A;  3AEL A;  4AOA A;  1ASL A;  1ASE A;  1LC7 A;  2QA3 A;  1B9I A;  1IX7 A;  4LNJ A;  3JZL A;  4EB5 A;  1TAS A;  5EIG A;  4P7Y A;  2VMV A;  2O7C A;  1AMA A;  1D7S A;  2GMS A;  1GC4 A;  3ACZ A;  3QBO A;  3FZ6 A;  4Y0D A;  3WCN A;  4JEV A;  3GWP A;  2HOR A;  3WY7 A;  1TOI A;  2Z9X A;  2VGT A;  3FVU A;  3WKR A;  1JS3 A;  2VMX A;  2YCN A;  4WLJ A;  1M0P A;  3I5T A;  3A9X A;  1TAR A;  1VP4 A;  2D66 A;  4JF1 A;  4U1T A;  4UHM A;  3VK4 A;  3EZ1 A;  1YOO A;  2ZSM A;  3QPG A;  5EAV A;  1ASF A;  3BWO A;  3W1I A;  1FG3 A;  5K8B A;  3K7Y A;  2JG2 A;  1YIZ A;  1M6S A;  2D5Y A;  2YCP A;  3QHX A;  1AY5 A;  1AX4 A;  2FNI A;  3WGC A;  4GDY A;  3WLX A;  4RJY A;  3FKD A;  4OBV A;  4W1V A;  3G0T A;  2VMW A;  3K40 A;  1M7Y A;  2YCT A;  2CAN A;  2AY1 A;  4IY7 A;  4GSA A;  1IUG A;  1E5E A;  2AAT A;  3ELE A;  1O4S A;  4F5I A;  2BI9 A;  2VMU A;  3ECD A;  2Q7W A;  1IVR A;  4H51 A;  1SFF A;  1SZU A;  3CAI A;  3F6T A;  4XAU A;  3AOV A;  2CFB A;  4IYO B;  4EU1 A;  4AH3 A;  1EQB A;  2VIA A;  3PDB B;  3FD0 A;  1WYV B;  5AX8 A;  4TN4 A;  1ASM A;  1QZ9 A;  4MGR A;  2PO3 A;  4ADB A;  2ZP7 A;  4ADD A;  3HLM A;  2VGU A;  3HQT A;  3N0L A;  3PD6 A;  4WXB A;  3RCH B;  5FT5 A;  3BCA A;  2BIG A;  3ZRQ A;  1G7X A;  3B8X A;  1M0N A;  4DGT A;  1TOJ A;  2GMU A;  1G7W A;  1ECX A;  3MAU A;  1DFO A;  1S08 A;  1IBJ A;  2FN6 A;  2QBT A;  5C6U A;  1WYT B;  1V2D A;  1RVU A;  3QN6 A;  2W7G A;  3LWS A;  3MAD A;  3Q8N A;  3CQ6 A;  2D7Y A;  1N2T A;  3E9K A;  5FT6 A;  4N0W A;  3HBX A;  1W7L A;  2ZJG A;  4WYE A;  3BCX A;  4R8D A;  3AOW A;  5FT8 A;  4BMK A;  4N0B A;  2DKJ A;  4ZLV A;  3JW9 A;  4FL0 A;  4KXK A;  4R2N A;  3UWC A;  1KL1 A;  2CJH A;  1ASG A;  4ZSY A;  2EPJ A;  3IHJ A;  4UOY A;  4WB0 B;  3RBF A;  3TAT A;  4XJM A;  1M0Q A;  1V72 A;  3FFR A;  4W1W A;  2EZ2 A;  1DGE A;  4JE5 A;  1BQA A;  4O6Z A;  3WX9 A;  4P3M A;  4W5K A;  4ZDL A;  3AV7 A;  4CVQ A;  4MSO A;  4F5K A;  1GCK A;  3E2F A;  1AJS B;  2JJF A;  2C0R A;  2ZYJ A;  4WYC A;  8AAT A;  3WZF A;  2OQX A;  2YOB A;  1IAY A;  3FZ7 A;  3R9A A;  1YIY A;  1AKA A;  3CBF A;  4PFF A;  3WCO A;  3LVL B;  3KGX A;  2Z9U A;  1AHY A;  3DC1 A;  3PA9 A;  3VK3 A;  2YRI A;  1LC8 A;  1MLZ A;  2DGL A;  3QM2 A;  3W1J A;  1B5P A;  3GJU A;  3NYT A;  3VP6 A;  4A6R A;  2CY8 A;  3FDB A;  4F5M A;  1YAA A;  4DQ6 A;  1AHF A;  5EUE A;  1W3U A;  1MDO A;  2YRR A;  4WXG A;  4EMY A;  1LKC A;  4JE5 D;  1MGV A;  3A9Y A;  4IW7 A;  1MAQ A;  2CH1 A;  3AAT A;  1MAP A;  3BS8 A;  2XH1 A;  1LW4 A;  2X8U A;  5F8V A;  5FT4 A;  2ZY5 A;  4F5L A;  4RKC A;  2D64 A;  2WK9 A;  2VMP A;  1AMQ A;  1KL2 A;  1X0M A;  1N8P A;  3BWN A;  1BQD A;  2BIE A;  3E2Y A;  2DR1 A;  1SPA A;  1BJO B;  1TPL A;  2JJG A;  4WLH A;  4ITG A;  5I92 A;  2BI2 A;  1QIS A;  3F9T A;  3PDX A;  1OHW A;  1OHY A;  4R5Z A;  4KYO A;  1AY4 A;  2D61 A;  3AEN A;  2NMP A;  1WYU A;  2W7L A;  3EIA A;  3GR9 A;  1AHX A;  1C4K A;  3HL2 A;  1SZS A;  2HP1 A;  1X28 A;  4TV7 A;  1ARI A;  4BA4 A;  3VK2 A;  4I8A A;  1S06 A;  1E5F A;  3HVY A;  2ZY2 A;  1ORD A;  2HOX A;  3TFT A;  3PAA A;  2DKB A;  3AEP A;  3JWB A;  4Y0H A;  2DOU A;  4JEW A;  3MAF B;  1PMO A;  1P3W A;  3KGW A;  3P6K A;  4MQQ A;  2BIA A;  2AEV A;  7AAT A;  2ZC0 A;  2VMR A;  3DU4 A;  4XEW A;  2Z61 A;  1RVY A;  3LVK A;  1W7N A;  4MKJ A;  1G4V A;  2O1B A;  2Z20 A;  1CQ7 A;  3W1H A;  3E2Z B;  3D6K A;  4AO9 A;  4WP0 A;  4ZDO A;  3NU8 A;  