2AATA

2.8-angstroms-resolution crystal structure of an active-site mutant of aspartate aminotransferase from escherichia coli
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSANFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title 2.8-A-resolution crystal structure of an active-site mutant of aspartate aminotransferase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
total genus 61
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1989-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2aatA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2aatA01
2AY3A 1SZUA 3HBXA 3FVUA 3EI6A 3N75A 3A2BA 3NUBA 1JS3A 1WSTA 1V72A 2W8TA 2CSTA 3DZZA 4WYGA 1PFFA 4E3RA 2W7LA 4WP0A 3ZRPA 4KXKA 5JAYA 3WCOA 1AKAA 3F6TA 1PG8A 2EPJA 3PJ0A 4OYTA 4XJLA 2W8UA 1CS1A 3FTBA 1H1CA 2YKYA 1KKPA 3NYUA 4M2MA 9AATA 3D6KA 4XK1A 2Z1YA 5EAAA 2WK8A 2BYJA 4KAMA 4Y0IA 3WKSA 1YJSA 1CQ6A 2CH1A 4JEWA 1E5EA 1P3WA 1ELUA 2PB2A 3I5TA 3ZRRA 4A0RA 3AEPA 2VGUA 3NX3A 3GBXA 1D7RA 1YIYA 1ARIA 1OXOA 1M32A 1B4XA 2V1PA 3ATHA 1MAPA 3EIAA 3EUCA 4ATQA 4MY5A 1YNUA 1ARTA 2AY5A 4JF0A 5EAVA 4Q75A 2OGEA 4JEYA 1GD9A 1ORDA 5EFSA 8AATA 1YAAA 1KL1A 4BMKA 3A8UX 3NUIA 2DGKA 4WXFA 2HUFA 4UQVA 1MLZA 4I8AA 5E4ZA 1VEFA 2XH1A 4CBRA 1BJOA 4XAUA 1G4XA 2OGAA 1YJYA 4MQQA 3WY7A 4F4EA 1GC4A 2O0RA 3KKIA 3FKDA 4GRXA 2CJGA 5G09A 4BA4A 4AZKA 4RM1A 1LC8A 1CZCA 5BJ4A 1B5OA 2CTZA 3W1HA 4OT8A 1DGEA 4CBSA 1WYVA 3RQ1A 2ZYJA 1W7NA 1GC0A 1GC3A 1FC4A 4ADBA 3QI6A 4F5IA 2XBNA 4K2BA 1SVVA 1KKJA 1UKJA 5DX5A 1B5PA 1MGVA 2D65A 2RFVA 3A9ZA 4QGRA 4AO9A 1XEYA 4RKDA 3JTXA 3P1TA 2BI5A 2X8UA 2DKJA 3MADA 1YJZA 3GZDC 3MBBA 1TOGA 4H51A 2W7MA 1QITA 4F5KA 5F9SA 1IVRA 4F5FA 1DJ9A 5D95A 3G7QA 2FNIA 2D5YA 2Z1ZA 1AAMA 2DKBA 3HDOA 3II0A 1AMQA 2C0RA 2O7CA 4W1VA 4IXSA 3GETA 1S09A 2ZJGA 3BWNA 3DODA 1ARSA 1KMKA 1WKHA 3COGA 2AATA 2D63A 3ELPA 4UHNA 5G2PA 2VGVA 3AEJC 2YOBA 4BHDA 3IF2A 2D66A 3KGXA 1GDEA 3EIBA 2W7DA 1DGDA 1RV4A 1TOIA 4XJOA 4LC3A 4A0FA 2DR1A 2VMSA 1ASCA 1XI9A 3VP6A 2HOYA 5HXXA 5BJ3A 3H14A 1CQ7A 5M4DA 2E7JA 1BS0A 1O69A 1C7GA 4J8LA 1OATA 2R5EA 1BT4A 1W23A 3FZ8A 1CQ8A 1B9IA 1TOKA 4GDYA 2VMUA 2X3LA 3WKRA 3QPGA 2CINA 1BJ4A 4WXGA 3W1IA 3WCNA 2W7GA 4K2MA 2QB3A 3K28A 2R5CA 3AATA 1TARA 2C81A 2AY4A 3FFHA 1N2TA 2FQ6A 3F9TA 1WYUB 5D5SA 1TOJA 4PIWA 4E1OA 3AENA 4EMYA 4M2JA 5F8VA 2AEUA 2EH6A 1IX6A 2GMSA 3L8AA 2E7UA 4GE7A 4ZDPA 2WKAA 4E3QA 4LNMA 2YCPA 1D7SA 3ZZJA 1H0CA 2D7ZA 1AKCA 3ELEA 3QM2A 4N0BA 1AHFA 1AHXA 2R0TA 4LW4A 5FT5A 1SZKA 4ADCA 3FZ7A 4P7YA 1MLYA 2Z61A 2DGMA 3B1CA 3FD0A 4WB0A 4W8IA 3RUYA 4F5HA 1ASBA 1JG8A 1C7NA 5EUEA 1DKAA 1EJIA 1TOEA 3AELA 1AY4A 3NYTA 5G2QA 1V2DA 2BI1A 1LK9A 2Z9XA 3I16A 5EUDA 5AX8A 2CJDA 5EQCA 3FDDA 4O6ZA 1WYTB 3MAFB 4J5UA 1CZEA 3CBFA 4UOYA 4UHMA 2BWNA 3LVLB 2R2NA 3LVJA 1EG5A 4MSOA 1RVYA 2VIAA 1J32A 4OBUA 2VGSA 3JZLA 3E2ZB 4W5KA 2ZY2A 5DJ9A 3FQAA 2C7TA 1QZ9A 3AEMC 4XEWA 3Q8NA 1O61A 2BIEA 1PMMA 1T3IA 4EU1A 2Z67A 4MKJA 4OTLA 4ZLVA 2W7KA 4ZWVA 1CL1A 3B1EA 5TF5A 2W7IA 3R4TA 1ARHA 2VMZA 4M2KA 1LW5A 2ZSMA 2CH2A 1ASDA 4CXQA 2Z9UA 3LWSA 4AH3A 3DU4A 2BI2A 4IY7A 2W7EA 3BB8A 3JWAA 1LS3A 2CY8A 4RJYA 1KL2A 2AY1A 2YCTA 4XJMA 3M5UA 2CANA 3FQ7A 4OBVA 2D61A 4PFNA 4FFCA 2OKKA 4DBCA 2ZY4A 2JJFA 3WGBA 4EFFA 3DXVA 4GE4A 1S0AA 3L44A 1U08A 5M4BA 3RI6A 2WK9A 1AKBA 5EUNA 3PD6B 4AZJA 4OMAA 1DFOA 1C7OA 1FG3A 2OQXA 3PDBA 3MC6C 5E5IA 2JG2A 2VGTA 4A0HA 2W7FA 3OKSA 2AEVA 4XQ2A 3NRAA 1X28A 3BCXA 3DXWA 3UE8A 2O1BA 2BIGA 1JF9A 1OXPA 3OP7A 1AX4A 4R8DA 1BJWA 4ZAHA 4MQRA 1W7LA 3R9AA 3FCRA 3TQXA 3TFUA 1QIRA 3IHJA 3FQ8A 3H7FA 4BQ0A 4EB7A 1AHEA 2EZ2A 2PB0A 1BKGA 4Q31A 3AV7A 3ISLA 1D7UA 3LVMA 2EGYA 3E6GA 1AHYA 4AOAA 3FDBA 1AY8A 1AJSA 3WZFA 2VMWA 1I43A 1ASGA 3DC1A 4FL0A 4R5ZA 4ZM4A 4JE5A 1I41A 1WYUA 3ECDA 4RITA 3VK3A 4IX8A 3LY1A 4IXOA 1AIAA 4RJ0A 4CVQA 1TASA 3BN1A 4AO4A 4ZWMA 4ZDOA 3QHXA 2JISA 4ZASA 1QJ3A 2QLRA 3VOMA 3E77A 3FFRA 3EI7A 2D64A 2OATA 2ZSLA 3DR7A 1CL2A 4A6TA 2GSAA 4ITXA 3PGYA 1B9HA 1FG7A 1LC7A 3I4JA 2VMOA 3BWOA 1BJOB 3GZDA 3EI5A 4F5GA 2ORDA 1ZODA 3BV0A 1G4VA 1LC5A 4W1WA 1AICA 1AMRA 2FNUA 2AY6A 5M46A 1GC2A 1WYVB 1M4NA 2W7HA 1V2FA 3FVSA 1WYTA 1PMOA 3MAFA 4ADDA 2X5FA 4F5MA 4MGRA 3CQ6A 5FT4A 3HQTA 3AEJA 4WYFA 4ADEA 3QGUA 1X0MA 4WBTA 2AY7A 2ZY3A 3F0HA 1M0PA 3E2ZA 3PAAA 1IX8A 3A9XA 1QGNA 1W3UA 2HP1A 4N0WA 1MDOA 3B8XA 1VP4A 3HT4A 5LHAA 2YRIA 3E2FA 1EQBA 4U1TA 1I29A 1ZC9A 3HL2A 4LW2A 2E54A 4K2IA 4KYOA 1B8GA 1AMSA 1GEWA 1IAXA 1LKCA 3NDNA 2HORA 4ISYA 4JEZA 5E3KA 3BS8A 1AHGA 4RLGA 3KE3A 4WLJA 1G7XA 4LNJA 4ZM3A 1BW0A 1N8PA 1CJ0A 2BYLA 4W1XA 4A6UA 1UU2A 2VMQA 5IWQA 1M6SA 2HOXA 3GSBA 2D7YA 1ASMA 1ASEA 1D7VA 2NMPA 4ZSWA 4LNLA 3TATA 1OHWA 5FT6A 3AOWA 1GEXA 1Z7DA 3QBOA 3BC8A 3BCAA 3CQ5A 3HLMA 3ASBA 2GQNA 5EIGB 2YKUA 4GSAA 4JE5D 3JWBA 4F5LA 5G0AA 2VIBA 3HVYA 2AY2A 2VYCA 3RCHB 2R5CB 2W7JA 2YHKA 1SPAA 3LVKA 3K40A 4DGTA 3HMUA 3PD6A 3K7YA 2GB3A 1BQDA 3FZ6A 1RV3A 2HZPA 3G0TA 4WLHA 4NOGA 3PIUA 2QMAA 4MQPA 4P3MA 2ZP7A 4MKKA 4TMRA 2HUUA 3B1DA 2ZY5A 3NU8A 5M49A 1Y4IA 1S08A 4IYOB 4A72A 5K8BA 4PFFA 3PA9A 1ASAA 1BJNA 2TPLA 2VMRA 4HVKA 3EZ1A 4OC9A 4WB0B 1QJ5A 4R2NA 3AEMA 1QISA 3GJUA 4IW7A 1ASNA 3AEOA 1IAYA 1KMJA 4WXBA 3WGCA 4E77A 3E9KA 5I92A 2YCNA 3FSLA 1D2FA 1M0QA 3P6KA 4GEBA 2JGTA 1SF2A 3WX9A 2HOZA 4W91A 4JEXA 1J04A 1SZSA 3CAIA 4JF1A 2QA3A 1TATA 3WLXA 3QN6A 4R5FA 2BHXA 1GBNA 3ZZKA 4B9BA 1SFFA 2CB1A 3DYDA 3MAUA 2BKWA 4L0OA 3GZCA 3GWPA 2JJEA 1M7YA 1IBJA 3DR4A 1X2AA 2BWOA 3A9YA 3TFTA 2PO3A 1S07A 2Z9VA 1AJRA 2GMUA 2DGLA 1X29A 4U2HA 3BWNC 1ZOBA 2W8JA 3UAKA 2E7IA 2Z9WA 1V2EA 3ACZA 4F5JA 2VGZA 1OHVA 3G8MA 1DJEA 3UWCA 2V0YA 3MC6A 1C0NA 5LH9A 1UU1A 2VMPA 1UU0A 3N0LA 4HF8A 4IXZA 3EI8A 1IJIA 4RKCA 4WYCA 4A0GA 2ZUKA 4WD2A 3B46A 4TN4A 1S06A 3NU7A 5DJ1A 1ASFA 3NYSA 4JEVA 4Y0HA 4BA5A 2BIAA 3BCBA 3W1JA 1RVUA 2QB2A 2ZC0A 4ITGA 7AATA 2YKXA 3LV2A 1MAQA 1JS6A 2DOUA 2C44A 4CXRA 2F8JA 1I48A 3TCMA 1ECXA 3ZRQA 3EZSA 4Y0DA 3FVXA 2G6WA 3PDBB 1VJOA 5G4IA 3PDXA 4GE9A 1O4SA 5C6UA 1G7WA 3E2YA 2FYFA 1ELQA 4TV7A 4WYDA 5HDMA 2FM1A 1ARGA 4A00A 2CFBA 3KGWA 2YRRA 4WYAA 4ZSYA 4OCAA 2VMVA 3USFA 4ATPA 1O62A 2WK7A 3DRDA 5J8QA 1WKGA 1OHYA 1GCKA 1E5FA 2JJHA 1DTYA 1W7MA 3RBFA 2VI9A 3MEBA 3EI9A 1IUGA 2BI3A 1DJUA 3CQ4A 3VAXA 5EIGA 3ASAA 1AY5A 3NTJA 4EB5A 1M0NA 3AOVA 3JU7A 3RCHA 1AAWA 1AJSB 4UHOA 4A6RA 1C9CA 3MKJA 1MDXA 5DB5A 1C4KA 5FT8A 2HUIA 2QBTA 2EZ1A 2HP2A 4XJPA 2EO5A 4B98A 4RAEA 2Z20A 3N5MA 3T32A 3LG0A 4PVFA 2VI8A 2BI9A 1AIBA 2VLHA 4ZDLA 1YOOA 3JW9A 4IYOA 2VMYA 2VLFA 2CJHA 3FRKA 1Z3ZA 3NNKA 3RBLA 3VK2A 3PPLA 2AY8A 2JJGA 2OKJA 4Q6RA 4DQ6A 1BQAA 1YIZA 2YKVA 4WYEA 5HHYA 1TPLA 2VMNA 2X5DA 3GR9A 4Q76A 2BWPA 1MDZA 2W8VA 1GEYA 2W8WA 1IX7A 1N31A 2FN6A 2Q7WA 3VK4A 2VGWA 2AY9A 1ASLA 4RIZA 2VMXA 5G4JA 3AENB 1M0OA 1LW4A 1AMAA 2VMTA
