3PAAA

Mechanism of inactivation of e. coli aspartate aminotransferase by (s)-4-amino-4,5-dihydro-2-furancarboxylic acid (s-adfa) ph 8.0
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
395
structure length
395
Chain Sequence
FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Mechanism of inactivation of Escherichia coli aspartate aminotransferase by (S)-4-amino-4,5-dihydro-2-furancarboxylic acid .
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 151
structure length 395
sequence length 395
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3paaA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3paaA01
4WBTA 2DGMA 3RCHB 3RUYA 4A6UA 1ASGA 4ADDA 4RJ0A 1IBJA 3ATHA 2VMPA 3DODA 4GSAA 4EFFA 1IX7A 2QB3A 1MLYA 3EI6A 4N0BA 2W8VA 3G8MA 2VMXA 4W1WA 2W7IA 1CQ6A 3L8AA 2G6WA 3EI8A 2AY3A 2X8UA 4IXZA 4OMAA 1AJSA 4ZAHA 2E7IA 1SZSA 3VK4A 4Y0IA 4JEVA 1YAAA 1W23A 2EGYA 3WKSA 2DKBA 4P3MA 1C0NA 3CAIA 1LK9A 1H0CA 1SVVA 3BV0A 4ATPA 3E9KA 4KAMA 5LHAA 4PFFA 4RM1A 2ZY3A 2YCPA 4CXRA 3R4TA 3B8XA 2VGVA 3NRAA 2VMTA 3FVXA 2VMUA 2XBNA 3FVSA 2PB0A 1G7WA 3W1IA 2D64A 3MAUA 2JISA 4WXBA 1BQDA 4B98A 4TN4A 4RIZA 2W7GA 4ZDLA 4XK1A 1D7VA 1GCKA 3BCXA 4M2JA 3AEJC 1CL1A 2HUUA 3AEMC 3AENA 2W8WA 4MKJA 1XEYA 4ZLVA 4F5LA 2CH1A 2BYLA 2D63A 3PDXA 2HOXA 1TARA 3N0LA 1QJ3A 1ARHA 1TPLA 3FKDA 2CH2A 3B1CA 4JE5D 2ZSLA 2JJGA 5FT4A 2Z67A 3QHXA 5EUDA 3K40A 3LWSA 5F9SA 2W7MA 3Q8NA 1W3UA 1PFFA 4WLHA 4F5GA 2Z1YA 3A9YA 3WZFA 3F9TA 2CTZA 3BC8A 4W8IA 3VP6A 1ELQA 1UKJA 1TOKA 5FT6A 5DJ9A 4B9BA 4E77A 3L44A 1N8PA 3RBLA 3RCHA 2X3LA 1GC4A 4IX8A 1MDZA 4BQ0A 1AIBA 5I92A 1B8GA 4BMKA 2FNIA 2E54A 3ECDA 5FT8A 3KGWA 4E1OA 1MLZA 5M4DA 1BKGA 4ZDOA 2D7YA 2CANA 3BWOA 2Z61A 1AY8A 3EZSA 1BS0A 1JF9A 1S08A 1V2EA 1V2DA 2EH6A 4LNLA 4ADBA 3EI5A 4AO4A 4GRXA 3DYDA 2VLHA 5EFSA 1BW0A 1W7MA 2EZ2A 3LV2A 1M4NA 4BHDA 3HL2A 1TOJA 5LH9A 1AJSB 1O62A 1MAQA 4OBVA 1YIYA 3BWNC 4R5FA 5TF5A 3BB8A 3LG0A 3DRDA 1BJ4A 1OXOA 2W7HA 3GZCA 3WLXA 4K2BA 2BHXA 3TQXA 4ZASA 4A6TA 5DJ1A 1AX4A 3AEMA 1AMRA 4XAUA 3TCMA 3ASAA 4ZWVA 1WSTA 4U2HA 4Q75A 4WYEA 3QN6A 1WYUA 2VMRA 2C44A 2YCNA 2ZY5A 1X29A 3AEOA 4LNJA 3W1JA 4W91A 2EO5A 3GETA 2E7UA 5G2QA 4E3QA 3UWCA 3JTXA 1KL2A 3AEPA 2ZY2A 2YHKA 2D65A 4R2NA 3DXVA 4A0GA 1J32A 4R8DA 3I4JA 1GEWA 1QZ9A 1AY5A 3DR4A 4OTLA 1E5EA 3NUBA 1TOGA 3QGUA 2HP1A 4WXGA 1LC7A 2BIAA 2R0TA 5G4JA 3WGBA 1YIZA 5K8BA 2CY8A 1JS3A 3AENB 2YKYA 4J8LA 4N0WA 4LNMA 4IYOA 4PFNA 1WYVB 1D2FA 3E2ZA 4ATQA 2YRIA 3E2YA 3LVJA 4DBCA 2ZY4A 2RFVA 2W8UA 1DGDA 1I41A 1M0QA 3AELA 2ZSMA 1X0MA 2HUFA 3H7FA 4JEYA 2DGLA 1ASCA 3CQ4A 1S06A 3N5MA 1IX6A 4P7YA 1BJNA 4A0HA 1GC0A 4Q6RA 4ISYA 1ASLA 2D5YA 1CQ7A 5C6UA 3MC6C 5IWQA 1RV3A 1GBNA 3BWNA 1AMQA 4WD2A 3JWAA 1QISA 1OHYA 4F5KA 1CJ0A 1EJIA 2DOUA 2GMSA 2VMSA 1X28A 2Q7WA 2BKWA 4F5IA 3DZZA 1ARSA 2E7JA 3TFTA 2ZP7A 4F4EA 3BS8A 1MDXA 2PB2A 2V0YA 2VI9A 3JW9A 3MKJA 4FL0A 4NOGA 1LC5A 4LW2A 1WKGA 2O7CA 3WKRA 3K28A 3DXWA 1MGVA 1FG7A 2VGWA 4WYCA 3VK2A 3G0TA 1J04A 1IJIA 3PA9A 1G4XA 2C7TA 4PVFA 4OC9A 1OATA 3GZDC 3A9XA 2YOBA 1QGNA 1VEFA 4XEWA 1ELUA 1LKCA 3NUIA 2X5FA 2OQXA 4ITGA 2OGEA 1C4KA 1H1CA 1N2TA 1C7GA 4ZSYA 1ECXA 2QLRA 1WYUB 3LVLB 4HVKA 1AKBA 1UU1A 4WXFA 4AH3A 4EU1A 4ZDPA 1B5PA 3FFRA 4RAEA 3FTBA 1CQ8A 1SF2A 5HDMA 1CL2A 1KKJA 1WYTB 2HZPA 2YKUA 4BA5A 1LS3A 4OYTA 4W1XA 4QGRA 4ZSWA 1GC2A 1ZOBA 2WKAA 4Y0DA 3FCRA 3DC1A 4MQRA 1OHWA 3N75A 3MC6A 3AV7A 3KE3A 3FDDA 1WYVA 4LC3A 4IYOB 3E2ZB 1AKCA 1AJRA 2HOZA 1PMMA 2O1BA 1MDOA 2BI1A 3GJUA 2BWPA 1AHFA 2ZYJA 3FD0A 3NU8A 1D7RA 1O4SA 3EIAA 3WY7A 5EAVA 4TMRA 3B1DA 2R5CA 5EAAA 4GDYA 5DB5A 2D66A 2OKKA 5M46A 2WK9A 5G0AA 3WCNA 9AATA 3GZDA 3E77A 4GE4A 4AZJA 3FQ7A 3NNKA 3VAXA 3ELEA 2C81A 2Z9VA 3TFUA 4JE5A 1LC8A 2JJHA 2GMUA 1ASNA 4ADCA 4F5MA 3MBBA 1T3IA 2W8TA 3NYTA 2BI2A 2X5DA 3QI6A 4WYGA 3AOWA 2R5EA 1X2AA 2VGUA 3H14A 2CFBA 4OBUA 3IF2A 2AEVA 2JG2A 1IAYA 4U1TA 3COGA 1G7XA 2QMAA 2VMZA 3R9AA 3G7QA 1FC4A 2EZ1A 4E3RA 2CJDA 4IY7A 3ELPA 1BT4A 3NX3A 4GE7A 3WX9A 3MAFA 3PD6A 4WP0A 2W8JA 2W7LA 2VGSA 1GEYA 3NTJA 1WKHA 2YRRA 4MSOA 4JEWA 1WYTA 2AY1A 4EB5A 2BI9A 4MY5A 2R2NA 1RVYA 