1ASC A;  2XBN A;  2BWP A;  2JGT A;  4J8L A;  1WST A;  2GSA A;  4A0F A;  1D7R A;  2CIN A;  3KKI A;  5M4B A;  3DZZ A;  2TPL A;  4EFF A;  2HOY A;  2VI8 A;  2HUI A;  4JF0 A;  1DGD A;  2Z9V A;  2W8U A;  2YHK A;  3ZZK A;  3EI5 A;  1IJI A;  3QGU A;  1SVV A;  4WXF A;  2FQ6 A;  5G2Q A;  2VMN A;  4LNM A;  1D7V A;  4A0R A;  4PIW A;  3GZD A;  1FG7 A;  2BYL A;  3MBB A;  2QLR A;  1W23 A;  3EI6 A;  3JTX A;  3TFU A;  1X29 A;  2W8J A;  3UAK A;  4M2M A;  2JJH A;  3BN1 A;  2D7Z A;  3HDO A;  2F8J A;  4K2M A;  4A0H A;  2V1P A;  5E4Z A;  3E77 A;  2HP2 A;  4CXQ A;  3EIB A;  3G8M A;  3GZC A;  1LS3 A;  4AZJ A;  2W8T A;  1AIA A;  2R5C B;  2ZSL A;  3B46 A;  4IXZ A;  4MQR A;  4EB7 A;  1GC0 A;  3DOD A;  3IF2 A;  4GE9 A;  1QGN A;  4HF8 A;  4LW4 A;  1UU0 A;  3UE8 A;  5M49 A;  4BHD A;  5IWQ A;  2W8W A;  1GEY A;  3ASB A;  2ORD A;  1CZC A;  3N5M A;  2WKA A;  3RUY A;  2PB0 A;  3MKJ A;  2ZUK A;  4M2K A;  2VIB A;  4WBT A;  3N75 A;  4UHN A;  1U08 A;  1AHG A;  4LC3 A;  5G4J A;  2WK7 A;  1VJO A;  1ZOB A;  1O61 A;  3G7Q A;  3FDD A;  1KKP A;  2W8V A;  2EZ1 A;  1M4N A;  4UQV A;  4OTL A;  3L44 A;  1DJ9 A;  1V2E A;  2Z1Y A;  1C7O A;  5DX5 A;  2QB2 A;  1IX6 A;  2VMT A;  4ZDP A;  3NTJ A;  3F0H A;  1FC4 A;  1V2F A;  3AEJ A;  2BWO A;  9AAT A;  5E5I A;  5G09 A;  4F5F A;  1AAW A;  4F5G A;  4ZWV A;  1ASB A;  3H14 A;  5F9S A;  2VYC A;  5JAY A;  2W7F A;  1YJY A;  1I43 A;  2W7H A;  2YKY A;  3EZS A;  3NUI A;  1ASD A;  4BA5 A;  2EGY A;  5EFS A;  3II0 A;  1I29 A;  3P1T A;  2GQN A;  3PJ0 A;  1VEF A;  1B8G A;  1QJ5 A;  3PGY A;  4Q6R A;  5HDM A;  1Z7D A;  1PFF A;  2O0R A;  4F4E A;  4WYA A;  3RI6 A;  1B4X A;  1O69 A;  5G2P A;  2VMZ A;  3BCB A;  1UKJ A;  1ASA A;  4A72 A;  3LV2 A;  3MC6 A;  4ITX A;  4K2I A;  4GE4 A;  4IYO A;  3AEM A;  4OT8 A;  1YJS A;  3PDB A;  1WYV A;  2AY4 A;  3LY1 A;  3WGB A;  1QJ3 A;  4CBR A;  3RBL A;  1TOK A;  3FFH A;  2X5F A;  1I48 A;  3VOM A;  3NDN A;  3DRD A;  1S07 A;  3RCH A;  3EUC A;  3NRA A;  4E1O A;  2C7T A;  4XJP A;  4M2J A;  1IX8 A;  4RIT A;  1DTY A;  1QIR A;  3JU7 A;  1KKJ A;  4U2H A;  2YKU A;  5EIG B;  2BI3 A;  1SZK A;  4ISY A;  4WYG A;  2QMA A;  2CJG A;  2VLF A;  3CQ4 A;  5D95 A;  4A6U A;  2VGS A;  4A0G A;  4DBC A;  1KMJ A;  1I41 A;  1WYT A;  1ELU A;  4GE7 A;  2OGA A;  2CTZ A;  3FZ8 A;  3AEJ C;  3KE3 A;  5D5S A;  3EI7 A;  1H0C A;  2C81 A;  4JEZ A;  4RIZ A;  1ZC9 A;  3ZRR A;  4IXO A;  2CB1 A;  2BI5 A;  2VGZ A;  3FCR A;  4GRX A;  2BI1 A;  4OBU A;  2V0Y A;  2OKJ A;  3K28 A;  1AAM A;  1G4X A;  3MEB A;  1TAT A;  4E77 A;  2W7I A;  4XJO A;  4FFC A;  5BJ4 A;  1AMS A;  4J5U A;  4WYF A;  1C7G A;  3DXW A;  4L0O A;  4CXR A;  1TOE A;  2PB2 A;  1ZOD A;  4BQ0 A;  3DXV A;  2HUF A;  4OYT A;  4WB0 A;  2BYJ A;  3NNK A;  1WKG A;  3ISL A;  2D65 A;  3LG0 A;  4MQP A;  2AY2 A;  3PIU A;  2AEU A;  3MC6 C;  2W7D A;  2W7M A;  4RM1 A;  3JWA A;  1BJ4 A;  1AJS A;  4CBS A;  1DJE A;  4W1X A;  1AY8 A;  1GC3 A;  3HMU A;  4ZSW A;  1ELQ A;  5HXX A;  2VLH A;  2ZY4 A;  1BJN A;  1D2F A;  2FYF A;  3I4J A;  3RQ1 A;  3LVM A;  3TQX A;  2AY8 A;  2AY7 A;  4B98 A;  3PD6 B;  5J8Q A;  2EO5 A;  3PPL A;  4NOG A;  1AJR A;  1OAT A;  3ZRP A;  3A9Z A;  3OP7 A;  4RJ0 A;  2BHX A;  1B9H A;  1AIB A;  1O62 A;  2BKW A;  4TMR A;  4Q75 A;  4AO4 A;  4IX8 A;  2CH2 A;  3COG A;  3EI8 A;  3QI6 A;  4OC9 A;  1RV4 A;  2YKX A;  3A2B A;  3B1C A;  4LNL A;  4RKD A;  1Z3Z A;  1Y4I A;  2HOZ A;  4ATQ A;  3A8U X;  4ZM4 A;  1AMR A;  2VI9 A;  3BWN C;  1DKA A;  1EJI A;  2OKK A;  4JEX A;  1LW5 A;  1XI9 A;  1BJO A;  2GB3 A;  4E3Q A;  5DJ9 A;  2VMY A;  1CQ6 A;  1AIC A;  4F5J A;  4ZAS A;  1PG8 A;  4PVF A;  3ZZJ A;  2W7K A;  2D63 A;  4RLG A;  3FTB A;  5BJ3 A;  3M5U A;  2JIS A;  1M0O A;  2X5D A;  3FVX A;  1BJW A;  3EI9 A;  5TF5 A;  4ATP A;  1GEW A;  1UU1 A;  2VGW A;  1CL1 A;  3NYS A;  2E54 A;  4E3R A;  5LH9 A;  1BT4 A;  1C0N A;  1EG5 A;  3MAF A;  4OMA A;  1ASN A;  3B1D A;  4MKK A;  2DGM A;  3E6G A;  3R4T A;  1H1C A;  1RV3 A;  2G6W A;  4WYD A;  4A6T A;  2AY3 A;  1B5O A;  2BWN A;  3E2Z A;  1W7M A;  5DJ1 A;  3L8A A;  1X2A A;  3CQ5 A;  3USF A;  5M46 A;  1CL2 A;  1KMK A;  1LK9 A;  5EUN A;  1IAX A;  5G0A A;  3FSL A;  4ZAH A;  4ADC A;  1MLY A;  2C44 A;  3FQ7 A;  3ATH A;  3DR7 A;  1GDE A;  3ELP A;  3BB8 A;  3NYU A;  1XEY A;  2VMS A;  2W7J A;  3GZD C;  1ARS A;  2JJE A;  2Z1Z A;  3NUB A;  1J04 A;  4KAM A;  3NU7 A;  1T3I A;  3AEO A;  1GEX A;  3OKS A;  5LHA A;  1ARG A;  4Y0I A;  3TCM A;  1GD9 A;  4WD2 A;  2X3L A;  4R5F A;  1BW0 A;  1MDZ A;  2E7U A;  1QIT A;  1OXO A;  2Z67 A;  1JS6 A;  5E3K A;  3GSB A;  3DR4 A;  3FRK A;  2AY9 A;  4XK1 A;  4RAE A;  1WKH A;  3BC8 A;  3DYD A;  3BV0 A;  2R5C A;  2CJD A;  4GEB A;  1JF9 A;  2DGK A;  3FVS A;  4QGR A;  1GC2 A;  1MDX A;  2E7J A;  5HHY A;  3AEN B;  2AY6 A;  2R2N A;  4AZK A;  1WYU B;  1C7N A;  4W8I A;  3VAX A;  3T32 A;  5M4D A;  1CQ8 A;  2ZY3 A;  3I16 A;  2RFV A;  1OXP A;  1CJ0 A;  1LC5 A;  2FM1 A;  1PMM A;  1UU2 A;  4Q31 A;  1BKG A;  4UHO A;  1J32 A;  2R5E A;  1TOG A;  2EH6 A;  2QB3 A;  4HVK A;  1M32 A;  1AKC A;  1ARH A;  3FQ8 A;  4XQ2 A;  4B9B A;  3GET A;  4JEY A;  2VGV A;  2VMO A;  1DJU A;  5EUD A;  4IXS A;  1OHV A;  1GBN A;  3FQA A;  4MY5 A;  1S0A A; 
#chains in the Genus database with same CATH topology
 2Z9W A;  2OAT A;  2R0T A;  1YJZ A;  4K2B A;  1SF2 A;  4LW2 A;  4ADE A;  4ZWM A;  2FNU A;  5DB5 A;  3WKS A;  2OGE A;  3ASA A;  2VMQ A;  4A00 A;  2E7I A;  3GBX A;  5EAA A;  1BS0 A;  1CS1 A;  2YKV A;  1AKB A;  3NX3 A;  1N31 A;  3B1E A;  3H7F A;  1JG8 A;  1C9C A;  1S09 A;  2HUU A;  4XJL A;  3AEM C;  1CZE A;  3LVJ A;  2WK8 A;  5EQC A;  4W91 A;  1D7U A;  2HZP A;  4Q76 A;  4PFN A;  4OCA A;  2FKI A;  1YNU A;  2CST A;  2W7E A;  5G4I A;  1ART A;  4ZM3 A;  4F5H A;  1AHE A;  3HT4 A;  2AY5 A;  3AEL A;  4AOA A;  1ASL A;  1ASE A;  1LC7 A;  2QA3 A;  1B9I A;  1IX7 A;  4LNJ A;  3JZL A;  4EB5 A;  1TAS A;  5EIG A;  4P7Y A;  2VMV A;  2O7C A;  1AMA A;  1D7S A;  2GMS A;  1GC4 A;  3ACZ A;  3QBO A;  3FZ6 A;  4Y0D A;  3WCN A;  4JEV A;  3GWP A;  2HOR A;  3WY7 A;  1TOI A;  2Z9X A;  2VGT A;  3FVU A;  3WKR A;  1JS3 A;  2VMX A;  2YCN A;  4WLJ A;  1M0P A;  3I5T A;  3A9X A;  3N7N A;  1TAR A;  1VP4 A;  2D66 A;  4JF1 A;  4U1T A;  4UHM A;  3VK4 A;  3EZ1 A;  1YOO A;  2ZSM A;  3QPG A;  5EAV A;  1ASF A;  3BWO A;  3W1I A;  1FG3 A;  5K8B A;  3K7Y A;  2JG2 A;  1YIZ A;  1M6S A;  2D5Y A;  2YCP A;  3QHX A;  1AY5 A;  1AX4 A;  2FNI A;  3WGC A;  4GDY A;  3WLX A;  4RJY A;  3FKD A;  4OBV A;  4W1V A;  2EYQ A;  3G0T A;  2VMW A;  3K40 A;  5KTB A;  1M7Y A;  2YCT A;  2CAN A;  2AY1 A;  4IY7 A;  4GSA A;  1IUG A;  1E5E A;  2AAT A;  3ELE A;  1O4S A;  4F5I A;  2BI9 A;  2VMU A;  3ECD A;  2Q7W A;  1IVR A;  4H51 A;  1SFF A;  1SZU A;  3CAI A;  3F6T A;  4XAU A;  3AOV A;  2CFB A;  4IYO B;  4EU1 A;  4AH3 A;  1EQB A;  2VIA A;  3N4S