chains in the Genus database with same CATH superfamily
2AY3A 1SZUA 3HBXA 3FVUA 3EI6A 3N75A 3A2BA 3NUBA 1JS3A 1WSTA 1V72A 2W8TA 2CSTA 3DZZA 4WYGA 1PFFA 4E3RA 2W7LA 4WP0A 3ZRPA 4KXKA 5JAYA 3WCOA 1AKAA 3F6TA 1PG8A 2EPJA 3PJ0A 4OYTA 4XJLA 2W8UA 1CS1A 3FTBA 1H1CA 2YKYA 1KKPA 3NYUA 4M2MA 9AATA 3D6KA 4XK1A 2Z1YA 5EAAA 2WK8A 2BYJA 4KAMA 4Y0IA 3WKSA 1YJSA 1CQ6A 2CH1A 4JEWA 1E5EA 1P3WA 1ELUA 2PB2A 3I5TA 3ZRRA 4A0RA 3AEPA 2VGUA 3NX3A 3GBXA 1D7RA 1YIYA 1ARIA 1OXOA 1M32A 1B4XA 2V1PA 3ATHA 1MAPA 3EIAA 3EUCA 4ATQA 1KAFA 4MY5A 1YNUA 1ARTA 2AY5A 4JF0A 5EAVA 4Q75A 2OGEA 4JEYA 1GD9A 1ORDA 5EFSA 3N4SA 8AATA 1YAAA 1KL1A 4BMKA 3A8UX 3NUIA 2DGKA 4WXFA 2HUFA 4UQVA 1MLZA 4I8AA 5E4ZA 1VEFA 2XH1A 4CBRA 1BJOA 4XAUA 1G4XA 2OGAA 1YJYA 4MQQA 3WY7A 4F4EA 1GC4A 2O0RA 3KKIA 3FKDA 4GRXA 2CJGA 5G09A 4BA4A 4AZKA 4RM1A 1LC8A 1CZCA 5BJ4A 1B5OA 2CTZA 3W1HA 4OT8A 1DGEA 4CBSA 1WYVA 3RQ1A 2ZYJA 1W7NA 1GC0A 1GC3A 1FC4A 4ADBA 3QI6A 4F5IA 2XBNA 4K2BA 1SVVA 1KKJA 1UKJA 5DX5A 1B5PA 1MGVA 2D65A 2RFVA 3A9ZA 4QGRA 4AO9A 1XEYA 4RKDA 3JTXA 3P1TA 2BI5A 2X8UA 2FKIA 2DKJA 3MADA 1YJZA 3GZDC 3MBBA 1TOGA 4H51A 2W7MA 1QITA 4F5KA 5F9SA 1IVRA 2A1VA 4F5FA 1DJ9A 5D95A 3G7QA 2FNIA 2D5YA 2Z1ZA 1AAMA 2DKBA 3HDOA 3II0A 1AMQA 2C0RA 2O7CA 4W1VA 4IXSA 3GETA 1S09A 2ZJGA 3BWNA 3DODA 1ARSA 1KMKA 1WKHA 3COGA 2AATA 2D63A 3ELPA 4UHNA 5G2PA 2VGVA 3AEJC 2YOBA 4BHDA 3IF2A 2D66A 3KGXA 1GDEA 3EIBA 2W7DA 1DGDA 1RV4A 1TOIA 4XJOA 4LC3A 4A0FA 2DR1A 2VMSA 1ASCA 1XI9A 3VP6A 2HOYA 5HXXA 5BJ3A 3H14A 1CQ7A 5M4DA 2E7JA 1BS0A 1O69A 1C7GA 4J8LA 1OATA 2R5EA 1BT4A 1W23A 3FZ8A 1CQ8A 1B9IA 1TOKA 4GDYA 2VMUA 2X3LA 3WKRA 3QPGA 2CINA 1BJ4A 4WXGA 3W1IA 3WCNA 2W7GA 4K2MA 2QB3A 3K28A 2R5CA 3AATA 1TARA 2C81A 2AY4A 3FFHA 1N2TA 2FQ6A 3F9TA 1WYUB 5D5SA 1TOJA 4PIWA 4E1OA 3AENA 4EMYA 4M2JA 5F8VA 2AEUA 2EH6A 1IX6A 2GMSA 3L8AA 2E7UA 4GE7A 4ZDPA 2WKAA 4E3QA 4LNMA 2YCPA 1D7SA 3ZZJA 1H0CA 2D7ZA 1AKCA 3ELEA 3QM2A 4N0BA 1AHFA 1AHXA 2R0TA 4LW4A 5FT5A 1SZKA 4ADCA 3FZ7A 4P7YA 1MLYA 2Z61A 2DGMA 3B1CA 3FD0A 4WB0A 4W8IA 3RUYA 4F5HA 1ASBA 1JG8A 1C7NA 5EUEA 1DKAA 1EJIA 1TOEA 3AELA 1AY4A 3NYTA 5G2QA 1V2DA 2BI1A 1LK9A 2Z9XA 3I16A 5EUDA 5AX8A 2CJDA 5EQCA 3FDDA 4O6ZA 1WYTB 3MAFB 4J5UA 1CZEA 3CBFA 4UOYA 2KFPA 4UHMA 2BWNA 3LVLB 2R2NA 3LVJA 1EG5A 4MSOA 1RVYA 2VIAA 1J32A 4OBUA 2VGSA 3JZLA 3E2ZB 4W5KA 2ZY2A 5DJ9A 3FQAA 2C7TA 1QZ9A 3AEMC 4XEWA 3Q8NA 1O61A 2BIEA 1PMMA 1T3IA 4EU1A 2Z67A 4MKJA 4OTLA 4ZLVA 2W7KA 4ZWVA 1CL1A 3B1EA 5TF5A 2W7IA 3R4TA 1ARHA 2VMZA 4M2KA 1LW5A 2ZSMA 2CH2A 3N4XA 1ASDA 4CXQA 2Z9UA 3LWSA 4AH3A 3DU4A 2BI2A 4IY7A 2W7EA 3BB8A 3JWAA 1LS3A 2CY8A 4RJYA 1KL2A 2AY1A 2YCTA 4XJMA 3M5UA 2CANA 3FQ7A 4OBVA 2D61A 4PFNA 4FFCA 2OKKA 3H9XA 4DBCA 2ZY4A 2JJFA 3WGBA 4EFFA 3DXVA 4GE4A 1S0AA 3L44A 1U08A 5M4BA 3RI6A 2WK9A 1AKBA 5EUNA 3PD6B 4AZJA 4OMAA 1DFOA 1C7OA 1FG3A 2OQXA 3PDBA 3MC6C 5E5IA 2JG2A 2VGTA 4A0HA 2W7FA 3OKSA 2AEVA 4XQ2A 3NRAA 1X28A 3BCXA 3DXWA 3UE8A 2O1BA 2BIGA 1JF9A 1OXPA 3OP7A 1AX4A 4R8DA 1BJWA 4ZAHA 4MQRA 1W7LA 3R9AA 3FCRA 3TQXA 3TFUA 1QIRA 3IHJA 3FQ8A 3H7FA 4BQ0A 4EB7A 1AHEA 2EZ2A 2PB0A 1BKGA 4Q31A 3AV7A 3ISLA 1D7UA 3LVMA 2EGYA 3E6GA 1AHYA 4AOAA 3FDBA 1AY8A 1AJSA 3WZFA 2VMWA 1I43A 1ASGA 3DC1A 4FL0A 4R5ZA 4ZM4A 4JE5A 1I41A 1WYUA 3ECDA 4RITA 3VK3A 4IX8A 3LY1A 4IXOA 1AIAA 4RJ0A 4CVQA 1TASA 3BN1A 4AO4A 4ZWMA 4ZDOA 3QHXA 2JISA 4ZASA 1QJ3A 2QLRA 3VOMA 3E77A 3FFRA 3EI7A 2D64A 2OATA 2ZSLA 3DR7A 1CL2A 4A6TA 2GSAA 4ITXA 3PGYA 1B9HA 1FG7A 1LC7A 3I4JA 2VMOA 3BWOA 1BJOB 3GZDA 3EI5A 4F5GA 2ORDA 1ZODA 3BV0A 1G4VA 2G7JA 1LC5A 4W1WA 1AICA 1AMRA 2FNUA 2AY6A 5M46A 1GC2A 1WYVB 1M4NA 2W7HA 1V2FA 3FVSA 1WYTA 1PMOA 3MAFA 4ADDA 2X5FA 4F5MA 4MGRA 3CQ6A 5FT4A 3HQTA 3AEJA 4WYFA 4ADEA 3QGUA 1X0MA 4WBTA 2AY7A 2ZY3A 3F0HA 1M0PA 3E2ZA 3PAAA 1IX8A 3A9XA 1QGNA 1W3UA 2HP1A 4N0WA 1MDOA 3B8XA 1VP4A 3HT4A 5LHAA 2YRIA 3E2FA 1EQBA 4U1TA 2EYQA 1I29A 1ZC9A 3HL2A 4LW2A 2E54A 4K2IA 4KYOA 1B8GA 1AMSA 1GEWA 1IAXA 1LKCA 3NDNA 2HORA 4ISYA 4JEZA 5E3KA 3BS8A 1AHGA 4RLGA 3KE3A 4WLJA 1G7XA 4LNJA 4ZM3A 1BW0A 1N8PA 1CJ0A 2BYLA 4W1XA 4A6UA 1UU2A 2VMQA 5IWQA 1M6SA 2HOXA 3GSBA 2D7YA 1ASMA 1ASEA 1D7VA 2NMPA 4ZSWA 4LNLA 3TATA 1OHWA 5FT6A 3AOWA 1GEXA 1Z7DA 3QBOA 3BC8A 3BCAA 3CQ5A 3HLMA 3ASBA 2GQNA 5EIGB 2YKUA 4GSAA 4JE5D 3JWBA 4F5LA 5G0AA 2VIBA 3HVYA 2AY2A 2VYCA 3RCHB 2R5CB 2W7JA 2YHKA 1SPAA 2WB6A 3LVKA 3K40A 4DGTA 3HMUA 3PD6A 3K7YA 2GB3A 1BQDA 3FZ6A 1RV3A 2HZPA 3G0TA 4WLHA 4NOGA 3PIUA 2QMAA 4MQPA 4P3MA 2ZP7A 4MKKA 4TMRA 2HUUA 3B1DA 2ZY5A 3NU8A 5KTBA 5M49A 1Y4IA 1S08A 4IYOB 4A72A 5K8BA 3N7NA 4PFFA 3PA9A 1ASAA 1BJNA 2TPLA 2VMRA 4HVKA 3EZ1A 4OC9A 4WB0B 1QJ5A 4R2NA 3AEMA 1QISA 3GJUA 4IW7A 2QSRA 1ASNA 3AEOA 1IAYA 1KMJA 4WXBA 3WGCA 4E77A 3E9KA 5I92A 2YCNA 3FSLA 4H63Q 1D2FA 1M0QA 3P6KA 4GEBA 2JGTA 1SF2A 3WX9A 2HOZA 4W91A 4JEXA 1J04A 1SZSA 3CAIA 4JF1A 2QA3A 1TATA 3WLXA 3QN6A 4R5FA 2BHXA 1GBNA 3ZZKA 4B9BA 1SFFA 2CB1A 3DYDA 3MAUA 2BKWA 4L0OA 3GZCA 3GWPA 2JJEA 1M7YA 1IBJA 3DR4A 1X2AA 2BWOA 3A9YA 3TFTA 2PO3A 1S07A 2Z9VA 1AJRA 2GMUA 2DGLA 1X29A 4U2HA 3BWNC 1ZOBA 2W8JA 3UAKA 2E7IA 3N4RA 2Z9WA 1V2EA 3ACZA 4F5JA 2VGZA 1OHVA 