3PAAA

Mechanism of inactivation of e. coli aspartate aminotransferase by (s)-4-amino-4,5-dihydro-2-furancarboxylic acid (s-adfa) ph 8.0
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
395
structure length
395
Chain Sequence
b'FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Mechanism of inactivation of Escherichia coli aspartate aminotransferase by (S)-4-amino-4,5-dihydro-2-furancarboxylic acid .
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 151
structure length 395
sequence length 395
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3paaA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3paaA01
1H0CA 3QGUA 1U08A 4Y0IA 4RJ0A 1QIRA 4WXFA 3QHXA 3WCOA 4RKCA 3GSBA 3HMUA 1V72A 1WYTB 1ASNA 2AY2A 4E3RA 5EAVA 1YNUA 3ACZA 3TCMA 1S0AA 1D7SA 1ELUA 2VGSA 2Z61A 4A0RA 2VMNA 3DR4A 2VMTA 2O1BA 4CXQA 1M7YA 2AY6A 2FQ6A 2YRRA 2DGLA 4IX8A 1IBJA 4LW4A 4RJYA 5EIGA 1GC3A 1PFFA 1CQ7A 2VMZA 1ARGA 5JAYA 4GEBA 5FT4A 4ADCA 4F5LA 2XBNA 3BCBA 4M2MA 4DBCA 2Z9VA 4KAMA 4EFFA 4WYEA 1IX6A 1T3IA 2CSTA 3RQ1A 4Y0DA 3FCRA 3A9ZA 4N0WA 2CY8A 2YOBA 2R5CB 4IYOB 3E2ZB 2Z67A 3R9AA 4ATQA 3UE8A 1XI9A 1UU2A 1V2EA 5LH9A 4OT8A 4ATPA 1ARIA 4ZDLA 5EFSA 2AATA 1B8GA 4N0BA 1J04A 2QB2A 3PD6A 5D95A 4AO9A 5DJ9A 3NUIA 3PDBA 3NU8A 1MAQA 3HVYA 1G4VA 3LVKA 4OYTA 4K2MA 4K2IA 2VIBA 1SF2A 3MC6A 3ELEA 2JJHA 1M32A 4OBVA 5E3KA 3RCHB 4TV7A 5DB5A 1G7XA 1I41A 1W7MA 3B1CA 5DJ1A 3WLXA 1VP4A 1ASBA 1WYUA 2BI2A 2D7ZA 2VGUA 2DGMA 3EIAA 3NYSA 3W1IA 4WXGA 4DGTA 2W8WA 2C81A 3AEMA 5K8BA 4LNMA 3VK4A 3KGXA 2CINA 3MKJA 2HORA 1O4SA 3HL2A 1LW5A 3BCAA 4M2JA 4ZWMA 3VK2A 1M0NA 1JS6A 4WBTA 3ZRQA 2PB2A 1MDOA 3H14A 4WLJA 1KMJA 1FG7A 3WGBA 2X5FA 4XJPA 2E7UA 2HP2A 1ARSA 1AMAA 4JEVA 2W7FA 3L8AA 1YJYA 3DZZA 5EAAA 3D6KA 1D7RA 1JF9A 4IY7A 1LKCA 2GQNA 4EB7A 1ASCA 2BI9A 2QB3A 4WP0A 3FZ6A 3B1EA 2QA3A 3NYUA 4MKKA 4MQPA 2JISA 4KYOA 2AY1A 2AEUA 1S06A 2ORDA 1ZOBA 2Z9WA 2VMWA 1X0MA 3JWBA 1C7OA 2E7IA 2DKBA 1AIAA 5TF5A 1CQ8A 3AENA 2QMAA 4P3MA 1TOKA 1V2DA 4WB0B 3LVJA 1VEFA 1DKAA 2VMOA 4PFNA 3WGCA 4GE7A 4A0GA 3QPGA 1GD9A 1EG5A 3G0TA 3AOWA 3AEOA 4A6UA 2DKJA 2W7HA 1GEWA 1S07A 4JE5A 1IJIA 5F9SA 2C0RA 3FZ8A 4E3QA 3EZSA 1AICA 2W7MA 4MKJA 2D61A 3RI6A 1CZEA 3JTXA 1AJSB 2HOYA 1B9IA 3FKDA 3EUCA 2VMVA 1ZC9A 3ZZJA 3A9XA 1I48A 1MDZA 4Y0HA 5E4ZA 3DU4A 4EU1A 1AHYA 1M4NA 4RIZA 1ARHA 2G6WA 2CJGA 1I43A 1DFOA 2ZSMA 1AY8A 4UOYA 2JJGA 2X3LA 1OXOA 4LNLA 1RVUA 4R5ZA 1W23A 4XJLA 4ISYA 4WXBA 3TQXA 3GZDC 1AJRA 1GC0A 4B9BA 1BJNA 2VMRA 3AEJA 2ZYJA 4MSOA 4LC3A 4Q76A 4ADBA 2Z9UA 1MAPA 2RFVA 4OMAA 3EZ1A 1AHGA 4F5IA 2FN6A 1OHVA 3I16A 2GSAA 3CQ4A 3B1DA 4AOAA 2EPJA 2EH6A 3G7QA 4XQ2A 2DOUA 2QLRA 1QISA 3HLMA 1YIYA 4W1WA 3HQTA 1H1CA 3HT4A 3L44A 4WYCA 2WK8A 5G4JA 1DJ9A 2EGYA 1BS0A 4R2NA 2ZY3A 4ZWVA 1N8PA 2Z1YA 3MAFA 4GSAA 2Q7WA 3CQ5A 2VI9A 5M49A 2D65A 2JJFA 2PB0A 1GDEA 2OQXA 3I5TA 3N5MA 5EUDA 3TFUA 4F5MA 4ITXA 9AATA 1C0NA 1DGDA 4ADEA 2ZY4A 1BJOB 3FTBA 3FD0A 3A8UX 2VLFA 2Z9XA 4F5HA 1G7WA 4XK1A 3E2YA 3G8MA 1QGNA 3FFHA 3COGA 2HP1A 4W1XA 4BHDA 4GDYA 4ZDPA 3GZCA 3K7YA 4CBRA 2D63A 2VGWA 2E7JA 2PO3A 2HOXA 5G09A 4OCAA 3JWAA 1X29A 1ASEA 5HHYA 1MLZA 2OKJA 2YKYA 2WK7A 1YIZA 2CFBA 3BV0A 2OGEA 2QBTA 4Q75A 3IF2A 2BYJA 3IHJA 1TARA 1SZSA 4JEWA 5EUEA 3WCNA 4Q6RA 2W8JA 4M2KA 3WZFA 4LW2A 2E54A 3ZZKA 2JGTA 2D7YA 1SVVA 1OATA 3B8XA 2ZY5A 5EQCA 2V1PA 3ASBA 3K40A 3PDXA 5M4BA 2VGVA 1D7UA 2R2NA 1C9CA 2HUIA 4L0OA 3AV7A 4J8LA 3W1JA 3LVMA 1ASLA 1BQAA 2W8UA 5D5SA 4GE9A 3BWNC 1AX4A 1CS1A 2CB1A 2VMXA 2YCPA 3CQ6A 4XAUA 1SZKA 2BI1A 4KXKA 2EZ2A 4XJMA 3NYTA 2BI3A 4GRXA 1MGVA 2CJHA 4IXZA 5EIGB 3EI8A 1IX7A 1OXPA 5M46A 4TMRA 3USFA 4U1TA 1LC8A 1AMRA 3DXWA 1P3WA 1AMSA 3JZLA 2VMQA 1AIBA 1Y4IA 3WX9A 2W7JA 4E1OA 2O7CA 3FVSA 4O6ZA 3VK3A 2W7EA 1BQDA 2YCTA 4OBUA 3FZ7A 2YKVA 3F6TA 4RLGA 7AATA 3F0HA 4QGRA 1YOOA 2BHXA 4OTLA 5BJ3A 4W91A 1UU1A 2HUUA 4R8DA 1C7NA 1W3UA 3ECDA 4ZASA 3WY7A 5M4DA 1D2FA 1CQ6A 4HF8A 4K2BA 3EI9A 4CXRA 3PD6B 4F5GA 1N2TA 1ORDA 3PDBB 2AY9A 4BMKA 2ZC0A 1S09A 1BW0A 1YAAA 2FNUA 4WYAA 1OHYA 2DGKA 2OKKA 3ISLA 3N0LA 3NNKA 4A72A 4P7YA 2VIAA 2ZSLA 3E9KA 3N75A 1WYTA 4U2HA 1Z7DA 3QBOA 1WYUB 3FQAA 4ZDOA 1VJOA 2OGAA 1TPLA 5G4IA 1FG3A 3KKIA 2W7LA 4MGRA 1LW4A 3FDDA 3RUYA 3GJUA 1PMOA 4A6RA 1X2AA 1QZ9A 3EI7A 1B5PA 2VMPA 1CL2A 1N31A 1B9HA 1KKPA 2VGTA 2EZ1A 3DODA 1CJ0A 2CJDA 2TPLA 4MQQA 1O69A 2BKWA 5G2PA 1YJSA 2VMUA 4LNJA 2R5CA 1X28A 3TATA 4AH3A 4IYOA 4CVQA 1C4KA 3E2ZA 3NDNA 3E6GA 3NTJA 4H51A 4IXSA 1QJ5A 4XEWA 1GC2A 4JE5D 1EJIA 2YRIA 2HOZA 2GB3A 1SFFA 2BWPA 1PG8A 4UQVA 2R0TA 1WKHA 4WD2A 5E5IA 1I29A 3ELPA 1M6SA 2DR1A 2WK9A 5EUNA 3W1HA 3JW9A 1BJ4A 2D66A 4A00A 1ASFA 3RCHA 4IXOA 2BWNA 3RBLA 1V2FA 3AENB 4MY5A 2WKAA 1AHXA 1O62A 3P6KA 4R5FA 1KL1A 3QM2A 3FRKA 4WLHA 4ZLVA 5HDMA 2YKUA 1AAMA 3LVLB 1TOIA 1O61A 1W7NA 2CANA 3LG0A 4WYFA 4JF1A 1KKJA 5FT8A 2O0RA 5AX8A 1IUGA 2W7KA 5I92A 3RBFA 1CL1A 4JEXA 3LY1A 4ZSYA 5IWQA 1ASAA 2ZJGA 3AATA 4JEYA 4GE4A 1EQBA 5FT6A 3E77A 1B5OA 3CBFA 3FQ7A 4CBSA 3DRDA 2GMUA 1AAWA 3NU7A 3GWPA 3BB8A 4I8AA 2AY8A 1SZUA 5G0AA 3PAAA 4HVKA 3VP6A 2FYFA 4F4EA 1ASDA 3T32A 2VYCA 1DGEA 1DJEA 2NMPA 3AOVA 5BJ4A 3EI5A 3MC6C 1MLYA 4ZSWA 2VMYA 1J32A 3DYDA 1RVYA 3F9TA 1D7VA 3PIUA 1JG8A 5G2QA 1E5EA 4B98A 3PJ0A 4WB0A 2JJEA 1BT4A 1MDXA 2W7DA 1AY4A 3MADA 1RV4A 1QJ3A 1WYVA 4UHOA 2W7IA 4BA4A 2YHKA 5F8VA 2BWOA 3K28A 3HDOA 3AEMC 1YJZA 3B46A 1IVRA 1ELQA 3LV2A 3P1TA 1IX8A 1LC5A 1JS3A 5C6UA 2BIEA 3QI6A 1AJSA 5J8QA 3E2FA 4EMYA 1GEXA 3KE3A 3DC1A 3UAKA 1M0OA 3MAFB 3OP7A 2XH1A 4IW7A 2EO5A 4A0FA 1UKJA 1Z3ZA 3BC8A 1GCKA 1B4XA 2VMSA 3FVXA 4JF0A 4AO4A 3MAUA 3BN1A 1AMQA 2GMSA 3EIBA 1ZODA 2CH1A 4A6TA 3FQ8A 2C44A 2D64A 1ARTA 1W7LA 2YKXA 3FFRA 4W5KA 2HUFA 1TOGA 2VGZA 1LK9A 1AKBA 3BWNA 4RITA 3PPLA 4J5UA 3AELA 3BWOA 4AZJA 2VI8A 4Q31A 2FNIA 3BCXA 4WYDA 4RKDA 3NRAA 4BQ0A 1OHWA 2D5YA 2AY7A 2BI5A 2R5EA 2AEVA 2Z20A 4W8IA 5FT5A 1TOEA 2CTZA 2AY5A 3II0A 1TATA 3TFTA 4PFFA 2FM1A 2ZUKA 3A9YA 4FFCA 4ADDA 4ZM3A 1LC7A 1S08A 3VAXA 3A2BA 3JU7A 3MBBA 2Z1ZA 2HZPA 2ZP7A 3NX3A 1PMMA 3FVUA 3FDBA 3LWSA 3H7FA 3HBXA 2X8UA 1GEYA 1SPAA 3GETA 2W8TA 4FL0A 1BJWA 4UHNA 2CH2A 2OATA 4OC9A 4EB5A 1IAYA 1BJOA 1UU0A 4JEZA 2X5DA 1WYVB 4E77A 4TN4A 3R4TA 1FC4A 2AY3A 1KL2A 3EI6A 4NOGA 1GBNA 2BIAA 4RAEA 2YCNA 4PIWA 3WKRA 3M5UA 3ASAA 2ZY2A 3GR9A 2C7TA 3BS8A 3AEPA 2JG2A 1AHFA 3AEJC 4AZKA 1ECXA 3I4JA 1G4XA 3ZRPA 2W7GA 4MQRA 2AY4A 1AKCA 1IAXA 5LHAA 1AHEA 1RV3A 3QN6A 1KMKA 3FSLA 3PGYA 1AY5A 3CAIA 4F5KA 4WYGA 3VOMA 1DTYA 2V0YA 3Q8NA 1M0QA 1QITA 1M0PA 8AATA 3GZDA 3GBXA 1E5FA 3UWCA 3DR7A 3OKSA 4ZM4A 2BYLA 4BA5A 1CZCA 1WKGA 3NUBA 5DX5A 1ASMA 4F5FA 1WSTA 1BKGA 4ITGA 2BIGA 3PA9A 4W1VA 4XJOA 4DQ6A 1GC4A 3DXVA 4ZAHA 1XEYA 1TOJA 5HXXA 1C7GA 1AKAA 4A0HA 1DJUA 4PVFA 1ASGA 3KGWA 2VLHA 3WKSA 2F8JA 4RM1A 3ZRRA 1LS3A 4F5JA 3MEBA 4UHMA 1TASA 3ATHA 2W8VA
