2AATA

2.8-angstroms-resolution crystal structure of an active-site mutant of aspartate aminotransferase from escherichia coli
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSANFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8-A-resolution crystal structure of an active-site mutant of aspartate aminotransferase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 61
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1989-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2aatA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2aatA01
3F9TA 3LWSA 3NYUA 1DGDA 4F5HA 3DR7A 4JF1A 4UHOA 2HUFA 3KKIA 1DJUA 1MDXA 4WD2A 4ZSYA 5G0AA 3ASAA 3PD6B 2GSAA 3VK4A 1J32A 1G4XA 4A6UA 4A0FA 4Y0HA 3H7FA 1ASCA 3Q8NA 1IX6A 1ZC9A 1TOEA 1IX7A 3NDNA 2RFVA 4XJPA 1RVUA 3E2ZB 2W7LA 2W7GA 2ZY4A 1O62A 4HF8A 5JAYA 4OT8A 1IAYA 2WK7A 1ARHA 2HOXA 1ECXA 1B9HA 2VLFA 4GEBA 2ORDA 1SZSA 2AEUA 3MBBA 4UHMA 4K2BA 3ZRPA 3NRAA 3ZZJA 1I41A 3VK3A 2W7HA 3FZ6A 1O4SA 2W7MA 1CQ8A 1PMOA 4OBVA 5E5IA 2ZC0A 3WCOA 1C7GA 2VGWA 4ADCA 3AOWA 1W7MA 2VIAA 2OKKA 3E2ZA 2C81A 3GETA 3B46A 4F5GA 4M2KA 1V2FA 2HP1A 4EB7A 2DGKA 3AEMC 2C7TA 1BJ4A 3K40A 3AEJC 3W1JA 5EUDA 2CH1A 5LHAA 2YKVA 2D64A 2W7DA 3DZZA 5M4DA 1AY5A 2DR1A 1W23A 3M5UA 2Q7WA 2YCTA 1ARIA 3LV2A 5D5SA 1C0NA 4XK1A 4J5UA 2VI9A 3DR4A 2FQ6A 2GMSA 1M4NA 3EI8A 3II0A 4AZJA 3KE3A 3DYDA 4JEZA 1CZCA 3HVYA 1WSTA 1ASNA 2Z1ZA 1GEYA 4GE9A 4OBUA 3W1HA 2JISA 1D7SA 2DGLA 2JJFA 1WYVA 2BIEA 2QB2A 2ZY5A 1SVVA 1SPAA 2WK8A 3FVSA 3HMUA 3ZRQA 2AY4A 2OATA 2GMUA 5IWQA 2JJHA 4JEWA 2PO3A 1KMJA 2VMXA 4MQQA 1LW4A 4Q31A 1YAAA 1B5OA 4MQRA 4RM1A 5E4ZA 3G8MA 2Z67A 3BS8A 1V72A 4TV7A 3FFRA 4H51A 1QJ5A 4WYGA 3OKSA 3HQTA 4UHNA 2ZUKA 1QISA 1AKAA 3ACZA 4JE5A 4A72A 2O0RA 3PA9A 4TMRA 2VGZA 4R8DA 1BT4A 2WKAA 3BCBA 1QGNA 2F8JA 3QBOA 4J8LA 1BJOB 4F4EA 1AHYA 2D5YA 3CQ5A 4Q76A 4A0HA 1G7WA 2Z1YA 1LW5A 2EO5A 5EQCA 1B5PA 3AOVA 3HLMA 4ZDPA 1OXPA 3HT4A 4Y0DA 3AATA 4W8IA 3NU7A 3R9AA 1AJSB 5EIGA 3NUBA 4CBSA 3BCXA 3L44A 3BB8A 2CY8A 3CQ6A 2JJGA 4MY5A 2PB2A 3QN6A 2OQXA 1E5FA 2BYJA 1M0QA 3COGA 1AHXA 3F0HA 3WCNA 2HOZA 3EI7A 4EB5A 2FNIA 1SZUA 3N0LA 2VIBA 1CS1A 4ZDLA 5I92A 3B8XA 3NU8A 4CXQA 1W3UA 2AY8A 1AJRA 1IUGA 1J04A 4RIZA 2EZ1A 2VMRA 1G7XA 2CJDA 3KGWA 2BWNA 2D61A 4JEVA 4LNLA 4N0BA 3QM2A 4OYTA 4OC9A 4BA4A 4F5IA 2Z9VA 4ITGA 2BIGA 5K8BA 4IX8A 3MC6A 2AEVA 3USFA 3P6KA 4BMKA 3RBLA 1AJSA 2E7JA 4K2MA 5EIGB 3GR9A 1M0NA 5G2QA 2DKBA 3JW9A 5BJ4A 3PD6A 5EFSA 3FDDA 3DODA 1M6SA 5M46A 2VMSA 1GCKA 1D2FA 1V2DA 5G4JA 1EQBA 3ATHA 2BI9A 4PVFA 2YRIA 2AY9A 4A6RA 2EZ2A 2VMTA 4ATQA 2AY5A 4WP0A 3TCMA 1VP4A 3QGUA 1AIAA 1SFFA 2CINA 3TQXA 4CVQA 1AMRA 1OATA 1TOGA 2O7CA 1IVRA 2V1PA 2X5DA 4HVKA 3EI5A 3BWNA 2W7KA 1MAQA 4JF0A 5C6UA 4BA5A 3EIBA 1S08A 3UWCA 1TPLA 1WYUA 3GJUA 5HDMA 4OTLA 1FC4A 3AV7A 3VOMA 2AATA 2VMWA 3QI6A 3LVMA 4MGRA 1LC5A 2BHXA 2OGEA 4JEXA 1MLZA 4WYAA 4EMYA 4BQ0A 4GE4A 2VMZA 1X29A 1YIYA 2BKWA 4ADDA 1OXOA 4UQVA 2Z9WA 1YJYA 1IX8A 4WXBA 1TOJA 3VAXA 1O69A 3CAIA 3JWBA 1ARGA 5EUEA 5EUNA 2R5EA 3WZFA 2D7YA 4F5FA 1AAMA 1AKCA 2JGTA 4XAUA 4E3RA 3PDXA 1KMKA 3PJ0A 4OMAA 3PDBA 4CXRA 5EAAA 1MDOA 4R2NA 3VK2A 3NUIA 3WY7A 4ZM3A 1BW0A 3BN1A 1KL2A 1JG8A 2C0RA 2QB3A 4IYOA 5E3KA 5FT8A 4GSAA 3DU4A 1U08A 3FRKA 4RLGA 2W7IA 1D7VA 4B9BA 2D65A 3MC6C 1IJIA 4BHDA 4ZM4A 3EUCA 2DKJA 3MKJA 4Y0IA 1ZOBA 1ELQA 5BJ3A 2BIAA 2VGUA 4AO9A 3LVJA 4GDYA 4WYEA 4MQPA 1CL1A 5EAVA 4WYFA 1DGEA 3VP6A 3A9ZA 1RV3A 2XH1A 3OP7A 2FN6A 3UE8A 2G6WA 3ISLA 2XBNA 1D7UA 3QPGA 1MGVA 5G2PA 1M0OA 2AY1A 1S09A 2DOUA 1DFOA 2YCNA 3HL2A 4OCAA 2D66A 4I8AA 4F5KA 2HORA 4U1TA 1E5EA 1TARA 2O1BA 2VMUA 4IW7A 4LW4A 1BQDA 3E2YA 2X8UA 1BJOA 1XI9A 3AEJA 4ISYA 5HHYA 3FKDA 5LH9A 1RV4A 3QHXA 2BWPA 1IAXA 3MADA 3GBXA 1H0CA 3JZLA 1AMAA 2BI5A 3N5MA 4U2HA 2PB0A 3RCHB 2VGSA 4LNJA 3P1TA 1M0PA 1ASGA 2YRRA 5DB5A 1ZODA 4Q75A 3I4JA 3RQ1A 3BV0A 3T32A 3HBXA 1JS6A 3EIAA 8AATA 3B1EA 3PIUA 4KXKA 4IY7A 4ZLVA 4EFFA 1N31A 1TOKA 3E9KA 1AX4A 2X5FA 2W8TA 3ASBA 4WXFA 2VMVA 4DBCA 5DJ9A 1LS3A 5M4BA 2YHKA 3D6KA 2AY2A 4B98A 1Z7DA 4L0OA 1CL2A 2CFBA 1LK9A 3DC1A 3HDOA 3A2BA 3KGXA 4Q6RA 4IXZA 2ZJGA 1GC4A 4RKCA 4WLJA 4ZSWA 1I48A 3GZDC 5AX8A 3WLXA 2HP2A 4IXOA 3FDBA 1JF9A 3I16A 4DGTA 1WYTA 4GRXA 4PFFA 1LC8A 4PFNA 3AEMA 3IHJA 2AY3A 2QBTA 1X0MA 5F9SA 2W7JA 4M2JA 3RBFA 3FSLA 1AMQA 5FT6A 4WB0B 3L8AA 1BQAA 1S06A 2QLRA 3MAFB 4W91A 1GEWA 3A8UX 1AMSA 5F8VA 1N2TA 4XEWA 2ZP7A 4AH3A 5M49A 2CTZA 4R5FA 5G4IA 2Z9XA 4A6TA 3FTBA 2GQNA 2WK9A 1TATA 4AZKA 4ZWVA 4LW2A 1GD9A 3BWNC 1VEFA 2EH6A 1DKAA 3FQAA 1VJOA 3RCHA 1TASA 4XJOA 1ASAA 2D63A 1M7YA 4RKDA 4TN4A 1PG8A 1WYVB 3F6TA 1KKJA 1FG7A 2BI3A 1GBNA 4JEYA 4P7YA 2GB3A 4WB0A 1O61A 2VYCA 3FVUA 4WYCA 2EPJA 1SF2A 3FZ7A 4P3MA 1QJ3A 1EJIA 1SZKA 4W5KA 1DJ9A 4MKKA 4F5LA 1CJ0A 4E77A 3I5TA 1OHYA 1WYTB 2OKJA 1FG3A 1G4VA 1ORDA 1GEXA 2NMPA 2VMPA 2Z20A 1JS3A 3A9XA 2FM1A 3BWOA 3DXWA 3EZSA 3MAUA 2Z9UA 2R5CB 1Z3ZA 4W1XA 9AATA 1UKJA 4N0WA 1UU2A 1ASFA 5HXXA 3G0TA 2E7IA 4M2MA 4K2IA 4A0GA 1AICA 2Z61A 5G09A 5D95A 4WLHA 3NX3A 1AIBA 4ADEA 1WKHA 2YOBA 2R0TA 3AEOA 3ELEA 3E6GA 4W1WA 2EGYA 1PMMA 1YJZA 2E54A 2VMOA 2W8UA 3AENB 4LNMA 1N8PA 3WKRA 1ELUA 2ZSMA 4E3QA 3DXVA 4RJ0A 1IBJA 1AY4A 1LKCA 3RUYA 2JG2A 5DJ1A 3ELPA 2W8JA 1S0AA 2VMYA 4KAMA 4CBRA 1AAWA 2V0YA 3K28A 4RJYA 1BKGA 4R5ZA 5FT4A 2CH2A 3CBFA 3AELA 7AATA 1ASLA 1X28A 3B1DA 1KKPA 3FCRA 1UU0A 3NTJA 4WBTA 1C9CA 4XQ2A 4ZASA 3ZZKA 2VMNA 3FFHA 4XJMA 4RITA 1X2AA 3CQ4A 1WYUB 3LVKA 3PDBB 2R5CA 1BS0A 1CQ7A 1DTYA 2ZY2A 4ATPA 2QA3A 4A00A 4PIWA 3GZCA 2W8VA 3JWAA 3G7QA 1RVYA 3DRDA 2X3LA 1C4KA 4E1OA 3PGYA 2E7UA 4NOGA 2HZPA 5FT5A 3LVLB 4LC3A 2FNUA 2OGAA 4ZDOA 3EI6A 5DX5A 1MLYA 3RI6A 4XJLA 1ASBA 1WKGA 4DQ6A 4EU1A 3LY1A 2W7EA 2ZSLA 3K7YA 2TPLA 3FD0A 3GSBA 2CSTA 2W8WA 4MKJA 3W1IA 4F5MA 3NNKA 4FFCA 1GC0A 1QITA 1TOIA 4ZWMA 3AEPA 4F5JA 3TFUA 1ARTA 3WX9A 1H1CA 3E2FA 1QIRA 4WYDA 1C7NA 1W7LA 2VMQA 4UOYA 1XEYA 4AOAA 3MAFA 2YKUA 1AHFA 1YIZA 1YOOA 3FQ8A 4WXGA 3A9YA 1EG5A 3R4TA 2YCPA 3WGBA 4A0RA 2CJGA 4ZAHA 1YNUA 2BYLA 3BC8A 1P3WA 1ASEA 3ZRRA 1I29A 1CQ6A 2CB1A 4ITXA 2VLHA 4GE7A 3AENA 3GWPA 2CANA 3GZDA 4IXSA 3H14A 1B4XA 3ECDA 4IYOB 3TFTA 3FZ8A 1MDZA 4RAEA 4AO4A 1AHEA 3MEBA 3IF2A 1GC3A 4W1VA 2AY6A 3EZ1A 1ASDA 1LC7A 3EI9A 1S07A 1M32A 1OHVA 1Y4IA 3JTXA 2JJEA 3PPLA 2W7FA 4JE5D 1KL1A 1I43A 2R2NA 3JU7A 1W7NA 2YKYA 1GC2A 1ASMA 3PAAA 1DJEA 2ZY3A 2AY7A 4MSOA 1GDEA 4QGRA 1ARSA 1MAPA 2C44A 2D7ZA 2FYFA 4FL0A 1PFFA 1B8GA 1D7RA 3FVXA 3WKSA 2VI8A 1T3IA 4ADBA 1BJNA 1B9IA 1OHWA 2HUIA 1V2EA 1YJSA 2CJHA 5TF5A 2BI2A 3E77A 2HOYA 2YKXA 3WGCA 1AKBA 1C7OA 1CZEA 3B1CA 1BJWA 2ZYJA 4O6ZA 2BI1A 3LG0A 2DGMA 2HUUA 4KYOA 1QZ9A 2QMAA 2VGVA 2VGTA 3BCAA 3N75A 1AHGA 3FQ7A 1UU1A 3NYTA 5J8QA 3TATA 3UAKA 3NYSA 2BWOA 1AY8A