3G8MA 1DJEA 3UWCA 2V0YA 3MC6A 1C0NA 5LH9A 1UU1A 2VMPA 1UU0A 3N0LA 4HF8A 4IXZA 3EI8A 1IJIA 4RKCA 4WYCA 4A0GA 2ZUKA 4WD2A 3B46A 4TN4A 1S06A 3NU7A 5DJ1A 1ASFA 3NYSA 4JEVA 4Y0HA 4BA5A 2BIAA 3BCBA 3W1JA 1RVUA 2QB2A 2ZC0A 4ITGA 7AATA 2YKXA 3LV2A 1MAQA 1JS6A 2DOUA 2C44A 4CXRA 2F8JA 1I48A 3TCMA 1ECXA 3ZRQA 3EZSA 4Y0DA 3FVXA 2G6WA 3PDBB 1VJOA 5G4IA 3PDXA 4GE9A 1O4SA 5C6UA 1G7WA 3E2YA 2FYFA 1ELQA 4TV7A 4WYDA 5HDMA 2FM1A 1ARGA 4A00A 2CFBA 3KGWA 2YRRA 4WYAA 4ZSYA 4OCAA 2VMVA 3USFA 4ATPA 1O62A 2WK7A 3DRDA 5J8QA 1WKGA 1OHYA 1GCKA 1E5FA 2JJHA 1DTYA 1W7MA 3RBFA 2VI9A 3MEBA 3EI9A 1IUGA 2BI3A 1DJUA 3CQ4A 3VAXA 5EIGA 3ASAA 1AY5A 3NTJA 4EB5A 1M0NA 3AOVA 3JU7A 3RCHA 1AAWA 1AJSB 4UHOA 4A6RA 1C9CA 3MKJA 1MDXA 5DB5A 1C4KA 5FT8A 2HUIA 2QBTA 2EZ1A 2HP2A 4XJPA 2EO5A 4B98A 4RAEA 2Z20A 3N5MA 3T32A 3LG0A 4PVFA 2VI8A 2BI9A 1AIBA 2VLHA 4ZDLA 1YOOA 3JW9A 4IYOA 2VMYA 2VLFA 2CJHA 3FRKA 1Z3ZA 3NNKA 3RBLA 3VK2A 3PPLA 2AY8A 2JJGA 2OKJA 4Q6RA 4DQ6A 1BQAA 1YIZA 2YKVA 4WYEA 5HHYA 1TPLA 2VMNA 2X5DA 3GR9A 4Q76A 2BWPA 1MDZA 2W8VA 1GEYA 2W8WA 1IX7A 1N31A 2FN6A 2Q7WA 3VK4A 2VGWA 2AY9A 1ASLA 4RIZA 2VMXA 5G4JA 4K05A 3AENB 1M0OA 1LW4A 1AMAA 2VMTA
chains in the Genus database with same CATH topology
2AY3A 1SZUA 3HBXA 3FVUA 3EI6A 3N75A 3A2BA 3NUBA 1JS3A 1WSTA 1V72A 2W8TA 2CSTA 3DZZA 4WYGA 1PFFA 4E3RA 2W7LA 4WP0A 3ZRPA 4KXKA 5JAYA 3WCOA 1AKAA 3F6TA 1PG8A 2EPJA 3PJ0A 4OYTA 4XJLA 2W8UA 1CS1A 3FTBA 1H1CA 2YKYA 1KKPA 3NYUA 4M2MA 9AATA 3D6KA 4XK1A 2Z1YA 5EAAA 2WK8A 2BYJA 4KAMA 4Y0IA 3WKSA 1YJSA 1CQ6A 2CH1A 4JEWA 1E5EA 1P3WA 1ELUA 2PB2A 3I5TA 3ZRRA 4A0RA 3AEPA 2VGUA 3NX3A 3GBXA 1D7RA 1YIYA 1ARIA 1OXOA 1M32A 1B4XA 2V1PA 3ATHA 1MAPA 3EIAA 3EUCA 4ATQA 4MY5A 1YNUA 1ARTA 2AY5A 4JF0A 5EAVA 4Q75A 2OGEA 4JEYA 1GD9A 1ORDA 5EFSA 3N4SA 8AATA 1YAAA 1KL1A 4BMKA 3A8UX 3NUIA 2DGKA 4WXFA 2HUFA 4UQVA 1MLZA 4I8AA 5E4ZA 1VEFA 2XH1A 4CBRA 1BJOA 4XAUA 1G4XA 2OGAA 1YJYA 4MQQA 3WY7A 4F4EA 1GC4A 2O0RA 3KKIA 3FKDA 4GRXA 2CJGA 5G09A 4BA4A 4AZKA 4RM1A 1LC8A 1CZCA 5BJ4A 1B5OA 2CTZA 3W1HA 4OT8A 1DGEA 4CBSA 1WYVA 3RQ1A 2ZYJA 1W7NA 1GC0A 1GC3A 1FC4A 4ADBA 3QI6A 4F5IA 2XBNA 4K2BA 1SVVA 1KKJA 1UKJA 5DX5A 1B5PA 1MGVA 2D65A 2RFVA 3A9ZA 4QGRA 4AO9A 1XEYA 4RKDA 3JTXA 3P1TA 2BI5A 2X8UA 2FKIA 2DKJA 3MADA 1YJZA 3GZDC 3MBBA 1TOGA 4H51A 2W7MA 1QITA 4F5KA 5F9SA 1IVRA 2A1VA 4F5FA 1DJ9A 5D95A 3G7QA 2FNIA 2D5YA 2Z1ZA 1AAMA 2DKBA 3HDOA 3II0A 1AMQA 2C0RA 2O7CA 4W1VA 4IXSA 3GETA 1S09A 2ZJGA 3BWNA 3DODA 1ARSA 1KMKA 1WKHA 3COGA 2AATA 2D63A 3ELPA 4UHNA 5G2PA 2VGVA 3AEJC 2YOBA 4BHDA 3IF2A 2D66A 3KGXA 1GDEA 3EIBA 2W7DA 1DGDA 1RV4A 1TOIA 4XJOA 4LC3A 4A0FA 2DR1A 2VMSA 1ASCA 1XI9A 3VP6A 2HOYA 5HXXA 5BJ3A 3H14A 1CQ7A 5M4DA 2E7JA 1BS0A 1O69A 1C7GA 4J8LA 1OATA 2R5EA 1BT4A 1W23A 3FZ8A 1CQ8A 1B9IA 1TOKA 4GDYA 2VMUA 2X3LA 3WKRA 3QPGA 2CINA 1BJ4A 4WXGA 3W1IA 3WCNA 2W7GA 4K2MA 2QB3A 3K28A 2R5CA 3AATA 1TARA 2C81A 2AY4A 3FFHA 1N2TA 2FQ6A 3F9TA 1WYUB 5D5SA 1TOJA 4PIWA 4E1OA 3AENA 4EMYA 4M2JA 5F8VA 2AEUA 2EH6A 1IX6A 2GMSA 3L8AA 2E7UA 4GE7A 4ZDPA 2WKAA 4E3QA 4LNMA 2YCPA 1D7SA 3ZZJA 1H0CA 2D7ZA 1AKCA 3ELEA 3QM2A 4N0BA 1AHFA 1AHXA 2R0TA 4LW4A 5FT5A 1SZKA 4ADCA 3FZ7A 4P7YA 1MLYA 2Z61A 2DGMA 3B1CA 3FD0A 4WB0A 4W8IA 3RUYA 4F5HA 1ASBA 1JG8A 1C7NA 5EUEA 1DKAA 1EJIA 1TOEA 3AELA 1AY4A 3NYTA 5G2QA 1V2DA 2BI1A 1LK9A 2Z9XA 3I16A 5EUDA 5AX8A 2CJDA 5EQCA 3FDDA 4O6ZA 1WYTB 3MAFB 4J5UA 1CZEA 3CBFA 4UOYA 2KFPA 4UHMA 2BWNA 3LVLB 2R2NA 3LVJA 1EG5A 4MSOA 1RVYA 2VIAA 1J32A 4OBUA 2VGSA 3JZLA 3E2ZB 4W5KA 2ZY2A 5DJ9A 3FQAA 2C7TA 1QZ9A 3AEMC 4XEWA 3Q8NA 1O61A 2BIEA 1PMMA 1T3IA 4EU1A 2Z67A 4MKJA 4OTLA 4ZLVA 2W7KA 4ZWVA 1CL1A 3B1EA 5TF5A 2W7IA 3R4TA 1ARHA 2VMZA 4M2KA 1LW5A 2ZSMA 2CH2A 3N4XA 1ASDA 4CXQA 2Z9UA 3LWSA 4AH3A 3DU4A 2BI2A 4IY7A 2W7EA 3BB8A 3JWAA 1LS3A 2CY8A 4RJYA 1KL2A 2AY1A 2YCTA 4XJMA 3M5UA 2CANA 3FQ7A 4OBVA 2D61A 4PFNA 4FFCA 2OKKA 3H9XA 4DBCA 2ZY4A 2JJFA 3WGBA 4EFFA 3DXVA 4GE4A 1S0AA 3L44A 1U08A 5M4BA 3RI6A 2WK9A 1AKBA 5EUNA 3PD6B 4AZJA 4OMAA 1DFOA 1C7OA 1FG3A 2OQXA 3PDBA 3MC6C 5E5IA 2JG2A 2VGTA 4A0HA 2W7FA 3OKSA 2AEVA 4XQ2A 3NRAA 1X28A 3BCXA 3DXWA 3UE8A 2O1BA 2BIGA 1JF9A 1OXPA 3OP7A 1AX4A 4R8DA 1BJWA 4ZAHA 4MQRA 1W7LA 3R9AA 3FCRA 3TQXA 3TFUA 1QIRA 3IHJA 3FQ8A 3H7FA 4BQ0A 4EB7A 1AHEA 2EZ2A 2PB0A 1BKGA 4Q31A 3AV7A 3ISLA 1D7UA 3LVMA 2EGYA 3E6GA 1AHYA 4AOAA 3FDBA 1AY8A 1AJSA 3WZFA 2VMWA 1I43A 1ASGA 3DC1A 4FL0A 4R5ZA 4ZM4A 4JE5A 1I41A 1WYUA 3ECDA 4RITA 3VK3A 4IX8A 3LY1A 4IXOA 1AIAA 4RJ0A 4CVQA 1TASA 3BN1A 4AO4A 4ZWMA 4ZDOA 3QHXA 2JISA 4ZASA 1QJ3A 2QLRA 3VOMA 3E77A 3FFRA 3EI7A 2D64A 2OATA 2ZSLA 3DR7A 1CL2A 4A6TA 2GSAA 4ITXA 3PGYA 1B9HA 1FG7A 1LC7A 3I4JA 2VMOA 3BWOA 1BJOB 3GZDA 3EI5A 4F5GA 2ORDA 1ZODA 3BV0A 1G4VA 2G7JA 1LC5A 4W1WA 1AICA 1AMRA 2FNUA 2AY6A 5M46A 1GC2A 1WYVB 1M4NA 2W7HA 1V2FA 3FVSA 1WYTA 1PMOA 3MAFA 4ADDA 2X5FA 4F5MA 4MGRA 3CQ6A 5FT4A 3HQTA 3AEJA 4WYFA 4ADEA 3QGUA 1X0MA 4WBTA 2AY7A 2ZY3A 3F0HA 1M0PA 3E2ZA 3PAAA 1IX8A 3A9XA 1QGNA 1W3UA 2HP1A 4N0WA 1MDOA 3B8XA 1VP4A 3HT4A 5LHAA 2YRIA 3E2FA 1EQBA 4U1TA 2EYQA 1I29A 1ZC9A 3HL2A 4LW2A 2E54A 4K2IA 4KYOA 1B8GA 1AMSA 1GEWA 1IAXA 1LKCA 3NDNA 2HORA 4ISYA 4JEZA 5E3KA 3BS8A 1AHGA 4RLGA 3KE3A 4WLJA 1G7XA 4LNJA 4ZM3A 1BW0A 1N8PA 1CJ0A 2BYLA 4W1XA 4A6UA 1UU2A 2VMQA 5IWQA 1M6SA 2HOXA 3GSBA 2D7YA 1ASMA 1ASEA 1D7VA 2NMPA 4ZSWA 4LNLA 3TATA 1OHWA 5FT6A 3AOWA 1GEXA 1Z7DA 3QBOA 3BC8A 3BCAA 3CQ5A 3HLMA 3ASBA 2GQNA 5EIGB 2YKUA 4GSAA 4JE5D 3JWBA 4F5LA 5G0AA 2VIBA 3HVYA 2AY2A 2VYCA 3RCHB 2R5CB 2W7JA 2YHKA 1SPAA 2WB6A 3LVKA 3K40A 4DGTA 3HMUA 3PD6A 3K7YA 2GB3A 1BQDA 3FZ6A 1RV3A 2HZPA 3G0TA 4WLHA 4NOGA 3PIUA 2QMAA 4MQPA 4P3MA 2ZP7A 4MKKA 4TMRA 2HUUA 3B1DA 2ZY5A 3NU8A 5KTBA 5M49A 1Y4IA 1S08A 4IYOB 4A72A 5K8BA 3N7NA 4PFFA 3PA9A 1ASAA 1BJNA 2TPLA 2VMRA 4HVKA 3EZ1A 4OC9A 4WB0B 1QJ5A 4R2NA 3AEMA 1QISA 3GJUA 4IW7A 2QSRA 1ASNA 3AEOA 1IAYA 1KMJA 4WXBA 3WGCA 4E77A 3E9KA 5I92A 2YCNA 3FSLA 4H63Q 1D2FA 1M0QA 3P6KA 4GEBA 