A;  4K05 A;  3PDB B;  3FD0 A;  1WYV B;  5AX8 A;  4TN4 A;  1ASM A;  1QZ9 A;  4MGR A;  2PO3 A;  4ADB A;  2ZP7 A;  4ADD A;  3HLM A;  2VGU A;  3HQT A;  3N0L A;  3PD6 A;  4WXB A;  3RCH B;  5FT5 A;  3BCA A;  2BIG A;  3ZRQ A;  1G7X A;  3B8X A;  1M0N A;  4DGT A;  1TOJ A;  2GMU A;  1G7W A;  1ECX A;  3MAU A;  1DFO A;  1S08 A;  1IBJ A;  2FN6 A;  2QBT A;  5C6U A;  1WYT B;  1V2D A;  1RVU A;  3QN6 A;  2W7G A;  3LWS A;  3MAD A;  3Q8N A;  3CQ6 A;  2D7Y A;  1N2T A;  3E9K A;  5FT6 A;  4N0W A;  3HBX A;  1W7L A;  2ZJG A;  4WYE A;  3BCX A;  4R8D A;  3AOW A;  5FT8 A;  4BMK A;  4N0B A;  2DKJ A;  4ZLV A;  3JW9 A;  4FL0 A;  4KXK A;  4R2N A;  3UWC A;  1KL1 A;  2CJH A;  1ASG A;  4ZSY A;  2EPJ A;  3IHJ A;  4UOY A;  4WB0 B;  3RBF A;  2WB6 A;  3TAT A;  4XJM A;  1M0Q A;  1V72 A;  3FFR A;  4W1W A;  2EZ2 A;  1DGE A;  4JE5 A;  1BQA A;  4O6Z A;  3WX9 A;  4P3M A;  4W5K A;  4ZDL A;  3AV7 A;  4CVQ A;  4MSO A;  4F5K A;  1GCK A;  3E2F A;  1AJS B;  2JJF A;  2C0R A;  2ZYJ A;  4WYC A;  8AAT A;  3WZF A;  2OQX A;  2YOB A;  1IAY A;  3FZ7 A;  3R9A A;  1YIY A;  1AKA A;  3CBF A;  4PFF A;  3WCO A;  3LVL B;  3KGX A;  2Z9U A;  4H63 Q;  1AHY A;  3DC1 A;  3PA9 A;  3VK3 A;  2YRI A;  1LC8 A;  1MLZ A;  2DGL A;  3QM2 A;  3W1J A;  1B5P A;  3GJU A;  3NYT A;  3VP6 A;  4A6R A;  2CY8 A;  3FDB A;  4F5M A;  1YAA A;  4DQ6 A;  1AHF A;  5EUE A;  1W3U A;  1MDO A;  2YRR A;  4WXG A;  4EMY A;  1LKC A;  4JE5 D;  1MGV A;  3A9Y A;  4IW7 A;  1MAQ A;  2CH1 A;  3AAT A;  1MAP A;  3BS8 A;  2XH1 A;  1LW4 A;  2X8U A;  5F8V A;  5FT4 A;  2ZY5 A;  4F5L A;  4RKC A;  2D64 A;  2WK9 A;  2VMP A;  1AMQ A;  1KL2 A;  1X0M A;  1N8P A;  3BWN A;  1BQD A;  2BIE A;  3E2Y A;  2DR1 A;  1SPA A;  1BJO B;  1TPL A;  2JJG A;  4WLH A;  4ITG A;  5I92 A;  2BI2 A;  1QIS A;  3F9T A;  3PDX A;  1OHW A;  1OHY A;  4R5Z A;  4KYO A;  1AY4 A;  2D61 A;  3AEN A;  2NMP A;  1WYU A;  2W7L A;  3EIA A;  3GR9 A;  1AHX A;  1C4K A;  3HL2 A;  1SZS A;  2HP1 A;  1X28 A;  4TV7 A;  1ARI A;  4BA4 A;  3VK2 A;  4I8A A;  1S06 A;  1E5F A;  3HVY A;  2ZY2 A;  1ORD A;  2HOX A;  3TFT A;  3PAA A;  2DKB A;  3AEP A;  3JWB A;  4Y0H A;  2DOU A;  4JEW A;  3MAF B;  1PMO A;  1P3W A;  3KGW A;  3P6K A;  4MQQ A;  2BIA A;  2AEV A;  7AAT A;  2ZC0 A;  2VMR A;  3DU4 A;  4XEW A;  2Z61 A;  1RVY A;  3LVK A;  1W7N A;  4MKJ A;  1G4V A;  2O1B A;  2Z20 A;  1CQ7 A;  3W1H A;  3E2Z B;  3D6K A;  4AO9 A;  4WP0 A;  4ZDO A;  3NU8 A;  1ASC A;  2XBN A;  2BWP A;  2JGT A;  4J8L A;  1WST A;  2GSA A;  4A0F A;  1D7R A;  2CIN A;  3KKI A;  5M4B A;  3DZZ A;  2TPL A;  4EFF A;  2HOY A;  2VI8 A;  2HUI A;  4JF0 A;  1DGD A;  2Z9V A;  2W8U A;  2YHK A;  3ZZK A;  3EI5 A;  1IJI A;  3QGU A;  1SVV A;  4WXF A;  2FQ6 A;  5G2Q A;  2VMN A;  4LNM A;  1D7V A;  4A0R A;  4PIW A;  3GZD A;  1FG7 A;  1KAF A;  2BYL A;  3MBB A;  2QLR A;  1W23 A;  3EI6 A;  3JTX A;  3TFU A;  1X29 A;  2W8J A;  3UAK A;  4M2M A;  2JJH A;  3BN1 A;  2D7Z A;  3HDO A;  2F8J A;  4K2M A;  4A0H A;  2V1P A;  5E4Z A;  3E77 A;  2HP2 A;  4CXQ A;  3EIB A;  3G8M A;  3GZC A;  1LS3 A;  4AZJ A;  2W8T A;  1AIA A;  2R5C B;  2ZSL A;  3B46 A;  4IXZ A;  4MQR A;  4EB7 A;  1GC0 A;  3DOD A;  3IF2 A;  4GE9 A;  1QGN A;  4HF8 A;  4LW4 A;  1UU0 A;  3UE8 A;  5M49 A;  4BHD A;  5IWQ A;  2W8W A;  1GEY A;  3ASB A;  2ORD A;  1CZC A;  3N5M A;  2WKA A;  3RUY A;  2PB0 A;  3MKJ A;  2ZUK A;  4M2K A;  2VIB A;  4WBT A;  3N75 A;  4UHN A;  1U08 A;  1AHG A;  