chains in the Genus database with same CATH superfamily
3F9TA 3LWSA 3NYUA 1DGDA 4F5HA 3DR7A 4JF1A 4UHOA 2HUFA 3KKIA 1DJUA 1MDXA 4WD2A 4ZSYA 5G0AA 3ASAA 3PD6B 2GSAA 3VK4A 1J32A 1G4XA 4A6UA 4A0FA 4Y0HA 3H7FA 1ASCA 3Q8NA 1IX6A 1ZC9A 1TOEA 1IX7A 3NDNA 2RFVA 4XJPA 1RVUA 3E2ZB 2W7LA 2W7GA 2ZY4A 1O62A 4HF8A 5JAYA 4OT8A 1IAYA 2WK7A 1ARHA 2HOXA 1ECXA 1B9HA 2VLFA 4GEBA 2ORDA 1SZSA 2AEUA 3MBBA 4UHMA 4K2BA 3ZRPA 3NRAA 3ZZJA 1I41A 3VK3A 2W7HA 3FZ6A 1O4SA 2W7MA 1CQ8A 1PMOA 4OBVA 5E5IA 2ZC0A 3WCOA 1C7GA 2VGWA 4ADCA 3AOWA 1W7MA 2VIAA 2OKKA 3E2ZA 2C81A 3GETA 3B46A 4F5GA 4M2KA 1V2FA 2HP1A 4EB7A 2DGKA 3AEMC 2C7TA 1BJ4A 3K40A 3AEJC 3W1JA 5EUDA 2CH1A 5LHAA 2YKVA 2D64A 2W7DA 3DZZA 5M4DA 1AY5A 2DR1A 1W23A 3M5UA 2Q7WA 2YCTA 1ARIA 3LV2A 5D5SA 1C0NA 4XK1A 4J5UA 2VI9A 3DR4A 2FQ6A 2GMSA 1M4NA 3EI8A 3II0A 4AZJA 3KE3A 3DYDA 2QSRA 4JEZA 1CZCA 3HVYA 1WSTA 1ASNA 2Z1ZA 1GEYA 4GE9A 4OBUA 3W1HA 2JISA 1D7SA 2DGLA 2JJFA 1WYVA 2BIEA 2QB2A 2ZY5A 1SVVA 1SPAA 2WK8A 3FVSA 3HMUA 3ZRQA 2AY4A 2OATA 2GMUA 5IWQA 2JJHA 4JEWA 2PO3A 1KMJA 2VMXA 4MQQA 1LW4A 4Q31A 1YAAA 1B5OA 4MQRA 4RM1A 5E4ZA 3G8MA 2Z67A 3BS8A 1V72A 4TV7A 3FFRA 4H51A 1QJ5A 4WYGA 3OKSA 3HQTA 4UHNA 2ZUKA 1QISA 1AKAA 3ACZA 4JE5A 4A72A 2O0RA 3PA9A 4TMRA 2VGZA 4R8DA 1BT4A 2WKAA 3BCBA 1QGNA 2F8JA 3QBOA 4J8LA 1BJOB 4F4EA 4H63Q 1AHYA 2D5YA 3CQ5A 4Q76A 4A0HA 1G7WA 2Z1YA 1LW5A 2EO5A 5EQCA 1B5PA 3AOVA 3HLMA 4ZDPA 1OXPA 3HT4A 4Y0DA 3AATA 4W8IA 3NU7A 3R9AA 1AJSB 5EIGA 3NUBA 4CBSA 3BCXA 3L44A 3BB8A 2CY8A 3CQ6A 2JJGA 4MY5A 2PB2A 3QN6A 2OQXA 4K05A 1E5FA 2BYJA 1M0QA 3COGA 1AHXA 3F0HA 3WCNA 2HOZA 3EI7A 4EB5A 2FNIA 1SZUA 3N0LA 2VIBA 1CS1A 4ZDLA 5I92A 3B8XA 3NU8A 4CXQA 1W3UA 2AY8A 2KFPA 1AJRA 1IUGA 1J04A 4RIZA 2EZ1A 2VMRA 1G7XA 2CJDA 3KGWA 2BWNA 2D61A 4JEVA 4LNLA 4N0BA 3QM2A 4OYTA 4OC9A 4BA4A 4F5IA 2Z9VA 4ITGA 2BIGA 5K8BA 4IX8A 3MC6A 2AEVA 3USFA 3P6KA 4BMKA 3RBLA 1AJSA 2E7JA 4K2MA 5EIGB 3GR9A 2EYQA 1M0NA 5G2QA 2DKBA 3JW9A 5BJ4A 3PD6A 5EFSA 3FDDA 3DODA 1M6SA 5M46A 2VMSA 1GCKA 1D2FA 1V2DA 5G4JA 1EQBA 3ATHA 2BI9A 4PVFA 2YRIA 2AY9A 4A6RA 2EZ2A 2VMTA 4ATQA 2AY5A 4WP0A 3TCMA 1VP4A 3QGUA 1AIAA 1SFFA 2CINA 3TQXA 4CVQA 1AMRA 1OATA 1TOGA 2O7CA 1IVRA 2V1PA 2X5DA 4HVKA 3EI5A 3BWNA 2W7KA 1MAQA 4JF0A 5C6UA 4BA5A 3EIBA 1S08A 3UWCA 1TPLA 1WYUA 3GJUA 5HDMA 3N4SA 4OTLA 3N4RA 1FC4A 3AV7A 3VOMA 2AATA 2VMWA 3QI6A 3LVMA 4MGRA 1LC5A 2BHXA 2OGEA 4JEXA 1MLZA 4WYAA 4EMYA 4BQ0A 4GE4A 2VMZA 1X29A 1YIYA 2BKWA 4ADDA 1OXOA 4UQVA 2Z9WA 1YJYA 1IX8A 4WXBA 1TOJA 3VAXA 1O69A 3CAIA 3JWBA 1ARGA 5EUEA 5EUNA 2R5EA 3WZFA 2D7YA 4F5FA 1AAMA 1AKCA 2JGTA 4XAUA 4E3RA 3PDXA 2A1VA 1KMKA 3PJ0A 4OMAA 3PDBA 4CXRA 5EAAA 1MDOA 4R2NA 3VK2A 3NUIA 3WY7A 4ZM3A 1BW0A 3BN1A 5KTBA 1KL2A 1JG8A 2C0RA 2QB3A 4IYOA 5E3KA 5FT8A 4GSAA 3DU4A 1U08A 3FRKA 4RLGA 2W7IA 1D7VA 4B9BA 3N4XA 2D65A 3MC6C 1IJIA 4BHDA 4ZM4A 3EUCA 2DKJA 3MKJA 4Y0IA 1ZOBA 1ELQA 5BJ3A 2BIAA 2VGUA 4AO9A 3LVJA 4GDYA 4WYEA 4MQPA 1CL1A 5EAVA 4WYFA 1DGEA 3VP6A 1KAFA 3A9ZA 1RV3A 2XH1A 3OP7A 2FN6A 3UE8A 2G6WA 3ISLA 2XBNA 1D7UA 3QPGA 1MGVA 5G2PA 1M0OA 2AY1A 3N7NA 1S09A 2DOUA 1DFOA 2YCNA 3HL2A 4OCAA 2D66A 4I8AA 4F5KA 2HORA 4U1TA 1E5EA 1TARA 2O1BA 2VMUA 4IW7A 4LW4A 1BQDA 3E2YA 2X8UA 1BJOA 1XI9A 3AEJA 4ISYA 5HHYA 3FKDA 5LH9A 1RV4A 3QHXA 2BWPA 1IAXA 3MADA 3GBXA 1H0CA 3JZLA 3H9XA 2G7JA 1AMAA 2BI5A 3N5MA 4U2HA 2PB0A 3RCHB 2VGSA 4LNJA 3P1TA 1M0PA 1ASGA 2YRRA 5DB5A 1ZODA 4Q75A 3I4JA 2WB6A 3RQ1A 3BV0A 3T32A 3HBXA 1JS6A 3EIAA 8AATA 3B1EA 3PIUA 4KXKA 4IY7A 4ZLVA 4EFFA 1N31A 1TOKA 3E9KA 1AX4A 2X5FA 2W8TA 3ASBA 4WXFA 2VMVA 4DBCA 5DJ9A 1LS3A 5M4BA 2YHKA 3D6KA 2AY2A 4B98A 1Z7DA 4L0OA 1CL2A 2CFBA 1LK9A 3DC1A 3HDOA 3A2BA 3KGXA 4Q6RA 4IXZA 2ZJGA 1GC4A 4RKCA 4WLJA 4ZSWA 1I48A 3GZDC 5AX8A 3WLXA 2HP2A 4IXOA 3FDBA 1JF9A 3I16A 4DGTA 1WYTA 4GRXA 4PFFA 1LC8A 4PFNA 3AEMA 3IHJA 2AY3A 2QBTA 1X0MA 5F9SA 2W7JA 4M2JA 3RBFA 3FSLA 1AMQA 5FT6A 4WB0B 3L8AA 1BQAA 1S06A 2QLRA 3MAFB 4W91A 1GEWA 3A8UX 1AMSA 5F8VA 1N2TA 4XEWA 2ZP7A 4AH3A 5M49A 2CTZA 4R5FA 5G4IA 2Z9XA 4A6TA 3FTBA 2GQNA 2WK9A 1TATA 4AZKA 4ZWVA 4LW2A 1GD9A 3BWNC 1VEFA 2EH6A 1DKAA 3FQAA 1VJOA 3RCHA 1TASA 4XJOA 1ASAA 2D63A 1M7YA 4RKDA 4TN4A 1PG8A 1WYVB 3F6TA 1KKJA 1FG7A 2BI3A 1GBNA 4JEYA 4P7YA 2GB3A 4WB0A 1O61A 2VYCA 3FVUA 4WYCA 2EPJA 1SF2A 3FZ7A 4P3MA 1QJ3A 1EJIA 1SZKA 4W5KA 1DJ9A 4MKKA 4F5LA 1CJ0A 4E77A 3I5TA 1OHYA 1WYTB 2OKJA 1FG3A 1G4VA 1ORDA 1GEXA 2NMPA 2VMPA 2Z20A 1JS3A 3A9XA 2FM1A 3BWOA 3DXWA 3EZSA 3MAUA 2Z9UA 2R5CB 1Z3ZA 4W1XA 9AATA 1UKJA 4N0WA 1UU2A 1ASFA 5HXXA 3G0TA 2E7IA 4M2MA 4K2IA 4A0GA 1AICA 2FKIA 2Z61A 5G09A 5D95A 4WLHA 3NX3A 1AIBA 4ADEA 1WKHA 2YOBA 2R0TA 3AEOA 3ELEA 3E6GA 4W1WA 2EGYA 1PMMA 1YJZA 2E54A 2VMOA 2W8UA 3AENB 4LNMA 1N8PA 3WKRA 1ELUA 2ZSMA 4E3QA 3DXVA 4RJ0A 1IBJA 1AY4A 1LKCA 3RUYA 2JG2A 5DJ1A 3ELPA 2W8JA 1S0AA 2VMYA 4KAMA 4CBRA 1AAWA 2V0YA 3K28A 4RJYA 1BKGA 4R5ZA 5FT4A 2CH2A 3CBFA 3AELA 7AATA 1ASLA 1X28A 3B1DA 1KKPA 3FCRA 1UU0A 3NTJA 4WBTA 1C9CA 4XQ2A 4ZASA 3ZZKA 2VMNA 3FFHA 4XJMA 4RITA 1X2AA 3CQ4A 1WYUB 3LVKA 3PDBB 2R5CA 1BS0A 1CQ7A 1DTYA 2ZY2A 4ATPA 2QA3A 4A00A 4PIWA 3GZCA 2W8VA 3JWAA 3G7QA 1RVYA 3DRDA 2X3LA 1C4KA 