2JGTA 1SF2A 3WX9A 2HOZA 4W91A 4JEXA 1J04A 1SZSA 3CAIA 4JF1A 2QA3A 1TATA 3WLXA 3QN6A 4R5FA 2BHXA 1GBNA 3ZZKA 4B9BA 1SFFA 2CB1A 3DYDA 3MAUA 2BKWA 4L0OA 3GZCA 3GWPA 2JJEA 1M7YA 1IBJA 3DR4A 1X2AA 2BWOA 3A9YA 3TFTA 2PO3A 1S07A 2Z9VA 1AJRA 2GMUA 2DGLA 1X29A 4U2HA 3BWNC 1ZOBA 2W8JA 3UAKA 2E7IA 3N4RA 2Z9WA 1V2EA 3ACZA 4F5JA 2VGZA 1OHVA 3G8MA 1DJEA 3UWCA 2V0YA 3MC6A 1C0NA 5LH9A 1UU1A 2VMPA 1UU0A 3N0LA 4HF8A 4IXZA 3EI8A 1IJIA 4RKCA 4WYCA 4A0GA 2ZUKA 4WD2A 3B46A 4TN4A 1S06A 3NU7A 5DJ1A 1ASFA 3NYSA 4JEVA 4Y0HA 4BA5A 2BIAA 3BCBA 3W1JA 1RVUA 2QB2A 2ZC0A 4ITGA 7AATA 2YKXA 3LV2A 1MAQA 1JS6A 2DOUA 2C44A 4CXRA 2F8JA 1I48A 3TCMA 1ECXA 3ZRQA 3EZSA 4Y0DA 3FVXA 2G6WA 3PDBB 1VJOA 5G4IA 3PDXA 4GE9A 1O4SA 5C6UA 1G7WA 3E2YA 2FYFA 1ELQA 4TV7A 4WYDA 5HDMA 2FM1A 1ARGA 4A00A 2CFBA 3KGWA 2YRRA 4WYAA 4ZSYA 4OCAA 2VMVA 3USFA 4ATPA 1O62A 2WK7A 3DRDA 5J8QA 1WKGA 1OHYA 1GCKA 1E5FA 2JJHA 1DTYA 1W7MA 3RBFA 2VI9A 3MEBA 3EI9A 1IUGA 2BI3A 1DJUA 3CQ4A 3VAXA 5EIGA 3ASAA 1AY5A 3NTJA 4EB5A 1M0NA 3AOVA 3JU7A 3RCHA 1AAWA 1AJSB 4UHOA 4A6RA 1C9CA 3MKJA 1MDXA 5DB5A 1C4KA 5FT8A 2HUIA 2QBTA 2EZ1A 2HP2A 4XJPA 2EO5A 4B98A 4RAEA 2Z20A 3N5MA 3T32A 3LG0A 4PVFA 2VI8A 2BI9A 1AIBA 2VLHA 4ZDLA 1YOOA 3JW9A 4IYOA 2VMYA 2VLFA 2CJHA 3FRKA 1Z3ZA 3NNKA 3RBLA 3VK2A 3PPLA 2AY8A 2JJGA 2OKJA 4Q6RA 4DQ6A 1BQAA 1YIZA 2YKVA 4WYEA 5HHYA 1TPLA 2VMNA 2X5DA 3GR9A 4Q76A 2BWPA 1MDZA 2W8VA 1GEYA 2W8WA 1IX7A 1N31A 2FN6A 2Q7WA 3VK4A 2VGWA 2AY9A 1ASLA 4RIZA 2VMXA 5G4JA 4K05A 3AENB 1M0OA 1LW4A 1AMAA 2VMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AY3 A;  1SZU A;  3HBX A;  3FVU A;  3EI6 A;  3N75 A;  3A2B A;  3NUB A;  1JS3 A;  1WST A;  1V72 A;  2W8T A;  2CST A;  3DZZ A;  4WYG A;  1PFF A;  4E3R A;  2W7L A;  4WP0 A;  3ZRP A;  4KXK A;  5JAY A;  3WCO A;  1AKA A;  3F6T A;  1PG8 A;  2EPJ A;  3PJ0 A;  4OYT A;  4XJL A;  2W8U A;  1CS1 A;  3FTB A;  1H1C A;  2YKY A;  1KKP A;  3NYU A;  4M2M A;  9AAT A;  3D6K A;  4XK1 A;  2Z1Y A;  5EAA A;  2WK8 A;  2BYJ A;  4KAM A;  4Y0I A;  3WKS A;  1YJS A;  1CQ6 A;  2CH1 A;  4JEW A;  1E5E A;  1P3W A;  1ELU A;  2PB2 A;  3I5T A;  3ZRR A;  4A0R A;  3AEP A;  2VGU A;  3NX3 A;  3GBX A;  1D7R A;  1YIY A;  1ARI A;  1OXO A;  1M32 A;  1B4X A;  2V1P A;  3ATH A;  1MAP A;  3EIA A;  3EUC A;  4ATQ A;  4MY5 A;  1YNU A;  1ART A;  2AY5 A;  4JF0 A;  5EAV A;  4Q75 A;  2OGE A;  4JEY A;  1GD9 A;  1ORD A;  5EFS A;  8AAT A;  1YAA A;  1KL1 A;  4BMK A;  3A8U X;  3NUI A;  2DGK A;  4WXF A;  2HUF A;  4UQV A;  1MLZ A;  4I8A A;  5E4Z A;  1VEF A;  2XH1 A;  4CBR A;  1BJO A;  4XAU A;  1G4X A;  2OGA A;  1YJY A;  4MQQ A;  3WY7 A;  4F4E A;  1GC4 A;  2O0R A;  3KKI A;  3FKD A;  4GRX A;  2CJG A;  5G09 A;  4BA4 A;  4AZK A;  4RM1 A;  1LC8 A;  1CZC A;  5BJ4 A;  1B5O A;  2CTZ A;  3W1H A;  4OT8 A;  1DGE A;  4CBS A;  1WYV A;  3RQ1 A;  2ZYJ A;  1W7N A;  1GC0 A;  1GC3 A;  1FC4 A;  4ADB A;  3QI6 A;  4F5I A;  2XBN A;  4K2B A;  1SVV A;  1KKJ A;  1UKJ A;  5DX5 A;  1B5P A;  1MGV A;  2D65 A;  2RFV A;  3A9Z A;  4QGR A;  4AO9 A;  1XEY A;  4RKD A;  3JTX A;  3P1T A;  2BI5 A;  2X8U A;  2DKJ A;  3MAD A;  1YJZ A;  3GZD C;  3MBB A;  1TOG A;  4H51 A;  2W7M A;  1QIT A;  4F5K A;  5F9S A;  1IVR A;  4F5F A;  1DJ9 A;  5D95 A;  3G7Q A;  2FNI A;  2D5Y A;  2Z1Z A;  1AAM A;  2DKB A;  3HDO A;  3II0 A;  1AMQ A;  2C0R A;  2O7C A;  4W1V A;  4IXS A;  3GET A;  1S09 A;  2ZJG A;  3BWN A;  3DOD A;  1ARS A;  1KMK A;  1WKH A;  3COG A;  2AAT A;  2D63 A;  3ELP A;  4UHN A;  5G2P A;  2VGV A;  3AEJ C;  2YOB A;  4BHD A;  3IF2 A;  2D66 A;  3KGX A;  1GDE A;  3EIB A;  2W7D A;  1DGD A;  1RV4 A;  1TOI A;  4XJO A;  4LC3 A;  4A0F A;  2DR1 A;  2VMS A;  1ASC A;  1XI9 A;  3VP6 A;  2HOY A;  5HXX A;  5BJ3 A;  3H14 A;  1CQ7 A;  5M4D A;  2E7J A;  1BS0 A;  1O69 A;  1C7G A;  4J8L A;  1OAT A;  2R5E A;  1BT4 A;  1W23 A;  3FZ8 A;  1CQ8 A;  1B9I A;  1TOK A;  4GDY A;  2VMU A;  2X3L A;  3WKR A;  3QPG A;  2CIN A;  1BJ4 A;  4WXG A;  3W1I A;  3WCN A;  2W7G A;  4K2M A;  2QB3 A;  3K28 A;  2R5C A;  3AAT A;  1TAR A;  2C81 A;  2AY4 A;  3FFH A;  1N2T A;  2FQ6 A;  3F9T A;  1WYU B;  5D5S A;  1TOJ A;  4PIW A;  4E1O A;  3AEN A;  4EMY A;  4M2J A;  5F8V A;  2AEU A;  2EH6 A;  1IX6 A;  2GMS A;  3L8A A;  2E7U A;  4GE7 A;  4ZDP A;  2WKA A;  4E3Q A;  4LNM A;  2YCP A;  1D7S A;  3ZZJ A;  1H0C A;  2D7Z A;  1AKC A;  3ELE A;  3QM2 A;  4N0B A;  1AHF A;  1AHX A;  2R0T A;  4LW4 A;  5FT5 A;  1SZK A;  4ADC A;  3FZ7 A;  4P7Y A;  1MLY A;  2Z61 A;  2DGM A;  3B1C A;  3FD0 A;  4WB0 A;  4W8I A;  3RUY A;  4F5H A;  1ASB A;  1JG8 A;  1C7N A;  5EUE A;  1DKA A;  1EJI A;  1TOE A;  3AEL A;  1AY4 A;  3NYT A;  5G2Q A;  1V2D A;  2BI1 A;  1LK9 A;  2Z9X A;  3I16 A;  5EUD A;  5AX8 A;  2CJD A;  5EQC A;  3FDD A;  4O6Z A;  1WYT B;  3MAF B;  4J5U A;  1CZE A;  3CBF A;  4UOY A;  4UHM A;  2BWN A;  3LVL B;  2R2N A;  3LVJ A;  1EG5 A;  4MSO A;  1RVY A;  2VIA A;  1J32 A;  4OBU A;  2VGS A;  3JZL A;  3E2Z B;  4W5K A;  2ZY2 A;  5DJ9 A;  3FQA A;  2C7T A;  1QZ9 A;  3AEM C;  4XEW A;  3Q8N A;  1O61 A;  2BIE A;  1PMM A;  1T3I A;  4EU1 A;  2Z67 A;  4MKJ A;  4OTL A;  4ZLV A;  2W7K A;  4ZWV A;  1CL1 A;  3B1E A;  5TF5 A;  2W7I A;  3R4T A;  1ARH A;  2VMZ A;  4M2K A;  1LW5 A;  2ZSM A;  2CH2 A;  1ASD A;  4CXQ A;  2Z9U A;  3LWS A;  4AH3 A;  3DU4 A;  2BI2 A;  4IY7 A;  2W7E A;  3BB8 A;  3JWA A;  1LS3 A;  2CY8 A;  4RJY A;  1KL2 A;  2AY1 A;  2YCT A;  4XJM A;  3M5U A;  2CAN A;  3FQ7 A;  4OBV A;  2D61 A;  4PFN A;  4FFC A;  2OKK A;  4DBC A;  2ZY4 A;  2JJF A;  3WGB A;  4EFF A;  3DXV A;  4GE4 A;  1S0A A;  3L44 A;  1U08 A;  5M4B A;  3RI6 A;  2WK9 A;  1AKB A;  5EUN A;  3PD6 B;  4AZJ A;  4OMA A;  1DFO A;  1C7O A;  1FG3 A;  2OQX A;  3PDB A;  3MC6 C;  5E5I A;  2JG2 A;  2VGT A;  4A0H A;  2W7F A;  3OKS A;  2AEV A;  4XQ2 A;  3NRA A;  1X28 A;  3BCX A;  3DXW A;  3UE8 A;  2O1B A;  2BIG A;  1JF9 A;  1OXP A;  3OP7 A;  1AX4 A;  4R8D A;  1BJW A;  4ZAH