chains in the Genus database with same CATH superfamily
1H0CA 3QGUA 1U08A 4Y0IA 4RJ0A 1QIRA 4WXFA 3QHXA 3WCOA 4RKCA 3GSBA 3HMUA 1V72A 1WYTB 1ASNA 2AY2A 4E3RA 5EAVA 1YNUA 3ACZA 3TCMA 1S0AA 1D7SA 1ELUA 2VGSA 2Z61A 4A0RA 2VMNA 3DR4A 2VMTA 2O1BA 4CXQA 1M7YA 2AY6A 2FQ6A 2YRRA 2DGLA 4IX8A 1IBJA 4LW4A 4RJYA 5EIGA 2FKIA 1GC3A 1PFFA 1CQ7A 2VMZA 1ARGA 5JAYA 4GEBA 5FT4A 4ADCA 4F5LA 2XBNA 3BCBA 4M2MA 4DBCA 2Z9VA 4KAMA 4EFFA 4WYEA 1IX6A 1T3IA 2CSTA 3RQ1A 4Y0DA 3FCRA 3A9ZA 4N0WA 2CY8A 2YOBA 2R5CB 4IYOB 3E2ZB 2Z67A 3R9AA 2G7JA 4ATQA 3UE8A 1XI9A 1UU2A 1V2EA 5LH9A 4OT8A 4ATPA 1ARIA 3N4SA 4ZDLA 5EFSA 2AATA 1B8GA 4N0BA 1J04A 2QB2A 3PD6A 5D95A 4AO9A 5DJ9A 3NUIA 3PDBA 3NU8A 1MAQA 3HVYA 1G4VA 3LVKA 4OYTA 4K2MA 4K2IA 2VIBA 1SF2A 3MC6A 3ELEA 2JJHA 1M32A 4OBVA 5E3KA 3RCHB 4TV7A 5DB5A 1G7XA 1I41A 1W7MA 3B1CA 5DJ1A 3WLXA 1VP4A 1ASBA 1WYUA 2BI2A 2D7ZA 2VGUA 2DGMA 3EIAA 3NYSA 3W1IA 4WXGA 4DGTA 2W8WA 2C81A 3AEMA 5K8BA 4LNMA 3VK4A 3KGXA 2CINA 3MKJA 2HORA 1O4SA 3HL2A 1LW5A 3BCAA 4M2JA 4ZWMA 3VK2A 1M0NA 1JS6A 4WBTA 3ZRQA 2PB2A 1MDOA 3H14A 4WLJA 1KMJA 1FG7A 3WGBA 2X5FA 4XJPA 2E7UA 2HP2A 1ARSA 1AMAA 4JEVA 2W7FA 3L8AA 1YJYA 3DZZA 5EAAA 3D6KA 1D7RA 1JF9A 4IY7A 1LKCA 2GQNA 4EB7A 1ASCA 2BI9A 2QB3A 4WP0A 3FZ6A 3B1EA 3N7NA 2QA3A 3NYUA 4MKKA 4MQPA 2JISA 4KYOA 2AY1A 2AEUA 1S06A 2ORDA 1ZOBA 2Z9WA 2VMWA 1X0MA 3JWBA 1C7OA 2E7IA 2DKBA 1AIAA 5TF5A 1CQ8A 3AENA 2QMAA 4P3MA 1TOKA 1V2DA 4WB0B 3LVJA 1VEFA 1DKAA 2VMOA 4PFNA 3WGCA 4GE7A 4A0GA 3QPGA 1GD9A 1EG5A 3G0TA 3AOWA 3AEOA 4A6UA 2DKJA 2W7HA 1GEWA 1S07A 4JE5A 1IJIA 5F9SA 2C0RA 3FZ8A 4E3QA 3EZSA 1AICA 2W7MA 4MKJA 2D61A 3RI6A 1CZEA 3JTXA 1AJSB 2HOYA 1B9IA 3FKDA 3EUCA 2VMVA 1ZC9A 3ZZJA 3A9XA 1I48A 1MDZA 4Y0HA 5E4ZA 3DU4A 4EU1A 1AHYA 1M4NA 4RIZA 1ARHA 2G6WA 2CJGA 1I43A 1DFOA 2ZSMA 1AY8A 4UOYA 2JJGA 2X3LA 1OXOA 4LNLA 1RVUA 4R5ZA 2WB6A 1W23A 4XJLA 4ISYA 4WXBA 3TQXA 3GZDC 1AJRA 1GC0A 4B9BA 1BJNA 2VMRA 3AEJA 2ZYJA 4MSOA 4H63Q 4LC3A 4Q76A 4ADBA 2EYQA 2Z9UA 1MAPA 2RFVA 4OMAA 3EZ1A 1AHGA 4F5IA 2FN6A 1OHVA 3I16A 2GSAA 3CQ4A 3B1DA 4AOAA 2EPJA 2EH6A 3G7QA 4XQ2A 2DOUA 2QLRA 1QISA 3HLMA 1YIYA 4W1WA 3HQTA 1H1CA 3HT4A 3L44A 4WYCA 2WK8A 5G4JA 1DJ9A 2EGYA 1BS0A 4R2NA 2ZY3A 4ZWVA 1N8PA 2Z1YA 3MAFA 4GSAA 2Q7WA 3CQ5A 2VI9A 5M49A 2D65A 2JJFA 2PB0A 1GDEA 2OQXA 3I5TA 3N5MA 5EUDA 3TFUA 4F5MA 4ITXA 9AATA 1C0NA 1DGDA 4ADEA 2ZY4A 1BJOB 3FTBA 3FD0A 3A8UX 2VLFA 2Z9XA 4F5HA 1G7WA 4XK1A 3E2YA 3G8MA 1QGNA 3FFHA 3COGA 2HP1A 4W1XA 4BHDA 4GDYA 4ZDPA 3GZCA 3K7YA 4CBRA 2D63A 2VGWA 2E7JA 2PO3A 2HOXA 5G09A 4OCAA 3JWAA 1X29A 1ASEA 5HHYA 1MLZA 2OKJA 2YKYA 2WK7A 1YIZA 2CFBA 3BV0A 2OGEA 2A1VA 2QBTA 4Q75A 3IF2A 2QSRA 2BYJA 3IHJA 1TARA 1SZSA 4JEWA 5EUEA 3WCNA 4Q6RA 2W8JA 4M2KA 3WZFA 4LW2A 2E54A 3ZZKA 2JGTA 4K05A 2D7YA 1SVVA 1OATA 3B8XA 2ZY5A 5EQCA 2V1PA 2KFPA 3ASBA 3K40A 3PDXA 5M4BA 2VGVA 1D7UA 2R2NA 1C9CA 2HUIA 4L0OA 3AV7A 4J8LA 3W1JA 3LVMA 1ASLA 1BQAA 2W8UA 5D5SA 4GE9A 3BWNC 1AX4A 1CS1A 2CB1A 2VMXA 2YCPA 3CQ6A 4XAUA 1SZKA 2BI1A 4KXKA 2EZ2A 4XJMA 3NYTA 2BI3A 4GRXA 1MGVA 2CJHA 4IXZA 5EIGB 3EI8A 1IX7A 1OXPA 5M46A 4TMRA 3USFA 4U1TA 1LC8A 1AMRA 3DXWA 1P3WA 1AMSA 3JZLA 3N4RA 2VMQA 1AIBA 1Y4IA 3WX9A 2W7JA 4E1OA 2O7CA 3FVSA 4O6ZA 3VK3A 2W7EA 1BQDA 2YCTA 1KAFA 4OBUA 3FZ7A 2YKVA 3F6TA 4RLGA 7AATA 3F0HA 4QGRA 1YOOA 2BHXA 4OTLA 5BJ3A 4W91A 1UU1A 2HUUA 4R8DA 1C7NA 1W3UA 3ECDA 4ZASA 3WY7A 5M4DA 1D2FA 1CQ6A 4HF8A 4K2BA 3EI9A 4CXRA 3PD6B 4F5GA 1N2TA 1ORDA 3PDBB 2AY9A 4BMKA 2ZC0A 1S09A 1BW0A 1YAAA 2FNUA 4WYAA 1OHYA 2DGKA 2OKKA 3ISLA 3N0LA 3NNKA 4A72A 4P7YA 2VIAA 2ZSLA 3E9KA 3N75A 1WYTA 4U2HA 1Z7DA 3QBOA 1WYUB 3FQAA 4ZDOA 1VJOA 2OGAA 1TPLA 5G4IA 1FG3A 3KKIA 2W7LA 4MGRA 1LW4A 3FDDA 3RUYA 3GJUA 1PMOA 4A6RA 1X2AA 1QZ9A 3EI7A 1B5PA 2VMPA 1CL2A 1N31A 1B9HA 1KKPA 2VGTA 2EZ1A 3DODA 1CJ0A 2CJDA 2TPLA 4MQQA 1O69A 2BKWA 5G2PA 3N4XA 1YJSA 2VMUA 4LNJA 2R5CA 1X28A 3TATA 4AH3A 4IYOA 4CVQA 1C4KA 3E2ZA 3NDNA 3E6GA 3NTJA 4H51A 4IXSA 1QJ5A 4XEWA 1GC2A 4JE5D 1EJIA 2YRIA 2HOZA 2GB3A 1SFFA 2BWPA 1PG8A 4UQVA 2R0TA 1WKHA 4WD2A 5E5IA 1I29A 3ELPA 1M6SA 2DR1A 2WK9A 5EUNA 3W1HA 3JW9A 1BJ4A 2D66A 4A00A 1ASFA 3RCHA 4IXOA 2BWNA 3RBLA 1V2FA 3AENB 4MY5A 2WKAA 1AHXA 1O62A 3P6KA 4R5FA 1KL1A 3QM2A 3FRKA 4WLHA 4ZLVA 5HDMA 2YKUA 1AAMA 3LVLB 1TOIA 1O61A 1W7NA 2CANA 3LG0A 4WYFA 4JF1A 1KKJA 5FT8A 2O0RA 5AX8A 1IUGA 2W7KA 5I92A 3RBFA 1CL1A 4JEXA 3LY1A 4ZSYA 5IWQA 1ASAA 2ZJGA 3AATA 4JEYA 4GE4A 1EQBA 5FT6A 3E77A 1B5OA 3CBFA 3FQ7A 4CBSA 3DRDA 2GMUA 1AAWA 3NU7A 3GWPA 3BB8A 4I8AA 2AY8A 1SZUA 5G0AA 3PAAA 4HVKA 3VP6A 2FYFA 4F4EA 1ASDA 3T32A 2VYCA 1DGEA 1DJEA 2NMPA 3AOVA 5BJ4A 3EI5A 3MC6C 1MLYA 4ZSWA 2VMYA 1J32A 3DYDA 1RVYA 3F9TA 1D7VA 3PIUA 1JG8A 5G2QA 1E5EA 4B98A 3PJ0A 4WB0A 2JJEA 1BT4A 1MDXA 2W7DA 1AY4A 3MADA 1RV4A 1QJ3A 1WYVA 4UHOA 2W7IA 4BA4A 2YHKA 5F8VA 2BWOA 3K28A 3HDOA 3AEMC 1YJZA 3B46A 1IVRA 1ELQA 3LV2A 3P1TA 1IX8A 1LC5A 1JS3A 5C6UA 2BIEA 3QI6A 1AJSA 5J8QA 3E2FA 4EMYA 1GEXA 3KE3A 3DC1A 3UAKA 1M0OA 3MAFB 3OP7A 2XH1A 4IW7A 2EO5A 4A0FA 1UKJA 1Z3ZA 3BC8A 1GCKA 1B4XA 2VMSA 3FVXA 4JF0A 4AO4A 3MAUA 3BN1A 1AMQA 