3MADA 1AIAA 4O6ZA 1AHYA 2BI5A 3AOVA 1RVUA 2HUIA 1LW4A 2BWOA 4KXKA 4MQQA 4AO9A 1OXPA 1PG8A 1ARGA 4HF8A 4F5FA 1DKAA 3HT4A 2AY8A 2DR1A 2QBTA 1YJZA 1BJOB 4UOYA 4KYOA 4DQ6A 4M2MA 2BIGA 2AY6A 2QB2A 1ASBA 4MQPA 3KGXA 2VGZA 2VMQA 3LVMA 3FDBA 2Z20A 1B9IA 3DR7A 3PJ0A 1AHGA 1QJ5A 3EIBA 1CZEA 4ZM3A 2VIAA 2CJHA 4I8AA 1QITA 1C9CA 3FZ6A 1VP4A 2AY2A 2R5CB 1VJOA 1ASEA 5M4BA 4J5UA 2ORDA 2D61A 2W7DA 3ASBA 1I48A 2BWNA 4ZWMA 1M0PA 2AY4A 3PPLA 1AMSA 1Z3ZA 4W5KA 3RQ1A 1AAMA 3HBXA 5G09A 3TATA 1IAXA 2W7KA 4H51A 1Z7DA 1S0AA 1ASFA 4Q31A 4AOAA 5M49A 2HORA 3D6KA 2WK8A 1B9HA 1DGEA 1YJSA 1GDEA 5J8QA 1ASMA 1Y4IA 3EZ1A 1KMKA 1TOIA 4RJYA 1JS6A 3LY1A 3GSBA 4IXOA 4JF0A 4K2MA 1W7LA 8AATA 4A0RA 3FRKA 1EG5A 4CVQA 4RITA 1ASAA 2VI8A 2GSAA 3VK3A 2V1PA 3QBOA 5BJ4A 1EQBA 1KKPA 1SZUA 3ZRQA 2W7JA 3EI7A 4JEZA 4XQ2A 4Y0HA 5HHYA 2DGKA 2Z9WA 3MAFB 3FSLA 3B1EA 3PD6B 4MGRA 1N31A 1JG8A 3LVKA 1V72A 1BQAA 4F5JA 1G4VA 1OHVA 4WYDA 3ZZJA 2BYJA 2NMPA 3GWPA 4IW7A 1SFFA 2AY9A 1C7OA 1D7SA 2JGTA 4OCAA 4K2IA 2GQNA 4MKKA 1KMJA 2AY7A 1U08A 1AY4A 2VGTA 2WK7A 4CBSA 5DX5A 2HOYA 3II0A 4XJOA 1BJOA 2VMNA 3QPGA 1UU2A 2FQ6A 4XJPA 3A8UX 5D95A 3P6KA 3FZ7A 1SZKA 1IVRA 3QM2A 5E5IA 3E2FA 3UE8A 4CXQA 4UQVA 3NYUA 4GEBA 2F8JA 1M6SA 5G4IA 1ASDA 2CB1A 1W7NA 3FFHA 1GEXA 3GR9A 3NU7A 1M32A 4RKDA 1IX8A 4ITXA 3VOMA 4RKCA 3MEBA 1CS1A 1AMAA 2C0RA 1ZODA 3HLMA 3M5UA 3USFA 4ADEA 3FQAA 2YCTA 1E5FA 2CSTA 1YNUA 1LW5A 1DFOA 3PDBA 4AZKA 4W1VA 3ZZKA 4RLGA 1IUGA 2DKJA 4XJMA 4R5ZA 3HMUA 3I5TA 3B46A 3BCBA 1XI9A 2OKJA 5EIGA 4XJLA 3BN1A 3DU4A 3OKSA 2BIEA 4WB0A 5D5SA 1GD9A 2W7EA 1FG3A 4UHMA 3P1TA 1QIRA 2YKXA 2EPJA 1M7YA 3WGCA 1V2FA 4A6RA 3ACZA 1MAPA 1S07A 2QA3A 3EI9A 1SPAA 4WLJA 4UHNA 5EUEA 5EUNA 4GE9A 1B5OA 3PAAA 4F5HA 2VMVA 2OATA 2VYCA 3EUCA 3HVYA 5G2PA 1I43A 2VMOA 3A2BA 4JEXA 4BA4A 4FFCA 3K7YA 1BJWA 3JWBA 3F6TA 4OT8A 4A0FA 3RBFA 2OGAA 2ZC0A 3AATA 3CQ5A 4A72A 2JJEA 1AHEA 4Q76A 2GB3A 1P3WA 2VLFA 2YKVA 4DGTA 3OP7A 2AATA 2FYFA 2TPLA 5F8VA 2HP2A 1KL1A 3FVUA 3FZ8A 1I29A 2CINA 5FT5A 3AEJA 3UAKA 5E3KA 4TV7A 1DJUA 2FM1A 1TASA 2O0RA 4IXSA 3PIUA 3JU7A 3ZRPA 2VMYA 3CQ6A 3HQTA 3RI6A 1M0OA 2JJFA 3E6GA 2AEUA 1YOOA 2D7ZA 4JF1A 1DJ9A 3GBXA 1B4XA 1TATA 2CJGA 1ARIA 3BCAA 2PO3A 2AY5A 2VIBA 1YJYA 3FQ8A 1DTYA 1ORDA 3ISLA 4L0OA 3T32A 5BJ3A 5JAYA 5HXXA 3CBFA 4LW4A 5EQCA 1RV4A 1UU0A 3HDOA 1ARTA 1CZCA 1M0NA 1PMOA 3A9ZA 2XH1A 7AATA 3NDNA 4EB7A 4ZM4A 1AKAA 1AICA 3IHJA 5E4ZA 2Z9XA 1D7UA 1O61A 3KKIA 3PGYA 4CBRA 2ZUKA 1O69A 4A00A 3PDBB 2W7FA 4PIWA 1DJEA 3I16A 1TOEA 1ZC9A 4UHOA 4M2KA 1AAWA 3F0HA 3W1HA 3NYSA 5AX8A 4EMYA 1AHXA 1C7NA 5EIGB 2BI3A 2FN6A 2Z9UA 4WB0B 4WYFA 1GC3A 3ZRRA 4WYAA 2VMWA 3WCOA 2ZJGA 2Z1ZA 1S09A 2FNUA 3JZLA
chains in the Genus database with same CATH superfamily
4WBTA 2DGMA 3RCHB 3RUYA 4A6UA 2KFPA 1ASGA 4ADDA 4RJ0A 4K05A 1IBJA 3ATHA 2VMPA 3DODA 4GSAA 4EFFA 1IX7A 2QB3A 1MLYA 3EI6A 4N0BA 2W8VA 3G8MA 2VMXA 4W1WA 2W7IA 1CQ6A 3L8AA 2G6WA 3EI8A 2AY3A 2X8UA 4IXZA 4OMAA 1AJSA 4ZAHA 2E7IA 1SZSA 3VK4A 4Y0IA 3N7NA 4JEVA 1YAAA 1W23A 2EGYA 3WKSA 2DKBA 4P3MA 1C0NA 3CAIA 1LK9A 1H0CA 1SVVA 3BV0A 4ATPA 3E9KA 4KAMA 5LHAA 4PFFA 4RM1A 2ZY3A 2YCPA 4CXRA 3R4TA 3B8XA 2VGVA 3NRAA 2VMTA 3FVXA 2VMUA 2XBNA 3FVSA 2PB0A 1G7WA 3W1IA 2D64A 3MAUA 2JISA 4WXBA 1BQDA 4B98A 4TN4A 4RIZA 2W7GA 4ZDLA 4XK1A 1D7VA 1GCKA 3BCXA 4M2JA 3AEJC 1CL1A 2HUUA 3AEMC 3AENA 2W8WA 4MKJA 1XEYA 4ZLVA 4F5LA 2CH1A 2BYLA 2D63A 3PDXA 2HOXA 1TARA 3N0LA 1QJ3A 1ARHA 1TPLA 3FKDA 2CH2A 3B1CA 4JE5D 2ZSLA 2JJGA 5FT4A 2Z67A 3QHXA 5EUDA 3K40A 3LWSA 5F9SA 2W7MA 3Q8NA 1W3UA 1PFFA 4WLHA 4F5GA 2Z1YA 3A9YA 3WZFA 3F9TA 2CTZA 3BC8A 4W8IA 3VP6A 1ELQA 1UKJA 1TOKA 5FT6A 5DJ9A 4B9BA 4E77A 3L44A 1N8PA 3RBLA 3RCHA 2X3LA 1GC4A 4IX8A 1MDZA 4BQ0A 1AIBA 5I92A 1B8GA 4BMKA 2FNIA 2E54A 3ECDA 5FT8A 3KGWA 4E1OA 1MLZA 5M4DA 1BKGA 4ZDOA 2D7YA 2CANA 3BWOA 2Z61A 1AY8A 3EZSA 1BS0A 1JF9A 1S08A 1V2EA 1V2DA 2EH6A 4LNLA 4ADBA 3EI5A 4AO4A 4GRXA 3DYDA 2VLHA 5EFSA 1BW0A 1W7MA 2EZ2A 3LV2A 1M4NA 4BHDA 3HL2A 1TOJA 5LH9A 1AJSB 1O62A 1MAQA 4OBVA 1YIYA 3BWNC 4R5FA 5TF5A 3BB8A 3LG0A 3DRDA 1BJ4A 1OXOA 2W7HA 3GZCA 3WLXA 4K2BA 2BHXA 3TQXA 4ZASA 4A6TA 5DJ1A 1AX4A 3AEMA 1AMRA 4XAUA 3TCMA 3ASAA 4ZWVA 1WSTA 4U2HA 4Q75A 4WYEA 3QN6A 1WYUA 2VMRA 2C44A 2YCNA 2ZY5A 1X29A 3AEOA 4LNJA 3W1JA 4W91A 2WB6A 2EO5A 3GETA 2E7UA 5G2QA 4E3QA 3UWCA 3JTXA 1KL2A 3AEPA 2ZY2A 2YHKA 2D65A 4R2NA 3DXVA 4A0GA 1J32A 4R8DA 3I4JA 1GEWA 1QZ9A 1AY5A 3DR4A 4OTLA 1E5EA 3NUBA 1TOGA 3QGUA 2HP1A 4WXGA 1LC7A 2BIAA 2R0TA 5G4JA 3WGBA 1YIZA 5K8BA 2CY8A 1JS3A 3AENB 2YKYA 4J8LA 4N0WA 4LNMA 4IYOA 4PFNA 1WYVB 1D2FA 3E2ZA 2FKIA 4ATQA 2YRIA 3E2YA 3LVJA 4DBCA 2ZY4A 2RFVA 2W8UA 1DGDA 1I41A 1M0QA 3AELA 2ZSMA 1X0MA 2HUFA 3H7FA 4JEYA 3N4SA 2DGLA 1ASCA 3CQ4A 1S06A 3N5MA 1IX6A 4P7YA 1BJNA 4A0HA 2G7JA 1GC0A 4Q6RA 4ISYA 3N4RA 1ASLA 2D5YA 1CQ7A 5C6UA 3MC6C 5IWQA 1RV3A 1GBNA 3BWNA 1AMQA 4WD2A 3JWAA 1QISA 1OHYA 4F5KA 1CJ0A 1EJIA 2DOUA 2GMSA 2VMSA 1X28A 2Q7WA 2BKWA 4F5IA 3DZZA 1ARSA 2E7JA 3TFTA 2ZP7A 4F4EA 3BS8A 1MDXA 2PB2A 2V0YA 2VI9A 3JW9A 3MKJA 4FL0A 4NOGA 1LC5A 4LW2A 1WKGA 2O7CA 3WKRA 3K28A 3DXWA 1MGVA 1FG7A 2VGWA 4WYCA 3VK2A 3G0TA 1J04A 1IJIA 3PA9A 1G4XA 2C7TA 4PVFA 4OC9A 1OATA 3GZDC 3A9XA 2YOBA 1QGNA 1VEFA 4XEWA 1ELUA 1LKCA 3NUIA 2X5FA 2OQXA 4ITGA 2OGEA 1C4KA 1H1CA 1N2TA 1C7GA 4ZSYA 1ECXA 2QLRA 1WYUB 3LVLB 4HVKA 1AKBA 1UU1A 4WXFA 4AH3A 4EU1A 4ZDPA 1B5PA 3FFRA 4RAEA 3FTBA 1CQ8A 1SF2A 5HDMA 1CL2A 1KKJA 1WYTB 2HZPA 2YKUA 4BA5A 1LS3A 4OYTA 4W1XA 4QGRA 4ZSWA 1GC2A 1ZOBA 2WKAA 4Y0DA 3FCRA 3DC1A 4MQRA 1OHWA 3N75A 3MC6A 3AV7A 3KE3A 3FDDA 1WYVA 4LC3A 4IYOB 3E2ZB 1AKCA 1AJRA 2HOZA 1PMMA 2O1BA 1MDOA 2BI1A 3GJUA 2BWPA 1AHFA 2ZYJA 3FD0A 3NU8A 1D7RA 1O4SA 3EIAA 3WY7A 5EAVA 5KTBA 4TMRA 3B1DA 2R5CA 5EAAA 4GDYA 5DB5A 2D66A 2OKKA 5M46A 2WK9A 5G0AA 3WCNA 9AATA 3GZDA 3E77A 4GE4A 4AZJA 3FQ7A 3NNKA 3VAXA 3ELEA 2C81A 1KAFA 2Z9VA 3TFUA 4JE5A 1LC8A 2JJHA 2GMUA 1ASNA 4ADCA 4F5MA 3MBBA 1T3IA 2W8TA 3NYTA 2EYQA 2BI2A 2X5DA 3QI6A 4WYGA 3AOWA 2R5EA 1X2AA 2VGUA 3H14A 2CFBA 4OBUA 3IF2A 2AEVA 2JG2A 1IAYA 4U1TA 3COGA 1G7XA 2QMAA 2VMZA 3R9AA 3G7QA 1FC4A 2EZ1A 4H63Q 4E3RA 2CJDA 4IY7A 3ELPA 1BT4A 3NX3A 4GE7A 3WX9A 3MAFA 3PD6A 4WP0A 2W8JA 2W7LA 2QSRA 2VGSA 1GEYA 3NTJA 1WKHA 2YRRA 4MSOA 4JEWA 1WYTA 2AY1A 4EB5A 2BI9A 4MY5A 2R2NA 1RVYA 3MADA 1AIAA 4O6ZA 1AHYA 2BI5A 3AOVA 1RVUA 2HUIA 1LW4A 2BWOA 4KXKA 4MQQA 4AO9A 1OXPA 1PG8A 1ARGA 4HF8A 4F5FA 1DKAA 3HT4A 2AY8A 2DR1A 2QBTA 1YJZA 1BJOB 4UOYA 4KYOA 4DQ6A 4M2MA 2BIGA 2AY6A 2QB2A 1ASBA 4MQPA 3KGXA 2VGZA 2VMQA 3LVMA 3FDBA 2Z20A 3N4XA 1B9IA 3DR7A 3PJ0A 1AHGA 1QJ5A 3EIBA 1CZEA 4ZM3A 2VIAA 2CJHA 4I8AA 1QITA 1C9CA 3FZ6A 1VP4A 2AY2A 2R5CB 1VJOA 1ASEA 5M4BA 4J5UA 2ORDA 2D61A 2W7DA 3ASBA 1I48A 2BWNA 4ZWMA 1M0PA 2AY4A 3PPLA 1AMSA 1Z3ZA 4W5KA 3RQ1A 1AAMA 3HBXA 5G09A 3TATA 1IAXA 2W7KA 4H51A 1Z7DA 1S0AA 1ASFA 4Q31A 4AOAA 5M49A 2HORA 3D6KA 2WK8A 1B9HA 1DGEA 2A1VA 1YJSA 1GDEA 5J8QA 1ASMA 1Y4IA 3EZ1A 1KMKA 1TOIA 4RJYA 1JS6A 3LY1A 3GSBA 4IXOA 4JF0A 4K2MA 1W7LA 8AATA 4A0RA 3FRKA 1EG5A 4CVQA 4RITA 1ASAA 2VI8A 2GSAA 3VK3A 2V1PA 3QBOA 5BJ4A 1EQBA 1KKPA 1SZUA 3ZRQA 2W7JA 3EI7A 4JEZA 4XQ2A 4Y0HA 5HHYA 2DGKA 2Z9WA 3MAFB 3FSLA 3B1EA 3PD6B 4MGRA 1N31A 1JG8A 3LVKA 1V72A 1BQAA 4F5JA 1G4VA 1OHVA 4WYDA 3ZZJA 2BYJA 2NMPA 3GWPA 4IW7A 1SFFA 2AY9A 1C7OA 1D7SA 2JGTA 4OCAA 4K2IA 2GQNA 4MKKA 1KMJA 2AY7A 1U08A 1AY4A 2VGTA 2WK7A 4CBSA 5DX5A 2HOYA 3II0A 4XJOA 1BJOA 2VMNA 3QPGA 1UU2A 2FQ6A 4XJPA 3A8UX 5D95A 3P6KA 3FZ7A 1SZKA 1IVRA 3QM2A 5E5IA 3E2FA 3UE8A 4CXQA 4UQVA 3NYUA 4GEBA 2F8JA 1M6SA 5G4IA 1ASDA 2CB1A 1W7NA 3FFHA 1GEXA 3GR9A 3NU7A 1M32A 4RKDA 1IX8A 4ITXA 3VOMA 4RKCA 3MEBA 1CS1A 1AMAA 2C0RA 1ZODA 3HLMA 3M5UA 3USFA 4ADEA 3FQAA 2YCTA 1E5FA 2CSTA 1YNUA 1LW5A 1DFOA 3PDBA 4AZKA 4W1VA 3ZZKA 4RLGA 1IUGA 2DKJA 4XJMA 4R5ZA 3HMUA 3I5TA 3B46A 3BCBA 1XI9A 2OKJA 5EIGA 4XJLA 3BN1A 3DU4A 3OKSA 2BIEA 4WB0A 5D5SA 1GD9A 2W7EA 1FG3A 4UHMA 3P1TA 1QIRA 2YKXA 2EPJA 1M7YA 3WGCA 1V2FA 4A6RA 3ACZA 1MAPA 1S07A 2QA3A 3EI9A 1SPAA 4WLJA 4UHNA 5EUEA 5EUNA 4GE9A 1B5OA 3PAAA 4F5HA 2VMVA 2OATA 2VYCA 3EUCA 3HVYA 5G2PA 1I43A 2VMOA 3A2BA 4JEXA 4BA4A 4FFCA 3K7YA 1BJWA 3JWBA 3F6TA 4OT8A 4A0FA 3RBFA 2OGAA 2ZC0A 3AATA 3CQ5A 4A72A 2JJEA 1AHEA 4Q76A 2GB3A 1P3WA 