A;  4MQR A;  1W7L A;  3R9A A;  3FCR A;  3TQX A;  3TFU A;  1QIR A;  3IHJ A;  3FQ8 A;  3H7F A;  4BQ0 A;  4EB7 A;  1AHE A;  2EZ2 A;  2PB0 A;  1BKG A;  4Q31 A;  3AV7 A;  3ISL A;  1D7U A;  3LVM A;  2EGY A;  3E6G A;  1AHY A;  4AOA A;  3FDB A;  1AY8 A;  1AJS A;  3WZF A;  2VMW A;  1I43 A;  1ASG A;  3DC1 A;  4FL0 A;  4R5Z A;  4ZM4 A;  4JE5 A;  1I41 A;  1WYU A;  3ECD A;  4RIT A;  3VK3 A;  4IX8 A;  3LY1 A;  4IXO A;  1AIA A;  4RJ0 A;  4CVQ A;  1TAS A;  3BN1 A;  4AO4 A;  4ZWM A;  4ZDO A;  3QHX A;  2JIS A;  4ZAS A;  1QJ3 A;  2QLR A;  3VOM A;  3E77 A;  3FFR A;  3EI7 A;  2D64 A;  2OAT A;  2ZSL A;  3DR7 A;  1CL2 A;  4A6T A;  2GSA A;  4ITX A;  3PGY A;  1B9H A;  1FG7 A;  1LC7 A;  3I4J A;  2VMO A;  3BWO A;  1BJO B;  3GZD A;  3EI5 A;  4F5G A;  2ORD A;  1ZOD A;  3BV0 A;  1G4V A;  1LC5 A;  4W1W A;  1AIC A;  1AMR A;  2FNU A;  2AY6 A;  5M46 A;  1GC2 A;  1WYV B;  1M4N A;  2W7H A;  1V2F A;  3FVS A;  1WYT A;  1PMO A;  3MAF A;  4ADD A;  2X5F A;  4F5M A;  4MGR A;  3CQ6 A;  5FT4 A;  3HQT A;  3AEJ A;  4WYF A;  4ADE A;  3QGU A;  1X0M A;  4WBT A;  2AY7 A;  2ZY3 A;  3F0H A;  1M0P A;  3E2Z A;  3PAA A;  1IX8 A;  3A9X A;  1QGN A;  1W3U A;  2HP1 A;  4N0W A;  1MDO A;  3B8X A;  1VP4 A;  3HT4 A;  5LHA A;  2YRI A;  3E2F A;  1EQB A;  4U1T A;  1I29 A;  1ZC9 A;  3HL2 A;  4LW2 A;  2E54 A;  4K2I A;  4KYO A;  1B8G A;  1AMS A;  1GEW A;  1IAX A;  1LKC A;  3NDN A;  2HOR A;  4ISY A;  4JEZ A;  5E3K A;  3BS8 A;  1AHG A;  4RLG A;  3KE3 A;  4WLJ A;  1G7X A;  4LNJ A;  4ZM3 A;  1BW0 A;  1N8P A;  1CJ0 A;  2BYL A;  4W1X A;  4A6U A;  1UU2 A;  2VMQ A;  5IWQ A;  1M6S A;  2HOX A;  3GSB A;  2D7Y A;  1ASM A;  1ASE A;  1D7V A;  2NMP A;  4ZSW A;  4LNL A;  3TAT A;  1OHW A;  5FT6 A;  3AOW A;  1GEX A;  1Z7D A;  3QBO A;  3BC8 A;  3BCA A;  3CQ5 A;  3HLM A;  3ASB A;  2GQN A;  5EIG B;  2YKU A;  4GSA A;  4JE5 D;  3JWB A;  4F5L A;  5G0A A;  2VIB A;  3HVY A;  2AY2 A;  2VYC A;  3RCH B;  2R5C B;  2W7J A;  2YHK A;  1SPA A;  3LVK A;  3K40 A;  4DGT A;  3HMU A;  3PD6 A;  3K7Y A;  2GB3 A;  1BQD A;  3FZ6 A;  1RV3 A;  2HZP A;  3G0T A;  4WLH A;  4NOG A;  3PIU A;  2QMA A;  4MQP A;  4P3M A;  2ZP7 A;  4MKK A;  4TMR A;  2HUU A;  3B1D A;  2ZY5 A;  3NU8 A;  5M49 A;  1Y4I A;  1S08 A;  4IYO B;  4A72 A;  5K8B A;  4PFF A;  3PA9 A;  1ASA A;  1BJN A;  2TPL A;  2VMR A;  4HVK A;  3EZ1 A;  4OC9 A;  4WB0 B;  1QJ5 A;  4R2N A;  3AEM A;  1QIS A;  3GJU A;  4IW7 A;  1ASN A;  3AEO A;  1IAY A;  1KMJ A;  4WXB A;  3WGC A;  4E77 A;  3E9K A;  5I92 A;  2YCN A;  3FSL A;  1D2F A;  1M0Q A;  3P6K A;  4GEB A;  2JGT A;  1SF2 A;  3WX9 A;  2HOZ A;  4W91 A;  4JEX A;  1J04 A;  1SZS A;  3CAI A;  4JF1 A;  2QA3 A;  1TAT A;  3WLX A;  3QN6 A;  4R5F A;  2BHX A;  1GBN A;  3ZZK A;  4B9B A;  1SFF A;  2CB1 A;  3DYD A;  3MAU A;  2BKW A;  4L0O A;  3GZC A;  3GWP A;  2JJE A;  1M7Y A;  1IBJ A;  3DR4 A;  1X2A A;  2BWO A;  3A9Y A;  3TFT A;  2PO3 A;  1S07 A;  2Z9V A;  1AJR A;  2GMU A;  2DGL A;  1X29 A;  4U2H A;  3BWN C;  1ZOB A;  2W8J A;  3UAK A;  2E7I A;  2Z9W A;  1V2E A;  3ACZ A;  4F5J A;  2VGZ A;  1OHV A;  3G8M A;  1DJE A;  3UWC A;  2V0Y A;  3MC6 A;  1C0N A;  5LH9 A;  1UU1 A;  2VMP A;  1UU0 A;  3N0L A;  4HF8 A;  4IXZ A;  3EI8 A;  1IJI A;  4RKC A;  4WYC A;  4A0G A;  2ZUK A;  4WD2 A;  3B46 A;  4TN4 A;  1S06 A;  3NU7 A;  5DJ1 A;  1ASF A;  3NYS A;  4JEV A;  4Y0H A;  4BA5 A;  2BIA A;  3BCB A;  3W1J A;  1RVU A;  2QB2 A;  2ZC0 A;  4ITG A;  7AAT A;  2YKX A;  3LV2 A;  1MAQ A;  1JS6 A;  2DOU A;  2C44 A;  4CXR A;  2F8J A;  1I48 A;  3TCM A;  1ECX A;  3ZRQ A;  3EZS A;  4Y0D A;  3FVX A;  2G6W A;  3PDB B;  1VJO A;  5G4I A;  3PDX A;  4GE9 A;  1O4S A;  5C6U A;  1G7W A;  3E2Y A;  2FYF A;  1ELQ A;  4TV7 A;  4WYD A;  5HDM A;  2FM1 A;  1ARG A;  4A00 A;  2CFB A;  3KGW A;  2YRR A;  4WYA A;  4ZSY A;  4OCA A;  2VMV A;  3USF A;  4ATP A;  1O62 A;  2WK7 A;  3DRD A;  5J8Q A;  1WKG A;  1OHY A;  1GCK A;  1E5F A;  2JJH A;  1DTY A;  1W7M A;  3RBF A;  2VI9 A;  3MEB A;  3EI9 A;  1IUG A;  2BI3 A;  1DJU A;  3CQ4 A;  3VAX A;  5EIG A;  3ASA A;  1AY5 A;  3NTJ A;  4EB5 A;  1M0N A;  3AOV A;  3JU7 A;  3RCH A;  1AAW A;  1AJS B;  4UHO A;  4A6R A;  1C9C A;  3MKJ A;  1MDX A;  5DB5 A;  1C4K A;  5FT8 A;  2HUI A;  2QBT A;  2EZ1 A;  2HP2 A;  4XJP A;  2EO5 A;  4B98 A;  4RAE A;  2Z20 A;  3N5M A;  3T32 A;  3LG0 A;  4PVF A;  2VI8 A;  2BI9 A;  1AIB A;  2VLH A;  4ZDL A;  1YOO A;  3JW9 A;  4IYO A;  2VMY A;  2VLF A;  2CJH A;  3FRK A;  1Z3Z A;  3NNK A;  3RBL A;  3VK2 A;  3PPL A;  2AY8 A;  2JJG A;  2OKJ A;  4Q6R A;  4DQ6 A;  1BQA A;  1YIZ A;  2YKV A;  4WYE A;  5HHY A;  1TPL A;  2VMN A;  2X5D A;  3GR9 A;  4Q76 A;  2BWP A;  1MDZ A;  2W8V A;  1GEY A;  2W8W A;  1IX7 A;  1N31 A;  2FN6 A;  2Q7W A;  3VK4 A;  2VGW A;  2AY9 A;  1ASL A;  4RIZ A;  2VMX A;  5G4J A;  3AEN B;  1M0O A;  1LW4 A;  1AMA A;  2VMT A; 
#chains in the Genus database with same CATH topology
 2AY3 A;  1SZU A;  3HBX A;  3FVU A;  3EI6 A;  3N75 A;  3A2B A;  3NUB A;  1JS3 A;  1WST A;  1V72 A;  2W8T A;  2CST A;  3DZZ A;  4WYG A;  1PFF A;  4E3R A;  2W7L A;  4WP0 A;  3ZRP A;  4KXK A;  5JAY A;  3WCO A;  1AKA A;  3F6T A;  1PG8 A;  2EPJ A;  3PJ0 A;  4OYT A;  4XJL A;  2W8U A;  1CS1 A;  3FTB A;  1H1C A;  2YKY A;  1KKP A;  3NYU A;  4M2M A;  9AAT A;  3D6K A;  4XK1 A;  2Z1Y A;  5EAA A;  2WK8 A;  2BYJ A;  4KAM A;  4Y0I A;  3WKS A;  1YJS A;  1CQ6 A;  2CH1 A;  4JEW A;  1E5E A;  1P3W A;  1ELU A;  2PB2 A;  3I5T A;  3ZRR A;  4A0R A;  3AEP A;  2VGU A;  3NX3 A;  3GBX A;  1D7R A;  1YIY A;  1ARI A;  1OXO A;  1M32 A;  1B4X A;  2V1P A;  3ATH A;  1MAP A;  3EIA A;  3EUC A;  4ATQ A;  1KAF A;  4MY5 A;  1YNU A;  1ART A;  2AY5 A;  4JF0 A;  5EAV A;  4Q75 A;  2OGE A;  4JEY A;  1GD9 A;  1ORD A;  5EFS A;  3N4S A;  8AAT A;  1YAA A;  1KL1 A;  4BMK A;  3A8U X;  3NUI A;  2DGK A;  4WXF A;  2HUF A;  4UQV A;  1MLZ A;  4I8A A;  5E4Z A;  1VEF A;  2XH1 A;  4CBR A;  1BJO A;  4XAU