2GMSA 3EIBA 1ZODA 2CH1A 4A6TA 3FQ8A 2C44A 2D64A 1ARTA 1W7LA 2YKXA 3FFRA 4W5KA 2HUFA 1TOGA 2VGZA 1LK9A 1AKBA 3BWNA 4RITA 3PPLA 4J5UA 3AELA 3BWOA 4AZJA 2VI8A 4Q31A 2FNIA 3BCXA 4WYDA 4RKDA 3NRAA 4BQ0A 1OHWA 2D5YA 2AY7A 2BI5A 2R5EA 2AEVA 2Z20A 4W8IA 5FT5A 1TOEA 2CTZA 2AY5A 3II0A 1TATA 3TFTA 4PFFA 2FM1A 2ZUKA 3A9YA 4FFCA 4ADDA 4ZM3A 1LC7A 1S08A 3VAXA 3A2BA 3JU7A 3MBBA 2Z1ZA 2HZPA 2ZP7A 3NX3A 1PMMA 3FVUA 3FDBA 3LWSA 3H7FA 3HBXA 2X8UA 1GEYA 1SPAA 3GETA 2W8TA 4FL0A 1BJWA 4UHNA 2CH2A 2OATA 4OC9A 4EB5A 1IAYA 1BJOA 1UU0A 4JEZA 2X5DA 1WYVB 4E77A 4TN4A 3R4TA 1FC4A 5KTBA 3H9XA 2AY3A 1KL2A 3EI6A 4NOGA 1GBNA 2BIAA 4RAEA 2YCNA 4PIWA 3WKRA 3M5UA 3ASAA 2ZY2A 3GR9A 2C7TA 3BS8A 3AEPA 2JG2A 1AHFA 3AEJC 4AZKA 1ECXA 3I4JA 1G4XA 3ZRPA 2W7GA 4MQRA 2AY4A 1AKCA 1IAXA 5LHAA 1AHEA 1RV3A 3QN6A 1KMKA 3FSLA 3PGYA 1AY5A 3CAIA 4F5KA 4WYGA 3VOMA 1DTYA 2V0YA 3Q8NA 1M0QA 1QITA 1M0PA 8AATA 3GZDA 3GBXA 1E5FA 3UWCA 3DR7A 3OKSA 4ZM4A 2BYLA 4BA5A 1CZCA 1WKGA 3NUBA 5DX5A 1ASMA 4F5FA 1WSTA 1BKGA 4ITGA 2BIGA 3PA9A 4W1VA 4XJOA 4DQ6A 1GC4A 3DXVA 4ZAHA 1XEYA 1TOJA 5HXXA 1C7GA 1AKAA 4A0HA 1DJUA 4PVFA 1ASGA 3KGWA 2VLHA 3WKSA 2F8JA 4RM1A 3ZRRA 1LS3A 4F5JA 3MEBA 4UHMA 1TASA 3ATHA 2W8VA
chains in the Genus database with same CATH topology
1H0CA 3QGUA 1U08A 4Y0IA 4RJ0A 1QIRA 4WXFA 3QHXA 3WCOA 4RKCA 3GSBA 3HMUA 1V72A 1WYTB 1ASNA 2AY2A 4E3RA 5EAVA 1YNUA 3ACZA 3TCMA 1S0AA 1D7SA 1ELUA 2VGSA 2Z61A 4A0RA 2VMNA 3DR4A 2VMTA 2O1BA 4CXQA 1M7YA 2AY6A 2FQ6A 2YRRA 2DGLA 4IX8A 1IBJA 4LW4A 4RJYA 5EIGA 2FKIA 1GC3A 1PFFA 1CQ7A 2VMZA 1ARGA 5JAYA 4GEBA 5FT4A 4ADCA 4F5LA 2XBNA 3BCBA 4M2MA 4DBCA 2Z9VA 4KAMA 4EFFA 4WYEA 1IX6A 1T3IA 2CSTA 3RQ1A 4Y0DA 3FCRA 3A9ZA 4N0WA 2CY8A 2YOBA 2R5CB 4IYOB 3E2ZB 2Z67A 3R9AA 2G7JA 4ATQA 3UE8A 1XI9A 1UU2A 1V2EA 5LH9A 4OT8A 4ATPA 1ARIA 3N4SA 4ZDLA 5EFSA 2AATA 1B8GA 4N0BA 1J04A 2QB2A 3PD6A 5D95A 4AO9A 5DJ9A 3NUIA 3PDBA 3NU8A 1MAQA 3HVYA 1G4VA 3LVKA 4OYTA 4K2MA 4K2IA 2VIBA 1SF2A 3MC6A 3ELEA 2JJHA 1M32A 4OBVA 5E3KA 3RCHB 4TV7A 5DB5A 1G7XA 1I41A 1W7MA 3B1CA 5DJ1A 3WLXA 1VP4A 1ASBA 1WYUA 2BI2A 2D7ZA 2VGUA 2DGMA 3EIAA 3NYSA 3W1IA 4WXGA 4DGTA 2W8WA 2C81A 3AEMA 5K8BA 4LNMA 3VK4A 3KGXA 2CINA 3MKJA 2HORA 1O4SA 3HL2A 1LW5A 3BCAA 4M2JA 4ZWMA 3VK2A 1M0NA 1JS6A 4WBTA 3ZRQA 2PB2A 1MDOA 3H14A 4WLJA 1KMJA 1FG7A 3WGBA 2X5FA 4XJPA 2E7UA 2HP2A 1ARSA 1AMAA 4JEVA 2W7FA 3L8AA 1YJYA 3DZZA 5EAAA 3D6KA 1D7RA 1JF9A 4IY7A 1LKCA 2GQNA 4EB7A 1ASCA 2BI9A 2QB3A 4WP0A 3FZ6A 3B1EA 3N7NA 2QA3A 3NYUA 4MKKA 4MQPA 2JISA 4KYOA 2AY1A 2AEUA 1S06A 2ORDA 1ZOBA 2Z9WA 2VMWA 1X0MA 3JWBA 1C7OA 2E7IA 2DKBA 1AIAA 5TF5A 1CQ8A 3AENA 2QMAA 4P3MA 1TOKA 1V2DA 4WB0B 3LVJA 1VEFA 1DKAA 2VMOA 4PFNA 3WGCA 4GE7A 4A0GA 3QPGA 1GD9A 1EG5A 3G0TA 3AOWA 3AEOA 4A6UA 2DKJA 2W7HA 1GEWA 1S07A 4JE5A 1IJIA 5F9SA 2C0RA 3FZ8A 4E3QA 3EZSA 1AICA 2W7MA 4MKJA 2D61A 3RI6A 1CZEA 3JTXA 1AJSB 2HOYA 1B9IA 3FKDA 3EUCA 2VMVA 1ZC9A 3ZZJA 3A9XA 1I48A 1MDZA 4Y0HA 5E4ZA 3DU4A 4EU1A 1AHYA 1M4NA 4RIZA 1ARHA 2G6WA 2CJGA 1I43A 1DFOA 2ZSMA 1AY8A 4UOYA 2JJGA 2X3LA 1OXOA 4LNLA 1RVUA 4R5ZA 2WB6A 1W23A 4XJLA 4ISYA 4WXBA 3TQXA 3GZDC 1AJRA 1GC0A 4B9BA 1BJNA 2VMRA 3AEJA 2ZYJA 4MSOA 4H63Q 4LC3A 4Q76A 4ADBA 2EYQA 2Z9UA 1MAPA 2RFVA 4OMAA 3EZ1A 1AHGA 4F5IA 2FN6A 1OHVA 3I16A 2GSAA 3CQ4A 3B1DA 4AOAA 2EPJA 2EH6A 3G7QA 4XQ2A 2DOUA 2QLRA 1QISA 3HLMA 1YIYA 4W1WA 3HQTA 1H1CA 3HT4A 3L44A 4WYCA 2WK8A 5G4JA 1DJ9A 2EGYA 1BS0A 4R2NA 2ZY3A 4ZWVA 1N8PA 2Z1YA 3MAFA 4GSAA 2Q7WA 3CQ5A 2VI9A 5M49A 2D65A 2JJFA 2PB0A 1GDEA 2OQXA 3I5TA 3N5MA 5EUDA 3TFUA 4F5MA 4ITXA 9AATA 1C0NA 1DGDA 4ADEA 2ZY4A 1BJOB 3FTBA 3FD0A 3A8UX 2VLFA 2Z9XA 4F5HA 1G7WA 4XK1A 3E2YA 3G8MA 1QGNA 3FFHA 3COGA 2HP1A 4W1XA 4BHDA 4GDYA 4ZDPA 3GZCA 3K7YA 4CBRA 2D63A 2VGWA 2E7JA 2PO3A 2HOXA 5G09A 4OCAA 3JWAA 1X29A 1ASEA 5HHYA 1MLZA 2OKJA 2YKYA 2WK7A 1YIZA 2CFBA 3BV0A 2OGEA 2A1VA 2QBTA 4Q75A 3IF2A 2QSRA 2BYJA 3IHJA 1TARA 1SZSA 4JEWA 5EUEA 3WCNA 4Q6RA 2W8JA 4M2KA 3WZFA 4LW2A 2E54A 3ZZKA 2JGTA 4K05A 2D7YA 1SVVA 1OATA 3B8XA 2ZY5A 5EQCA 2V1PA 2KFPA 3ASBA 3K40A 3PDXA 5M4BA 2VGVA 1D7UA 2R2NA 1C9CA 2HUIA 4L0OA 3AV7A 4J8LA 3W1JA 3LVMA 1ASLA 1BQAA 2W8UA 5D5SA 4GE9A 3BWNC 1AX4A 1CS1A 2CB1A 2VMXA 2YCPA 3CQ6A 4XAUA 1SZKA 2BI1A 4KXKA 2EZ2A 4XJMA 3NYTA 2BI3A 4GRXA 1MGVA 2CJHA 4IXZA 5EIGB 3EI8A 1IX7A 1OXPA 5M46A 4TMRA 3USFA 4U1TA 1LC8A 1AMRA 3DXWA 1P3WA 1AMSA 3JZLA 3N4RA 2VMQA 1AIBA 1Y4IA 3WX9A 2W7JA 4E1OA 2O7CA 3FVSA 4O6ZA 3VK3A 2W7EA 1BQDA 2YCTA 4OBUA 3FZ7A 2YKVA 3F6TA 4RLGA 7AATA 3F0HA 4QGRA 1YOOA 2BHXA 4OTLA 5BJ3A 4W91A 1UU1A 2HUUA 4R8DA 1C7NA 1W3UA 3ECDA 4ZASA 3WY7A 5M4DA 1D2FA 1CQ6A 4HF8A 4K2BA 3EI9A 4CXRA 3PD6B 4F5GA 1N2TA 1ORDA 3PDBB 2AY9A 4BMKA 2ZC0A 1S09A 1BW0A 1YAAA 2FNUA 4WYAA 1OHYA 2DGKA 2OKKA 3ISLA 3N0LA 3NNKA 4A72A 4P7YA 2VIAA 2ZSLA 3E9KA 3N75A 1WYTA 4U2HA 1Z7DA 3QBOA 1WYUB 3FQAA 4ZDOA 1VJOA 2OGAA 1TPLA 5G4IA 1FG3A 3KKIA 2W7LA 4MGRA 1LW4A 3FDDA 3RUYA 3GJUA 1PMOA 4A6RA 1X2AA 1QZ9A 3EI7A 1B5PA 2VMPA 1CL2A 1N31A 1B9HA 1KKPA 2VGTA 2EZ1A 3DODA 1CJ0A 2CJDA 2TPLA 4MQQA 1O69A 2BKWA 5G2PA 3N4XA 1YJSA 2VMUA 4LNJA 2R5CA 1X28A 3TATA 4AH3A 4IYOA 4CVQA 1C4KA 3E2ZA 3NDNA 3E6GA 3NTJA 4H51A 4IXSA 1QJ5A 4XEWA 1GC2A 4JE5D 1EJIA 2YRIA 2HOZA 2GB3A 1SFFA 2BWPA 1PG8A 4UQVA 2R0TA 1WKHA 4WD2A 5E5IA 1I29A 3ELPA 1M6SA 2DR1A 2WK9A 5EUNA 3W1HA 3JW9A 1BJ4A 2D66A 4A00A 1ASFA 3RCHA 4IXOA 2BWNA 3RBLA 1V2FA 3AENB 4MY5A 2WKAA 1AHXA 1O62A 3P6KA 4R5FA 1KL1A 3QM2A 3FRKA 4WLHA 4ZLVA 5HDMA 2YKUA 1AAMA 3LVLB 1TOIA 1O61A 1W7NA 2CANA 3LG0A 4WYFA 4JF1A 1KKJA 5FT8A 2O0RA 5AX8A 1IUGA 2W7KA 5I92A 3RBFA 1CL1A 4JEXA 3LY1A 4ZSYA 5IWQA 1ASAA 2ZJGA 3AATA 4JEYA 4GE4A 1EQBA 5FT6A 3E77A 1B5OA 3CBFA 3FQ7A 4CBSA 3DRDA 2GMUA 1AAWA 3NU7A 3GWPA 3BB8A 4I8AA 2AY8A 1SZUA 5G0AA 3PAAA 4HVKA 3VP6A 2FYFA 4F4EA 1ASDA 3T32A 2VYCA 1DGEA 1DJEA 2NMPA 3AOVA 5BJ4A 3EI5A 3MC6C 1MLYA 4ZSWA 2VMYA 1J32A 3DYDA 1RVYA 3F9TA 1D7VA 3PIUA 1JG8A 5G2QA 1E5EA 4B98A 3PJ0A 4WB0A 2JJEA 1BT4A 