2VLFA 2YKVA 4DGTA 3OP7A 2AATA 2FYFA 2TPLA 5F8VA 2HP2A 1KL1A 3FVUA 3FZ8A 1I29A 2CINA 5FT5A 3AEJA 3UAKA 5E3KA 4TV7A 1DJUA 2FM1A 1TASA 2O0RA 4IXSA 3PIUA 3JU7A 3ZRPA 2VMYA 3CQ6A 3HQTA 3RI6A 1M0OA 2JJFA 3E6GA 2AEUA 1YOOA 2D7ZA 4JF1A 1DJ9A 3GBXA 1B4XA 1TATA 2CJGA 1ARIA 3BCAA 2PO3A 2AY5A 2VIBA 1YJYA 3FQ8A 1DTYA 1ORDA 3ISLA 4L0OA 3T32A 5BJ3A 5JAYA 3H9XA 5HXXA 3CBFA 4LW4A 5EQCA 1RV4A 1UU0A 3HDOA 1ARTA 1CZCA 1M0NA 1PMOA 3A9ZA 2XH1A 7AATA 3NDNA 4EB7A 4ZM4A 1AKAA 1AICA 3IHJA 5E4ZA 2Z9XA 1D7UA 1O61A 3KKIA 3PGYA 4CBRA 2ZUKA 1O69A 4A00A 3PDBB 2W7FA 4PIWA 1DJEA 3I16A 1TOEA 1ZC9A 4UHOA 4M2KA 1AAWA 3F0HA 3W1HA 3NYSA 5AX8A 4EMYA 1AHXA 1C7NA 5EIGB 2BI3A 2FN6A 2Z9UA 4WB0B 4WYFA 1GC3A 3ZRRA 4WYAA 2VMWA 3WCOA 2ZJGA 2Z1ZA 1S09A 2FNUA 3JZLA
chains in the Genus database with same CATH topology
4WBTA 2DGMA 3RCHB 3RUYA 4A6UA 2KFPA 1ASGA 4ADDA 4RJ0A 4K05A 1IBJA 3ATHA 2VMPA 3DODA 4GSAA 4EFFA 1IX7A 2QB3A 1MLYA 3EI6A 4N0BA 2W8VA 3G8MA 2VMXA 4W1WA 2W7IA 1CQ6A 3L8AA 2G6WA 3EI8A 2AY3A 2X8UA 4IXZA 4OMAA 1AJSA 4ZAHA 2E7IA 1SZSA 3VK4A 4Y0IA 3N7NA 4JEVA 1YAAA 1W23A 2EGYA 3WKSA 2DKBA 4P3MA 1C0NA 3CAIA 1LK9A 1H0CA 1SVVA 3BV0A 4ATPA 3E9KA 4KAMA 5LHAA 4PFFA 4RM1A 2ZY3A 2YCPA 4CXRA 3R4TA 3B8XA 2VGVA 3NRAA 2VMTA 3FVXA 2VMUA 2XBNA 3FVSA 2PB0A 1G7WA 3W1IA 2D64A 3MAUA 2JISA 4WXBA 1BQDA 4B98A 4TN4A 4RIZA 2W7GA 4ZDLA 4XK1A 1D7VA 1GCKA 3BCXA 4M2JA 3AEJC 1CL1A 2HUUA 3AEMC 3AENA 2W8WA 4MKJA 1XEYA 4ZLVA 4F5LA 2CH1A 2BYLA 2D63A 3PDXA 2HOXA 1TARA 3N0LA 1QJ3A 1ARHA 1TPLA 3FKDA 2CH2A 3B1CA 4JE5D 2ZSLA 2JJGA 5FT4A 2Z67A 3QHXA 5EUDA 3K40A 3LWSA 5F9SA 2W7MA 3Q8NA 1W3UA 1PFFA 4WLHA 4F5GA 2Z1YA 3A9YA 3WZFA 3F9TA 2CTZA 3BC8A 4W8IA 3VP6A 1ELQA 1UKJA 1TOKA 5FT6A 5DJ9A 4B9BA 4E77A 3L44A 1N8PA 3RBLA 3RCHA 2X3LA 1GC4A 4IX8A 1MDZA 4BQ0A 1AIBA 5I92A 1B8GA 4BMKA 2FNIA 2E54A 3ECDA 5FT8A 3KGWA 4E1OA 1MLZA 5M4DA 1BKGA 4ZDOA 2D7YA 2CANA 3BWOA 2Z61A 1AY8A 3EZSA 1BS0A 1JF9A 1S08A 1V2EA 1V2DA 2EH6A 4LNLA 4ADBA 3EI5A 4AO4A 4GRXA 3DYDA 2VLHA 5EFSA 1BW0A 1W7MA 2EZ2A 3LV2A 1M4NA 4BHDA 3HL2A 1TOJA 5LH9A 1AJSB 1O62A 1MAQA 4OBVA 1YIYA 3BWNC 4R5FA 5TF5A 3BB8A 3LG0A 3DRDA 1BJ4A 1OXOA 2W7HA 3GZCA 3WLXA 4K2BA 2BHXA 3TQXA 4ZASA 4A6TA 5DJ1A 1AX4A 3AEMA 1AMRA 4XAUA 3TCMA 3ASAA 4ZWVA 1WSTA 4U2HA 4Q75A 4WYEA 3QN6A 1WYUA 2VMRA 2C44A 2YCNA 2ZY5A 1X29A 3AEOA 4LNJA 3W1JA 4W91A 2WB6A 2EO5A 3GETA 2E7UA 5G2QA 4E3QA 3UWCA 3JTXA 1KL2A 3AEPA 2ZY2A 2YHKA 2D65A 4R2NA 3DXVA 4A0GA 1J32A 4R8DA 3I4JA 1GEWA 1QZ9A 1AY5A 3DR4A 4OTLA 1E5EA 3NUBA 1TOGA 3QGUA 2HP1A 4WXGA 1LC7A 2BIAA 2R0TA 5G4JA 3WGBA 1YIZA 5K8BA 2CY8A 1JS3A 3AENB 2YKYA 4J8LA 4N0WA 4LNMA 4IYOA 4PFNA 1WYVB 1D2FA 3E2ZA 2FKIA 4ATQA 2YRIA 3E2YA 3LVJA 4DBCA 2ZY4A 2RFVA 2W8UA 1DGDA 1I41A 1M0QA 3AELA 2ZSMA 1X0MA 2HUFA 3H7FA 4JEYA 3N4SA 2DGLA 1ASCA 3CQ4A 1S06A 3N5MA 1IX6A 4P7YA 1BJNA 4A0HA 2G7JA 1GC0A 4Q6RA 4ISYA 3N4RA 1ASLA 2D5YA 1CQ7A 5C6UA 3MC6C 5IWQA 1RV3A 1GBNA 3BWNA 1AMQA 4WD2A 3JWAA 1QISA 1OHYA 4F5KA 1CJ0A 1EJIA 2DOUA 2GMSA 2VMSA 1X28A 2Q7WA 2BKWA 4F5IA 3DZZA 1ARSA 2E7JA 3TFTA 2ZP7A 4F4EA 3BS8A 1MDXA 2PB2A 2V0YA 2VI9A 3JW9A 3MKJA 4FL0A 4NOGA 1LC5A 4LW2A 1WKGA 2O7CA 3WKRA 3K28A 3DXWA 1MGVA 1FG7A 2VGWA 4WYCA 3VK2A 3G0TA 1J04A 1IJIA 3PA9A 1G4XA 2C7TA 4PVFA 4OC9A 1OATA 3GZDC 3A9XA 2YOBA 1QGNA 1VEFA 4XEWA 1ELUA 1LKCA 3NUIA 2X5FA 2OQXA 4ITGA 2OGEA 1C4KA 1H1CA 1N2TA 1C7GA 4ZSYA 1ECXA 2QLRA 1WYUB 3LVLB 4HVKA 1AKBA 1UU1A 4WXFA 4AH3A 4EU1A 4ZDPA 1B5PA 3FFRA 4RAEA 3FTBA 1CQ8A 1SF2A 5HDMA 1CL2A 1KKJA 1WYTB 2HZPA 2YKUA 4BA5A 1LS3A 4OYTA 4W1XA 4QGRA 4ZSWA 1GC2A 1ZOBA 2WKAA 4Y0DA 3FCRA 3DC1A 4MQRA 1OHWA 3N75A 3MC6A 3AV7A 3KE3A 3FDDA 1WYVA 4LC3A 4IYOB 3E2ZB 1AKCA 1AJRA 2HOZA 1PMMA 2O1BA 1MDOA 2BI1A 3GJUA 2BWPA 1AHFA 2ZYJA 3FD0A 3NU8A 1D7RA 1O4SA 3EIAA 3WY7A 5EAVA 5KTBA 4TMRA 3B1DA 2R5CA 5EAAA 4GDYA 5DB5A 2D66A 2OKKA 5M46A 2WK9A 5G0AA 3WCNA 9AATA 3GZDA 3E77A 4GE4A 4AZJA 3FQ7A 3NNKA 3VAXA 3ELEA 2C81A 2Z9VA 3TFUA 4JE5A 1LC8A 2JJHA 2GMUA 1ASNA 4ADCA 4F5MA 3MBBA 1T3IA 2W8TA 3NYTA 2EYQA 2BI2A 2X5DA 3QI6A 4WYGA 3AOWA 2R5EA 1X2AA 2VGUA 3H14A 2CFBA 4OBUA 3IF2A 2AEVA 2JG2A 1IAYA 