A;  1G4X A;  2OGA A;  1YJY A;  4MQQ A;  3WY7 A;  4F4E A;  1GC4 A;  2O0R A;  3KKI A;  3FKD A;  4GRX A;  2CJG A;  5G09 A;  4BA4 A;  4AZK A;  4RM1 A;  1LC8 A;  1CZC A;  5BJ4 A;  1B5O A;  2CTZ A;  3W1H A;  4OT8 A;  1DGE A;  4CBS A;  1WYV A;  3RQ1 A;  2ZYJ A;  1W7N A;  1GC0 A;  1GC3 A;  1FC4 A;  4ADB A;  3QI6 A;  4F5I A;  2XBN A;  4K2B A;  1SVV A;  1KKJ A;  1UKJ A;  5DX5 A;  1B5P A;  1MGV A;  2D65 A;  2RFV A;  3A9Z A;  4QGR A;  4AO9 A;  1XEY A;  4RKD A;  3JTX A;  3P1T A;  2BI5 A;  2X8U A;  2FKI A;  2DKJ A;  3MAD A;  1YJZ A;  3GZD C;  3MBB A;  1TOG A;  4H51 A;  2W7M A;  1QIT A;  4F5K A;  5F9S A;  1IVR A;  2A1V A;  4F5F A;  1DJ9 A;  5D95 A;  3G7Q A;  2FNI A;  2D5Y A;  2Z1Z A;  1AAM A;  2DKB A;  3HDO A;  3II0 A;  1AMQ A;  2C0R A;  2O7C A;  4W1V A;  4IXS A;  3GET A;  1S09 A;  2ZJG A;  3BWN A;  3DOD A;  1ARS A;  1KMK A;  1WKH A;  3COG A;  2AAT A;  2D63 A;  3ELP A;  4UHN A;  5G2P A;  2VGV A;  3AEJ C;  2YOB A;  4BHD A;  3IF2 A;  2D66 A;  3KGX A;  1GDE A;  3EIB A;  2W7D A;  1DGD A;  1RV4 A;  1TOI A;  4XJO A;  4LC3 A;  4A0F A;  2DR1 A;  2VMS A;  1ASC A;  1XI9 A;  3VP6 A;  2HOY A;  5HXX A;  5BJ3 A;  3H14 A;  1CQ7 A;  5M4D A;  2E7J A;  1BS0 A;  1O69 A;  1C7G A;  4J8L A;  1OAT A;  2R5E A;  1BT4 A;  1W23 A;  3FZ8 A;  1CQ8 A;  1B9I A;  1TOK A;  4GDY A;  2VMU A;  2X3L A;  3WKR A;  3QPG A;  2CIN A;  1BJ4 A;  4WXG A;  3W1I A;  3WCN A;  2W7G A;  4K2M A;  2QB3 A;  3K28 A;  2R5C A;  3AAT A;  1TAR A;  2C81 A;  2AY4 A;  3FFH A;  1N2T A;  2FQ6 A;  3F9T A;  1WYU B;  5D5S A;  1TOJ A;  4PIW A;  4E1O A;  3AEN A;  4EMY A;  4M2J A;  5F8V A;  2AEU A;  2EH6 A;  1IX6 A;  2GMS A;  3L8A A;  2E7U A;  4GE7 A;  4ZDP A;  2WKA A;  4E3Q A;  4LNM A;  2YCP A;  1D7S A;  3ZZJ A;  1H0C A;  2D7Z A;  1AKC A;  3ELE A;  3QM2 A;  4N0B A;  1AHF A;  1AHX A;  2R0T A;  4LW4 A;  5FT5 A;  1SZK A;  4ADC A;  3FZ7 A;  4P7Y A;  1MLY A;  2Z61 A;  2DGM A;  3B1C A;  3FD0 A;  4WB0 A;  4W8I A;  3RUY A;  4F5H A;  1ASB A;  1JG8 A;  1C7N A;  5EUE A;  1DKA A;  1EJI A;  1TOE A;  3AEL A;  1AY4 A;  3NYT A;  5G2Q A;  1V2D A;  2BI1 A;  1LK9 A;  2Z9X A;  3I16 A;  5EUD A;  5AX8 A;  2CJD A;  5EQC A;  3FDD A;  4O6Z A;  1WYT B;  3MAF B;  4J5U A;  1CZE A;  3CBF A;  4UOY A;  2KFP A;  4UHM A;  2BWN A;  3LVL B;  2R2N A;  3LVJ A;  1EG5 A;  4MSO A;  1RVY A;  2VIA A;  1J32 A;  4OBU A;  2VGS A;  3JZL A;  3E2Z B;  4W5K A;  2ZY2 A;  5DJ9 A;  3FQA A;  2C7T A;  1QZ9 A;  3AEM C;  4XEW A;  3Q8N A;  1O61 A;  2BIE A;  1PMM A;  1T3I A;  4EU1 A;  2Z67 A;  4MKJ A;  4OTL A;  4ZLV A;  2W7K A;  4ZWV A;  1CL1 A;  3B1E A;  5TF5 A;  2W7I A;  3R4T A;  1ARH A;  2VMZ A;  4M2K A;  1LW5 A;  2ZSM A;  2CH2 A;  3N4X A;  1ASD A;  4CXQ A;  2Z9U A;  3LWS A;  4AH3 A;  3DU4 A;  2BI2 A;  4IY7 A;  2W7E A;  3BB8 A;  3JWA A;  1LS3 A;  2CY8 A;  4RJY A;  1KL2 A;  2AY1 A;  2YCT A;  4XJM A;  3M5U A;  2CAN A;  3FQ7 A;  4OBV A;  2D61 A;  4PFN A;  4FFC A;  2OKK A;  3H9X A;  4DBC A;  2ZY4 A;  2JJF A;  3WGB A;  4EFF A;  3DXV A;  4GE4 A;  1S0A A;  3L44 A;  1U08 A;  5M4B A;  3RI6 A;  2WK9 A;  1AKB A;  5EUN A;  3PD6 B;  4AZJ A;  4OMA A;  1DFO A;  1C7O A;  1FG3 A;  2OQX A;  3PDB A;  3MC6 C;  5E5I A;  2JG2 A;  2VGT A;  4A0H A;  2W7F A;  3OKS A;  2AEV A;  4XQ2 A;  3NRA A;  1X28 A;  3BCX A;  3DXW A;  3UE8 A;  2O1B A;  2BIG A;  1JF9 A;  1OXP A;  3OP7 A;  1AX4 A;  4R8D A;  1BJW A;  4ZAH A;  4MQR A;  1W7L A;  3R9A A;  3FCR A;  3TQX A;  3TFU A;  1QIR A;  3IHJ A;  3FQ8 A;  3H7F A;  4BQ0 A;  4EB7 A;  1AHE A;  2EZ2 A;  2PB0 A;  1BKG A;  4Q31 A;  3AV7 A;  3ISL A;  1D7U A;  3LVM A;  2EGY A;  3E6G A;  1AHY A;  4AOA A;  3FDB A;  1AY8 A;  1AJS A;  3WZF A;  2VMW A;  1I43 A;  1ASG A;  3DC1 A;  4FL0 A;  4R5Z A;  4ZM4 A;  4JE5 A;  1I41 A;  1WYU A;  3ECD A;  4RIT A;  3VK3 A;  4IX8 A;  3LY1 A;  4IXO A;  1AIA A;  4RJ0 A;  4CVQ A;  1TAS A;  3BN1 A;  4AO4 A;  4ZWM A;  4ZDO A;  3QHX A;  2JIS A;  4ZAS A;  1QJ3 A;  2QLR A;  3VOM A;  3E77 A;  3FFR A;  3EI7 A;  2D64 A;  2OAT A;  2ZSL A;  3DR7 A;  1CL2 A;  4A6T A;  2GSA A;  4ITX A;  3PGY A;  1B9H A;  1FG7 A;  1LC7 A;  3I4J A;  2VMO A;  3BWO A;  1BJO B;  3GZD A;  3EI5 A;  4F5G A;  2ORD A;  1ZOD A;  3BV0 A;  1G4V A;  2G7J A;  1LC5 A;  4W1W A;  1AIC A;  1AMR A;  2FNU A;  2AY6 A;  5M46 A;  1GC2 A;  1WYV B;  1M4N A;  2W7H A;  1V2F A;  3FVS A;  1WYT A;  1PMO A;  3MAF A;  4ADD A;  2X5F A;  4F5M A;  4MGR A;  3CQ6 A;  5FT4 A;  3HQT A;  3AEJ A;  4WYF A;  4ADE A;  3QGU A;  1X0M A;  4WBT A;  2AY7 A;  2ZY3 A;  3F0H A;  1M0P A;  3E2Z A;  3PAA A;  1IX8 A;  3A9X A;  1QGN A;  1W3U A;  2HP1 A;  4N0W A;  1MDO A;  3B8X A;  1VP4 A;  3HT4 A;  5LHA A;  2YRI A;  3E2F A;  1EQB A;  4U1T A;  2EYQ A;  1I29 A;  1ZC9 A;  3HL2 A;  4LW2 A;  2E54 A;  4K2I A;  4KYO A;  1B8G A;  1AMS A;  1GEW A;  1IAX A;  1LKC A;  3NDN A;  2HOR A;  4ISY A;  4JEZ A;  5E3K A;  3BS8 A;  1AHG A;  4RLG A;  3KE3 A;  4WLJ A;  1G7X A;  4LNJ A;  4ZM3 A;  1BW0 A;  1N8P A;  1CJ0 A;  2BYL A;  4W1X A;  4A6U A;  1UU2 A;  2VMQ A;  5IWQ A;  1M6S A;  2HOX A;  3GSB A;  2D7Y A;  1ASM A;  1ASE A;  1D7V A;  2NMP A;  4ZSW A;  4LNL A;  3TAT A;  1OHW A;  5FT6 A;  3AOW A;  1GEX A;  1Z7D A;  3QBO A;  3BC8 A;  3BCA A;  3CQ5 A;  3HLM A;  3ASB A;  2GQN A;  5EIG B;  2YKU A;  4GSA A;  4JE5 D;  3JWB A;  4F5L A;  5G0A A;  2VIB A;  3HVY A;  2AY2 A;  2VYC A;  3RCH B;  2R5C B;  2W7J A;  2YHK A;  1SPA A;  2WB6 A;  3LVK A;  3K40 A;  4DGT A;  3HMU A;  3PD6 A;  3K7Y A;  2GB3 A;  1BQD A;  3FZ6 A;  1RV3 A;  2HZP A;  3G0T A;  4WLH A;  4NOG A;  3PIU A;  2QMA A;  4MQP A;  4P3M A;  2ZP7 A;  4MKK A;  4TMR A;  2HUU A;  3B1D A;  2ZY5 A;  3NU8 A;  5KTB A;  5M49 A;  1Y4I A;  1S08 A;  4IYO B;  4A72 A;  5K8B A;  3N7N A;  4PFF A;  3PA9 A;  1ASA A;  1BJN A;  2TPL A;  2VMR A;  4HVK A;  3EZ1 A;  4OC9 A;  4WB0 B;  1QJ5 A;  4R2N A;  3AEM A;  1QIS A;  3GJU A;  4IW7 A;  2QSR A;  1ASN A;  3AEO A;  1IAY A;  1KMJ A;  4WXB