4LC3 A;  5G4J A;  2WK7 A;  1VJO A;  1ZOB A;  1O61 A;  3G7Q A;  3FDD A;  1KKP A;  2W8V A;  2EZ1 A;  1M4N A;  4UQV A;  4OTL A;  3L44 A;  1DJ9 A;  1V2E A;  2Z1Y A;  1C7O A;  5DX5 A;  2QB2 A;  1IX6 A;  2VMT A;  2QSR A;  4ZDP A;  3NTJ A;  3F0H A;  1FC4 A;  1V2F A;  3AEJ A;  2BWO A;  9AAT A;  5E5I A;  5G09 A;  4F5F A;  1AAW A;  4F5G A;  4ZWV A;  1ASB A;  3H14 A;  5F9S A;  2VYC A;  5JAY A;  2W7F A;  1YJY A;  1I43 A;  2W7H A;  2YKY A;  3EZS A;  3NUI A;  1ASD A;  4BA5 A;  2EGY A;  5EFS A;  3II0 A;  1I29 A;  3P1T A;  2GQN A;  3PJ0 A;  1VEF A;  1B8G A;  1QJ5 A;  3PGY A;  4Q6R A;  5HDM A;  1Z7D A;  1PFF A;  2O0R A;  4F4E A;  4WYA A;  3RI6 A;  1B4X A;  1O69 A;  5G2P A;  2VMZ A;  3BCB A;  1UKJ A;  1ASA A;  4A72 A;  3LV2 A;  3MC6 A;  4ITX A;  4K2I A;  4GE4 A;  4IYO A;  3AEM A;  4OT8 A;  1YJS A;  3PDB A;  1WYV A;  2AY4 A;  3LY1 A;  3WGB A;  1QJ3 A;  4CBR A;  3RBL A;  1TOK A;  3FFH A;  2G7J A;  2X5F A;  1I48 A;  3VOM A;  3NDN A;  3DRD A;  1S07 A;  3RCH A;  3EUC A;  3NRA A;  4E1O A;  2C7T A;  4XJP A;  4M2J A;  1IX8 A;  4RIT A;  1DTY A;  1QIR A;  3JU7 A;  1KKJ A;  4U2H A;  2YKU A;  5EIG B;  2BI3 A;  1SZK A;  4ISY A;  4WYG A;  2QMA A;  2CJG A;  2VLF A;  3CQ4 A;  5D95 A;  4A6U A;  2VGS A;  4A0G A;  4DBC A;  3N4R A;  1KMJ A;  1I41 A;  1WYT A;  1ELU A;  4GE7 A;  2OGA A;  2CTZ A;  3FZ8 A;  3AEJ C;  3KE3 A;  5D5S A;  3EI7 A;  1H0C A;  2C81 A;  4JEZ A;  4RIZ A;  1ZC9 A;  3ZRR A;  4IXO A;  2CB1 A;  2BI5 A;  2VGZ A;  3FCR A;  4GRX A;  2BI1 A;  4OBU A;  2V0Y A;  2OKJ A;  3K28 A;  1AAM A;  1G4X A;  3MEB A;  1TAT A;  4E77 A;  2W7I A;  4XJO A;  4FFC A;  5BJ4 A;  1AMS A;  4J5U A;  4WYF A;  1C7G A;  3DXW A;  4L0O A;  4CXR A;  1TOE A;  2PB2 A;  1ZOD A;  4BQ0 A;  3DXV A;  2HUF A;  4OYT A;  4WB0 A;  2BYJ A;  3NNK A;  1WKG A;  3ISL A;  2D65 A;  3LG0 A;  4MQP A;  2AY2 A;  3PIU A;  2AEU A;  3MC6 C;  2W7D A;  2W7M A;  4RM1 A;  3JWA A;  1BJ4 A;  1AJS A;  4CBS A;  1DJE A;  4W1X A;  1AY8 A;  1GC3 A;  3HMU A;  4ZSW A;  1ELQ A;  5HXX A;  2VLH A;  2ZY4 A;  1BJN A;  1D2F A;  2FYF A;  3I4J A;  3RQ1 A;  3LVM A;  3TQX A;  2AY8 A;  2AY7 A;  4B98 A;  3PD6 B;  5J8Q A;  2EO5 A;  3PPL A;  4NOG A;  1AJR A;  1OAT A;  3ZRP A;  3A9Z A;  3OP7 A;  4RJ0 A;  2BHX A;  1B9H A;  1AIB A;  1O62 A;  2BKW A;  4TMR A;  4Q75 A;  4AO4 A;  3N4X A;  4IX8 A;  2CH2 A;  3COG A;  3EI8 A;  3QI6 A;  4OC9 A;  1RV4 A;  2YKX A;  3A2B A;  3B1C A;  4LNL A;  4RKD A;  1Z3Z A;  1Y4I A;  2HOZ A;  4ATQ A;  3A8U X;  4ZM4 A;  1AMR A;  2VI9 A;  2A1V A;  3BWN C;  1DKA A;  1EJI A;  2OKK A;  4JEX A;  1LW5 A;  1XI9 A;  1BJO A;  2GB3 A;  4E3Q A;  5DJ9 A;  2VMY A;  1CQ6 A;  1AIC A;  4F5J A;  4ZAS A;  1PG8 A;  4PVF A;  3ZZJ A;  2W7K A;  2D63 A;  4RLG A;  3FTB A;  5BJ3 A;  3M5U A;  2JIS A;  1M0O A;  2X5D A;  3FVX A;  1BJW A;  3H9X A;  3EI9 A;  5TF5 A;  4ATP A;  1GEW A;  1UU1 A;  2VGW A;  1CL1 A;  3NYS A;  2E54 A;  4E3R A;  5LH9 A;  1BT4 A;  1C0N A;  1EG5 A;  3MAF A;  4OMA A;  1ASN A;  3B1D A;  4MKK A;  2DGM A;  3E6G A;  3R4T A;  1H1C A;  1RV3 A;  2G6W A;  4WYD A;  4A6T A;  2AY3 A;  1B5O A;  2BWN A;  3E2Z A;  1W7M A;  5DJ1 A;  3L8A A;  1X2A A;  3CQ5 A;  3USF A;  5M46 A;  1CL2 A;  1KMK A;  1LK9 A;  5EUN A;  1IAX A;  5G0A A;  3FSL A;  4ZAH A;  4ADC A;  1MLY A;  2C44 A;  3FQ7 A;  3ATH A;  3DR7 A;  1GDE A;  3ELP A;  3BB8 A;  3NYU A;  1XEY A;  2VMS A;  2W7J A;  3GZD C;  1ARS A;  2JJE A;  2Z1Z A;  3NUB