4U1TA 3COGA 1G7XA 2QMAA 2VMZA 3R9AA 3G7QA 1FC4A 2EZ1A 4H63Q 4E3RA 2CJDA 4IY7A 3ELPA 1BT4A 3NX3A 4GE7A 3WX9A 3MAFA 3PD6A 4WP0A 2W8JA 2W7LA 2QSRA 2VGSA 1GEYA 3NTJA 1WKHA 2YRRA 4MSOA 4JEWA 1WYTA 2AY1A 4EB5A 2BI9A 4MY5A 2R2NA 1RVYA 3MADA 1AIAA 4O6ZA 1AHYA 2BI5A 3AOVA 1RVUA 2HUIA 1LW4A 2BWOA 4KXKA 4MQQA 4AO9A 1OXPA 1PG8A 1ARGA 4HF8A 4F5FA 1DKAA 3HT4A 2AY8A 2DR1A 2QBTA 1YJZA 1BJOB 4UOYA 4KYOA 4DQ6A 4M2MA 2BIGA 2AY6A 2QB2A 1ASBA 4MQPA 3KGXA 2VGZA 2VMQA 3LVMA 3FDBA 2Z20A 3N4XA 1B9IA 3DR7A 3PJ0A 1AHGA 1QJ5A 3EIBA 1CZEA 4ZM3A 2VIAA 2CJHA 4I8AA 1QITA 1C9CA 3FZ6A 1VP4A 2AY2A 2R5CB 1VJOA 1ASEA 5M4BA 4J5UA 2ORDA 2D61A 2W7DA 3ASBA 1I48A 2BWNA 4ZWMA 1M0PA 2AY4A 3PPLA 1AMSA 1Z3ZA 4W5KA 3RQ1A 1AAMA 3HBXA 5G09A 3TATA 1IAXA 2W7KA 4H51A 1Z7DA 1S0AA 1ASFA 4Q31A 4AOAA 5M49A 2HORA 3D6KA 2WK8A 1B9HA 1DGEA 2A1VA 1YJSA 1GDEA 5J8QA 1ASMA 1Y4IA 3EZ1A 1KMKA 1TOIA 4RJYA 1JS6A 3LY1A 3GSBA 4IXOA 4JF0A 4K2MA 1W7LA 8AATA 4A0RA 3FRKA 1EG5A 4CVQA 4RITA 1ASAA 2VI8A 2GSAA 3VK3A 2V1PA 3QBOA 5BJ4A 1EQBA 1KKPA 1SZUA 3ZRQA 2W7JA 3EI7A 4JEZA 4XQ2A 4Y0HA 5HHYA 2DGKA 2Z9WA 3MAFB 3FSLA 3B1EA 3PD6B 4MGRA 1N31A 1JG8A 3LVKA 1V72A 1BQAA 4F5JA 1G4VA 1OHVA 4WYDA 3ZZJA 2BYJA 2NMPA 3GWPA 4IW7A 1SFFA 2AY9A 1C7OA 1D7SA 2JGTA 4OCAA 4K2IA 2GQNA 4MKKA 1KMJA 2AY7A 1U08A 1AY4A 2VGTA 2WK7A 4CBSA 5DX5A 2HOYA 3II0A 4XJOA 1BJOA 2VMNA 3QPGA 1UU2A 2FQ6A 4XJPA 3A8UX 5D95A 3P6KA 3FZ7A 1SZKA 1IVRA 3QM2A 5E5IA 3E2FA 3UE8A 4CXQA 4UQVA 3NYUA 4GEBA 2F8JA 1M6SA 5G4IA 1ASDA 2CB1A 1W7NA 3FFHA 1GEXA 3GR9A 3NU7A 1M32A 4RKDA 1IX8A 4ITXA 3VOMA 4RKCA 3MEBA 1CS1A 1AMAA 2C0RA 1ZODA 3HLMA 3M5UA 3USFA 4ADEA 3FQAA 2YCTA 1E5FA 2CSTA 1YNUA 1LW5A 1DFOA 3PDBA 4AZKA 4W1VA 3ZZKA 4RLGA 1IUGA 2DKJA 4XJMA 4R5ZA 3HMUA 3I5TA 3B46A 3BCBA 1XI9A 2OKJA 5EIGA 4XJLA 3BN1A 3DU4A 3OKSA 2BIEA 4WB0A 5D5SA 1GD9A 2W7EA 1FG3A 4UHMA 3P1TA 1QIRA 2YKXA 2EPJA 1M7YA 3WGCA 1V2FA 4A6RA 3ACZA 1MAPA 1S07A 2QA3A 3EI9A 1SPAA 4WLJA 4UHNA 5EUEA 5EUNA 4GE9A 1B5OA 3PAAA 4F5HA 2VMVA 2OATA 2VYCA 3EUCA 3HVYA 5G2PA 1I43A 2VMOA 3A2BA 4JEXA 4BA4A 4FFCA 3K7YA 1BJWA 3JWBA 3F6TA 4OT8A 4A0FA 3RBFA 2OGAA 2ZC0A 3AATA 3CQ5A 4A72A 2JJEA 1AHEA 4Q76A 2GB3A 1P3WA 2VLFA 2YKVA 4DGTA 3OP7A 2AATA 2FYFA 2TPLA 5F8VA 2HP2A 1KL1A 3FVUA 3FZ8A 1I29A 2CINA 5FT5A 3AEJA 3UAKA 5E3KA 4TV7A 1DJUA 2FM1A 1TASA 2O0RA 4IXSA 3PIUA 3JU7A 3ZRPA 2VMYA 3CQ6A 3HQTA 3RI6A 1M0OA 2JJFA 3E6GA 2AEUA 1YOOA 2D7ZA 4JF1A 1DJ9A 3GBXA 1B4XA 1TATA 2CJGA 1ARIA 3BCAA 2PO3A 2AY5A 2VIBA 1YJYA 3FQ8A 1DTYA 1ORDA 3ISLA 4L0OA 3T32A 5BJ3A 5JAYA 3H9XA 5HXXA 3CBFA 4LW4A 5EQCA 1RV4A 1UU0A 3HDOA 1ARTA 1CZCA 1M0NA 1PMOA 3A9ZA 2XH1A 7AATA 3NDNA 4EB7A 4ZM4A 1AKAA 1AICA 3IHJA 5E4ZA 2Z9XA 1D7UA 1O61A 3KKIA 3PGYA 4CBRA 2ZUKA 1O69A 4A00A 3PDBB 2W7FA 4PIWA 1DJEA 3I16A 1TOEA 1ZC9A 4UHOA 4M2KA 1AAWA 3F0HA 3W1HA 3NYSA 5AX8A 4EMYA 1AHXA 1C7NA 5EIGB 2BI3A 2FN6A 2Z9UA 4WB0B 4WYFA 1GC3A 3ZRRA 4WYAA 2VMWA 3WCOA 2ZJGA 2Z1ZA 1S09A 2FNUA 3JZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WBT A;  2DGM A;  3RCH B;  3RUY A;  4A6U A;  1ASG A;  4ADD A;  4RJ0 A;  1IBJ A;  3ATH A;  2VMP A;  3DOD A;  4GSA A;  4EFF A;  1IX7 A;  2QB3 A;  1MLY A;  3EI6 A;  4N0B A;  2W8V A;  3G8M A;  2VMX A;  4W1W A;  2W7I A;  1CQ6 A;  3L8A A;  2G6W A;  3EI8 A;  2AY3 A;  2X8U A;  4IXZ A;  4OMA A;  1AJS A;  4ZAH A;  2E7I A;  1SZS A;  3VK4 A;  4Y0I A;  4JEV A;  1YAA A;  1W23 A;  2EGY A;  3WKS A;  2DKB A;  4P3M A;  1C0N A;  3CAI A;  1LK9 A;  1H0C A;  1SVV A;  3BV0 A;  4ATP A;  3E9K A;  4KAM A;  5LHA A;  4PFF A;  4RM1 A;  2ZY3 A;  2YCP A;  4CXR A;  3R4T A;  3B8X A;  2VGV A;  3NRA A;  2VMT A;  3FVX A;  2VMU A;  2XBN A;  3FVS A;  2PB0 A;  1G7W A;  3W1I A;  2D64 A;  3MAU A;  2JIS A;  4WXB A;  1BQD A;  4B98 A;  4TN4 A;  4RIZ A;  2W7G A;  4ZDL A;  4XK1 A;  1D7V A;  1GCK A;  3BCX A;  4M2J A;  3AEJ C;  1CL1 A;  2HUU A;  3AEM C;  3AEN A;  2W8W A;  4MKJ A;  1XEY A;  4ZLV A;  4F5L A;  2CH1 A;  2BYL A;  2D63 A;  3PDX A;  2HOX A;  1TAR A;  3N0L A;  1QJ3 A;  1ARH A;  1TPL A;  3FKD A;  2CH2 A;  3B1C A;  4JE5 D;  2ZSL A;  2JJG A;  5FT4 A;  2Z67 A;  3QHX A;  5EUD