1MDXA 2W7DA 1AY4A 3MADA 1RV4A 1QJ3A 1WYVA 4UHOA 2W7IA 4BA4A 2YHKA 5F8VA 2BWOA 3K28A 3HDOA 3AEMC 1YJZA 3B46A 1IVRA 1ELQA 3LV2A 3P1TA 1IX8A 1LC5A 1JS3A 5C6UA 2BIEA 3QI6A 1AJSA 5J8QA 3E2FA 4EMYA 1GEXA 3KE3A 3DC1A 3UAKA 1M0OA 3MAFB 3OP7A 2XH1A 4IW7A 2EO5A 4A0FA 1UKJA 1Z3ZA 3BC8A 1GCKA 1B4XA 2VMSA 3FVXA 4JF0A 4AO4A 3MAUA 3BN1A 1AMQA 2GMSA 3EIBA 1ZODA 2CH1A 4A6TA 3FQ8A 2C44A 2D64A 1ARTA 1W7LA 2YKXA 3FFRA 4W5KA 2HUFA 1TOGA 2VGZA 1LK9A 1AKBA 3BWNA 4RITA 3PPLA 4J5UA 3AELA 3BWOA 4AZJA 2VI8A 4Q31A 2FNIA 3BCXA 4WYDA 4RKDA 3NRAA 4BQ0A 1OHWA 2D5YA 2AY7A 2BI5A 2R5EA 2AEVA 2Z20A 4W8IA 5FT5A 1TOEA 2CTZA 2AY5A 3II0A 1TATA 3TFTA 4PFFA 2FM1A 2ZUKA 3A9YA 4FFCA 4ADDA 4ZM3A 1LC7A 1S08A 3VAXA 3A2BA 3JU7A 3MBBA 2Z1ZA 2HZPA 2ZP7A 3NX3A 1PMMA 3FVUA 3FDBA 3LWSA 3H7FA 3HBXA 2X8UA 1GEYA 1SPAA 3GETA 2W8TA 4FL0A 1BJWA 4UHNA 2CH2A 2OATA 4OC9A 4EB5A 1IAYA 1BJOA 1UU0A 4JEZA 2X5DA 1WYVB 4E77A 4TN4A 3R4TA 1FC4A 5KTBA 3H9XA 2AY3A 1KL2A 3EI6A 4NOGA 1GBNA 2BIAA 4RAEA 2YCNA 4PIWA 3WKRA 3M5UA 3ASAA 2ZY2A 3GR9A 2C7TA 3BS8A 3AEPA 2JG2A 1AHFA 3AEJC 4AZKA 1ECXA 3I4JA 1G4XA 3ZRPA 2W7GA 4MQRA 2AY4A 1AKCA 1IAXA 5LHAA 1AHEA 1RV3A 3QN6A 1KMKA 3FSLA 3PGYA 1AY5A 3CAIA 4F5KA 4WYGA 3VOMA 1DTYA 2V0YA 3Q8NA 1M0QA 1QITA 1M0PA 8AATA 3GZDA 3GBXA 1E5FA 3UWCA 3DR7A 3OKSA 4ZM4A 2BYLA 4BA5A 1CZCA 1WKGA 3NUBA 5DX5A 1ASMA 4F5FA 1WSTA 1BKGA 4ITGA 2BIGA 3PA9A 4W1VA 4XJOA 4DQ6A 1GC4A 3DXVA 4ZAHA 1XEYA 1TOJA 5HXXA 1C7GA 1AKAA 4A0HA 1DJUA 4PVFA 1ASGA 3KGWA 2VLHA 3WKSA 2F8JA 4RM1A 3ZRRA 1LS3A 4F5JA 3MEBA 4UHMA 1TASA 3ATHA 2W8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0C A;  3QGU A;  1U08 A;  4Y0I A;  4RJ0 A;  1QIR A;  4WXF A;  3QHX A;  3WCO A;  4RKC A;  3GSB A;  3HMU A;  1V72 A;  1WYT B;  1ASN A;  2AY2 A;  4E3R A;  5EAV A;  1YNU A;  3ACZ A;  3TCM A;  1S0A A;  1D7S A;  1ELU A;  2VGS A;  2Z61 A;  4A0R A;  2VMN A;  3DR4 A;  2VMT A;  2O1B A;  4CXQ A;  1M7Y A;  2AY6 A;  2FQ6 A;  2YRR A;  2DGL A;  4IX8 A;  1IBJ A;  4LW4 A;  4RJY A;  5EIG A;  1GC3 A;  1PFF A;  1CQ7 A;  2VMZ A;  1ARG A;  5JAY A;  4GEB A;  5FT4 A;  4ADC A;  4F5L A;  2XBN A;  3BCB A;  4M2M A;  4DBC A;  2Z9V A;  4KAM A;  4EFF A;  4WYE A;  1IX6 A;  1T3I A;  2CST A;  3RQ1 A;  4Y0D A;  3FCR A;  3A9Z A;  4N0W A;  2CY8 A;  2YOB A;  2R5C B;  4IYO B;  3E2Z B;  2Z67 A;  3R9A A;  4ATQ A;  3UE8 A;  1XI9 A;  1UU2 A;  1V2E A;  5LH9 A;  4OT8 A;  4ATP A;  1ARI A;  4ZDL A;  5EFS A;  2AAT A;  1B8G A;  4N0B A;  1J04 A;  2QB2 A;  3PD6 A;  5D95 A;  4AO9 A;  5DJ9 A;  3NUI A;  3PDB A;  3NU8 A;  1MAQ A;  3HVY A;  1G4V A;  3LVK A;  4OYT A;  4K2M A;  4K2I A;  2VIB A;  1SF2 A;  3MC6 A;  3ELE A;  2JJH A;  1M32 A;  4OBV A;  5E3K A;  3RCH B;  4TV7 A;  5DB5 A;  1G7X A;  1I41 A;  1W7M A;  3B1C A;  5DJ1 A;  3WLX A;  1VP4 A;  1ASB A;  1WYU A;  2BI2 A;  2D7Z A;  2VGU A;  2DGM A;  3EIA A;  3NYS A;  3W1I A;  4WXG A;  4DGT A;  2W8W A;  2C81 A;  3AEM A;  5K8B A;  4LNM A;  3VK4 A;  3KGX A;  2CIN A;  3MKJ A;  2HOR A;  1O4S A;  3HL2 A;  1LW5 A;  3BCA A;  4M2J A;  4ZWM A;  3VK2 A;  1M0N A;  1JS6 A;  4WBT A;  3ZRQ A;  2PB2 A;  1MDO A;  3H14 A;  4WLJ A;  1KMJ A;  1FG7 A;  3WGB A;  2X5F A;  4XJP A;  2E7U A;  2HP2 A;  1ARS A;  1AMA A;  4JEV A;  2W7F A;  3L8A A;  1YJY A;  3DZZ A;  5EAA A;  3D6K A;  1D7R A;  1JF9 A;  4IY7 A;  1LKC A;  2GQN A;  4EB7 A;  1ASC A;  2BI9 A;  2QB3 A;  4WP0 A;  3FZ6 A;  3B1E A;  2QA3 A;  3NYU A;  4MKK A;  4MQP A;  2JIS A;  4KYO A;  2AY1 A;  2AEU A;  1S06 A;  2ORD A;  1ZOB A;  2Z9W A;  2VMW A;  1X0M A;  3JWB A;  1C7O A;  2E7I A;  2DKB A;  1AIA A;  5TF5 A;  1CQ8 A;  3AEN A;  2QMA A;  4P3M A;  1TOK A;  1V2D A;  4WB0 B;  3LVJ A;  1VEF A;  1DKA A;  2VMO A;  4PFN A;  3WGC A;  4GE7 A;  4A0G A;  3QPG A;  1GD9 A;  1EG5 A;  3G0T A;  3AOW A;  3AEO A;  4A6U A;  2DKJ A;  2W7H A;  1GEW A;  1S07 A;  4JE5 A;  1IJI A;  5F9S A;  2C0R A;  3FZ8 A;  4E3Q A;  3EZS A;  1AIC A;  2W7M A;  4MKJ A;  2D61 A;  3RI6 A;  1CZE A;  3JTX A;  1AJS B;  2HOY A;  1B9I A;  3FKD A;  3EUC A;  2VMV A;  1ZC9 A;  3ZZJ A;  3A9X A;  1I48 A;  1MDZ A;  4Y0H A;  5E4Z A;  3DU4 A;  4EU1 A;  1AHY A;  1M4N A;  4RIZ A;  1ARH A;  2G6W A;  2CJG A;  1I43 A;  1DFO A;  2ZSM A;  1AY8 A;  4UOY A;  2JJG A;  2X3L A;  1OXO A;  4LNL A;  1RVU A;  4R5Z A;  1W23 A;  4XJL A;  4ISY A;  4WXB A;  3TQX A;  3GZD C;  1AJR A;  1GC0 A;  4B9B A;  1BJN A;  2VMR A;  3AEJ A;  2ZYJ A;  4MSO A;  4LC3 A;  4Q76 A;  4ADB A;  2Z9U A;  1MAP A;  2RFV A;  4OMA A;  3EZ1 A;  1AHG A;  4F5I A;  2FN6 A;  1OHV A;  3I16 A;  2GSA A;  3CQ4 A;  3B1D A;  4AOA A;  2EPJ A;  2EH6 A;  3G7Q A;  4XQ2 A;  2DOU A;  2QLR A;  1QIS A;  3HLM A;  1YIY A;  4W1W A;  3HQT A;  1H1C A;  3HT4 A;  3L44 A;  4WYC A;  2WK8 A;  5G4J A;  1DJ9 A;  2EGY A;  1BS0 A;  4R2N A;  2ZY3 A;  4ZWV A;  1N8P A;  2Z1Y A;  3MAF A;  4GSA A;  2Q7W A;  3CQ5 A;  2VI9 A;  5M49 A;  2D65 A;  2JJF A;  2PB0 A;  1GDE A;  2OQX A;  3I5T A;  3N5M A;  5EUD A;  3TFU A;  4F5M A;  4ITX A;  9AAT A;  1C0N A;  1DGD A;  4ADE A;  2ZY4 A;  1BJO B;  3FTB A;  3FD0 A;  3A8U X;  2VLF A;  2Z9X A;  4F5H A;  1G7W A;  4XK1 A;  3E2Y A;  3G8M A;  1QGN A;  3FFH A;  3COG A;  2HP1 A;  4W1X A;  4BHD A;  4GDY A;  4ZDP A;  3GZC A;  3K7Y A;  4CBR A;  2D63 A;  2VGW A;  2E7J A;  2PO3 A;  2HOX A;  5G09 A;  4OCA A;  3JWA A;  1X29 A;  1ASE A;  5HHY A;  1MLZ A;  2OKJ A;  2YKY A;  2WK7 A;  1YIZ A;  2CFB A;  3BV0 A;  2OGE A;  2QBT A;  4Q75 A;  3IF2 A;  2BYJ A;  3IHJ A;  1TAR A;  1SZS A;  4JEW A;  5EUE A;  3WCN A;  4Q6R A;  2W8J A;  4M2K A;  3WZF A;  4LW2 A;  2E54 A;  3ZZK A;  2JGT A;  2D7Y A;  1SVV A;  1OAT A;  3B8X A;  2ZY5 A;  5EQC A;  2V1P A;  3ASB A;  3K40 A;  3PDX A;  5M4B A;  2VGV A;  1D7U A;  2R2N A;  1C9C A;  2HUI A;  4L0O A;  3AV7 A;  4J8L A;  3W1J A;  3LVM A;  1ASL A;  1BQA A;  2W8U A;  5D5S A;  4GE9 A;  3BWN C;  1AX4 A;  1CS1 A;  2CB1 A;  2VMX A;  2YCP A;  3CQ6 A;  4XAU A;  1SZK A;  2BI1 A;  4KXK A;  