4E1OA 3PGYA 2E7UA 4NOGA 2HZPA 5FT5A 3LVLB 4LC3A 2FNUA 2OGAA 4ZDOA 3EI6A 5DX5A 1MLYA 3RI6A 4XJLA 1ASBA 1WKGA 4DQ6A 4EU1A 3LY1A 2W7EA 2ZSLA 3K7YA 2TPLA 3FD0A 3GSBA 2CSTA 2W8WA 4MKJA 3W1IA 4F5MA 3NNKA 4FFCA 1GC0A 1QITA 1TOIA 4ZWMA 3AEPA 4F5JA 3TFUA 1ARTA 3WX9A 1H1CA 3E2FA 1QIRA 4WYDA 1C7NA 1W7LA 2VMQA 4UOYA 1XEYA 4AOAA 3MAFA 2YKUA 1AHFA 1YIZA 1YOOA 3FQ8A 4WXGA 3A9YA 1EG5A 3R4TA 2YCPA 3WGBA 4A0RA 2CJGA 4ZAHA 1YNUA 2BYLA 3BC8A 1P3WA 1ASEA 3ZRRA 1I29A 1CQ6A 2CB1A 4ITXA 2VLHA 4GE7A 3AENA 3GWPA 2CANA 3GZDA 4IXSA 3H14A 1B4XA 3ECDA 4IYOB 3TFTA 3FZ8A 1MDZA 4RAEA 4AO4A 1AHEA 3MEBA 3IF2A 1GC3A 4W1VA 2AY6A 3EZ1A 1ASDA 1LC7A 3EI9A 1S07A 1M32A 1OHVA 1Y4IA 3JTXA 2JJEA 3PPLA 2W7FA 4JE5D 1KL1A 1I43A 2R2NA 3JU7A 1W7NA 2YKYA 1GC2A 1ASMA 3PAAA 1DJEA 2ZY3A 2AY7A 4MSOA 1GDEA 4QGRA 1ARSA 1MAPA 2C44A 2D7ZA 2FYFA 4FL0A 1PFFA 1B8GA 1D7RA 3FVXA 3WKSA 2VI8A 1T3IA 4ADBA 1BJNA 1B9IA 1OHWA 2HUIA 1V2EA 1YJSA 2CJHA 5TF5A 2BI2A 3E77A 2HOYA 2YKXA 3WGCA 1AKBA 1C7OA 1CZEA 3B1CA 1BJWA 2ZYJA 4O6ZA 2BI1A 3LG0A 2DGMA 2HUUA 4KYOA 1QZ9A 2QMAA 2VGVA 2VGTA 3BCAA 3N75A 1AHGA 3FQ7A 1UU1A 3NYTA 5J8QA 3TATA 3UAKA 3NYSA 2BWOA 1AY8A
chains in the Genus database with same CATH topology
3F9TA 3LWSA 3NYUA 1DGDA 4F5HA 3DR7A 4JF1A 4UHOA 2HUFA 3KKIA 1DJUA 1MDXA 4WD2A 4ZSYA 5G0AA 3ASAA 3PD6B 2GSAA 3VK4A 1J32A 1G4XA 4A6UA 4A0FA 4Y0HA 3H7FA 1ASCA 3Q8NA 1IX6A 1ZC9A 1TOEA 1IX7A 3NDNA 2RFVA 4XJPA 1RVUA 3E2ZB 2W7LA 2W7GA 2ZY4A 1O62A 4HF8A 5JAYA 4OT8A 1IAYA 2WK7A 1ARHA 2HOXA 1ECXA 1B9HA 2VLFA 4GEBA 2ORDA 1SZSA 2AEUA 3MBBA 4UHMA 4K2BA 3ZRPA 3NRAA 3ZZJA 1I41A 3VK3A 2W7HA 3FZ6A 1O4SA 2W7MA 1CQ8A 1PMOA 4OBVA 5E5IA 2ZC0A 3WCOA 1C7GA 2VGWA 4ADCA 3AOWA 1W7MA 2VIAA 2OKKA 3E2ZA 2C81A 3GETA 3B46A 4F5GA 4M2KA 1V2FA 2HP1A 4EB7A 2DGKA 3AEMC 2C7TA 1BJ4A 3K40A 3AEJC 3W1JA 5EUDA 2CH1A 5LHAA 2YKVA 2D64A 2W7DA 3DZZA 5M4DA 1AY5A 2DR1A 1W23A 3M5UA 2Q7WA 2YCTA 1ARIA 3LV2A 5D5SA 1C0NA 4XK1A 4J5UA 2VI9A 3DR4A 2FQ6A 2GMSA 1M4NA 3EI8A 3II0A 4AZJA 3KE3A 3DYDA 2QSRA 4JEZA 1CZCA 3HVYA 1WSTA 1ASNA 2Z1ZA 1GEYA 4GE9A 4OBUA 3W1HA 2JISA 1D7SA 2DGLA 2JJFA 1WYVA 2BIEA 2QB2A 2ZY5A 1SVVA 1SPAA 2WK8A 3FVSA 3HMUA 3ZRQA 2AY4A 2OATA 2GMUA 5IWQA 2JJHA 4JEWA 2PO3A 1KMJA 2VMXA 4MQQA 1LW4A 4Q31A 1YAAA 1B5OA 4MQRA 4RM1A 5E4ZA 3G8MA 2Z67A 3BS8A 1V72A 4TV7A 3FFRA 4H51A 1QJ5A 4WYGA 3OKSA 3HQTA 4UHNA 2ZUKA 1QISA 1AKAA 3ACZA 4JE5A 4A72A 2O0RA 3PA9A 4TMRA 2VGZA 4R8DA 1BT4A 2WKAA 3BCBA 1QGNA 2F8JA 3QBOA 4J8LA 1BJOB 4F4EA 4H63Q 1AHYA 2D5YA 3CQ5A 4Q76A 4A0HA 1G7WA 2Z1YA 1LW5A 2EO5A 5EQCA 1B5PA 3AOVA 3HLMA 4ZDPA 1OXPA 3HT4A 4Y0DA 3AATA 4W8IA 3NU7A 3R9AA 1AJSB 5EIGA 3NUBA 4CBSA 3BCXA 3L44A 3BB8A 2CY8A 3CQ6A 2JJGA 4MY5A 2PB2A 3QN6A 2OQXA 4K05A 1E5FA 2BYJA 1M0QA 3COGA 1AHXA 3F0HA 3WCNA 2HOZA 3EI7A 4EB5A 2FNIA 1SZUA 3N0LA 2VIBA 1CS1A 4ZDLA 5I92A 3B8XA 3NU8A 4CXQA 1W3UA 2AY8A 2KFPA 1AJRA 1IUGA 1J04A 4RIZA 2EZ1A 2VMRA 1G7XA 2CJDA 3KGWA 2BWNA 2D61A 4JEVA 4LNLA 4N0BA 3QM2A 4OYTA 4OC9A 4BA4A 4F5IA 2Z9VA 4ITGA 2BIGA 5K8BA 4IX8A 3MC6A 2AEVA 3USFA 3P6KA 4BMKA 3RBLA 1AJSA 2E7JA 4K2MA 5EIGB 3GR9A 2EYQA 1M0NA 5G2QA 2DKBA 3JW9A 5BJ4A 3PD6A 5EFSA 3FDDA 3DODA 1M6SA 5M46A 2VMSA 1GCKA 1D2FA 1V2DA 5G4JA 1EQBA 3ATHA 2BI9A 4PVFA 2YRIA 2AY9A 4A6RA 2EZ2A 2VMTA 4ATQA 2AY5A 4WP0A 3TCMA 1VP4A 3QGUA 1AIAA 1SFFA 2CINA 3TQXA 4CVQA 1AMRA 1OATA 1TOGA 2O7CA 1IVRA 2V1PA 2X5DA 4HVKA 3EI5A 3BWNA 2W7KA 1MAQA 4JF0A 5C6UA 4BA5A 3EIBA 1S08A 3UWCA 1TPLA 1WYUA 3GJUA 5HDMA 3N4SA 4OTLA 3N4RA 1FC4A 3AV7A 3VOMA 2AATA 2VMWA 3QI6A 3LVMA 4MGRA 1LC5A 2BHXA 2OGEA 4JEXA 1MLZA 4WYAA 4EMYA 4BQ0A 4GE4A 2VMZA 1X29A 1YIYA 2BKWA 4ADDA 1OXOA 4UQVA 2Z9WA 1YJYA 1IX8A 4WXBA 1TOJA 3VAXA 1O69A 3CAIA 3JWBA 1ARGA 5EUEA 5EUNA 2R5EA 3WZFA 2D7YA 4F5FA 1AAMA 1AKCA 2JGTA 4XAUA 4E3RA 3PDXA 2A1VA 1KMKA 3PJ0A 4OMAA 3PDBA 4CXRA 5EAAA 1MDOA 4R2NA 3VK2A 3NUIA 3WY7A 4ZM3A 1BW0A 3BN1A 5KTBA 1KL2A 1JG8A 2C0RA 2QB3A 4IYOA 5E3KA 5FT8A 4GSAA 3DU4A 1U08A 3FRKA 4RLGA 2W7IA 1D7VA 4B9BA 3N4XA 2D65A 3MC6C 1IJIA 4BHDA 4ZM4A 3EUCA 2DKJA 3MKJA 4Y0IA 1ZOBA 1ELQA 5BJ3A 2BIAA 2VGUA 4AO9A 3LVJA 4GDYA 4WYEA 4MQPA 1CL1A 5EAVA 4WYFA 1DGEA 3VP6A 3A9ZA 1RV3A 2XH1A 3OP7A 2FN6A 3UE8A 2G6WA 3ISLA 2XBNA 1D7UA 3QPGA 1MGVA 5G2PA 1M0OA 2AY1A 3N7NA 1S09A 2DOUA 1DFOA 2YCNA 3HL2A 4OCAA 2D66A 4I8AA 4F5KA 2HORA 4U1TA 1E5EA 1TARA 2O1BA 2VMUA 4IW7A 4LW4A 1BQDA 3E2YA 2X8UA 1BJOA 1XI9A 3AEJA 4ISYA 5HHYA 3FKDA 5LH9A 1RV4A 3QHXA 2BWPA 1IAXA 3MADA 3GBXA 1H0CA 3JZLA 3H9XA 2G7JA 1AMAA 2BI5A 3N5MA 4U2HA 2PB0A 3RCHB 2VGSA 4LNJA 3P1TA 1M0PA 1ASGA 2YRRA 5DB5A 1ZODA 4Q75A 3I4JA 2WB6A 3RQ1A 3BV0A 3T32A 3HBXA 1JS6A 3EIAA 8AATA 3B1EA 3PIUA 4KXKA 4IY7A 4ZLVA 4EFFA 1N31A 1TOKA 3E9KA 1AX4A 2X5FA 2W8TA 3ASBA 4WXFA 2VMVA 4DBCA 5DJ9A 1LS3A 5M4BA 2YHKA 3D6KA 2AY2A 4B98A 1Z7DA 4L0OA 1CL2A 2CFBA 1LK9A 3DC1A 3HDOA 3A2BA 3KGXA 4Q6RA 4IXZA 2ZJGA 1GC4A 4RKCA 4WLJA 4ZSWA 1I48A 3GZDC 5AX8A 3WLXA 2HP2A 4IXOA 3FDBA 1JF9A 3I16A 4DGTA 1WYTA 4GRXA 4PFFA 1LC8A 4PFNA 3AEMA 3IHJA 2AY3A 2QBTA 1X0MA 5F9SA 2W7JA 4M2JA 3RBFA 3FSLA 1AMQA 5FT6A 4WB0B 3L8AA 1BQAA 1S06A 2QLRA 3MAFB 4W91A 1GEWA 3A8UX 1AMSA 5F8VA 1N2TA 4XEWA 2ZP7A 4AH3A 5M49A 2CTZA 4R5FA 5G4IA 2Z9XA 4A6TA 3FTBA 2GQNA 2WK9A 1TATA 4AZKA 4ZWVA 4LW2A 1GD9A 3BWNC 1VEFA 2EH6A 1DKAA 3FQAA 1VJOA 3RCHA 1TASA 4XJOA 1ASAA 2D63A 1M7YA 4RKDA 4TN4A 1PG8A 1WYVB 3F6TA 1KKJA 1FG7A 2BI3A 1GBNA 4JEYA 4P7YA 2GB3A 4WB0A 1O61A 2VYCA 3FVUA 4WYCA 2EPJA 1SF2A 3FZ7A 4P3MA 1QJ3A 1EJIA 1SZKA 4W5KA 1DJ9A 4MKKA 4F5LA 1CJ0A 4E77A 3I5TA 1OHYA 1WYTB 2OKJA 1FG3A 1G4VA 1ORDA 1GEXA 2NMPA 2VMPA 2Z20A 1JS3A 3A9XA 2FM1A 3BWOA 3DXWA 3EZSA 3MAUA 2Z9UA 2R5CB 1Z3ZA 4W1XA 9AATA 1UKJA 4N0WA 1UU2A 1ASFA 5HXXA 3G0TA 2E7IA 4M2MA 4K2IA 4A0GA 1AICA 2FKIA 2Z61A 5G09A 5D95A 4WLHA 3NX3A 1AIBA 4ADEA 1WKHA 2YOBA 2R0TA 3AEOA 3ELEA 3E6GA 4W1WA 2EGYA 1PMMA 1YJZA 2E54A 2VMOA 2W8UA 3AENB 4LNMA 1N8PA 3WKRA 1ELUA 2ZSMA 4E3QA 3DXVA 4RJ0A 1IBJA 1AY4A 1LKCA 3RUYA 2JG2A 