A;  3K40 A;  3LWS A;  5F9S A;  2W7M A;  3Q8N A;  1W3U A;  1PFF A;  4WLH A;  4F5G A;  2Z1Y A;  3A9Y A;  3WZF A;  3F9T A;  2CTZ A;  3BC8 A;  4W8I A;  3VP6 A;  1ELQ A;  1UKJ A;  1TOK A;  5FT6 A;  5DJ9 A;  4B9B A;  4E77 A;  3L44 A;  1N8P A;  3RBL A;  3RCH A;  2X3L A;  1GC4 A;  4IX8 A;  1MDZ A;  4BQ0 A;  1AIB A;  5I92 A;  1B8G A;  4BMK A;  2FNI A;  2E54 A;  3ECD A;  5FT8 A;  3KGW A;  4E1O A;  1MLZ A;  5M4D A;  1BKG A;  4ZDO A;  2D7Y A;  2CAN A;  3BWO A;  2Z61 A;  1AY8 A;  3EZS A;  1BS0 A;  1JF9 A;  1S08 A;  1V2E A;  1V2D A;  2EH6 A;  4LNL A;  4ADB A;  3EI5 A;  4AO4 A;  4GRX A;  3DYD A;  2VLH A;  5EFS A;  1BW0 A;  1W7M A;  2EZ2 A;  3LV2 A;  1M4N A;  4BHD A;  3HL2 A;  1TOJ A;  5LH9 A;  1AJS B;  1O62 A;  1MAQ A;  4OBV A;  1YIY A;  3BWN C;  4R5F A;  5TF5 A;  3BB8 A;  3LG0 A;  3DRD A;  1BJ4 A;  1OXO A;  2W7H A;  3GZC A;  3WLX A;  4K2B A;  2BHX A;  3TQX A;  4ZAS A;  4A6T A;  5DJ1 A;  1AX4 A;  3AEM A;  1AMR A;  4XAU A;  3TCM A;  3ASA A;  4ZWV A;  1WST A;  4U2H A;  4Q75 A;  4WYE A;  3QN6 A;  1WYU A;  2VMR A;  2C44 A;  2YCN A;  2ZY5 A;  1X29 A;  3AEO A;  4LNJ A;  3W1J A;  4W91 A;  2EO5 A;  3GET A;  2E7U A;  5G2Q A;  4E3Q A;  3UWC A;  3JTX A;  1KL2 A;  3AEP A;  2ZY2 A;  2YHK A;  2D65 A;  4R2N A;  3DXV A;  4A0G A;  1J32 A;  4R8D A;  3I4J A;  1GEW A;  1QZ9 A;  1AY5 A;  3DR4 A;  4OTL A;  1E5E A;  3NUB A;  1TOG A;  3QGU A;  2HP1 A;  4WXG A;  1LC7 A;  2BIA A;  2R0T A;  5G4J A;  3WGB A;  1YIZ A;  5K8B A;  2CY8 A;  1JS3 A;  3AEN B;  2YKY A;  4J8L A;  4N0W A;  4LNM A;  4IYO A;  4PFN A;  1WYV B;  1D2F A;  3E2Z A;  4ATQ A;  2YRI A;  3E2Y A;  3LVJ A;  4DBC A;  2ZY4 A;  2RFV A;  2W8U A;  1DGD A;  1I41 A;  1M0Q A;  3AEL A;  2ZSM A;  1X0M A;  2HUF A;  3H7F A;  4JEY A;  2DGL A;  1ASC A;  3CQ4 A;  1S06 A;  3N5M A;  1IX6 A;  4P7Y A;  1BJN A;  4A0H A;  1GC0 A;  4Q6R A;  4ISY A;  1ASL A;  2D5Y A;  1CQ7 A;  5C6U A;  3MC6 C;  5IWQ A;  1RV3 A;  1GBN A;  3BWN A;  1AMQ A;  4WD2 A;  3JWA A;  1QIS A;  1OHY A;  4F5K A;  1CJ0 A;  1EJI A;  2DOU A;  2GMS A;  2VMS A;  1X28 A;  2Q7W A;  2BKW A;  4F5I A;  3DZZ A;  1ARS A;  2E7J A;  3TFT A;  2ZP7 A;  4F4E A;  3BS8 A;  1MDX A;  2PB2 A;  2V0Y A;  2VI9 A;  3JW9 A;  3MKJ A;  4FL0 A;  4NOG A;  1LC5 A;  4LW2 A;  1WKG A;  2O7C A;  3WKR A;  3K28 A;  3DXW A;  1MGV A;  1FG7 A;  2VGW A;  4WYC A;  3VK2 A;  3G0T A;  1J04 A;  1IJI A;  3PA9 A;  1G4X A;  2C7T A;  4PVF A;  4OC9 A;  1OAT A;  3GZD C;  3A9X A;  2YOB A;  1QGN A;  1VEF A;  4XEW A;  1ELU A;  1LKC A;  3NUI A;  2X5F A;  2OQX A;  4ITG A;  2OGE A;  1C4K A;  1H1C A;  1N2T A;  1C7G A;  4ZSY A;  1ECX A;  2QLR A;  1WYU B;  3LVL B;  4HVK A;  1AKB A;  1UU1 A;  4WXF A;  4AH3 A;  4EU1 A;  4ZDP A;  1B5P A;  3FFR A;  4RAE A;  3FTB A;  1CQ8 A;  1SF2 A;  5HDM A;  1CL2 A;  1KKJ A;  1WYT B;  2HZP A;  2YKU A;  4BA5 A;  1LS3 A;  4OYT A;  4W1X A;  4QGR A;  4ZSW A;  1GC2 A;  1ZOB A;  2WKA A;  4Y0D A;  3FCR A;  3DC1 A;  4MQR A;  1OHW A;  3N75 A;  3MC6 A;  3AV7 A;  3KE3 A;  3FDD A;  1WYV A;  4LC3 A;  4IYO B;  3E2Z B;  1AKC A;  1AJR A;  2HOZ A;  1PMM A;  2O1B A;  1MDO A;  2BI1 A;  3GJU A;  2BWP A;  1AHF A;  2ZYJ A;  3FD0 A;  3NU8 A;  1D7R A;  1O4S A;  3EIA A;  3WY7 A;  5EAV A;  4TMR A;  3B1D A;  2R5C A;  5EAA A;  4GDY A;  5DB5 A;  2D66 A;  2OKK A;  5M46 A;  2WK9 A;  5G0A A;  3WCN A;  9AAT A;  3GZD A;  3E77 A;  4GE4 A;  4AZJ A;  3FQ7 A;  3NNK A;  3VAX A;  3ELE A;  2C81 A;  2Z9V A;  3TFU A;  4JE5 A;  1LC8 A;  2JJH A;  2GMU A;  1ASN A;  4ADC A;  4F5M A;  3MBB A;  1T3I A;  2W8T A;  3NYT A;  2BI2 A;  2X5D A;  3QI6 A;  4WYG A;  3AOW A;  2R5E A;  1X2A A;  2VGU A;  3H14 A;  2CFB A;  4OBU A;  3IF2 A;  2AEV A;  2JG2 A;  1IAY A;  4U1T A;  3COG A;  1G7X A;  2QMA A;  2VMZ A;  3R9A A;  3G7Q A;  1FC4 A;  2EZ1 A;  4E3R A;  2CJD A;  4IY7 A;  3ELP A;  1BT4 A;  3NX3 A;  4GE7 A;  3WX9 A;  3MAF A;  3PD6 A;  4WP0 A;  2W8J A;  2W7L A;  2VGS A;  1GEY A;  3NTJ A;  1WKH A;  2YRR A;  4MSO A;  4JEW A;  1WYT A;  2AY1 A;  4EB5 A;  2BI9 A;  4MY5 A;  2R2N A;  1RVY A;  3MAD A;  1AIA A;  4O6Z A;  1AHY A;  2BI5 A;  3AOV