A;  3WGC A;  4E77 A;  3E9K A;  5I92 A;  2YCN A;  3FSL A;  4H63 Q;  1D2F A;  1M0Q A;  3P6K A;  4GEB A;  2JGT A;  1SF2 A;  3WX9 A;  2HOZ A;  4W91 A;  4JEX A;  1J04 A;  1SZS A;  3CAI A;  4JF1 A;  2QA3 A;  1TAT A;  3WLX A;  3QN6 A;  4R5F A;  2BHX A;  1GBN A;  3ZZK A;  4B9B A;  1SFF A;  2CB1 A;  3DYD A;  3MAU A;  2BKW A;  4L0O A;  3GZC A;  3GWP A;  2JJE A;  1M7Y A;  1IBJ A;  3DR4 A;  1X2A A;  2BWO A;  3A9Y A;  3TFT A;  2PO3 A;  1S07 A;  2Z9V A;  1AJR A;  2GMU A;  2DGL A;  1X29 A;  4U2H A;  3BWN C;  1ZOB A;  2W8J A;  3UAK A;  2E7I A;  3N4R A;  2Z9W A;  1V2E A;  3ACZ A;  4F5J A;  2VGZ A;  1OHV A;  3G8M A;  1DJE A;  3UWC A;  2V0Y A;  3MC6 A;  1C0N A;  5LH9 A;  1UU1 A;  2VMP A;  1UU0 A;  3N0L A;  4HF8 A;  4IXZ A;  3EI8 A;  1IJI A;  4RKC A;  4WYC A;  4A0G A;  2ZUK A;  4WD2 A;  3B46 A;  4TN4 A;  1S06 A;  3NU7 A;  5DJ1 A;  1ASF A;  3NYS A;  4JEV A;  4Y0H A;  4BA5 A;  2BIA A;  3BCB A;  3W1J A;  1RVU A;  2QB2 A;  2ZC0 A;  4ITG A;  7AAT A;  2YKX A;  3LV2 A;  1MAQ A;  1JS6 A;  2DOU A;  2C44 A;  4CXR A;  2F8J A;  1I48 A;  3TCM A;  1ECX A;  3ZRQ A;  3EZS A;  4Y0D A;  3FVX A;  2G6W A;  3PDB B;  1VJO A;  5G4I A;  3PDX A;  4GE9 A;  1O4S A;  5C6U A;  1G7W A;  3E2Y A;  2FYF A;  1ELQ A;  4TV7 A;  4WYD A;  5HDM A;  2FM1 A;  1ARG A;  4A00 A;  2CFB A;  3KGW A;  2YRR A;  4WYA A;  4ZSY A;  4OCA A;  2VMV A;  3USF A;  4ATP A;  1O62 A;  2WK7 A;  3DRD A;  5J8Q A;  1WKG A;  1OHY A;  1GCK A;  1E5F A;  2JJH A;  1DTY A;  1W7M A;  3RBF A;  2VI9 A;  3MEB A;  3EI9 A;  1IUG A;  2BI3 A;  1DJU A;  3CQ4 A;  3VAX A;  5EIG A;  3ASA A;  1AY5 A;  3NTJ A;  4EB5 A;  1M0N A;  3AOV A;  3JU7 A;  3RCH A;  1AAW A;  1AJS B;  4UHO A;  4A6R A;  1C9C A;  3MKJ A;  1MDX A;  5DB5 A;  1C4K A;  5FT8 A;  2HUI A;  2QBT A;  2EZ1 A;  2HP2 A;  4XJP A;  2EO5 A;  4B98 A;  4RAE A;  2Z20 A;  3N5M A;  3T32 A;  3LG0 A;  4PVF A;  2VI8 A;  2BI9 A;  1AIB A;  2VLH A;  4ZDL A;  1YOO A;  3JW9 A;  4IYO A;  2VMY A;  2VLF A;  2CJH A;  3FRK A;  1Z3Z A;  3NNK A;  3RBL A;  3VK2 A;  3PPL A;  2AY8 A;  2JJG A;  2OKJ A;  4Q6R A;  4DQ6 A;  1BQA A;  1YIZ A;  2YKV A;  4WYE A;  5HHY A;  1TPL A;  2VMN A;  2X5D A;  3GR9 A;  4Q76 A;  2BWP A;  1MDZ A;  2W8V A;  1GEY A;  2W8W A;  1IX7 A;  1N31 A;  2FN6 A;  2Q7W A;  3VK4 A;  2VGW A;  2AY9 A;  1ASL A;  4RIZ A;  2VMX A;  5G4J A;  4K05 A;  3AEN B;  1M0O A;  1LW4 A;  1AMA A;  2VMT A; 
#chains in the Genus database with same CATH homology
 2AY3 A;  1SZU A;  3HBX A;  3FVU A;  3EI6 A;  3N75 A;  3A2B A;  3NUB A;  1JS3 A;  1WST A;  1V72 A;  2W8T A;  2CST A;  3DZZ A;  4WYG A;  1PFF A;  4E3R A;  2W7L A;  4WP0 A;  3ZRP A;  4KXK A;  5JAY A;  3WCO A;  1AKA A;  3F6T A;  1PG8 A;  2EPJ A;  3PJ0 A;  4OYT A;  4XJL A;  2W8U A;  1CS1 A;  3FTB A;  1H1C A;  2YKY A;  1KKP A;  3NYU A;  4M2M A;  9AAT A;  3D6K A;  4XK1 A;  2Z1Y A;  5EAA A;  2WK8 A;  2BYJ A;  4KAM A;  4Y0I A;  3WKS A;  1YJS A;  1CQ6 A;  2CH1 A;  4JEW A;  1E5E A;  1P3W A;  1ELU A;  2PB2 A;  3I5T A;  3ZRR A;  4A0R A;  3AEP A;  2VGU A;  3NX3 A;  3GBX A;  1D7R A;  1YIY A;  1ARI A;  1OXO A;  1M32 A;  1B4X A;  2V1P A;  3ATH A;  1MAP A;  3EIA A;  3EUC A;  4ATQ A;  4MY5 A;  1YNU A;  1ART A;  2AY5 A;  4JF0 A;  5EAV A;  4Q75 A;  2OGE A;  4JEY A;  1GD9 A;  1ORD A;  5EFS A;  3N4S A;  8AAT A;  1YAA A;  1KL1 A;  4BMK A;  3A8U X;  3NUI A;  2DGK A;  4WXF A;  2HUF A;  4UQV A;  1MLZ A;  4I8A A;  5E4Z A;  1VEF A;  2XH1 A;  4CBR A;  1BJO A;  4XAU A;  1G4X A;  2OGA A;  1YJY A;  4MQQ A;  3WY7 A;  4F4E A;  1GC4 A;  2O0R A;  3KKI A;  3FKD A;  4GRX A;  2CJG A;  5G09 A;  4BA4 A;  4AZK A;  4RM1 A;  1LC8 A;  1CZC A;  5BJ4 A;  1B5O A;  2CTZ A;  3W1H A;  4OT8 A;  1DGE A;  4CBS A;  1WYV A;  3RQ1 A;  2ZYJ A;  1W7N A;  1GC0 A;  1GC3 A;  1FC4 A;  4ADB A;  3QI6 A;  4F5I A;  2XBN A;  4K2B A;  1SVV A;  1KKJ A;  1UKJ A;  5DX5 A;  1B5P A;  1MGV A;  2D65 A;  2RFV A;  3A9Z A;  4QGR A;  4AO9 A;  1XEY A;  4RKD A;  3JTX A;  3P1T A;  2BI5 A;  2X8U A;  2FKI A;  2DKJ A;  3MAD A;  1YJZ A;  3GZD C;  3MBB A;  1TOG A;  4H51 A;  2W7M A;  1QIT A;  4F5K A;  5F9S A;  1IVR A;  2A1V A;  4F5F A;  1DJ9 A;  5D95 A;  3G7Q A;  2FNI A;  2D5Y A;  2Z1Z A;  1AAM A;  2DKB A;  3HDO A;  3II0 A;  1AMQ A;  2C0R A;  2O7C A;  4W1V A;  4IXS A;  3GET A;  1S09 A;  2ZJG A;  3BWN A;  3DOD A;  1ARS A;  1KMK A;  1WKH A;  3COG A;  2AAT A;  2D63 A;  3ELP A;  4UHN A;  5G2P A;  2VGV A;  3AEJ C;  2YOB A;  4BHD A;  3IF2 A;  2D66 A;  3KGX A;  1GDE A;  3EIB A;  2W7D A;  1DGD A;  1RV4 A;  1TOI A;  4XJO A;  4LC3 A;  4A0F A;  2DR1 A;  2VMS A;  1ASC A;  1XI9 A;  3VP6 A;  2HOY A;  5HXX A;  5BJ3 A;  3H14 A;  1CQ7 A;  5M4D A;  2E7J A;  1BS0 A;  1O69 A;  1C7G A;  4J8L A;  1OAT A;  2R5E A;  1BT4 A;  1W23 A;  3FZ8 A;  1CQ8 A;  1B9I A;  1TOK A;  4GDY A;  2VMU A;  2X3L A;  3WKR A;  3QPG A;  2CIN A;  1BJ4 A;  4WXG A;  3W1I A;  3WCN A;  2W7G A;  4K2M A;  2QB3 A;  3K28 A;  2R5C A;  3AAT A;  1TAR A;  2C81 A;  2AY4 A;  3FFH A;  1N2T A;  2FQ6 A;  3F9T A;  1WYU B;  5D5S A;  1TOJ A;  4PIW A;  4E1O A;  3AEN A;  4EMY A;  4M2J A;  5F8V A;  2AEU A;  2EH6 A;  1IX6 A;  2GMS A;  3L8A A;  2E7U A;  4GE7 A;  4ZDP A;  2WKA A;  4E3Q A;  4LNM A;  2YCP A;  1D7S A;  3ZZJ A;  1H0C A;  2D7Z A;  1AKC A;  3ELE A;  3QM2 A;  4N0B A;  1AHF A;  1AHX A;  2R0T A;  4LW4 A;  5FT5 A;  1SZK A;  4ADC A;  3FZ7 A;  4P7Y A;  1MLY A;  2Z61 A;  2DGM A;  3B1C A;  3FD0 A;  4WB0 A;  4W8I A;  3RUY A;  4F5H A;  1ASB A;  1JG8 A;  1C7N A;  5EUE A;  1DKA A;  1EJI A;  1TOE A;  3AEL A;  1AY4 A;  3NYT A;  5G2Q A;  1V2D A;  2BI1 A;  1LK9 A;  2Z9X A;  3I16 A;  5EUD A;  5AX8 A;  2CJD A;  5EQC A;  3FDD A;  4O6Z A;  1WYT B;  3MAF B;  4J5U A;  1CZE A;  3CBF A;  4UOY A;  2KFP A;  4UHM A;  2BWN A;  3LVL B;  2R2N A;  3LVJ A;  1EG5 A;  4MSO A;  1RVY A;  2VIA A;  1J32 A;  4OBU A;  2VGS A;  3JZL A;  3E2Z B;  4W5K A;  2ZY2 A;  5DJ9 A;  3FQA A;  2C7T A;  1QZ9 A;  3AEM