5DJ1A 3ELPA 2W8JA 1S0AA 2VMYA 4KAMA 4CBRA 1AAWA 2V0YA 3K28A 4RJYA 1BKGA 4R5ZA 5FT4A 2CH2A 3CBFA 3AELA 7AATA 1ASLA 1X28A 3B1DA 1KKPA 3FCRA 1UU0A 3NTJA 4WBTA 1C9CA 4XQ2A 4ZASA 3ZZKA 2VMNA 3FFHA 4XJMA 4RITA 1X2AA 3CQ4A 1WYUB 3LVKA 3PDBB 2R5CA 1BS0A 1CQ7A 1DTYA 2ZY2A 4ATPA 2QA3A 4A00A 4PIWA 3GZCA 2W8VA 3JWAA 3G7QA 1RVYA 3DRDA 2X3LA 1C4KA 4E1OA 3PGYA 2E7UA 4NOGA 2HZPA 5FT5A 3LVLB 4LC3A 2FNUA 2OGAA 4ZDOA 3EI6A 5DX5A 1MLYA 3RI6A 4XJLA 1ASBA 1WKGA 4DQ6A 4EU1A 3LY1A 2W7EA 2ZSLA 3K7YA 2TPLA 3FD0A 3GSBA 2CSTA 2W8WA 4MKJA 3W1IA 4F5MA 3NNKA 4FFCA 1GC0A 1QITA 1TOIA 4ZWMA 3AEPA 4F5JA 3TFUA 1ARTA 3WX9A 1H1CA 3E2FA 1QIRA 4WYDA 1C7NA 1W7LA 2VMQA 4UOYA 1XEYA 4AOAA 3MAFA 2YKUA 1AHFA 1YIZA 1YOOA 3FQ8A 4WXGA 3A9YA 1EG5A 3R4TA 2YCPA 3WGBA 4A0RA 2CJGA 4ZAHA 1YNUA 2BYLA 3BC8A 1P3WA 1ASEA 3ZRRA 1I29A 1CQ6A 2CB1A 4ITXA 2VLHA 4GE7A 3AENA 3GWPA 2CANA 3GZDA 4IXSA 3H14A 1B4XA 3ECDA 4IYOB 3TFTA 3FZ8A 1MDZA 4RAEA 4AO4A 1AHEA 3MEBA 3IF2A 1GC3A 4W1VA 2AY6A 3EZ1A 1ASDA 1LC7A 3EI9A 1S07A 1M32A 1OHVA 1Y4IA 3JTXA 2JJEA 3PPLA 2W7FA 4JE5D 1KL1A 1I43A 2R2NA 3JU7A 1W7NA 2YKYA 1GC2A 1ASMA 3PAAA 1DJEA 2ZY3A 2AY7A 4MSOA 1GDEA 4QGRA 1ARSA 1MAPA 2C44A 2D7ZA 2FYFA 4FL0A 1PFFA 1B8GA 1D7RA 3FVXA 3WKSA 2VI8A 1T3IA 4ADBA 1BJNA 1B9IA 1OHWA 2HUIA 1V2EA 1YJSA 2CJHA 5TF5A 2BI2A 3E77A 2HOYA 2YKXA 3WGCA 1AKBA 1C7OA 1CZEA 3B1CA 1BJWA 2ZYJA 4O6ZA 2BI1A 3LG0A 2DGMA 2HUUA 4KYOA 1QZ9A 2QMAA 2VGVA 2VGTA 3BCAA 3N75A 1AHGA 3FQ7A 1UU1A 3NYTA 5J8QA 3TATA 3UAKA 3NYSA 2BWOA 1AY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9T A;  3LWS A;  3NYU A;  1DGD A;  4F5H A;  3DR7 A;  4JF1 A;  4UHO A;  2HUF A;  3KKI A;  1DJU A;  1MDX A;  4WD2 A;  4ZSY A;  5G0A A;  3ASA A;  3PD6 B;  2GSA A;  3VK4 A;  1J32 A;  1G4X A;  4A6U A;  4A0F A;  4Y0H A;  3H7F A;  1ASC A;  3Q8N A;  1IX6 A;  1ZC9 A;  1TOE A;  1IX7 A;  3NDN A;  2RFV A;  4XJP A;  1RVU A;  3E2Z B;  2W7L A;  2W7G A;  2ZY4 A;  1O62 A;  4HF8 A;  5JAY A;  4OT8 A;  1IAY A;  2WK7 A;  1ARH A;  2HOX A;  1ECX A;  1B9H A;  2VLF A;  4GEB A;  2ORD A;  1SZS A;  2AEU A;  3MBB A;  4UHM A;  4K2B A;  3ZRP A;  3NRA A;  3ZZJ A;  1I41 A;  3VK3 A;  2W7H A;  3FZ6 A;  1O4S A;  2W7M A;  1CQ8 A;  1PMO A;  4OBV A;  5E5I A;  2ZC0 A;  3WCO A;  1C7G A;  2VGW A;  4ADC A;  3AOW A;  1W7M A;  2VIA A;  2OKK A;  3E2Z A;  2C81 A;  3GET A;  3B46 A;  4F5G A;  4M2K A;  1V2F A;  2HP1 A;  4EB7 A;  2DGK A;  3AEM C;  2C7T A;  1BJ4 A;  3K40 A;  3AEJ C;  3W1J A;  5EUD A;  2CH1 A;  5LHA A;  2YKV A;  2D64 A;  2W7D A;  3DZZ A;  5M4D A;  1AY5 A;  2DR1 A;  1W23 A;  3M5U A;  2Q7W A;  2YCT A;  1ARI A;  3LV2 A;  5D5S A;  1C0N A;  4XK1 A;  4J5U A;  2VI9 A;  3DR4 A;  2FQ6 A;  2GMS A;  1M4N A;  3EI8 A;  3II0 A;  4AZJ A;  3KE3 A;  3DYD A;  4JEZ A;  1CZC A;  3HVY A;  1WST A;  1ASN A;  2Z1Z A;  1GEY A;  4GE9 A;  4OBU A;  3W1H A;  2JIS A;  1D7S A;  2DGL A;  2JJF A;  1WYV A;  2BIE A;  2QB2 A;  2ZY5 A;  1SVV A;  1SPA A;  2WK8 A;  3FVS A;  3HMU A;  3ZRQ A;  2AY4 A;  2OAT A;  2GMU A;  5IWQ A;  2JJH A;  4JEW A;  2PO3 A;  1KMJ A;  2VMX A;  4MQQ A;  1LW4 A;  4Q31 A;  1YAA A;  1B5O A;  4MQR A;  4RM1 A;  5E4Z A;  3G8M A;  2Z67 A;  3BS8 A;  1V72 A;  4TV7 A;  3FFR A;  4H51 A;  1QJ5 A;  4WYG A;  3OKS A;  3HQT A;  4UHN A;  2ZUK A;  1QIS A;  1AKA A;  3ACZ A;  4JE5 A;  4A72 A;  2O0R A;  3PA9 A;  4TMR A;  2VGZ A;  4R8D A;  1BT4 A;  2WKA A;  3BCB A;  1QGN A;  2F8J A;  3QBO A;  4J8L A;  1BJO B;  4F4E A;  1AHY A;  2D5Y A;  3CQ5 A;  4Q76 A;  4A0H A;  1G7W A;  2Z1Y A;  1LW5 A;  2EO5 A;  5EQC A;  1B5P A;  3AOV A;  3HLM A;  4ZDP A;  1OXP A;  3HT4 A;  4Y0D A;  3AAT A;  4W8I A;  3NU7 A;  3R9A A;  1AJS B;  5EIG A;  3NUB A;  4CBS A;  3BCX A;  3L44 A;  3BB8 A;  2CY8 A;  3CQ6 A;  2JJG A;  4MY5 A;  2PB2 A;  3QN6 A;  2OQX A;  1E5F A;  2BYJ A;  1M0Q A;  3COG A;  1AHX A;  3F0H A;  3WCN A;  2HOZ A;  3EI7 A;  4EB5 A;  2FNI A;  1SZU A;  3N0L A;  2VIB A;  1CS1 A;  4ZDL A;  5I92 A;  3B8X A;  3NU8 A;  4CXQ A;  1W3U A;  2AY8 A;  1AJR A;  1IUG A;  1J04 A;  4RIZ A;  2EZ1 A;  2VMR A;  1G7X A;  2CJD A;  3KGW A;  2BWN A;  2D61 A;  4JEV A;  4LNL A;  4N0B A;  3QM2 A;  4OYT A;  4OC9 A;  4BA4 A;  4F5I A;  2Z9V A;  4ITG A;  2BIG A;  5K8B A;  4IX8 A;  3MC6 A;  2AEV A;  3USF A;  3P6K A;  4BMK A;  3RBL A;  1AJS A;  2E7J A;  4K2M A;  5EIG B;  3GR9 A;  1M0N A;  5G2Q A;  2DKB A;  3JW9 A;  5BJ4 A;  3PD6 A;  5EFS A;  3FDD A;  3DOD A;  1M6S A;  5M46 A;  2VMS A;  1GCK A;  1D2F A;  1V2D A;  5G4J A;  1EQB A;  3ATH A;  2BI9 A;  4PVF A;  2YRI A;  2AY9 A;  4A6R A;  2EZ2 A;  2VMT A;  4ATQ A;  2AY5 A;  4WP0 A;  3TCM A;  1VP4 A;  3QGU A;  1AIA A;  1SFF A;  2CIN A;  3TQX A;  4CVQ A;  1AMR A;  1OAT A;  1TOG A;  2O7C A;  1IVR A;  2V1P A;  2X5D A;  4HVK A;  3EI5 A;  3BWN A;  2W7K A;  1MAQ A;  4JF0 A;  5C6U A;  4BA5 A;  3EIB A;  1S08 A;  3UWC A;  1TPL A;  1WYU A;  3GJU A;  5HDM A;  4OTL A;  1FC4 A;  3AV7 A;  3VOM A;  2AAT A;  2VMW A;  3QI6 A;  3LVM A;  4MGR A;  1LC5 A;  2BHX A;  2OGE A;  4JEX A;  1MLZ A;  4WYA A;  4EMY A;  4BQ0 A;  4GE4 A;  2VMZ A;  1X29 A;  1YIY A;  2BKW A;  4ADD A;  1OXO A;  4UQV A;  2Z9W A;  1YJY A;  1IX8 A;  4WXB A;  1TOJ A;  3VAX A;  1O69 A;  3CAI A;  3JWB A;  1ARG A;  5EUE A;  5EUN A;  2R5E A;  3WZF A;  2D7Y A;  4F5F A;  1AAM A;  1AKC A;  2JGT A;  4XAU A;  4E3R A;  3PDX A;  1KMK A;  3PJ0 A;  4OMA A;  3PDB A;  4CXR A;  5EAA A;  1MDO A;  4R2N A;  3VK2 A;  3NUI A;  3WY7 A;  4ZM3 A;  1BW0 A;  3BN1 A;  1KL2 A;  1JG8 A;  2C0R A;  2QB3 A;  4IYO A;  5E3K A;  5FT8 A;  4GSA A;  3DU4 A;  1U08 A;  3FRK A;  4RLG A;  2W7I A;  1D7V A;  4B9B A;  2D65 A;  3MC6 C;  1IJI A;  4BHD A;  4ZM4 A;  3EUC A;  2DKJ A;  3MKJ A;  4Y0I A;  1ZOB A;  1ELQ A;  5BJ3 A;  2BIA A;  2VGU A;  4AO9 A;  3LVJ A;  4GDY A;  4WYE A;  4MQP A;  1CL1 A;  5EAV A;  4WYF A;  1DGE A;  3VP6 A;  3A9Z A;  1RV3 A;  2XH1 A;  3OP7 A;  2FN6 A;  3UE8 A;  2G6W A;  3ISL A;  2XBN A;  