2EZ2 A;  4XJM A;  3NYT A;  2BI3 A;  4GRX A;  1MGV A;  2CJH A;  4IXZ A;  5EIG B;  3EI8 A;  1IX7 A;  1OXP A;  5M46 A;  4TMR A;  3USF A;  4U1T A;  1LC8 A;  1AMR A;  3DXW A;  1P3W A;  1AMS A;  3JZL A;  2VMQ A;  1AIB A;  1Y4I A;  3WX9 A;  2W7J A;  4E1O A;  2O7C A;  3FVS A;  4O6Z A;  3VK3 A;  2W7E A;  1BQD A;  2YCT A;  4OBU A;  3FZ7 A;  2YKV A;  3F6T A;  4RLG A;  7AAT A;  3F0H A;  4QGR A;  1YOO A;  2BHX A;  4OTL A;  5BJ3 A;  4W91 A;  1UU1 A;  2HUU A;  4R8D A;  1C7N A;  1W3U A;  3ECD A;  4ZAS A;  3WY7 A;  5M4D A;  1D2F A;  1CQ6 A;  4HF8 A;  4K2B A;  3EI9 A;  4CXR A;  3PD6 B;  4F5G A;  1N2T A;  1ORD A;  3PDB B;  2AY9 A;  4BMK A;  2ZC0 A;  1S09 A;  1BW0 A;  1YAA A;  2FNU A;  4WYA A;  1OHY A;  2DGK A;  2OKK A;  3ISL A;  3N0L A;  3NNK A;  4A72 A;  4P7Y A;  2VIA A;  2ZSL A;  3E9K A;  3N75 A;  1WYT A;  4U2H A;  1Z7D A;  3QBO A;  1WYU B;  3FQA A;  4ZDO A;  1VJO A;  2OGA A;  1TPL A;  5G4I A;  1FG3 A;  3KKI A;  2W7L A;  4MGR A;  1LW4 A;  3FDD A;  3RUY A;  3GJU A;  1PMO A;  4A6R A;  1X2A A;  1QZ9 A;  3EI7 A;  1B5P A;  2VMP A;  1CL2 A;  1N31 A;  1B9H A;  1KKP A;  2VGT A;  2EZ1 A;  3DOD A;  1CJ0 A;  2CJD A;  2TPL A;  4MQQ A;  1O69 A;  2BKW A;  5G2P A;  1YJS A;  2VMU A;  4LNJ A;  2R5C A;  1X28 A;  3TAT A;  4AH3 A;  4IYO A;  4CVQ A;  1C4K A;  3E2Z A;  3NDN A;  3E6G A;  3NTJ A;  4H51 A;  4IXS A;  1QJ5 A;  4XEW A;  1GC2 A;  4JE5 D;  1EJI A;  2YRI A;  2HOZ A;  2GB3 A;  1SFF A;  2BWP A;  1PG8 A;  4UQV A;  2R0T A;  1WKH A;  4WD2 A;  5E5I A;  1I29 A;  3ELP A;  1M6S A;  2DR1 A;  2WK9 A;  5EUN A;  3W1H A;  3JW9 A;  1BJ4 A;  2D66 A;  4A00 A;  1ASF A;  3RCH A;  4IXO A;  2BWN A;  3RBL A;  1V2F A;  3AEN B;  4MY5 A;  2WKA A;  1AHX A;  1O62 A;  3P6K A;  4R5F A;  1KL1 A;  3QM2 A;  3FRK A;  4WLH A;  4ZLV A;  5HDM A;  2YKU A;  1AAM A;  3LVL B;  1TOI A;  1O61 A;  1W7N A;  2CAN A;  3LG0 A;  4WYF A;  4JF1 A;  1KKJ A;  5FT8 A;  2O0R A;  5AX8 A;  1IUG A;  2W7K A;  5I92 A;  3RBF A;  1CL1 A;  4JEX A;  3LY1 A;  4ZSY A;  5IWQ A;  1ASA A;  2ZJG A;  3AAT A;  4JEY A;  4GE4 A;  1EQB A;  5FT6 A;  3E77 A;  1B5O A;  3CBF A;  3FQ7 A;  4CBS A;  3DRD A;  2GMU A;  1AAW A;  3NU7 A;  3GWP A;  3BB8 A;  4I8A A;  2AY8 A;  1SZU A;  5G0A A;  3PAA A;  4HVK A;  3VP6 A;  2FYF A;  4F4E A;  1ASD A;  3T32 A;  2VYC A;  1DGE A;  1DJE A;  2NMP A;  3AOV A;  5BJ4 A;  3EI5 A;  3MC6 C;  1MLY A;  4ZSW A;  2VMY A;  1J32 A;  3DYD A;  1RVY A;  3F9T A;  1D7V A;  3PIU A;  1JG8 A;  5G2Q A;  1E5E A;  4B98 A;  3PJ0 A;  4WB0 A;  2JJE A;  1BT4 A;  1MDX A;  2W7D A;  1AY4 A;  3MAD A;  1RV4 A;  1QJ3 A;  1WYV A;  4UHO A;  2W7I A;  4BA4 A;  2YHK A;  5F8V A;  2BWO A;  3K28 A;  3HDO A;  3AEM C;  1YJZ A;  3B46 A;  1IVR A;  1ELQ A;  3LV2 A;  3P1T A;  1IX8 A;  1LC5 A;  1JS3 A;  5C6U A;  2BIE A;  3QI6 A;  1AJS A;  5J8Q A;  3E2F A;  4EMY A;  1GEX A;  3KE3 A;  3DC1 A;  3UAK A;  1M0O A;  3MAF B;  3OP7 A;  2XH1 A;  4IW7 A;  2EO5 A;  4A0F A;  1UKJ A;  1Z3Z A;  3BC8 A;  1GCK A;  1B4X A;  2VMS A;  3FVX A;  4JF0 A;  4AO4 A;  3MAU A;  3BN1 A;  1AMQ A;  2GMS A;  3EIB A;  1ZOD A;  2CH1 A;  4A6T A;  3FQ8 A;  2C44 A;  2D64 A;  1ART A;  1W7L A;  2YKX A;  3FFR A;  4W5K A;  2HUF A;  1TOG A;  2VGZ A;  1LK9 A;  1AKB A;  3BWN A;  4RIT A;  3PPL A;  4J5U A;  3AEL A;  3BWO A;  4AZJ A;  2VI8 A;  4Q31 A;  2FNI A;  3BCX A;  4WYD A;  4RKD A;  3NRA A;  4BQ0 A;  1OHW A;  2D5Y A;  2AY7 A;  2BI5 A;  2R5E A;  2AEV A;  2Z20 A;  4W8I A;  5FT5 A;  1TOE A;  2CTZ A;  2AY5 A;  3II0 A;  1TAT A;  3TFT A;  4PFF A;  2FM1 A;  2ZUK A;  3A9Y A;  4FFC A;  4ADD A;  4ZM3 A;  1LC7 A;  1S08 A;  3VAX A;  3A2B A;  3JU7 A;  3MBB A;  2Z1Z A;  2HZP A;  2ZP7 A;  3NX3 A;  1PMM A;  3FVU A;  3FDB A;  3LWS A;  3H7F A;  3HBX A;  2X8U A;  1GEY A;  1SPA A;  3GET A;  2W8T A;  4FL0 A;  1BJW A;  4UHN A;  2CH2 A;  2OAT A;  4OC9 A;  4EB5 A;  1IAY A;  1BJO A;  1UU0 A;  4JEZ A;  2X5D A;  1WYV B;  4E77 A;  4TN4 A;  3R4T A;  1FC4 A;  2AY3 A;  1KL2 A;  3EI6 A;  4NOG A;  1GBN A;  2BIA A;  4RAE A;  2YCN A;  4PIW A;  3WKR A;  3M5U A;  3ASA A;  2ZY2 A;  3GR9 A;  2C7T A;  3BS8 A;  3AEP A;  2JG2 A;  1AHF A;  3AEJ C;  4AZK A;  1ECX A;  3I4J A;  1G4X A;  3ZRP A;  2W7G A;  4MQR A;  2AY4 A;  1AKC A;  1IAX A;  5LHA A;  1AHE A;  1RV3 A;  3QN6 A;  1KMK A;  3FSL A;  3PGY A;  1AY5 A;  3CAI A;  4F5K A;  4WYG A;  3VOM A;  1DTY A;  2V0Y A;  3Q8N A;  1M0Q A;  1QIT A;  1M0P A;  8AAT A;  3GZD A;  3GBX A;  1E5F A;  3UWC A;  3DR7 A;  3OKS A;  4ZM4 A;  2BYL A;  4BA5 A;  1CZC A;  1WKG A;  3NUB A;  5DX5 A;  1ASM A;  4F5F A;  1WST A;  1BKG A;  4ITG A;  2BIG A;  3PA9 A;  4W1V A;  4XJO A;  4DQ6 A;  1GC4 A;  3DXV A;  4ZAH A;  1XEY A;  1TOJ A;  5HXX A;  1C7G A;  1AKA A;  4A0H A;  1DJU A;  4PVF A;  1ASG A;  3KGW A;  2VLH A;  3WKS A;  2F8J A;  4RM1 A;  3ZRR A;  1LS3 A;  4F5J A;  3MEB A;  4UHM A;  1TAS A;  3ATH A;  2W8V A; 
#chains in the Genus database with same CATH topology
 1H0C A;  3QGU A;  1U08 A;  4Y0I A;  4RJ0 A;  1QIR A;  4WXF A;  3QHX A;  3WCO A;  4RKC A;  3GSB A;  3HMU A;  1V72 A;  1WYT B;  1ASN A;  2AY2 A;  4E3R A;  5EAV A;  1YNU A;  3ACZ A;  3TCM A;  1S0A A;  1D7S A;  1ELU A;  2VGS A;  2Z61 A;  4A0R A;  2VMN A;  3DR4 A;  2VMT A;  2O1B A;  4CXQ A;  1M7Y A;  2AY6 A;  2FQ6 A;  2YRR A;  2DGL A;  4IX8 A;  1IBJ A;  4LW4 A;  4RJY A;  5EIG A;  2FKI A;  1GC3 A;  1PFF A;  1CQ7 A;  2VMZ A;  1ARG A;  5JAY A;  4GEB A;  5FT4 A;  4ADC A;  4F5L A;  2XBN A;  3BCB A;  4M2M A;  4DBC A;  2Z9V A;  4KAM A;  4EFF A;  4WYE A;  1IX6 A;  1T3I A;  2CST A;  3RQ1 A;  4Y0D A;  3FCR A;  3A9Z A;  4N0W A;  2CY8 A;  2YOB A;  2R5C B;  4IYO B;  3E2Z B;  2Z67 A;  3R9A A;  2G7J A;  4ATQ A;  3UE8 A;  1XI9 A;  1UU2 A;  1V2E A;  5LH9 A;  4OT8 A;  4ATP A;  1ARI A;  3N4S A;  4ZDL A;  5EFS A;  2AAT A;  1B8G A;  4N0B A;  1J04 A;  2QB2 A;  3PD6 A;  5D95 A;  4AO9 A;  5DJ9 A;  3NUI A;  3PDB A;  3NU8 A;  1MAQ A;  3HVY A;  1G4V A;  3LVK