A;  1RVU A;  2HUI A;  1LW4 A;  2BWO A;  4KXK A;  4MQQ A;  4AO9 A;  1OXP A;  1PG8 A;  1ARG A;  4HF8 A;  4F5F A;  1DKA A;  3HT4 A;  2AY8 A;  2DR1 A;  2QBT A;  1YJZ A;  1BJO B;  4UOY A;  4KYO A;  4DQ6 A;  4M2M A;  2BIG A;  2AY6 A;  2QB2 A;  1ASB A;  4MQP A;  3KGX A;  2VGZ A;  2VMQ A;  3LVM A;  3FDB A;  2Z20 A;  1B9I A;  3DR7 A;  3PJ0 A;  1AHG A;  1QJ5 A;  3EIB A;  1CZE A;  4ZM3 A;  2VIA A;  2CJH A;  4I8A A;  1QIT A;  1C9C A;  3FZ6 A;  1VP4 A;  2AY2 A;  2R5C B;  1VJO A;  1ASE A;  5M4B A;  4J5U A;  2ORD A;  2D61 A;  2W7D A;  3ASB A;  1I48 A;  2BWN A;  4ZWM A;  1M0P A;  2AY4 A;  3PPL A;  1AMS A;  1Z3Z A;  4W5K A;  3RQ1 A;  1AAM A;  3HBX A;  5G09 A;  3TAT A;  1IAX A;  2W7K A;  4H51 A;  1Z7D A;  1S0A A;  1ASF A;  4Q31 A;  4AOA A;  5M49 A;  2HOR A;  3D6K A;  2WK8 A;  1B9H A;  1DGE A;  1YJS A;  1GDE A;  5J8Q A;  1ASM A;  1Y4I A;  3EZ1 A;  1KMK A;  1TOI A;  4RJY A;  1JS6 A;  3LY1 A;  3GSB A;  4IXO A;  4JF0 A;  4K2M A;  1W7L A;  8AAT A;  4A0R A;  3FRK A;  1EG5 A;  4CVQ A;  4RIT A;  1ASA A;  2VI8 A;  2GSA A;  3VK3 A;  2V1P A;  3QBO A;  5BJ4 A;  1EQB A;  1KKP A;  1SZU A;  3ZRQ A;  2W7J A;  3EI7 A;  4JEZ A;  4XQ2 A;  4Y0H A;  5HHY A;  2DGK A;  2Z9W A;  3MAF B;  3FSL A;  3B1E A;  3PD6 B;  4MGR A;  1N31 A;  1JG8 A;  3LVK A;  1V72 A;  1BQA A;  4F5J A;  1G4V A;  1OHV A;  4WYD A;  3ZZJ A;  2BYJ A;  2NMP A;  3GWP A;  4IW7 A;  1SFF A;  2AY9 A;  1C7O A;  1D7S A;  2JGT A;  4OCA A;  4K2I A;  2GQN A;  4MKK A;  1KMJ A;  2AY7 A;  1U08 A;  1AY4 A;  2VGT A;  2WK7 A;  4CBS A;  5DX5 A;  2HOY A;  3II0 A;  4XJO A;  1BJO A;  2VMN A;  3QPG A;  1UU2 A;  2FQ6 A;  4XJP A;  3A8U X;  5D95 A;  3P6K A;  3FZ7 A;  1SZK A;  1IVR A;  3QM2 A;  5E5I A;  3E2F A;  3UE8 A;  4CXQ A;  4UQV A;  3NYU A;  4GEB A;  2F8J A;  1M6S A;  5G4I A;  1ASD A;  2CB1 A;  1W7N A;  3FFH A;  1GEX A;  3GR9 A;  3NU7 A;  1M32 A;  4RKD A;  1IX8 A;  4ITX A;  3VOM A;  4RKC A;  3MEB A;  1CS1 A;  1AMA A;  2C0R A;  1ZOD A;  3HLM A;  3M5U A;  3USF A;  4ADE A;  3FQA A;  2YCT A;  1E5F A;  2CST A;  1YNU A;  1LW5 A;  1DFO A;  3PDB A;  4AZK A;  4W1V A;  3ZZK A;  4RLG A;  1IUG A;  2DKJ A;  4XJM A;  4R5Z A;  3HMU A;  3I5T A;  3B46 A;  3BCB A;  1XI9 A;  2OKJ A;  5EIG A;  4XJL A;  3BN1 A;  3DU4 A;  3OKS A;  2BIE A;  4WB0 A;  5D5S A;  1GD9 A;  2W7E A;  1FG3 A;  4UHM A;  3P1T A;  1QIR A;  2YKX A;  2EPJ A;  1M7Y A;  3WGC A;  1V2F A;  4A6R A;  3ACZ A;  1MAP A;  1S07 A;  2QA3 A;  3EI9 A;  1SPA A;  4WLJ A;  4UHN A;  5EUE A;  5EUN A;  4GE9 A;  1B5O A;  3PAA A;  4F5H A;  2VMV A;  2OAT A;  2VYC A;  3EUC A;  3HVY A;  5G2P A;  1I43 A;  2VMO A;  3A2B A;  4JEX A;  4BA4 A;  4FFC A;  3K7Y A;  1BJW A;  3JWB A;  3F6T A;  4OT8 A;  4A0F A;  3RBF A;  2OGA A;  2ZC0 A;  3AAT A;  3CQ5 A;  4A72 A;  2JJE A;  1AHE A;  4Q76 A;  2GB3 A;  1P3W A;  2VLF A;  2YKV A;  4DGT A;  3OP7 A;  2AAT A;  2FYF A;  2TPL A;  5F8V A;  2HP2 A;  1KL1 A;  3FVU A;  3FZ8 A;  1I29 A;  2CIN A;  5FT5 A;  3AEJ A;  3UAK A;  5E3K A;  4TV7 A;  1DJU A;  2FM1 A;  1TAS A;  2O0R A;  4IXS A;  3PIU A;  3JU7 A;  3ZRP A;  2VMY A;  3CQ6 A;  3HQT A;  3RI6 A;  1M0O A;  2JJF A;  3E6G A;  2AEU A;  1YOO A;  2D7Z A;  4JF1 A;  1DJ9 A;  3GBX A;  1B4X A;  1TAT A;  2CJG A;  1ARI A;  3BCA A;  2PO3 A;  2AY5 A;  2VIB A;  1YJY A;  3FQ8 A;  1DTY A;  1ORD A;  3ISL A;  4L0O A;  3T32 A;  5BJ3 A;  5JAY A;  5HXX A;  3CBF A;  4LW4 A;  5EQC A;  1RV4 A;  1UU0 A;  3HDO A;  1ART A;  1CZC A;  1M0N A;  1PMO A;  3A9Z A;  2XH1 A;  7AAT A;  3NDN A;  4EB7 A;  4ZM4 A;  1AKA A;  1AIC A;  3IHJ A;  5E4Z A;  2Z9X A;  1D7U A;  1O61 A;  3KKI A;  3PGY A;  4CBR A;  2ZUK A;  1O69 A;  4A00 A;  3PDB B;  2W7F A;  4PIW A;  1DJE A;  3I16 A;  1TOE A;  1ZC9 A;  4UHO A;  4M2K A;  1AAW A;  3F0H A;  3W1H A;  3NYS A;  5AX8 A;  4EMY A;  1AHX A;  1C7N A;  5EIG B;  2BI3 A;  2FN6 A;  2Z9U A;  4WB0 B;  4WYF A;  1GC3 A;  3ZRR A;  4WYA A;  2VMW A;  3WCO A;  2ZJG A;  2Z1Z A;  1S09 A;  2FNU A;  3JZL A; 
#chains in the Genus database with same CATH topology