1D7U A;  3QPG A;  1MGV A;  5G2P A;  1M0O A;  2AY1 A;  1S09 A;  2DOU A;  1DFO A;  2YCN A;  3HL2 A;  4OCA A;  2D66 A;  4I8A A;  4F5K A;  2HOR A;  4U1T A;  1E5E A;  1TAR A;  2O1B A;  2VMU A;  4IW7 A;  4LW4 A;  1BQD A;  3E2Y A;  2X8U A;  1BJO A;  1XI9 A;  3AEJ A;  4ISY A;  5HHY A;  3FKD A;  5LH9 A;  1RV4 A;  3QHX A;  2BWP A;  1IAX A;  3MAD A;  3GBX A;  1H0C A;  3JZL A;  1AMA A;  2BI5 A;  3N5M A;  4U2H A;  2PB0 A;  3RCH B;  2VGS A;  4LNJ A;  3P1T A;  1M0P A;  1ASG A;  2YRR A;  5DB5 A;  1ZOD A;  4Q75 A;  3I4J A;  3RQ1 A;  3BV0 A;  3T32 A;  3HBX A;  1JS6 A;  3EIA A;  8AAT A;  3B1E A;  3PIU A;  4KXK A;  4IY7 A;  4ZLV A;  4EFF A;  1N31 A;  1TOK A;  3E9K A;  1AX4 A;  2X5F A;  2W8T A;  3ASB A;  4WXF A;  2VMV A;  4DBC A;  5DJ9 A;  1LS3 A;  5M4B A;  2YHK A;  3D6K A;  2AY2 A;  4B98 A;  1Z7D A;  4L0O A;  1CL2 A;  2CFB A;  1LK9 A;  3DC1 A;  3HDO A;  3A2B A;  3KGX A;  4Q6R A;  4IXZ A;  2ZJG A;  1GC4 A;  4RKC A;  4WLJ A;  4ZSW A;  1I48 A;  3GZD C;  5AX8 A;  3WLX A;  2HP2 A;  4IXO A;  3FDB A;  1JF9 A;  3I16 A;  4DGT A;  1WYT A;  4GRX A;  4PFF A;  1LC8 A;  4PFN A;  3AEM A;  3IHJ A;  2AY3 A;  2QBT A;  1X0M A;  5F9S A;  2W7J A;  4M2J A;  3RBF A;  3FSL A;  1AMQ A;  5FT6 A;  4WB0 B;  3L8A A;  1BQA A;  1S06 A;  2QLR A;  3MAF B;  4W91 A;  1GEW A;  3A8U X;  1AMS A;  5F8V A;  1N2T A;  4XEW A;  2ZP7 A;  4AH3 A;  5M49 A;  2CTZ A;  4R5F A;  5G4I A;  2Z9X A;  4A6T A;  3FTB A;  2GQN A;  2WK9 A;  1TAT A;  4AZK A;  4ZWV A;  4LW2 A;  1GD9 A;  3BWN C;  1VEF A;  2EH6 A;  1DKA A;  3FQA A;  1VJO A;  3RCH A;  1TAS A;  4XJO A;  1ASA A;  2D63 A;  1M7Y A;  4RKD A;  4TN4 A;  1PG8 A;  1WYV B;  3F6T A;  1KKJ A;  1FG7 A;  2BI3 A;  1GBN A;  4JEY A;  4P7Y A;  2GB3 A;  4WB0 A;  1O61 A;  2VYC A;  3FVU A;  4WYC A;  2EPJ A;  1SF2 A;  3FZ7 A;  4P3M A;  1QJ3 A;  1EJI A;  1SZK A;  4W5K A;  1DJ9 A;  4MKK A;  4F5L A;  1CJ0 A;  4E77 A;  3I5T A;  1OHY A;  1WYT B;  2OKJ A;  1FG3 A;  1G4V A;  1ORD A;  1GEX A;  2NMP A;  2VMP A;  2Z20 A;  1JS3 A;  3A9X A;  2FM1 A;  3BWO A;  3DXW A;  3EZS A;  3MAU A;  2Z9U A;  2R5C B;  1Z3Z A;  4W1X A;  9AAT A;  1UKJ A;  4N0W A;  1UU2 A;  1ASF A;  5HXX A;  3G0T A;  2E7I A;  4M2M A;  4K2I A;  4A0G A;  1AIC A;  2Z61 A;  5G09 A;  5D95 A;  4WLH A;  3NX3 A;  1AIB A;  4ADE A;  1WKH A;  2YOB A;  2R0T A;  3AEO A;  3ELE A;  3E6G A;  4W1W A;  2EGY A;  1PMM A;  1YJZ A;  2E54 A;  2VMO A;  2W8U A;  3AEN B;  4LNM A;  1N8P A;  3WKR A;  1ELU A;  2ZSM A;  4E3Q A;  3DXV A;  4RJ0 A;  1IBJ A;  1AY4 A;  1LKC A;  3RUY A;  2JG2 A;  5DJ1 A;  3ELP A;  2W8J A;  1S0A A;  2VMY A;  4KAM A;  4CBR A;  1AAW A;  2V0Y A;  3K28 A;  4RJY A;  1BKG A;  4R5Z A;  5FT4 A;  2CH2 A;  3CBF A;  3AEL A;  7AAT A;  1ASL A;  1X28 A;  3B1D A;  1KKP A;  3FCR A;  1UU0 A;  3NTJ A;  4WBT A;  1C9C A;  4XQ2 A;  4ZAS A;  3ZZK A;  2VMN A;  3FFH A;  4XJM A;  4RIT A;  1X2A A;  3CQ4 A;  1WYU B;  3LVK A;  3PDB B;  2R5C A;  1BS0 A;  1CQ7 A;  1DTY A;  2ZY2 A;  4ATP A;  2QA3 A;  4A00 A;  4PIW A;  3GZC A;  2W8V A;  3JWA A;  3G7Q A;  1RVY A;  3DRD A;  2X3L A;  1C4K A;  4E1O A;  3PGY A;  2E7U A;  4NOG A;  2HZP A;  5FT5 A;  3LVL B;  4LC3 A;  2FNU A;  2OGA A;  4ZDO A;  3EI6 A;  5DX5 A;  1MLY A;  3RI6 A;  4XJL A;  1ASB A;  1WKG A;  4DQ6 A;  4EU1 A;  3LY1 A;  2W7E A;  2ZSL A;  3K7Y A;  2TPL A;  3FD0 A;  3GSB A;  2CST A;  2W8W A;  4MKJ A;  3W1I A;  4F5M A;  3NNK A;  4FFC A;  1GC0 A;  1QIT A;  1TOI A;  4ZWM A;  3AEP A;  4F5J A;  3TFU A;  1ART A;  3WX9 A;  1H1C A;  3E2F A;  1QIR A;  4WYD A;  1C7N A;  1W7L A;  2VMQ A;  4UOY A;  1XEY A;  4AOA A;  3MAF A;  2YKU A;  1AHF A;  1YIZ A;  1YOO A;  3FQ8 A;  4WXG A;  3A9Y A;  1EG5 A;  3R4T A;  2YCP A;  3WGB A;  4A0R A;  2CJG A;  4ZAH A;  1YNU A;  2BYL A;  3BC8 A;  1P3W A;  1ASE A;  3ZRR A;  1I29 A;  1CQ6 A;  2CB1 A;  4ITX A;  2VLH A;  4GE7 A;  3AEN A;  3GWP A;  2CAN A;  3GZD A;  4IXS A;  3H14 A;  1B4X A;  3ECD A;  4IYO B;  3TFT A;  3FZ8 A;  1MDZ A;  4RAE A;  4AO4 A;  1AHE A;  3MEB A;  3IF2 A;  1GC3 A;  4W1V A;  2AY6 A;  3EZ1 A;  1ASD A;  1LC7 A;  3EI9 A;  1S07 A;  1M32 A;  1OHV A;  1Y4I A;  3JTX A;  2JJE A;  3PPL A;  2W7F A;  4JE5 D;  1KL1 A;  1I43 A;  2R2N A;  3JU7 A;  1W7N A;  2YKY A;  1GC2 A;  1ASM A;  3PAA A;  1DJE A;  2ZY3 A;  2AY7 A;  4MSO A;  1GDE A;  4QGR A;  1ARS A;  1MAP A;  2C44 A;  2D7Z A;  2FYF A;  4FL0 A;  1PFF A;  1B8G A;  1D7R A;  3FVX A;  3WKS A;  2VI8 A;  1T3I A;  4ADB A;  1BJN A;  1B9I A;  1OHW A;  2HUI A;  1V2E A;  1YJS A;  2CJH A;  5TF5 A;  2BI2 A;  3E77 A;  2HOY A;  2YKX A;  3WGC A;  1AKB A;  1C7O A;  1CZE A;  3B1C A;  1BJW A;  2ZYJ A;  4O6Z A;  2BI1 A;  3LG0 A;  2DGM A;  2HUU A;  4KYO A;  1QZ9 A;  2QMA A;  2VGV A;  2VGT A;  3BCA A;  3N75 A;  1AHG A;  3FQ7 A;  1UU1 A;  3NYT A;  5J8Q A;  3TAT A;  3UAK A;  3NYS A;  2BWO A;  1AY8 A; 
#chains in the Genus database with same CATH topology
 3F9T A;  3LWS A;  3NYU A;  1DGD A;  4F5H A;  3DR7 A;  4JF1 A;  4UHO A;  2HUF A;  3KKI A;  1DJU A;  1MDX A;  4WD2 A;  4ZSY A;  5G0A A;  3ASA A;  3PD6 B;  2GSA A;  3VK4 A;  1J32 A;  1G4X A;  4A6U A;  4A0F A;  4Y0H A;  3H7F A;  1ASC A;  3Q8N A;  1IX6 A;  1ZC9 A;  1TOE A;  1IX7 A;  3NDN A;  2RFV A;  4XJP A;  1RVU A;  3E2Z B;  2W7L A;  2W7G A;  2ZY4 A;  1O62 A;  4HF8 A;  5JAY A;  4OT8 A;  1IAY A;  2WK7 A;  1ARH A;  2HOX A;  1ECX A;  1B9H A;  2VLF A;  4GEB A;  2ORD A;  1SZS A;  2AEU A;  3MBB A;  4UHM A;  4K2B A;  3ZRP A;  3NRA A;  3ZZJ A;  1I41 A;  3VK3 A;  2W7H A;  3FZ6 A;  1O4S A;  2W7M A;  1CQ8 A;  1PMO A;  4OBV A;  5E5I A;  2ZC0 A;  3WCO A;  1C7G A;  2VGW A;  4ADC A;  3AOW A;  1W7M A;  2VIA A;  2OKK A;  3E2Z A;  2C81 A;  3GET A;  3B46 A;  4F5G A;  4M2K A;  1V2F A;  2HP1 A;  4EB7 A;  2DGK A;  3AEM C;  2C7T A;  1BJ4 A;  3K40 A;  3AEJ C;  3W1J A;  5EUD A;  2CH1 A;  5LHA A;  2YKV A;  2D64 A;  2W7D A;  3DZZ A;  5M4D A;  1AY5 A;  2DR1 A;  1W23 A;  3M5U A;  2Q7W