A;  4OYT A;  4K2M A;  4K2I A;  2VIB A;  1SF2 A;  3MC6 A;  3ELE A;  2JJH A;  1M32 A;  4OBV A;  5E3K A;  3RCH B;  4TV7 A;  5DB5 A;  1G7X A;  1I41 A;  1W7M A;  3B1C A;  5DJ1 A;  3WLX A;  1VP4 A;  1ASB A;  1WYU A;  2BI2 A;  2D7Z A;  2VGU A;  2DGM A;  3EIA A;  3NYS A;  3W1I A;  4WXG A;  4DGT A;  2W8W A;  2C81 A;  3AEM A;  5K8B A;  4LNM A;  3VK4 A;  3KGX A;  2CIN A;  3MKJ A;  2HOR A;  1O4S A;  3HL2 A;  1LW5 A;  3BCA A;  4M2J A;  4ZWM A;  3VK2 A;  1M0N A;  1JS6 A;  4WBT A;  3ZRQ A;  2PB2 A;  1MDO A;  3H14 A;  4WLJ A;  1KMJ A;  1FG7 A;  3WGB A;  2X5F A;  4XJP A;  2E7U A;  2HP2 A;  1ARS A;  1AMA A;  4JEV A;  2W7F A;  3L8A A;  1YJY A;  3DZZ A;  5EAA A;  3D6K A;  1D7R A;  1JF9 A;  4IY7 A;  1LKC A;  2GQN A;  4EB7 A;  1ASC A;  2BI9 A;  2QB3 A;  4WP0 A;  3FZ6 A;  3B1E A;  3N7N A;  2QA3 A;  3NYU A;  4MKK A;  4MQP A;  2JIS A;  4KYO A;  2AY1 A;  2AEU A;  1S06 A;  2ORD A;  1ZOB A;  2Z9W A;  2VMW A;  1X0M A;  3JWB A;  1C7O A;  2E7I A;  2DKB A;  1AIA A;  5TF5 A;  1CQ8 A;  3AEN A;  2QMA A;  4P3M A;  1TOK A;  1V2D A;  4WB0 B;  3LVJ A;  1VEF A;  1DKA A;  2VMO A;  4PFN A;  3WGC A;  4GE7 A;  4A0G A;  3QPG A;  1GD9 A;  1EG5 A;  3G0T A;  3AOW A;  3AEO A;  4A6U A;  2DKJ A;  2W7H A;  1GEW A;  1S07 A;  4JE5 A;  1IJI A;  5F9S A;  2C0R A;  3FZ8 A;  4E3Q A;  3EZS A;  1AIC A;  2W7M A;  4MKJ A;  2D61 A;  3RI6 A;  1CZE A;  3JTX A;  1AJS B;  2HOY A;  1B9I A;  3FKD A;  3EUC A;  2VMV A;  1ZC9 A;  3ZZJ A;  3A9X A;  1I48 A;  1MDZ A;  4Y0H A;  5E4Z A;  3DU4 A;  4EU1 A;  1AHY A;  1M4N A;  4RIZ A;  1ARH A;  2G6W A;  2CJG A;  1I43 A;  1DFO A;  2ZSM A;  1AY8 A;  4UOY A;  2JJG A;  2X3L A;  1OXO A;  4LNL A;  1RVU A;  4R5Z A;  2WB6 A;  1W23 A;  4XJL A;  4ISY A;  4WXB A;  3TQX A;  3GZD C;  1AJR A;  1GC0 A;  4B9B A;  1BJN A;  2VMR A;  3AEJ A;  2ZYJ A;  4MSO A;  4H63 Q;  4LC3 A;  4Q76 A;  4ADB A;  2EYQ A;  2Z9U A;  1MAP A;  2RFV A;  4OMA A;  3EZ1 A;  1AHG A;  4F5I A;  2FN6 A;  1OHV A;  3I16 A;  2GSA A;  3CQ4 A;  3B1D A;  4AOA A;  2EPJ A;  2EH6 A;  3G7Q A;  4XQ2 A;  2DOU A;  2QLR A;  1QIS A;  3HLM A;  1YIY A;  4W1W A;  3HQT A;  1H1C A;  3HT4 A;  3L44 A;  4WYC A;  2WK8 A;  5G4J A;  1DJ9 A;  2EGY A;  1BS0 A;  4R2N A;  2ZY3 A;  4ZWV A;  1N8P A;  2Z1Y A;  3MAF A;  4GSA A;  2Q7W A;  3CQ5 A;  2VI9 A;  5M49 A;  2D65 A;  2JJF A;  2PB0 A;  1GDE A;  2OQX A;  3I5T A;  3N5M A;  5EUD A;  3TFU A;  4F5M A;  4ITX A;  9AAT A;  1C0N A;  1DGD A;  4ADE A;  2ZY4 A;  1BJO B;  3FTB A;  3FD0 A;  3A8U X;  2VLF A;  2Z9X A;  4F5H A;  1G7W A;  4XK1 A;  3E2Y A;  3G8M A;  1QGN A;  3FFH A;  3COG A;  2HP1 A;  4W1X A;  4BHD A;  4GDY A;  4ZDP A;  3GZC A;  3K7Y A;  4CBR A;  2D63 A;  2VGW A;  2E7J A;  2PO3 A;  2HOX A;  5G09 A;  4OCA A;  3JWA A;  1X29 A;  1ASE A;  5HHY A;  1MLZ A;  2OKJ A;  2YKY A;  2WK7 A;  1YIZ A;  2CFB A;  3BV0 A;  2OGE A;  2A1V A;  2QBT A;  4Q75 A;  3IF2 A;  2QSR A;  2BYJ A;  3IHJ A;  1TAR A;  1SZS A;  4JEW A;  5EUE A;  3WCN A;  4Q6R A;  2W8J A;  4M2K A;  3WZF A;  4LW2 A;  2E54 A;  3ZZK A;  2JGT A;  4K05 A;  2D7Y A;  1SVV A;  1OAT A;  3B8X A;  2ZY5 A;  5EQC A;  2V1P A;  2KFP A;  3ASB A;  3K40 A;  3PDX A;  5M4B A;  2VGV A;  1D7U A;  2R2N A;  1C9C A;  2HUI A;  4L0O A;  3AV7 A;  4J8L A;  3W1J A;  3LVM A;  1ASL A;  1BQA A;  2W8U A;  5D5S A;  4GE9 A;  3BWN C;  1AX4 A;  1CS1 A;  2CB1 A;  2VMX A;  2YCP A;  3CQ6 A;  4XAU A;  1SZK A;  2BI1 A;  4KXK A;  2EZ2 A;  4XJM A;  3NYT A;  2BI3 A;  4GRX A;  1MGV A;  2CJH A;  4IXZ A;  5EIG B;  3EI8 A;  1IX7 A;  1OXP A;  5M46 A;  4TMR A;  3USF A;  4U1T A;  1LC8 A;  1AMR A;  3DXW A;  1P3W A;  1AMS A;  3JZL A;  3N4R A;  2VMQ A;  1AIB A;  1Y4I A;  3WX9 A;  2W7J A;  4E1O A;  2O7C A;  3FVS A;  4O6Z A;  3VK3 A;  2W7E A;  1BQD A;  2YCT A;  1KAF A;  4OBU A;  3FZ7 A;  2YKV A;  3F6T A;  4RLG A;  7AAT A;  3F0H A;  4QGR A;  1YOO A;  2BHX A;  4OTL A;  5BJ3 A;  4W91 A;  1UU1 A;  2HUU A;  4R8D A;  1C7N A;  1W3U A;  3ECD A;  4ZAS A;  3WY7 A;  5M4D A;  1D2F A;  1CQ6 A;  4HF8 A;  4K2B A;  3EI9 A;  4CXR A;  3PD6 B;  4F5G A;  1N2T A;  1ORD A;  3PDB B;  2AY9 A;  4BMK A;  2ZC0 A;  1S09 A;  1BW0 A;  1YAA A;  2FNU A;  4WYA A;  1OHY A;  2DGK A;  2OKK A;  3ISL A;  3N0L A;  3NNK A;  4A72 A;  4P7Y A;  2VIA A;  2ZSL A;  3E9K A;  3N75 A;  1WYT A;  4U2H A;  1Z7D A;  3QBO A;  1WYU B;  3FQA A;  4ZDO A;  1VJO A;  2OGA A;  1TPL A;  5G4I A;  1FG3 A;  3KKI A;  2W7L A;  4MGR A;  1LW4 A;  3FDD A;  3RUY A;  3GJU A;  1PMO A;  4A6R A;  1X2A A;  1QZ9 A;  3EI7 A;  1B5P A;  2VMP A;  1CL2 A;  1N31 A;  1B9H A;  1KKP A;  2VGT A;  2EZ1 A;  3DOD A;  1CJ0 A;  2CJD A;  2TPL A;  4MQQ A;  1O69 A;  2BKW A;  5G2P A;  3N4X A;  1YJS A;  2VMU A;  4LNJ A;  2R5C A;  1X28 A;  3TAT A;  4AH3 A;  4IYO A;  4CVQ A;  1C4K A;  3E2Z A;  3NDN A;  3E6G A;  3NTJ A;  4H51 A;  4IXS A;  1QJ5 A;  4XEW A;  1GC2 A;  4JE5 D;  1EJI A;  2YRI A;  2HOZ A;  2GB3 A;  1SFF A;  2BWP A;  1PG8 A;  4UQV A;  2R0T A;  1WKH A;  4WD2 A;  5E5I A;  1I29 A;  3ELP A;  1M6S A;  2DR1 A;  2WK9 A;  5EUN A;  3W1H A;  3JW9 A;  1BJ4 A;  2D66 A;  4A00 A;  1ASF A;  3RCH A;  4IXO A;  2BWN A;  3RBL A;  1V2F A;  3AEN B;  4MY5 A;  2WKA A;  1AHX A;  1O62 A;  3P6K A;  4R5F A;  1KL1 A;  3QM2 A;  3FRK A;  4WLH A;  4ZLV A;  5HDM A;  2YKU A;  1AAM A;  3LVL B;  1TOI A;  1O61 A;  1W7N A;  2CAN A;  3LG0 A;  4WYF A;  4JF1 A;  1KKJ A;  5FT8 A;  2O0R A;  5AX8 A;  1IUG A;  2W7K A;  5I92 A;  3RBF A;  1CL1 A;  4JEX A;  3LY1 A;  4ZSY A;  5IWQ A;  1ASA A;  2ZJG A;  3AAT A;  4JEY A;  4GE4 A;  1EQB A;  5FT6 A;  3E77 A;  1B5O A;  3CBF A;  3FQ7 A;  4CBS A;  3DRD A;  2GMU A;  1AAW A;  3NU7 A;  3GWP A;  3BB8 A;  4I8A A;  2AY8 A;  1SZU A;  5G0A A;  3PAA A;  4HVK A;  3VP6 A;  2FYF A;  4F4E A;  1ASD A;  3T32 A;  2VYC A;  1DGE A;  1DJE A;  2NMP A;  3AOV A;  5BJ4 A;  3EI5 A;  3MC6 C;  1MLY A;  4ZSW A;  2VMY A;  1J32 A;  3DYD A;  1RVY A;  3F9T A;  1D7V A;  3PIU A;  1JG8 A;  5G2Q A;  1E5E A;  4B98 A;  3PJ0 A;  4WB0 A;  2JJE A;  1BT4 A;  1MDX A;  2W7D A;  1AY4 A;  3MAD A;  1RV4 A;  1QJ3 A;  1WYV A;  4UHO A;  2W7I A;  4BA4 A;  2YHK A;  5F8V A;  2BWO A;  3K28 A;  3HDO A;  3AEM C;  1YJZ A;  3B46 A;  1IVR A;  1ELQ A;  3LV2 A;  3P1T A;  1IX8 A;  1LC5 A;  1JS3 A;  5C6U A;  2BIE A;  3QI6 A;  1AJS A;  5J8Q A;  3E2F A;  4EMY A;  1GEX A;  3KE3 A;  3DC1 A;  3UAK A;  1M0O A;  3MAF B;  3OP7 A;  2XH1 A;  4IW7 A;  2EO5 A;  4A0F A;  1UKJ A;  1Z3Z A;  3BC8 A;  1GCK A;  1B4X A;  2VMS A;  3FVX A;  4JF0 A;  4AO4 A;  3MAU A;  3BN1 A;  1AMQ A;  2GMS A;  3EIB A;  1ZOD A;  2CH1 A;  4A6T A;  3FQ8 A;  2C44 A;  2D64 A;  1ART A;  1W7L A;  2YKX A;  3FFR A;  4W5K A;  2HUF A;  1TOG A;  2VGZ A;  1LK9 A;  1AKB A;  3BWN A;  4RIT A;  3PPL A;  4J5U A;  3AEL A;  3BWO A;  4AZJ A;  2VI8 A;  4Q31 A;  2FNI A;  3BCX A;  4WYD A;  4RKD A;  3NRA A;  4BQ0 A;  1OHW A;  2D5Y A;  2AY7 A;  2BI5 A;  2R5E A;  2AEV A;  2Z20 A;  4W8I A;  5FT5 A;  1TOE A;  2CTZ A;  2AY5 A;  3II0 A;  1TAT A;  3TFT A;  4PFF A;  2FM1 A;  2ZUK A;  3A9Y A;  4FFC A;  4ADD A;  4ZM3 A;  1LC7 A;  1S08 A;  3VAX A;  3A2B A;  3JU7 A;  3MBB A;  2Z1Z A;  2HZP A;  2ZP7 A;  3NX3 A;  1PMM A;  3FVU A;  3FDB A;  3LWS A;  3H7F A;  3HBX A;  2X8U A;  1GEY A;  1SPA A;  3GET A;  2W8T A;  4FL0 A;  1BJW A;  4UHN A;  2CH2 A;  2OAT A;  4OC9 A;  4EB5 A;  1IAY A;  1BJO A;  1UU0 A;  4JEZ A;  2X5D A;  1WYV B;  4E77 A;  4TN4 A;  3R4T A;  1FC4 A;  5KTB A;  3H9X A;  2AY3 A;  1KL2 A;  3EI6 A;  4NOG A;  1GBN A;  2BIA A;  4RAE A;  2YCN A;  4PIW A;  3WKR A;  3M5U A;  3ASA A;  2ZY2 A;  3GR9 A;  2C7T A;  3BS8 A;  3AEP A;  2JG2 A;  1AHF A;  3AEJ C;  4AZK A;  1ECX A;  3I4J A;  1G4X A;  3ZRP A;  2W7G A;  4MQR A;  2AY4 A;  1AKC A;  1IAX A;  5LHA A;  1AHE A;  1RV3 A;  3QN6 A;  1KMK A;  3FSL A;  3PGY A;  1AY5 A;  3CAI A;  4F5K A;  4WYG A;  3VOM A;  1DTY A;  2V0Y A;  3Q8N A;  1M0Q A;  1QIT A;  1M0P A;  8AAT A;  3GZD A;  3GBX A;  1E5F A;  3UWC A;  3DR7 A;  3OKS A;  4ZM4 A;  2BYL A;  4BA5 A;  1CZC A;  1WKG A;  3NUB A;  5DX5 A;  1ASM A;  4F5F A;  1WST A;  1BKG A;  4ITG A;  2BIG A;  3PA9 A;  4W1V A;  4XJO A;  4DQ6 A;  1GC4 A;  3DXV A;  4ZAH A;  1XEY A;  1TOJ A;  5HXX A;  1C7G A;  1AKA A;  4A0H A;  1DJU A;  4PVF A;  1ASG A;  3KGW A;  2VLH A;  3WKS A;  2F8J A;  4RM1 A;  3ZRR A;  1LS3 A;  4F5J A;  3MEB A;  4UHM A;  1TAS A;  3ATH A;  2W8V A; 
#chains in the Genus database with same CATH homology
 1H0C A;  3QGU A;  1U08 A;  4Y0I A;  4RJ0 A;  1QIR A;  4WXF A;  3QHX A;  3WCO A;  4RKC A;  3GSB A;  3HMU A;  1V72 A;  1WYT B;  1ASN A;  2AY2 A;  4E3R A;  5EAV A;  1YNU A;  3ACZ A;  3TCM A;  1S0A A;  1D7S A;  1ELU A;  2VGS A;  2Z61 A;  4A0R A;  2VMN A;  3DR4 A;  2VMT A;  2O1B A;  4CXQ A;  1M7Y A;  2AY6 A;  2FQ6 A;  2YRR A;  2DGL A;  4IX8 A;  1IBJ A;  4LW4 A;  4RJY A;  5EIG A;  2FKI A;  1GC3 A;  1PFF A;  1CQ7 A;  2VMZ A;  1ARG A;  5JAY A;  4GEB A;  5FT4 A;  4ADC A;  4F5L A;  2XBN A;  3BCB A;  4M2M A;  4DBC A;  2Z9V A;  4KAM A;  4EFF A;  4WYE A;  1IX6 A;  1T3I A;  2CST A;  3RQ1 A;  4Y0D A;  3FCR A;  3A9Z A;  4N0W A;  2CY8 A;  2YOB A;  2R5C B;  4IYO B;  3E2Z B;  2Z67 A;  3R9A A;  2G7J A;  4ATQ A;  3UE8 A;  1XI9 A;  1UU2 A;  1V2E A;  5LH9 A;  4OT8 A;  4ATP A;  1ARI A;  3N4S A;  4ZDL A;  5EFS A;  2AAT A;  1B8G A;  4N0B A;  1J04 A;  2QB2 A;  3PD6 A;  5D95 A;  4AO9 A;  5DJ9 A;  3NUI A;  3PDB A;  3NU8 A;  1MAQ A;  3HVY A;  1G4V A;  3LVK A;  4OYT A;  4K2M A;  4K2I A;  2VIB A;  1SF2 A;  3MC6 A;  3ELE A;  2JJH A;  1M32 A;  4OBV A;  5E3K A;  3RCH B;  4TV7 A;  5DB5 A;  1G7X A;  1I41 A;  1W7M A;  3B1C A;  5DJ1 A;  3WLX A;  1VP4 A;  1ASB A;  1WYU A;  2BI2 A;  2D7Z A;  2VGU A;  2DGM A;  3EIA A;  3NYS A;  3W1I A;  4WXG A;  4DGT A;  2W8W A;  2C81 A;  3AEM A;  5K8B A;  4LNM A;  3VK4 A;  3KGX A;  2CIN A;  3MKJ A;  2HOR A;  1O4S A;  3HL2 A;  1LW5 A;  3BCA A;  4M2J A;  4ZWM A;  3VK2 A;  1M0N A;  1JS6 A;  4WBT A;  3ZRQ A;  2PB2 A;  1MDO A;  3H14 A;  4WLJ A;  1KMJ A;  1FG7 A;  3WGB A;  2X5F A;  4XJP A;  2E7U A;  2HP2 A;  1ARS A;  1AMA A;  4JEV A;  2W7F A;  3L8A A;  1YJY A;  3DZZ A;  5EAA A;  3D6K A;  1D7R A;  1JF9 A;  4IY7 A;  1LKC A;  2GQN A;  4EB7 A;  1ASC A;  2BI9 A;  2QB3 A;  4WP0 A;  3FZ6 A;  3B1E A;  3N7N A;  2QA3 A;  3NYU A;  4MKK A;  4MQP A;  2JIS A;  4KYO A;  2AY1 A;  2AEU A;  1S06 A;  2ORD A;  1ZOB A;  2Z9W A;  2VMW A;  1X0M A;  3JWB A;  1C7O A;  2E7I A;  2DKB A;  1AIA A;  5TF5 A;  1CQ8 A;  3AEN A;  2QMA A;  4P3M A;  1TOK A;  1V2D A;  4WB0 B;  3LVJ A;  1VEF A;  1DKA A;  2VMO A;  4PFN A;  3WGC A;  4GE7 A;  4A0G A;  3QPG A;  1GD9 A;  1EG5 A;  3G0T A;  3AOW A;  3AEO A;  4A6U A;  2DKJ A;  2W7H A;  1GEW A;  1S07 A;  4JE5 A;  1IJI A;  5F9S A;  2C0R A;  3FZ8 A;  4E3Q A;  3EZS A;  1AIC A;  2W7M A;  4MKJ A;  2D61 A;  3RI6 A;  1CZE A;  3JTX A;  1AJS B;  2HOY A;  1B9I A;  3FKD A;  3EUC A;  2VMV A;  1ZC9 A;  3ZZJ A;  3A9X A;  1I48 A;  1MDZ A;  4Y0H A;  5E4Z A;  3DU4 A;  4EU1 A;  1AHY A;  1M4N A;  4RIZ A;  1ARH A;  2G6W A;  2CJG A;  1I43 A;  1DFO A;  2ZSM A;  1AY8 A;  4UOY A;  2JJG A;  2X3L A;  1OXO A;  4LNL A;  1RVU A;  4R5Z A;  2WB6 A;  1W23 A;  4XJL A;  4ISY A;  4WXB A;  3TQX A;  3GZD C;  1AJR A;  1GC0 A;  4B9B A;  1BJN A;  2VMR A;  3AEJ A;  2ZYJ A;  4MSO A;  4H63 Q;  4LC3 A;  4Q76 A;  4ADB A;  2EYQ A;  2Z9U A;  1MAP A;  2RFV A;  4OMA A;  3EZ1 A;  1AHG A;  4F5I A;  2FN6 A;  1OHV A;  3I16 A;  2GSA A;  3CQ4 A;  3B1D A;  4AOA A;  2EPJ A;  2EH6 A;  3G7Q A;  4XQ2 A;  2DOU A;  2QLR A;  1QIS A;  3HLM A;  1YIY A;  4W1W A;  3HQT A;  1H1C A;  3HT4 A;  3L44 A;  4WYC A;  2WK8 A;  5G4J A;  1DJ9 A;  2EGY A;  1BS0 A;  4R2N A;  2ZY3 A;  4ZWV A;  1N8P A;  2Z1Y A;  3MAF A;  4GSA A;  2Q7W A;  3CQ5 A;  2VI9 A;  5M49 A;  2D65 A;  2JJF A;  2PB0 A;  1GDE A;  2OQX A;  3I5T A;  3N5M A;  5EUD A;  3TFU A;  4F5M A;  4ITX A;  9AAT A;  1C0N A;  1DGD A;  4ADE A;  