A;  1J04 A;  4KAM A;  3NU7 A;  1T3I A;  3AEO A;  1GEX A;  3OKS A;  5LHA A;  1ARG A;  4Y0I A;  3TCM A;  1GD9 A;  4WD2 A;  2X3L A;  4R5F A;  1BW0 A;  1MDZ A;  2E7U A;  1QIT A;  1OXO A;  2Z67 A;  1JS6 A;  5E3K A;  3GSB A;  3DR4 A;  3FRK A;  2AY9 A;  4XK1 A;  4RAE A;  1WKH A;  3BC8 A;  3DYD A;  3BV0 A;  2R5C A;  2CJD A;  4GEB A;  1JF9 A;  2DGK A;  3FVS A;  4QGR A;  1GC2 A;  1MDX A;  2E7J A;  5HHY A;  3AEN B;  2AY6 A;  2R2N A;  4AZK A;  1WYU B;  1C7N A;  4W8I A;  3VAX A;  3T32 A;  5M4D A;  1CQ8 A;  2ZY3 A;  3I16 A;  2RFV A;  1OXP A;  1CJ0 A;  1LC5 A;  2FM1 A;  1PMM A;  1UU2 A;  4Q31 A;  1BKG A;  4UHO A;  1J32 A;  2R5E A;  1TOG A;  2EH6 A;  2QB3 A;  4HVK A;  1M32 A;  1AKC A;  1ARH A;  3FQ8 A;  4XQ2 A;  4B9B A;  3GET A;  4JEY A;  2KFP A;  2VGV A;  2VMO A;  1DJU A;  5EUD A;  4IXS A;  1OHV A;  1GBN A;  3FQA A;  4MY5 A;  1S0A A; 
#chains in the Genus database with same CATH homology
 2Z9W A;  2OAT A;  2R0T A;  1YJZ A;  4K2B A;  1SF2 A;  4LW2 A;  4ADE A;  4ZWM A;  2FNU A;  5DB5 A;  3WKS A;  2OGE A;  3ASA A;  2VMQ A;  4A00 A;  2E7I A;  3GBX A;  5EAA A;  1BS0 A;  1CS1 A;  2YKV A;  1AKB A;  3NX3 A;  1N31 A;  3B1E A;  3H7F A;  1JG8 A;  1C9C A;  1S09 A;  2HUU A;  4XJL A;  3AEM C;  1CZE A;  3LVJ A;  2WK8 A;  5EQC A;  4W91 A;  1D7U A;  2HZP A;  4Q76 A;  4PFN A;  4OCA A;  2FKI A;  1YNU A;  2CST A;  2W7E A;  5G4I A;  1ART A;  4ZM3 A;  4F5H A;  1AHE A;  3HT4 A;  2AY5 A;  3AEL A;  4AOA A;  1ASL A;  1ASE A;  1LC7 A;  2QA3 A;  1B9I A;  1IX7 A;  4LNJ A;  3JZL A;  4EB5 A;  1TAS A;  5EIG A;  4P7Y A;  2VMV A;  2O7C A;  1AMA A;  1D7S A;  2GMS A;  1GC4 A;  3ACZ A;  3QBO A;  3FZ6 A;  4Y0D A;  3WCN A;  4JEV A;  3GWP A;  2HOR A;  3WY7 A;  1TOI A;  2Z9X A;  2VGT A;  3FVU A;  3WKR A;  1JS3 A;  2VMX A;  2YCN A;  4WLJ A;  1M0P A;  3I5T A;  3A9X A;  3N7N A;  1TAR A;  1VP4 A;  2D66 A;  4JF1 A;  4U1T A;  4UHM A;  3VK4 A;  3EZ1 A;  1YOO A;  2ZSM A;  3QPG A;  5EAV A;  1ASF A;  3BWO A;  3W1I A;  1FG3 A;  5K8B A;  3K7Y A;  2JG2 A;  1YIZ A;  1M6S A;  2D5Y A;  2YCP A;  3QHX A;  1AY5 A;  1AX4 A;  2FNI A;  3WGC A;  4GDY A;  3WLX A;  4RJY A;  3FKD A;  4OBV A;  4W1V A;  2EYQ A;  3G0T A;  2VMW A;  3K40 A;  5KTB A;  1M7Y A;  2YCT A;  2CAN A;  2AY1 A;  4IY7 A;  4GSA A;  1IUG A;  1E5E A;  2AAT A;  3ELE A;  1O4S A;  4F5I A;  2BI9 A;  2VMU A;  3ECD A;  2Q7W A;  1IVR A;  4H51 A;  1SFF A;  1SZU A;  3CAI A;  3F6T A;  4XAU A;  3AOV A;  2CFB A;  4IYO B;  4EU1 A;  4AH3 A;  1EQB A;  2VIA A;  3N4S A;  4K05 A;  3PDB B;  3FD0 A;  1WYV B;  5AX8 A;  4TN4 A;  1ASM A;  1QZ9 A;  4MGR A;  2PO3 A;  4ADB A;  2ZP7 A;  4ADD A;  3HLM A;  2VGU A;  3HQT A;  3N0L A;  3PD6 A;  4WXB A;  3RCH B;  5FT5 A;  3BCA A;  2BIG A;  3ZRQ A;  1G7X A;  3B8X A;  1M0N A;  4DGT A;  1TOJ A;  2GMU A;  1G7W A;  1ECX A;  3MAU A;  1DFO A;  1S08 A;  1IBJ A;  2FN6 A;  2QBT A;  5C6U A;  1WYT B;  1V2D A;  1RVU A;  3QN6 A;  2W7G A;  3LWS A;  3MAD A;  3Q8N A;  3CQ6 A;  2D7Y A;  1N2T A;  3E9K A;  5FT6 A;  4N0W A;  3HBX A;  1W7L A;  2ZJG A;  4WYE A;  3BCX A;  4R8D A;  3AOW A;  5FT8 A;  4BMK A;  4N0B A;  2DKJ A;  4ZLV A;  3JW9 A;  4FL0 A;  4KXK A;  4R2N A;  3UWC A;  1KL1 A;  2CJH A;  1ASG A;  4ZSY A;  2EPJ A;  3IHJ A;  4UOY A;  4WB0 B;  3RBF A;  2WB6 A;  3TAT A;  4XJM A;  1M0Q A;  1V72 A;  3FFR A;  4W1W A;  2EZ2 A;  1DGE A;  4JE5 A;  1BQA A;  4O6Z A;  3WX9 A;  4P3M A;  4W5K A;  4ZDL A;  3AV7 A;  4CVQ A;  4MSO A;  4F5K A;  1GCK A;  3E2F A;  1AJS B;  2JJF A;  2C0R A;  2ZYJ A;  4WYC A;  8AAT A;  3WZF A;  2OQX A;  2YOB A;  1IAY A;  3FZ7 A;  3R9A A;  1YIY A;  1AKA A;  3CBF A;  4PFF A;  3WCO A;  3LVL B;  3KGX A;  2Z9U A;  4H63 Q;  1AHY A;  3DC1 A;  3PA9 A;  3VK3 A;  2YRI A;  1LC8 A;  1MLZ A;  2DGL A;  3QM2 A;  3W1J A;  1B5P A;  3GJU A;  3NYT A;  3VP6 A;  4A6R A;  2CY8 A;  3FDB A;  4F5M A;  1YAA A;  4DQ6 A;  1AHF A;  5EUE A;  1W3U A;  1MDO A;  2YRR A;  4WXG A;  4EMY A;  1LKC A;  4JE5 D;  1MGV A;  3A9Y A;  4IW7 A;  1MAQ A;  2CH1 A;  3AAT A;  1MAP A;  3BS8 A;  2XH1 A;  1LW4 A;  2X8U A;  5F8V A;  5FT4 A;  2ZY5 A;  4F5L A;  4RKC A;  2D64 A;  2WK9 A;  2VMP A;  1AMQ A;  1KL2 A;  1X0M A;  1N8P A;  3BWN A;  1BQD A;  2BIE A;  3E2Y A;  2DR1 A;  1SPA A;  1BJO B;  1TPL A;  2JJG A;  4WLH A;  4ITG A;  5I92 A;  2BI2 A;  1QIS A;  3F9T A;  3PDX A;  1OHW A;  1OHY A;  4R5Z A;  4KYO A;  1AY4 A;  2D61 A;  3AEN A;  2NMP A;  1WYU A;  2W7L A;  3EIA A;  3GR9 A;  1AHX A;  1C4K A;  3HL2 A;  1SZS A;  2HP1 A;  1X28 A;  4TV7 A;  1ARI A;  4BA4 A;  3VK2 A;  4I8A A;  1S06 A;  1E5F A;  3HVY A;  2ZY2 A;  1ORD A;  2HOX A;  3TFT A;  3PAA A;  2DKB A;  3AEP A;  3JWB A;  4Y0H A;  2DOU A;  4JEW A;  3MAF B;  1PMO A;  1P3W A;  3KGW A;  3P6K A;  4MQQ A;  2BIA A;  2AEV A;  7AAT A;  2ZC0 A;  2VMR A;  3DU4 A;  4XEW A;  2Z61 A;  1RVY A;  3LVK A;  1W7N A;  4MKJ A;  1G4V A;  2O1B A;  2Z20 A;  1CQ7 A;  3W1H A;  3E2Z B;  3D6K A;  4AO9 A;  4WP0 A;  4ZDO A;  3NU8 A;  1ASC A;  2XBN A;  2BWP A;  2JGT A;  4J8L A;  1WST A;  2GSA A;  4A0F A;  1D7R A;  2CIN A;  3KKI A;  5M4B A;  3DZZ A;  2TPL A;  4EFF A;  2HOY A;  2VI8 A;  2HUI A;  4JF0 A;  1DGD A;  2Z9V A;  2W8U A;  2YHK A;  3ZZK A;  3EI5 A;  1IJI A;  3QGU A;  1SVV A;  4WXF A;  2FQ6 A;  5G2Q A;  2VMN A;  4LNM A;  1D7V A;  4A0R A;  4PIW A;  3GZD A;  1FG7 A;  2BYL A;  3MBB A;  2QLR A;  1W23 A;  3EI6 A;  3JTX A;  3TFU A;  1X29 A;  2W8J A;  3UAK A;  4M2M A;  2JJH A;  3BN1 A;  2D7Z A;  3HDO A;  2F8J A;  4K2M A;  4A0H A;  2V1P A;  5E4Z A;  3E77 A;  2HP2 A;  4CXQ A;  3EIB A;  3G8M A;  3GZC A;  1LS3 A;  4AZJ A;  2W8T A;  1AIA A;  2R5C B;  2ZSL A;  3B46 A;  4IXZ A;  4MQR A;  4EB7 A;  1GC0 A;  3DOD A;  3IF2 A;  4GE9 A;  1QGN A;  4HF8 A;  4LW4 A;  1UU0 A;  3UE8 A;  5M49 A;  4BHD A;  5IWQ A;  2W8W A;  1GEY A;  3ASB A;  2ORD A;  1CZC A;  3N5M A;  2WKA A;  3RUY A;  2PB0 A;  3MKJ A;  2ZUK A;  4M2K A;  2VIB A;  4WBT A;  3N75 A;  4UHN A;  1U08 A;  1AHG A;  4LC3 A;  5G4J A;  2WK7 A;  1VJO A;  1ZOB A;  1O61 A;  3G7Q A;  3FDD A;  1KKP A;  2W8V A;  2EZ1 A;  1M4N A;  4UQV A;  4OTL A;  3L44 A;  1DJ9 A;  1V2E A;  2Z1Y A;  1C7O A;  5DX5 A;  2QB2 A;  1IX6 A;  2VMT A;  2QSR A;  4ZDP A;  3NTJ A;  3F0H A;  1FC4 A;  1V2F A;  3AEJ A;  2BWO A;  9AAT A;  5E5I A;  5G09 A;  4F5F A;  1AAW A;  4F5G A;  4ZWV A;  1ASB A;  3H14 A;  5F9S A;  2VYC A;  5JAY A;  2W7F A;  1YJY A;  1I43 A;  2W7H A;  2YKY A;  3EZS A;  3NUI A;  1ASD A;  4BA5 A;  2EGY A;  5EFS A;  3II0 A;  1I29 A;  3P1T A;  2GQN A;  3PJ0 A;  1VEF A;  1B8G A;  1QJ5 A;  3PGY A;  4Q6R A;  5HDM A;  1Z7D A;  1PFF A;  2O0R A;  4F4E A;  4WYA A;  3RI6 A;  1B4X A;  1O69 A;  5G2P A;  2VMZ A;  3BCB A;  1UKJ A;  1ASA A;  4A72 A;  3LV2 A;  3MC6 A;  4ITX A;  4K2I A;  4GE4 A;  4IYO A;  3AEM A;  4OT8 A;  1YJS A;  3PDB A;  1WYV A;  2AY4 A;  3LY1 A;  3WGB A;  1QJ3 A;  4CBR A;  3RBL A;  1TOK A;  3FFH A;  