A;  2YCT A;  1ARI A;  3LV2 A;  5D5S A;  1C0N A;  4XK1 A;  4J5U A;  2VI9 A;  3DR4 A;  2FQ6 A;  2GMS A;  1M4N A;  3EI8 A;  3II0 A;  4AZJ A;  3KE3 A;  3DYD A;  2QSR A;  4JEZ A;  1CZC A;  3HVY A;  1WST A;  1ASN A;  2Z1Z A;  1GEY A;  4GE9 A;  4OBU A;  3W1H A;  2JIS A;  1D7S A;  2DGL A;  2JJF A;  1WYV A;  2BIE A;  2QB2 A;  2ZY5 A;  1SVV A;  1SPA A;  2WK8 A;  3FVS A;  3HMU A;  3ZRQ A;  2AY4 A;  2OAT A;  2GMU A;  5IWQ A;  2JJH A;  4JEW A;  2PO3 A;  1KMJ A;  2VMX A;  4MQQ A;  1LW4 A;  4Q31 A;  1YAA A;  1B5O A;  4MQR A;  4RM1 A;  5E4Z A;  3G8M A;  2Z67 A;  3BS8 A;  1V72 A;  4TV7 A;  3FFR A;  4H51 A;  1QJ5 A;  4WYG A;  3OKS A;  3HQT A;  4UHN A;  2ZUK A;  1QIS A;  1AKA A;  3ACZ A;  4JE5 A;  4A72 A;  2O0R A;  3PA9 A;  4TMR A;  2VGZ A;  4R8D A;  1BT4 A;  2WKA A;  3BCB A;  1QGN A;  2F8J A;  3QBO A;  4J8L A;  1BJO B;  4F4E A;  4H63 Q;  1AHY A;  2D5Y A;  3CQ5 A;  4Q76 A;  4A0H A;  1G7W A;  2Z1Y A;  1LW5 A;  2EO5 A;  5EQC A;  1B5P A;  3AOV A;  3HLM A;  4ZDP A;  1OXP A;  3HT4 A;  4Y0D A;  3AAT A;  4W8I A;  3NU7 A;  3R9A A;  1AJS B;  5EIG A;  3NUB A;  4CBS A;  3BCX A;  3L44 A;  3BB8 A;  2CY8 A;  3CQ6 A;  2JJG A;  4MY5 A;  2PB2 A;  3QN6 A;  2OQX A;  4K05 A;  1E5F A;  2BYJ A;  1M0Q A;  3COG A;  1AHX A;  3F0H A;  3WCN A;  2HOZ A;  3EI7 A;  4EB5 A;  2FNI A;  1SZU A;  3N0L A;  2VIB A;  1CS1 A;  4ZDL A;  5I92 A;  3B8X A;  3NU8 A;  4CXQ A;  1W3U A;  2AY8 A;  2KFP A;  1AJR A;  1IUG A;  1J04 A;  4RIZ A;  2EZ1 A;  2VMR A;  1G7X A;  2CJD A;  3KGW A;  2BWN A;  2D61 A;  4JEV A;  4LNL A;  4N0B A;  3QM2 A;  4OYT A;  4OC9 A;  4BA4 A;  4F5I A;  2Z9V A;  4ITG A;  2BIG A;  5K8B A;  4IX8 A;  3MC6 A;  2AEV A;  3USF A;  3P6K A;  4BMK A;  3RBL A;  1AJS A;  2E7J A;  4K2M A;  5EIG B;  3GR9 A;  2EYQ A;  1M0N A;  5G2Q A;  2DKB A;  3JW9 A;  5BJ4 A;  3PD6 A;  5EFS A;  3FDD A;  3DOD A;  1M6S A;  5M46 A;  2VMS A;  1GCK A;  1D2F A;  1V2D A;  5G4J A;  1EQB A;  3ATH A;  2BI9 A;  4PVF A;  2YRI A;  2AY9 A;  4A6R A;  2EZ2 A;  2VMT A;  4ATQ A;  2AY5 A;  4WP0 A;  3TCM A;  1VP4 A;  3QGU A;  1AIA A;  1SFF A;  2CIN A;  3TQX A;  4CVQ A;  1AMR A;  1OAT A;  1TOG A;  2O7C A;  1IVR A;  2V1P A;  2X5D A;  4HVK A;  3EI5 A;  3BWN A;  2W7K A;  1MAQ A;  4JF0 A;  5C6U A;  4BA5 A;  3EIB A;  1S08 A;  3UWC A;  1TPL A;  1WYU A;  3GJU A;  5HDM A;  3N4S A;  4OTL A;  3N4R A;  1FC4 A;  3AV7 A;  3VOM A;  2AAT A;  2VMW A;  3QI6 A;  3LVM A;  4MGR A;  1LC5 A;  2BHX A;  2OGE A;  4JEX A;  1MLZ A;  4WYA A;  4EMY A;  4BQ0 A;  4GE4 A;  2VMZ A;  1X29 A;  1YIY A;  2BKW A;  4ADD A;  1OXO A;  4UQV A;  2Z9W A;  1YJY A;  1IX8 A;  4WXB A;  1TOJ A;  3VAX A;  1O69 A;  3CAI A;  3JWB A;  1ARG A;  5EUE A;  5EUN A;  2R5E A;  3WZF A;  2D7Y A;  4F5F A;  1AAM A;  1AKC A;  2JGT A;  4XAU A;  4E3R A;  3PDX A;  2A1V A;  1KMK A;  3PJ0 A;  4OMA A;  3PDB A;  4CXR A;  5EAA A;  1MDO A;  4R2N A;  3VK2 A;  3NUI A;  3WY7 A;  4ZM3 A;  1BW0 A;  3BN1 A;  5KTB A;  1KL2 A;  1JG8 A;  2C0R A;  2QB3 A;  4IYO A;  5E3K A;  5FT8 A;  4GSA A;  3DU4 A;  1U08 A;  3FRK A;  4RLG A;  2W7I A;  1D7V A;  4B9B A;  3N4X A;  2D65 A;  3MC6 C;  1IJI A;  4BHD A;  4ZM4 A;  3EUC A;  2DKJ A;  3MKJ A;  4Y0I A;  1ZOB A;  1ELQ A;  5BJ3 A;  2BIA A;  2VGU A;  4AO9 A;  3LVJ A;  4GDY A;  4WYE A;  4MQP A;  1CL1 A;  5EAV A;  4WYF A;  1DGE A;  3VP6 A;  1KAF A;  3A9Z A;  1RV3 A;  2XH1 A;  3OP7 A;  2FN6 A;  3UE8 A;  2G6W A;  3ISL A;  2XBN A;  1D7U A;  3QPG A;  1MGV A;  5G2P A;  1M0O A;  2AY1 A;  3N7N A;  1S09 A;  2DOU A;  1DFO A;  2YCN A;  3HL2 A;  4OCA A;  2D66 A;  4I8A A;  4F5K A;  2HOR A;  4U1T A;  1E5E A;  1TAR A;  2O1B A;  2VMU A;  4IW7 A;  4LW4 A;  1BQD A;  3E2Y A;  2X8U A;  1BJO A;  1XI9 A;  3AEJ A;  4ISY A;  5HHY A;  3FKD A;  5LH9 A;  1RV4 A;  3QHX A;  2BWP A;  1IAX A;  3MAD A;  3GBX A;  1H0C A;  3JZL A;  3H9X A;  2G7J A;  1AMA A;  2BI5 A;  3N5M A;  4U2H A;  2PB0 A;  3RCH B;  2VGS A;  4LNJ A;  3P1T A;  1M0P A;  1ASG A;  2YRR A;  5DB5 A;  1ZOD A;  4Q75 A;  3I4J A;  2WB6 A;  3RQ1 A;  3BV0 A;  3T32 A;  3HBX A;  1JS6 A;  3EIA A;  8AAT A;  3B1E A;  3PIU A;  4KXK A;  4IY7 A;  4ZLV A;  4EFF A;  1N31 A;  1TOK A;  3E9K A;  1AX4 A;  2X5F A;  2W8T A;  3ASB A;  4WXF A;  2VMV A;  4DBC A;  5DJ9 A;  1LS3 A;  5M4B A;  2YHK A;  3D6K A;  2AY2 A;  4B98 A;  1Z7D A;  4L0O A;  1CL2 A;  2CFB A;  1LK9 A;  3DC1 A;  3HDO A;  3A2B A;  3KGX A;  4Q6R A;  4IXZ A;  2ZJG A;  1GC4 A;  4RKC A;  4WLJ A;  4ZSW A;  1I48 A;  3GZD C;  5AX8 A;  3WLX A;  2HP2 A;  4IXO A;  3FDB A;  1JF9 A;  3I16 A;  4DGT A;  1WYT A;  4GRX A;  4PFF A;  1LC8 A;  4PFN A;  3AEM A;  3IHJ A;  2AY3 A;  2QBT A;  1X0M A;  5F9S A;  2W7J A;  4M2J A;  3RBF A;  3FSL A;  1AMQ A;  5FT6 A;  4WB0 B;  3L8A A;  1BQA A;  1S06 A;  2QLR A;  3MAF B;  4W91 A;  1GEW A;  3A8U X;  1AMS A;  5F8V A;  1N2T A;  4XEW A;  2ZP7 A;  4AH3 A;  5M49 A;  2CTZ A;  4R5F A;  5G4I A;  2Z9X A;  4A6T A;  3FTB A;  2GQN A;  2WK9 A;  1TAT A;  4AZK A;  4ZWV A;  4LW2 A;  1GD9 A;  3BWN C;  1VEF A;  2EH6 A;  1DKA A;  3FQA A;  1VJO A;  3RCH A;  1TAS A;  4XJO A;  1ASA A;  2D63 A;  1M7Y A;  4RKD A;  4TN4 A;  1PG8 A;  1WYV B;  3F6T A;  1KKJ A;  1FG7 A;  2BI3 A;  1GBN A;  4JEY A;  4P7Y A;  2GB3 A;  4WB0 A;  1O61 A;  2VYC A;  3FVU A;  4WYC A;  2EPJ A;  1SF2 A;  3FZ7 A;  4P3M A;  1QJ3 A;  1EJI A;  1SZK A;  4W5K A;  1DJ9 A;  4MKK A;  4F5L A;  1CJ0 A;  4E77 A;  3I5T A;  1OHY A;  1WYT B;  2OKJ A;  1FG3 A;  1G4V A;  1ORD A;  1GEX A;  2NMP A;  2VMP A;  2Z20 A;  1JS3 A;  3A9X A;  2FM1 A;  3BWO A;  3DXW A;  3EZS A;  3MAU A;  2Z9U A;  2R5C B;  1Z3Z A;  4W1X A;  9AAT A;  1UKJ A;  4N0W A;  1UU2 A;  1ASF A;  5HXX A;  3G0T A;  2E7I A;  4M2M A;  4K2I A;  4A0G A;  1AIC A;  2FKI A;  2Z61 A;  5G09 A;  5D95 A;  4WLH A;  3NX3 A;  1AIB A;  4ADE A;  1WKH A;  2YOB A;  2R0T A;  3AEO A;  3ELE A;  3E6G A;  4W1W A;  2EGY A;  1PMM A;  1YJZ A;  2E54 A;  2VMO A;  2W8U A;  3AEN B;  