C;  4XEW A;  3Q8N A;  1O61 A;  2BIE A;  1PMM A;  1T3I A;  4EU1 A;  2Z67 A;  4MKJ A;  4OTL A;  4ZLV A;  2W7K A;  4ZWV A;  1CL1 A;  3B1E A;  5TF5 A;  2W7I A;  3R4T A;  1ARH A;  2VMZ A;  4M2K A;  1LW5 A;  2ZSM A;  2CH2 A;  3N4X A;  1ASD A;  4CXQ A;  2Z9U A;  3LWS A;  4AH3 A;  3DU4 A;  2BI2 A;  4IY7 A;  2W7E A;  3BB8 A;  3JWA A;  1LS3 A;  2CY8 A;  4RJY A;  1KL2 A;  2AY1 A;  2YCT A;  4XJM A;  3M5U A;  2CAN A;  3FQ7 A;  4OBV A;  2D61 A;  4PFN A;  4FFC A;  2OKK A;  3H9X A;  4DBC A;  2ZY4 A;  2JJF A;  3WGB A;  4EFF A;  3DXV A;  4GE4 A;  1S0A A;  3L44 A;  1U08 A;  5M4B A;  3RI6 A;  2WK9 A;  1AKB A;  5EUN A;  3PD6 B;  4AZJ A;  4OMA A;  1DFO A;  1C7O A;  1FG3 A;  2OQX A;  3PDB A;  3MC6 C;  5E5I A;  2JG2 A;  2VGT A;  4A0H A;  2W7F A;  3OKS A;  2AEV A;  4XQ2 A;  3NRA A;  1X28 A;  3BCX A;  3DXW A;  3UE8 A;  2O1B A;  2BIG A;  1JF9 A;  1OXP A;  3OP7 A;  1AX4 A;  4R8D A;  1BJW A;  4ZAH A;  4MQR A;  1W7L A;  3R9A A;  3FCR A;  3TQX A;  3TFU A;  1QIR A;  3IHJ A;  3FQ8 A;  3H7F A;  4BQ0 A;  4EB7 A;  1AHE A;  2EZ2 A;  2PB0 A;  1BKG A;  4Q31 A;  3AV7 A;  3ISL A;  1D7U A;  3LVM A;  2EGY A;  3E6G A;  1AHY A;  4AOA A;  3FDB A;  1AY8 A;  1AJS A;  3WZF A;  2VMW A;  1I43 A;  1ASG A;  3DC1 A;  4FL0 A;  4R5Z A;  4ZM4 A;  4JE5 A;  1I41 A;  1WYU A;  3ECD A;  4RIT A;  3VK3 A;  4IX8 A;  3LY1 A;  4IXO A;  1AIA A;  4RJ0 A;  4CVQ A;  1TAS A;  3BN1 A;  4AO4 A;  4ZWM A;  4ZDO A;  3QHX A;  2JIS A;  4ZAS A;  1QJ3 A;  2QLR A;  3VOM A;  3E77 A;  3FFR A;  3EI7 A;  2D64 A;  2OAT A;  2ZSL A;  3DR7 A;  1CL2 A;  4A6T A;  2GSA A;  4ITX A;  3PGY A;  1B9H A;  1FG7 A;  1LC7 A;  3I4J A;  2VMO A;  3BWO A;  1BJO B;  3GZD A;  3EI5 A;  4F5G A;  2ORD A;  1ZOD A;  3BV0 A;  1G4V A;  2G7J A;  1LC5 A;  4W1W A;  1AIC A;  1AMR A;  2FNU A;  2AY6 A;  5M46 A;  1GC2 A;  1WYV B;  1M4N A;  2W7H A;  1V2F A;  3FVS A;  1WYT A;  1PMO A;  3MAF A;  4ADD A;  2X5F A;  4F5M A;  4MGR A;  3CQ6 A;  5FT4 A;  3HQT A;  3AEJ A;  4WYF A;  4ADE A;  3QGU A;  1X0M A;  4WBT A;  2AY7 A;  2ZY3 A;  3F0H A;  1M0P A;  3E2Z A;  3PAA A;  1IX8 A;  3A9X A;  1QGN A;  1W3U A;  2HP1 A;  4N0W A;  1MDO A;  3B8X A;  1VP4 A;  3HT4 A;  5LHA A;  2YRI A;  3E2F A;  1EQB A;  4U1T A;  2EYQ A;  1I29 A;  1ZC9 A;  3HL2 A;  4LW2 A;  2E54 A;  4K2I A;  4KYO A;  1B8G A;  1AMS A;  1GEW A;  1IAX A;  1LKC A;  3NDN A;  2HOR A;  4ISY A;  4JEZ A;  5E3K A;  3BS8 A;  1AHG A;  4RLG A;  3KE3 A;  4WLJ A;  1G7X A;  4LNJ A;  4ZM3 A;  1BW0 A;  1N8P A;  1CJ0 A;  2BYL A;  4W1X A;  4A6U A;  1UU2 A;  2VMQ A;  5IWQ A;  1M6S A;  2HOX A;  3GSB A;  2D7Y A;  1ASM A;  1ASE A;  1D7V A;  2NMP A;  4ZSW A;  4LNL A;  3TAT A;  1OHW A;  5FT6 A;  3AOW A;  1GEX A;  1Z7D A;  3QBO A;  3BC8 A;  3BCA A;  3CQ5 A;  3HLM A;  3ASB A;  2GQN A;  5EIG B;  2YKU A;  4GSA A;  4JE5 D;  3JWB A;  4F5L A;  5G0A A;  2VIB A;  3HVY A;  2AY2 A;  2VYC A;  3RCH B;  2R5C B;  2W7J A;  2YHK A;  1SPA A;  2WB6 A;  3LVK A;  3K40 A;  4DGT A;  3HMU A;  3PD6 A;  3K7Y A;  2GB3 A;  1BQD A;  3FZ6 A;  1RV3 A;  2HZP A;  3G0T A;  4WLH A;  4NOG A;  3PIU A;  2QMA A;  4MQP A;  4P3M A;  2ZP7 A;  4MKK A;  4TMR A;  2HUU A;  3B1D A;  2ZY5 A;  3NU8 A;  5KTB A;  5M49 A;  1Y4I A;  1S08 A;  4IYO B;  4A72 A;  5K8B A;  3N7N A;  4PFF A;  3PA9 A;  1ASA A;  1BJN A;  2TPL A;  2VMR A;  4HVK A;  3EZ1 A;  4OC9 A;  4WB0 B;  1QJ5 A;  4R2N A;  3AEM A;  1QIS A;  3GJU A;  4IW7 A;  2QSR A;  1ASN A;  3AEO A;  1IAY A;  1KMJ A;  4WXB A;  3WGC A;  4E77 A;  3E9K A;  5I92 A;  2YCN A;  3FSL A;  4H63 Q;  1D2F A;  1M0Q A;  3P6K A;  4GEB A;  2JGT A;  1SF2 A;  3WX9 A;  2HOZ A;  4W91 A;  4JEX A;  1J04 A;  1SZS A;  3CAI A;  4JF1 A;  2QA3 A;  1TAT A;  3WLX A;  3QN6 A;  4R5F A;  2BHX A;  1GBN A;  3ZZK A;  4B9B A;  1SFF A;  2CB1 A;  3DYD A;  3MAU A;  2BKW A;  4L0O A;  3GZC A;  3GWP A;  2JJE A;  1M7Y A;  1IBJ A;  3DR4 A;  1X2A A;  2BWO A;  3A9Y A;  3TFT A;  2PO3 A;  1S07 A;  2Z9V A;  1AJR A;  2GMU A;  2DGL A;  1X29 A;  4U2H A;  3BWN C;  1ZOB A;  2W8J A;  3UAK A;  2E7I A;  3N4R A;  2Z9W A;  1V2E A;  3ACZ A;  4F5J A;  2VGZ A;  1OHV A;  3G8M A;  1DJE A;  3UWC A;  2V0Y A;  3MC6 A;  1C0N A;  5LH9 A;  1UU1 A;  2VMP A;  1UU0 A;  3N0L A;  4HF8 A;  4IXZ A;  3EI8 A;  1IJI A;  4RKC A;  4WYC A;  4A0G A;  2ZUK A;  4WD2 A;  3B46 A;  4TN4 A;  1S06 A;  3NU7 A;  5DJ1 A;  1ASF A;  3NYS A;  4JEV A;  4Y0H A;  4BA5 A;  2BIA A;  3BCB A;  3W1J A;  1RVU A;  2QB2 A;  2ZC0 A;  4ITG A;  7AAT A;  2YKX A;  3LV2 A;  1MAQ A;  1JS6 A;  2DOU A;  2C44 A;  4CXR A;  2F8J A;  1I48 A;  3TCM A;  1ECX A;  3ZRQ A;  3EZS A;  4Y0D A;  3FVX A;  2G6W A;  3PDB B;  1VJO A;  5G4I A;  3PDX A;  4GE9 A;  1O4S A;  5C6U A;  1G7W A;  3E2Y A;  2FYF A;  1ELQ A;  4TV7 A;  4WYD A;  5HDM A;  2FM1 A;  1ARG A;  4A00 A;  2CFB A;  3KGW A;  2YRR A;  4WYA A;  4ZSY A;  4OCA A;  2VMV A;  3USF A;  4ATP A;  1O62 A;  2WK7 A;  3DRD A;  5J8Q A;  1WKG A;  1OHY A;  1GCK A;  1E5F A;  2JJH A;  1DTY A;  1W7M A;  3RBF A;  2VI9 A;  3MEB A;  3EI9 A;  1IUG A;  2BI3 A;  1DJU A;  3CQ4 A;  3VAX A;  5EIG A;  3ASA A;  1AY5 A;  3NTJ A;  4EB5 A;  1M0N A;  3AOV A;  3JU7 A;  3RCH A;  1AAW A;  1AJS B;  4UHO A;  4A6R A;  1C9C A;  3MKJ A;  1MDX A;  5DB5 A;  1C4K A;  5FT8 A;  2HUI A;  2QBT A;  2EZ1 A;  2HP2 A;  4XJP A;  2EO5 A;  4B98 A;  4RAE A;  2Z20 A;  3N5M A;  3T32 A;  3LG0 A;  4PVF A;  2VI8 A;  2BI9 A;  1AIB A;  2VLH A;  4ZDL A;  1YOO A;  3JW9 A;  4IYO A;  2VMY A;  2VLF A;  2CJH A;  3FRK A;  1Z3Z A;  3NNK A;  3RBL A;  3VK2 A;  3PPL A;  2AY8 A;  2JJG A;  2OKJ A;  4Q6R A;  4DQ6 A;  1BQA A;  1YIZ A;  2YKV A;  4WYE A;  5HHY A;  1TPL A;  2VMN A;  2X5D A;  3GR9 A;  4Q76 A;  2BWP A;  1MDZ A;  2W8V A;  1GEY A;  2W8W A;  1IX7 A;  1N31 A;  2FN6 A;  2Q7W A;  3VK4 A;  2VGW A;  2AY9 A;  1ASL A;  4RIZ A;  2VMX A;  5G4J A;  4K05 A;  3AEN B;  1M0O A;  1LW4 A;  1AMA A;  2VMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...