2G7J A;  2X5F A;  1I48 A;  3VOM A;  3NDN A;  3DRD A;  1S07 A;  3RCH A;  3EUC A;  3NRA A;  4E1O A;  2C7T A;  4XJP A;  4M2J A;  1IX8 A;  4RIT A;  1DTY A;  1QIR A;  3JU7 A;  1KKJ A;  4U2H A;  2YKU A;  5EIG B;  2BI3 A;  1SZK A;  4ISY A;  4WYG A;  2QMA A;  2CJG A;  2VLF A;  3CQ4 A;  5D95 A;  4A6U A;  2VGS A;  4A0G A;  4DBC A;  3N4R A;  1KMJ A;  1I41 A;  1WYT A;  1ELU A;  4GE7 A;  2OGA A;  2CTZ A;  3FZ8 A;  3AEJ C;  3KE3 A;  5D5S A;  3EI7 A;  1H0C A;  2C81 A;  4JEZ A;  4RIZ A;  1ZC9 A;  3ZRR A;  4IXO A;  2CB1 A;  2BI5 A;  2VGZ A;  3FCR A;  4GRX A;  2BI1 A;  4OBU A;  2V0Y A;  2OKJ A;  3K28 A;  1AAM A;  1G4X A;  3MEB A;  1TAT A;  4E77 A;  2W7I A;  4XJO A;  4FFC A;  5BJ4 A;  1AMS A;  4J5U A;  4WYF A;  1C7G A;  3DXW A;  4L0O A;  4CXR A;  1TOE A;  2PB2 A;  1ZOD A;  4BQ0 A;  3DXV A;  2HUF A;  4OYT A;  4WB0 A;  2BYJ A;  3NNK A;  1WKG A;  3ISL A;  2D65 A;  3LG0 A;  4MQP A;  2AY2 A;  3PIU A;  2AEU A;  3MC6 C;  2W7D A;  2W7M A;  4RM1 A;  3JWA A;  1BJ4 A;  1AJS A;  4CBS A;  1DJE A;  4W1X A;  1AY8 A;  1GC3 A;  3HMU A;  4ZSW A;  1ELQ A;  5HXX A;  2VLH A;  2ZY4 A;  1BJN A;  1D2F A;  2FYF A;  3I4J A;  3RQ1 A;  3LVM A;  3TQX A;  2AY8 A;  2AY7 A;  4B98 A;  3PD6 B;  5J8Q A;  2EO5 A;  3PPL A;  4NOG A;  1AJR A;  1OAT A;  3ZRP A;  3A9Z A;  3OP7 A;  4RJ0 A;  2BHX A;  1B9H A;  1AIB A;  1O62 A;  2BKW A;  4TMR A;  4Q75 A;  4AO4 A;  3N4X A;  4IX8 A;  2CH2 A;  3COG A;  3EI8 A;  3QI6 A;  4OC9 A;  1RV4 A;  2YKX A;  3A2B A;  3B1C A;  4LNL A;  4RKD A;  1Z3Z A;  1Y4I A;  2HOZ A;  4ATQ A;  3A8U X;  4ZM4 A;  1AMR A;  2VI9 A;  2A1V A;  3BWN C;  1DKA A;  1EJI A;  2OKK A;  4JEX A;  1LW5 A;  1XI9 A;  1BJO A;  2GB3 A;  4E3Q A;  5DJ9 A;  2VMY A;  1CQ6 A;  1AIC A;  4F5J A;  4ZAS A;  1PG8 A;  4PVF A;  3ZZJ A;  2W7K A;  2D63 A;  4RLG A;  3FTB A;  5BJ3 A;  3M5U A;  2JIS A;  1M0O A;  2X5D A;  3FVX A;  1BJW A;  3H9X A;  3EI9 A;  5TF5 A;  4ATP A;  1GEW A;  1UU1 A;  2VGW A;  1CL1 A;  3NYS A;  2E54 A;  4E3R A;  5LH9 A;  1BT4 A;  1C0N A;  1EG5 A;  3MAF A;  4OMA A;  1ASN A;  3B1D A;  4MKK A;  2DGM A;  3E6G A;  3R4T A;  1H1C A;  1RV3 A;  2G6W A;  4WYD A;  4A6T A;  2AY3 A;  1B5O A;  2BWN A;  3E2Z A;  1W7M A;  5DJ1 A;  3L8A A;  1X2A A;  3CQ5 A;  3USF A;  5M46 A;  1CL2 A;  1KMK A;  1LK9 A;  5EUN A;  1IAX A;  5G0A A;  3FSL A;  4ZAH A;  4ADC A;  1MLY A;  2C44 A;  3FQ7 A;  3ATH A;  3DR7 A;  1GDE A;  3ELP A;  3BB8 A;  3NYU A;  1XEY A;  2VMS A;  2W7J A;  3GZD C;  1ARS A;  2JJE A;  2Z1Z A;  3NUB A;  1J04 A;  4KAM A;  3NU7 A;  1T3I A;  3AEO A;  1GEX A;  3OKS A;  5LHA A;  1ARG A;  4Y0I A;  3TCM A;  1GD9 A;  4WD2 A;  2X3L A;  4R5F A;  1BW0 A;  1MDZ A;  2E7U A;  1QIT A;  1OXO A;  2Z67 A;  1JS6 A;  5E3K A;  3GSB A;  3DR4 A;  3FRK A;  2AY9 A;  4XK1 A;  4RAE A;  1WKH A;  3BC8 A;  3DYD A;  3BV0 A;  2R5C A;  2CJD A;  4GEB A;  1JF9 A;  2DGK A;  3FVS A;  4QGR A;  1GC2 A;  1MDX A;  2E7J A;  5HHY A;  3AEN B;  2AY6 A;  2R2N A;  4AZK A;  1WYU B;  1C7N A;  4W8I A;  3VAX A;  3T32 A;  5M4D A;  1CQ8 A;  2ZY3 A;  3I16 A;  2RFV A;  1OXP A;  1CJ0 A;  1LC5 A;  2FM1 A;  1PMM A;  1UU2 A;  4Q31 A;  1BKG A;  4UHO A;  1J32 A;  2R5E A;  1TOG A;  2EH6 A;  2QB3 A;  4HVK A;  1M32 A;  1AKC A;  1ARH A;  3FQ8 A;  4XQ2 A;  4B9B A;  3GET A;  4JEY A;  2KFP A;  2VGV A;  2VMO A;  1DJU A;  5EUD A;  4IXS A;  1OHV A;  1GBN A;  3FQA A;  4MY5 A;  1S0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...