4LNM A;  1N8P A;  3WKR A;  1ELU A;  2ZSM A;  4E3Q A;  3DXV A;  4RJ0 A;  1IBJ A;  1AY4 A;  1LKC A;  3RUY A;  2JG2 A;  5DJ1 A;  3ELP A;  2W8J A;  1S0A A;  2VMY A;  4KAM A;  4CBR A;  1AAW A;  2V0Y A;  3K28 A;  4RJY A;  1BKG A;  4R5Z A;  5FT4 A;  2CH2 A;  3CBF A;  3AEL A;  7AAT A;  1ASL A;  1X28 A;  3B1D A;  1KKP A;  3FCR A;  1UU0 A;  3NTJ A;  4WBT A;  1C9C A;  4XQ2 A;  4ZAS A;  3ZZK A;  2VMN A;  3FFH A;  4XJM A;  4RIT A;  1X2A A;  3CQ4 A;  1WYU B;  3LVK A;  3PDB B;  2R5C A;  1BS0 A;  1CQ7 A;  1DTY A;  2ZY2 A;  4ATP A;  2QA3 A;  4A00 A;  4PIW A;  3GZC A;  2W8V A;  3JWA A;  3G7Q A;  1RVY A;  3DRD A;  2X3L A;  1C4K A;  4E1O A;  3PGY A;  2E7U A;  4NOG A;  2HZP A;  5FT5 A;  3LVL B;  4LC3 A;  2FNU A;  2OGA A;  4ZDO A;  3EI6 A;  5DX5 A;  1MLY A;  3RI6 A;  4XJL A;  1ASB A;  1WKG A;  4DQ6 A;  4EU1 A;  3LY1 A;  2W7E A;  2ZSL A;  3K7Y A;  2TPL A;  3FD0 A;  3GSB A;  2CST A;  2W8W A;  4MKJ A;  3W1I A;  4F5M A;  3NNK A;  4FFC A;  1GC0 A;  1QIT A;  1TOI A;  4ZWM A;  3AEP A;  4F5J A;  3TFU A;  1ART A;  3WX9 A;  1H1C A;  3E2F A;  1QIR A;  4WYD A;  1C7N A;  1W7L A;  2VMQ A;  4UOY A;  1XEY A;  4AOA A;  3MAF A;  2YKU A;  1AHF A;  1YIZ A;  1YOO A;  3FQ8 A;  4WXG A;  3A9Y A;  1EG5 A;  3R4T A;  2YCP A;  3WGB A;  4A0R A;  2CJG A;  4ZAH A;  1YNU A;  2BYL A;  3BC8 A;  1P3W A;  1ASE A;  3ZRR A;  1I29 A;  1CQ6 A;  2CB1 A;  4ITX A;  2VLH A;  4GE7 A;  3AEN A;  3GWP A;  2CAN A;  3GZD A;  4IXS A;  3H14 A;  1B4X A;  3ECD A;  4IYO B;  3TFT A;  3FZ8 A;  1MDZ A;  4RAE A;  4AO4 A;  1AHE A;  3MEB A;  3IF2 A;  1GC3 A;  4W1V A;  2AY6 A;  3EZ1 A;  1ASD A;  1LC7 A;  3EI9 A;  1S07 A;  1M32 A;  1OHV A;  1Y4I A;  3JTX A;  2JJE A;  3PPL A;  2W7F A;  4JE5 D;  1KL1 A;  1I43 A;  2R2N A;  3JU7 A;  1W7N A;  2YKY A;  1GC2 A;  1ASM A;  3PAA A;  1DJE A;  2ZY3 A;  2AY7 A;  4MSO A;  1GDE A;  4QGR A;  1ARS A;  1MAP A;  2C44 A;  2D7Z A;  2FYF A;  4FL0 A;  1PFF A;  1B8G A;  1D7R A;  3FVX A;  3WKS A;  2VI8 A;  1T3I A;  4ADB A;  1BJN A;  1B9I A;  1OHW A;  2HUI A;  1V2E A;  1YJS A;  2CJH A;  5TF5 A;  2BI2 A;  3E77 A;  2HOY A;  2YKX A;  3WGC A;  1AKB A;  1C7O A;  1CZE A;  3B1C A;  1BJW A;  2ZYJ A;  4O6Z A;  2BI1 A;  3LG0 A;  2DGM A;  2HUU A;  4KYO A;  1QZ9 A;  2QMA A;  2VGV A;  2VGT A;  3BCA A;  3N75 A;  1AHG A;  3FQ7 A;  1UU1 A;  3NYT A;  5J8Q A;  3TAT A;  3UAK A;  3NYS A;  2BWO A;  1AY8 A; 
#chains in the Genus database with same CATH homology
 3F9T A;  3LWS A;  3NYU A;  1DGD A;  4F5H A;  3DR7 A;  4JF1 A;  4UHO A;  2HUF A;  3KKI A;  1DJU A;  1MDX A;  4WD2 A;  4ZSY A;  5G0A A;  3ASA A;  3PD6 B;  2GSA A;  3VK4 A;  1J32 A;  1G4X A;  4A6U A;  4A0F A;  4Y0H A;  3H7F A;  1ASC A;  3Q8N A;  1IX6 A;  1ZC9 A;  1TOE A;  1IX7 A;  3NDN A;  2RFV A;  4XJP A;  1RVU A;  3E2Z B;  2W7L A;  2W7G A;  2ZY4 A;  1O62 A;  4HF8 A;  5JAY A;  4OT8 A;  1IAY A;  2WK7 A;  1ARH A;  2HOX A;  1ECX A;  1B9H A;  2VLF A;  4GEB A;  2ORD A;  1SZS A;  2AEU A;  3MBB A;  4UHM A;  4K2B A;  3ZRP A;  3NRA A;  3ZZJ A;  1I41 A;  3VK3 A;  2W7H A;  3FZ6 A;  1O4S A;  2W7M A;  1CQ8 A;  1PMO A;  4OBV A;  5E5I A;  2ZC0 A;  3WCO A;  1C7G A;  2VGW A;  4ADC A;  3AOW A;  1W7M A;  2VIA A;  2OKK A;  3E2Z A;  2C81 A;  3GET A;  3B46 A;  4F5G A;  4M2K A;  1V2F A;  2HP1 A;  4EB7 A;  2DGK A;  3AEM C;  2C7T A;  1BJ4 A;  3K40 A;  3AEJ C;  3W1J A;  5EUD A;  2CH1 A;  5LHA A;  2YKV A;  2D64 A;  2W7D A;  3DZZ A;  5M4D A;  1AY5 A;  2DR1 A;  1W23 A;  3M5U A;  2Q7W A;  2YCT A;  1ARI A;  3LV2 A;  5D5S A;  1C0N A;  4XK1 A;  4J5U A;  2VI9 A;  3DR4 A;  2FQ6 A;  2GMS A;  1M4N A;  3EI8 A;  3II0 A;  4AZJ A;  3KE3 A;  3DYD A;  2QSR A;  4JEZ A;  1CZC A;  3HVY A;  1WST A;  1ASN A;  2Z1Z A;  1GEY A;  4GE9 A;  4OBU A;  3W1H A;  2JIS A;  1D7S A;  2DGL A;  2JJF A;  1WYV A;  2BIE A;  2QB2 A;  2ZY5 A;  1SVV A;  1SPA A;  2WK8 A;  3FVS A;  3HMU A;  3ZRQ A;  2AY4 A;  2OAT A;  2GMU A;  5IWQ A;  2JJH A;  4JEW A;  2PO3 A;  1KMJ A;  2VMX A;  4MQQ A;  1LW4 A;  4Q31 A;  1YAA A;  1B5O A;  4MQR A;  4RM1 A;  5E4Z A;  3G8M A;  2Z67 A;  3BS8 A;  1V72 A;  4TV7 A;  3FFR A;  4H51 A;  1QJ5 A;  4WYG A;  3OKS A;  3HQT A;  4UHN A;  2ZUK A;  1QIS A;  1AKA A;  3ACZ A;  4JE5 A;  4A72 A;  2O0R A;  3PA9 A;  4TMR A;  2VGZ A;  4R8D A;  1BT4 A;  2WKA A;  3BCB A;  1QGN A;  2F8J A;  3QBO A;  4J8L A;  1BJO B;  4F4E A;  4H63 Q;  1AHY A;  2D5Y A;  3CQ5 A;  4Q76 A;  4A0H A;  1G7W A;  2Z1Y A;  1LW5 A;  2EO5 A;  5EQC A;  1B5P A;  3AOV A;  3HLM A;  4ZDP A;  1OXP A;  3HT4 A;  4Y0D A;  3AAT A;  4W8I A;  3NU7 A;  3R9A A;  1AJS B;  5EIG A;  3NUB A;  4CBS A;  3BCX A;  3L44 A;  3BB8 A;  2CY8 A;  3CQ6 A;  2JJG A;  4MY5 A;  2PB2 A;  3QN6 A;  2OQX A;  4K05 A;  1E5F A;  2BYJ A;  1M0Q A;  3COG A;  1AHX A;  3F0H A;  3WCN A;  2HOZ A;  3EI7 A;  4EB5 A;  2FNI A;  1SZU A;  3N0L A;  2VIB A;  1CS1 A;  4ZDL A;  5I92 A;  3B8X A;  3NU8 A;  4CXQ A;  1W3U A;  2AY8 A;  2KFP A;  1AJR A;  1IUG A;  1J04 A;  4RIZ A;  2EZ1 A;  2VMR A;  1G7X A;  2CJD A;  3KGW A;  2BWN A;  2D61 A;  4JEV A;  4LNL A;  4N0B A;  3QM2 A;  4OYT A;  4OC9 A;  4BA4 A;  4F5I A;  2Z9V A;  4ITG A;  2BIG A;  5K8B A;  4IX8 A;  3MC6 A;  2AEV A;  3USF A;  3P6K A;  4BMK A;  3RBL A;  1AJS A;  2E7J A;  4K2M A;  5EIG B;  3GR9 A;  2EYQ A;  1M0N A;  5G2Q A;  2DKB A;  3JW9 A;  5BJ4 A;  3PD6 A;  5EFS A;  3FDD A;  3DOD A;  1M6S A;  5M46 A;  2VMS A;  1GCK A;  1D2F A;  1V2D A;  5G4J A;  1EQB A;  3ATH A;  2BI9 A;  4PVF A;  2YRI A;  2AY9 A;  4A6R A;  2EZ2 A;  2VMT A;  4ATQ A;  2AY5 A;  4WP0 A;  3TCM A;  1VP4 A;  3QGU A;  1AIA A;  1SFF A;  2CIN A;  3TQX A;  4CVQ A;  1AMR A;  1OAT A;  1TOG A;  2O7C A;  1IVR A;  2V1P A;  2X5D A;  4HVK A;  3EI5 A;  3BWN A;  2W7K A;  1MAQ A;  4JF0 A;  5C6U A;  4BA5 A;  3EIB A;  1S08 A;  3UWC A;  1TPL A;  1WYU A;  3GJU A;  5HDM A;  3N4S A;  4OTL A;  3N4R A;  1FC4 A;  3AV7 A;  3VOM A;  2AAT A;  2VMW A;  3QI6 A;  3LVM A;  4MGR A;  