2ZY4 A;  1BJO B;  3FTB A;  3FD0 A;  3A8U X;  2VLF A;  2Z9X A;  4F5H A;  1G7W A;  4XK1 A;  3E2Y A;  3G8M A;  1QGN A;  3FFH A;  3COG A;  2HP1 A;  4W1X A;  4BHD A;  4GDY A;  4ZDP A;  3GZC A;  3K7Y A;  4CBR A;  2D63 A;  2VGW A;  2E7J A;  2PO3 A;  2HOX A;  5G09 A;  4OCA A;  3JWA A;  1X29 A;  1ASE A;  5HHY A;  1MLZ A;  2OKJ A;  2YKY A;  2WK7 A;  1YIZ A;  2CFB A;  3BV0 A;  2OGE A;  2A1V A;  2QBT A;  4Q75 A;  3IF2 A;  2QSR A;  2BYJ A;  3IHJ A;  1TAR A;  1SZS A;  4JEW A;  5EUE A;  3WCN A;  4Q6R A;  2W8J A;  4M2K A;  3WZF A;  4LW2 A;  2E54 A;  3ZZK A;  2JGT A;  4K05 A;  2D7Y A;  1SVV A;  1OAT A;  3B8X A;  2ZY5 A;  5EQC A;  2V1P A;  2KFP A;  3ASB A;  3K40 A;  3PDX A;  5M4B A;  2VGV A;  1D7U A;  2R2N A;  1C9C A;  2HUI A;  4L0O A;  3AV7 A;  4J8L A;  3W1J A;  3LVM A;  1ASL A;  1BQA A;  2W8U A;  5D5S A;  4GE9 A;  3BWN C;  1AX4 A;  1CS1 A;  2CB1 A;  2VMX A;  2YCP A;  3CQ6 A;  4XAU A;  1SZK A;  2BI1 A;  4KXK A;  2EZ2 A;  4XJM A;  3NYT A;  2BI3 A;  4GRX A;  1MGV A;  2CJH A;  4IXZ A;  5EIG B;  3EI8 A;  1IX7 A;  1OXP A;  5M46 A;  4TMR A;  3USF A;  4U1T A;  1LC8 A;  1AMR A;  3DXW A;  1P3W A;  1AMS A;  3JZL A;  3N4R A;  2VMQ A;  1AIB A;  1Y4I A;  3WX9 A;  2W7J A;  4E1O A;  2O7C A;  3FVS A;  4O6Z A;  3VK3 A;  2W7E A;  1BQD A;  2YCT A;  4OBU A;  3FZ7 A;  2YKV A;  3F6T A;  4RLG A;  7AAT A;  3F0H A;  4QGR A;  1YOO A;  2BHX A;  4OTL A;  5BJ3 A;  4W91 A;  1UU1 A;  2HUU A;  4R8D A;  1C7N A;  1W3U A;  3ECD A;  4ZAS A;  3WY7 A;  5M4D A;  1D2F A;  1CQ6 A;  4HF8 A;  4K2B A;  3EI9 A;  4CXR A;  3PD6 B;  4F5G A;  1N2T A;  1ORD A;  3PDB B;  2AY9 A;  4BMK A;  2ZC0 A;  1S09 A;  1BW0 A;  1YAA A;  2FNU A;  4WYA A;  1OHY A;  2DGK A;  2OKK A;  3ISL A;  3N0L A;  3NNK A;  4A72 A;  4P7Y A;  2VIA A;  2ZSL A;  3E9K A;  3N75 A;  1WYT A;  4U2H A;  1Z7D A;  3QBO A;  1WYU B;  3FQA A;  4ZDO A;  1VJO A;  2OGA A;  1TPL A;  5G4I A;  1FG3 A;  3KKI A;  2W7L A;  4MGR A;  1LW4 A;  3FDD A;  3RUY A;  3GJU A;  1PMO A;  4A6R A;  1X2A A;  1QZ9 A;  3EI7 A;  1B5P A;  2VMP A;  1CL2 A;  1N31 A;  1B9H A;  1KKP A;  2VGT A;  2EZ1 A;  3DOD A;  1CJ0 A;  2CJD A;  2TPL A;  4MQQ A;  1O69 A;  2BKW A;  5G2P A;  3N4X A;  1YJS A;  2VMU A;  4LNJ A;  2R5C A;  1X28 A;  3TAT A;  4AH3 A;  4IYO A;  4CVQ A;  1C4K A;  3E2Z A;  3NDN A;  3E6G A;  3NTJ A;  4H51 A;  4IXS A;  1QJ5 A;  4XEW A;  1GC2 A;  4JE5 D;  1EJI A;  2YRI A;  2HOZ A;  2GB3 A;  1SFF A;  2BWP A;  1PG8 A;  4UQV A;  2R0T A;  1WKH A;  4WD2 A;  5E5I A;  1I29 A;  3ELP A;  1M6S A;  2DR1 A;  2WK9 A;  5EUN A;  3W1H A;  3JW9 A;  1BJ4 A;  2D66 A;  4A00 A;  1ASF A;  3RCH A;  4IXO A;  2BWN A;  3RBL A;  1V2F A;  3AEN B;  4MY5 A;  2WKA A;  1AHX A;  1O62 A;  3P6K A;  4R5F A;  1KL1 A;  3QM2 A;  3FRK A;  4WLH A;  4ZLV A;  5HDM A;  2YKU A;  1AAM A;  3LVL B;  1TOI A;  1O61 A;  1W7N A;  2CAN A;  3LG0 A;  4WYF A;  4JF1 A;  1KKJ A;  5FT8 A;  2O0R A;  5AX8 A;  1IUG A;  2W7K A;  5I92 A;  3RBF A;  1CL1 A;  4JEX A;  3LY1 A;  4ZSY A;  5IWQ A;  1ASA A;  2ZJG A;  3AAT A;  4JEY A;  4GE4 A;  1EQB A;  5FT6 A;  3E77 A;  1B5O A;  3CBF A;  3FQ7 A;  4CBS A;  3DRD A;  2GMU A;  1AAW A;  3NU7 A;  3GWP A;  3BB8 A;  4I8A A;  2AY8 A;  1SZU A;  5G0A A;  3PAA A;  4HVK A;  3VP6 A;  2FYF A;  4F4E A;  1ASD A;  3T32 A;  2VYC A;  1DGE A;  1DJE A;  2NMP A;  3AOV A;  5BJ4 A;  3EI5 A;  3MC6 C;  1MLY A;  4ZSW A;  2VMY A;  1J32 A;  3DYD A;  1RVY A;  3F9T A;  1D7V A;  3PIU A;  1JG8 A;  5G2Q A;  1E5E A;  4B98 A;  3PJ0 A;  4WB0 A;  2JJE A;  1BT4 A;  1MDX A;  2W7D A;  1AY4 A;  3MAD A;  1RV4 A;  1QJ3 A;  1WYV A;  4UHO A;  2W7I A;  4BA4 A;  2YHK A;  5F8V A;  2BWO A;  3K28 A;  3HDO A;  3AEM C;  1YJZ A;  3B46 A;  1IVR A;  1ELQ A;  3LV2 A;  3P1T A;  1IX8 A;  1LC5 A;  1JS3 A;  5C6U A;  2BIE A;  3QI6 A;  1AJS A;  5J8Q A;  3E2F A;  4EMY A;  1GEX A;  3KE3 A;  3DC1 A;  3UAK A;  1M0O A;  3MAF B;  3OP7 A;  2XH1 A;  4IW7 A;  2EO5 A;  4A0F A;  1UKJ A;  1Z3Z A;  3BC8 A;  1GCK A;  1B4X A;  2VMS A;  3FVX A;  4JF0 A;  4AO4 A;  3MAU A;  3BN1 A;  1AMQ A;  2GMS A;  3EIB A;  1ZOD A;  2CH1 A;  4A6T A;  3FQ8 A;  2C44 A;  2D64 A;  1ART A;  1W7L A;  2YKX A;  3FFR A;  4W5K A;  2HUF A;  1TOG A;  2VGZ A;  1LK9 A;  1AKB A;  3BWN A;  4RIT A;  3PPL A;  4J5U A;  3AEL A;  3BWO A;  4AZJ A;  2VI8 A;  4Q31 A;  2FNI A;  3BCX A;  4WYD A;  4RKD A;  3NRA A;  4BQ0 A;  1OHW A;  2D5Y A;  2AY7 A;  2BI5 A;  2R5E A;  2AEV A;  2Z20 A;  4W8I A;  5FT5 A;  1TOE A;  2CTZ A;  2AY5 A;  3II0 A;  1TAT A;  3TFT A;  4PFF A;  2FM1 A;  2ZUK A;  3A9Y A;  4FFC A;  4ADD A;  4ZM3 A;  1LC7 A;  1S08 A;  3VAX A;  3A2B A;  3JU7 A;  3MBB A;  2Z1Z A;  2HZP A;  2ZP7 A;  3NX3 A;  1PMM A;  3FVU A;  3FDB A;  3LWS A;  3H7F A;  3HBX A;  2X8U A;  1GEY A;  1SPA A;  3GET A;  2W8T A;  4FL0 A;  1BJW A;  4UHN A;  2CH2 A;  2OAT A;  4OC9 A;  4EB5 A;  1IAY A;  1BJO A;  1UU0 A;  4JEZ A;  2X5D A;  1WYV B;  4E77 A;  4TN4 A;  3R4T A;  1FC4 A;  5KTB A;  3H9X A;  2AY3 A;  1KL2 A;  3EI6 A;  4NOG A;  1GBN A;  2BIA A;  4RAE A;  2YCN A;  4PIW A;  3WKR A;  3M5U A;  3ASA A;  2ZY2 A;  3GR9 A;  2C7T A;  3BS8 A;  3AEP A;  2JG2 A;  1AHF A;  3AEJ C;  4AZK A;  1ECX A;  3I4J A;  1G4X A;  3ZRP A;  2W7G A;  4MQR A;  2AY4 A;  1AKC A;  1IAX A;  5LHA A;  1AHE A;  1RV3 A;  3QN6 A;  1KMK A;  3FSL A;  3PGY A;  1AY5 A;  3CAI A;  4F5K A;  4WYG A;  3VOM A;  1DTY A;  2V0Y A;  3Q8N A;  1M0Q A;  1QIT A;  1M0P A;  8AAT A;  3GZD A;  3GBX A;  1E5F A;  3UWC A;  3DR7 A;  3OKS A;  4ZM4 A;  2BYL A;  4BA5 A;  1CZC A;  1WKG A;  3NUB A;  5DX5 A;  1ASM A;  4F5F A;  1WST A;  1BKG A;  4ITG A;  2BIG A;  3PA9 A;  4W1V A;  4XJO A;  4DQ6 A;  1GC4 A;  3DXV A;  4ZAH A;  1XEY A;  1TOJ A;  5HXX A;  1C7G A;  1AKA A;  4A0H A;  1DJU A;  4PVF A;  1ASG A;  3KGW A;  2VLH A;  3WKS A;  2F8J A;  4RM1 A;  3ZRR A;  1LS3 A;  4F5J A;  3MEB A;  4UHM A;  1TAS A;  3ATH A;  2W8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...