1LC5 A;  2BHX A;  2OGE A;  4JEX A;  1MLZ A;  4WYA A;  4EMY A;  4BQ0 A;  4GE4 A;  2VMZ A;  1X29 A;  1YIY A;  2BKW A;  4ADD A;  1OXO A;  4UQV A;  2Z9W A;  1YJY A;  1IX8 A;  4WXB A;  1TOJ A;  3VAX A;  1O69 A;  3CAI A;  3JWB A;  1ARG A;  5EUE A;  5EUN A;  2R5E A;  3WZF A;  2D7Y A;  4F5F A;  1AAM A;  1AKC A;  2JGT A;  4XAU A;  4E3R A;  3PDX A;  2A1V A;  1KMK A;  3PJ0 A;  4OMA A;  3PDB A;  4CXR A;  5EAA A;  1MDO A;  4R2N A;  3VK2 A;  3NUI A;  3WY7 A;  4ZM3 A;  1BW0 A;  3BN1 A;  5KTB A;  1KL2 A;  1JG8 A;  2C0R A;  2QB3 A;  4IYO A;  5E3K A;  5FT8 A;  4GSA A;  3DU4 A;  1U08 A;  3FRK A;  4RLG A;  2W7I A;  1D7V A;  4B9B A;  3N4X A;  2D65 A;  3MC6 C;  1IJI A;  4BHD A;  4ZM4 A;  3EUC A;  2DKJ A;  3MKJ A;  4Y0I A;  1ZOB A;  1ELQ A;  5BJ3 A;  2BIA A;  2VGU A;  4AO9 A;  3LVJ A;  4GDY A;  4WYE A;  4MQP A;  1CL1 A;  5EAV A;  4WYF A;  1DGE A;  3VP6 A;  3A9Z A;  1RV3 A;  2XH1 A;  3OP7 A;  2FN6 A;  3UE8 A;  2G6W A;  3ISL A;  2XBN A;  1D7U A;  3QPG A;  1MGV A;  5G2P A;  1M0O A;  2AY1 A;  3N7N A;  1S09 A;  2DOU A;  1DFO A;  2YCN A;  3HL2 A;  4OCA A;  2D66 A;  4I8A A;  4F5K A;  2HOR A;  4U1T A;  1E5E A;  1TAR A;  2O1B A;  2VMU A;  4IW7 A;  4LW4 A;  1BQD A;  3E2Y A;  2X8U A;  1BJO A;  1XI9 A;  3AEJ A;  4ISY A;  5HHY A;  3FKD A;  5LH9 A;  1RV4 A;  3QHX A;  2BWP A;  1IAX A;  3MAD A;  3GBX A;  1H0C A;  3JZL A;  3H9X A;  2G7J A;  1AMA A;  2BI5 A;  3N5M A;  4U2H A;  2PB0 A;  3RCH B;  2VGS A;  4LNJ A;  3P1T A;  1M0P A;  1ASG A;  2YRR A;  5DB5 A;  1ZOD A;  4Q75 A;  3I4J A;  2WB6 A;  3RQ1 A;  3BV0 A;  3T32 A;  3HBX A;  1JS6 A;  3EIA A;  8AAT A;  3B1E A;  3PIU A;  4KXK A;  4IY7 A;  4ZLV A;  4EFF A;  1N31 A;  1TOK A;  3E9K A;  1AX4 A;  2X5F A;  2W8T A;  3ASB A;  4WXF A;  2VMV A;  4DBC A;  5DJ9 A;  1LS3 A;  5M4B A;  2YHK A;  3D6K A;  2AY2 A;  4B98 A;  1Z7D A;  4L0O A;  1CL2 A;  2CFB A;  1LK9 A;  3DC1 A;  3HDO A;  3A2B A;  3KGX A;  4Q6R A;  4IXZ A;  2ZJG A;  1GC4 A;  4RKC A;  4WLJ A;  4ZSW A;  1I48 A;  3GZD C;  5AX8 A;  3WLX A;  2HP2 A;  4IXO A;  3FDB A;  1JF9 A;  3I16 A;  4DGT A;  1WYT A;  4GRX A;  4PFF A;  1LC8 A;  4PFN A;  3AEM A;  3IHJ A;  2AY3 A;  2QBT A;  1X0M A;  5F9S A;  2W7J A;  4M2J A;  3RBF A;  3FSL A;  1AMQ A;  5FT6 A;  4WB0 B;  3L8A A;  1BQA A;  1S06 A;  2QLR A;  3MAF B;  4W91 A;  1GEW A;  3A8U X;  1AMS A;  5F8V A;  1N2T A;  4XEW A;  2ZP7 A;  4AH3 A;  5M49 A;  2CTZ A;  4R5F A;  5G4I A;  2Z9X A;  4A6T A;  3FTB A;  2GQN A;  2WK9 A;  1TAT A;  4AZK A;  4ZWV A;  4LW2 A;  1GD9 A;  3BWN C;  1VEF A;  2EH6 A;  1DKA A;  3FQA A;  1VJO A;  3RCH A;  1TAS A;  4XJO A;  1ASA A;  2D63 A;  1M7Y A;  4RKD A;  4TN4 A;  1PG8 A;  1WYV B;  3F6T A;  1KKJ A;  1FG7 A;  2BI3 A;  1GBN A;  4JEY A;  4P7Y A;  2GB3 A;  4WB0 A;  1O61 A;  2VYC A;  3FVU A;  4WYC A;  2EPJ A;  1SF2 A;  3FZ7 A;  4P3M A;  1QJ3 A;  1EJI A;  1SZK A;  4W5K A;  1DJ9 A;  4MKK A;  4F5L A;  1CJ0 A;  4E77 A;  3I5T A;  1OHY A;  1WYT B;  2OKJ A;  1FG3 A;  1G4V A;  1ORD A;  1GEX A;  2NMP A;  2VMP A;  2Z20 A;  1JS3 A;  3A9X A;  2FM1 A;  3BWO A;  3DXW A;  3EZS A;  3MAU A;  2Z9U A;  2R5C B;  1Z3Z A;  4W1X A;  9AAT A;  1UKJ A;  4N0W A;  1UU2 A;  1ASF A;  5HXX A;  3G0T A;  2E7I A;  4M2M A;  4K2I A;  4A0G A;  1AIC A;  2FKI A;  2Z61 A;  5G09 A;  5D95 A;  4WLH A;  3NX3 A;  1AIB A;  4ADE A;  1WKH A;  2YOB A;  2R0T A;  3AEO A;  3ELE A;  3E6G A;  4W1W A;  2EGY A;  1PMM A;  1YJZ A;  2E54 A;  2VMO A;  2W8U A;  3AEN B;  4LNM A;  1N8P A;  3WKR A;  1ELU A;  2ZSM A;  4E3Q A;  3DXV A;  4RJ0 A;  1IBJ A;  1AY4 A;  1LKC A;  3RUY A;  2JG2 A;  5DJ1 A;  3ELP A;  2W8J A;  1S0A A;  2VMY A;  4KAM A;  4CBR A;  1AAW A;  2V0Y A;  3K28 A;  4RJY A;  1BKG A;  4R5Z A;  5FT4 A;  2CH2 A;  3CBF A;  3AEL A;  7AAT A;  1ASL A;  1X28 A;  3B1D A;  1KKP A;  3FCR A;  1UU0 A;  3NTJ A;  4WBT A;  1C9C A;  4XQ2 A;  4ZAS A;  3ZZK A;  2VMN A;  3FFH A;  4XJM A;  4RIT A;  1X2A A;  3CQ4 A;  1WYU B;  3LVK A;  3PDB B;  2R5C A;  1BS0 A;  1CQ7 A;  1DTY A;  2ZY2 A;  4ATP A;  2QA3 A;  4A00 A;  4PIW A;  3GZC A;  2W8V A;  3JWA A;  3G7Q A;  1RVY A;  3DRD A;  2X3L A;  1C4K A;  4E1O A;  3PGY A;  2E7U A;  4NOG A;  2HZP A;  5FT5 A;  3LVL B;  4LC3 A;  2FNU A;  2OGA A;  4ZDO A;  3EI6 A;  5DX5 A;  1MLY A;  3RI6 A;  4XJL A;  1ASB A;  1WKG A;  4DQ6 A;  4EU1 A;  3LY1 A;  2W7E A;  2ZSL A;  3K7Y A;  2TPL A;  3FD0 A;  3GSB A;  2CST A;  2W8W A;  4MKJ A;  3W1I A;  4F5M A;  3NNK A;  4FFC A;  1GC0 A;  1QIT A;  1TOI A;  4ZWM A;  3AEP A;  4F5J A;  3TFU A;  1ART A;  3WX9 A;  1H1C A;  3E2F A;  1QIR A;  4WYD A;  1C7N A;  1W7L A;  2VMQ A;  4UOY A;  1XEY A;  4AOA A;  3MAF A;  2YKU A;  1AHF A;  1YIZ A;  1YOO A;  3FQ8 A;  4WXG A;  3A9Y A;  1EG5 A;  3R4T A;  2YCP A;  3WGB A;  4A0R A;  2CJG A;  4ZAH A;  1YNU A;  2BYL A;  3BC8 A;  1P3W A;  1ASE A;  3ZRR A;  1I29 A;  1CQ6 A;  2CB1 A;  4ITX A;  2VLH A;  4GE7 A;  3AEN A;  3GWP A;  2CAN A;  3GZD A;  4IXS A;  3H14 A;  1B4X A;  3ECD A;  4IYO B;  3TFT A;  3FZ8 A;  1MDZ A;  4RAE A;  4AO4 A;  1AHE A;  3MEB A;  3IF2 A;  1GC3 A;  4W1V A;  2AY6 A;  3EZ1 A;  1ASD A;  1LC7 A;  3EI9 A;  1S07 A;  1M32 A;  1OHV A;  1Y4I A;  3JTX A;  2JJE A;  3PPL A;  2W7F A;  4JE5 D;  1KL1 A;  1I43 A;  2R2N A;  3JU7 A;  1W7N A;  2YKY A;  1GC2 A;  1ASM A;  3PAA A;  1DJE A;  2ZY3 A;  2AY7 A;  4MSO A;  1GDE A;  4QGR A;  1ARS A;  1MAP A;  2C44 A;  2D7Z A;  2FYF A;  4FL0 A;  1PFF A;  1B8G A;  1D7R A;  3FVX A;  3WKS A;  2VI8 A;  1T3I A;  4ADB A;  1BJN A;  1B9I A;  1OHW A;  2HUI A;  1V2E A;  1YJS A;  2CJH A;  5TF5 A;  2BI2 A;  3E77 A;  2HOY A;  2YKX A;  3WGC A;  1AKB A;  1C7O A;  1CZE A;  3B1C A;  1BJW A;  2ZYJ A;  4O6Z A;  2BI1 A;  3LG0 A;  2DGM A;  2HUU A;  4KYO A;  1QZ9 A;  2QMA A;  2VGV A;  2VGT A;  3BCA A;  3N75 A;  1AHG A;  3FQ7 A;  1UU1 A;  3NYT A;  5J8Q A;  3TAT A;  3UAK A;  3NYS A;  2BWO A;  1AY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...