 4WBT A;  2DGM A;  3RCH B;  3RUY A;  4A6U A;  2KFP A;  1ASG A;  4ADD A;  4RJ0 A;  4K05 A;  1IBJ A;  3ATH A;  2VMP A;  3DOD A;  4GSA A;  4EFF A;  1IX7 A;  2QB3 A;  1MLY A;  3EI6 A;  4N0B A;  2W8V A;  3G8M A;  2VMX A;  4W1W A;  2W7I A;  1CQ6 A;  3L8A A;  2G6W A;  3EI8 A;  2AY3 A;  2X8U A;  4IXZ A;  4OMA A;  1AJS A;  4ZAH A;  2E7I A;  1SZS A;  3VK4 A;  4Y0I A;  3N7N A;  4JEV A;  1YAA A;  1W23 A;  2EGY A;  3WKS A;  2DKB A;  4P3M A;  1C0N A;  3CAI A;  1LK9 A;  1H0C A;  1SVV A;  3BV0 A;  4ATP A;  3E9K A;  4KAM A;  5LHA A;  4PFF A;  4RM1 A;  2ZY3 A;  2YCP A;  4CXR A;  3R4T A;  3B8X A;  2VGV A;  3NRA A;  2VMT A;  3FVX A;  2VMU A;  2XBN A;  3FVS A;  2PB0 A;  1G7W A;  3W1I A;  2D64 A;  3MAU A;  2JIS A;  4WXB A;  1BQD A;  4B98 A;  4TN4 A;  4RIZ A;  2W7G A;  4ZDL A;  4XK1 A;  1D7V A;  1GCK A;  3BCX A;  4M2J A;  3AEJ C;  1CL1 A;  2HUU A;  3AEM C;  3AEN A;  2W8W A;  4MKJ A;  1XEY A;  4ZLV A;  4F5L A;  2CH1 A;  2BYL A;  2D63 A;  3PDX A;  2HOX A;  1TAR A;  3N0L A;  1QJ3 A;  1ARH A;  1TPL A;  3FKD A;  2CH2 A;  3B1C A;  4JE5 D;  2ZSL A;  2JJG A;  5FT4 A;  2Z67 A;  3QHX A;  5EUD A;  3K40 A;  3LWS A;  5F9S A;  2W7M A;  3Q8N A;  1W3U A;  1PFF A;  4WLH A;  4F5G A;  2Z1Y A;  3A9Y A;  3WZF A;  3F9T A;  2CTZ A;  3BC8 A;  4W8I A;  3VP6 A;  1ELQ A;  1UKJ A;  1TOK A;  5FT6 A;  5DJ9 A;  4B9B A;  4E77 A;  3L44 A;  1N8P A;  3RBL A;  3RCH A;  2X3L A;  1GC4 A;  4IX8 A;  1MDZ A;  4BQ0 A;  1AIB A;  5I92 A;  1B8G A;  4BMK A;  2FNI A;  2E54 A;  3ECD A;  5FT8 A;  3KGW A;  4E1O A;  1MLZ A;  5M4D A;  1BKG A;  4ZDO A;  2D7Y A;  2CAN A;  3BWO A;  2Z61 A;  1AY8 A;  3EZS A;  1BS0 A;  1JF9 A;  1S08 A;  1V2E A;  1V2D A;  2EH6 A;  4LNL A;  4ADB A;  3EI5 A;  4AO4 A;  4GRX A;  3DYD A;  2VLH A;  5EFS A;  1BW0 A;  1W7M A;  2EZ2 A;  3LV2 A;  1M4N A;  4BHD A;  3HL2 A;  1TOJ A;  5LH9 A;  1AJS B;  1O62 A;  1MAQ A;  4OBV A;  1YIY A;  3BWN C;  4R5F A;  5TF5 A;  3BB8 A;  3LG0 A;  3DRD A;  1BJ4 A;  1OXO A;  2W7H A;  3GZC A;  3WLX A;  4K2B A;  2BHX A;  3TQX A;  4ZAS A;  4A6T A;  5DJ1 A;  1AX4 A;  3AEM A;  1AMR A;  4XAU A;  3TCM A;  3ASA A;  4ZWV A;  1WST A;  4U2H A;  4Q75 A;  4WYE A;  3QN6 A;  1WYU A;  2VMR A;  2C44 A;  2YCN A;  2ZY5 A;  1X29 A;  3AEO A;  4LNJ A;  3W1J A;  4W91 A;  2WB6 A;  2EO5 A;  3GET A;  2E7U A;  5G2Q A;  4E3Q A;  3UWC A;  3JTX A;  1KL2 A;  3AEP A;  2ZY2 A;  2YHK A;  2D65 A;  4R2N A;  3DXV A;  4A0G A;  1J32 A;  4R8D A;  3I4J A;  1GEW A;  1QZ9 A;  1AY5 A;  3DR4 A;  4OTL A;  1E5E A;  3NUB A;  1TOG A;  3QGU A;  2HP1 A;  4WXG A;  1LC7 A;  2BIA A;  2R0T A;  5G4J A;  3WGB A;  1YIZ A;  5K8B A;  2CY8 A;  1JS3 A;  3AEN B;  2YKY A;  4J8L A;  4N0W A;  4LNM A;  4IYO A;  4PFN A;  1WYV B;  1D2F A;  3E2Z A;  2FKI A;  4ATQ A;  2YRI A;  3E2Y A;  3LVJ A;  4DBC A;  2ZY4 A;  2RFV A;  2W8U A;  1DGD A;  1I41 A;  1M0Q A;  3AEL A;  2ZSM A;  1X0M A;  2HUF A;  3H7F A;  4JEY A;  3N4S A;  2DGL A;  1ASC A;  3CQ4 A;  1S06 A;  3N5M A;  1IX6 A;  4P7Y A;  1BJN A;  4A0H A;  2G7J A;  1GC0 A;  4Q6R A;  4ISY A;  3N4R A;  1ASL A;  2D5Y A;  1CQ7 A;  5C6U A;  3MC6 C;  5IWQ A;  1RV3 A;  1GBN A;  3BWN A;  1AMQ A;  4WD2 A;  3JWA A;  1QIS A;  1OHY A;  4F5K A;  1CJ0 A;  1EJI A;  2DOU A;  2GMS A;  2VMS A;  1X28 A;  2Q7W A;  2BKW A;  4F5I A;  3DZZ A;  1ARS A;  2E7J A;  3TFT A;  2ZP7 A;  4F4E A;  3BS8 A;  1MDX A;  2PB2 A;  2V0Y A;  2VI9 A;  3JW9 A;  3MKJ A;  4FL0 A;  4NOG A;  1LC5 A;  4LW2 A;  1WKG A;  2O7C A;  3WKR A;  3K28 A;  3DXW A;  1MGV A;  1FG7 A;  2VGW A;  4WYC A;  3VK2 A;  3G0T A;  1J04 A;  1IJI A;  3PA9 A;  1G4X A;  2C7T A;  4PVF A;  4OC9 A;  1OAT A;  3GZD C;  3A9X A;  2YOB A;  1QGN A;  1VEF A;  4XEW A;  1ELU A;  1LKC A;  3NUI A;  2X5F A;  2OQX A;  4ITG A;  2OGE A;  1C4K A;  1H1C A;  1N2T A;  1C7G A;  4ZSY A;  1ECX A;  2QLR A;  1WYU B;  3LVL B;  4HVK A;  1AKB A;  1UU1 A;  4WXF A;  4AH3 A;  4EU1 A;  4ZDP A;  1B5P A;  3FFR A;  4RAE A;  3FTB A;  1CQ8 A;  1SF2 A;  5HDM A;  1CL2 A;  1KKJ A;  1WYT B;  2HZP A;  2YKU A;  4BA5 A;  1LS3 A;  4OYT A;  4W1X A;  4QGR A;  4ZSW A;  1GC2 A;  1ZOB A;  2WKA A;  4Y0D A;  3FCR A;  3DC1 A;  4MQR A;  1OHW A;  3N75 A;  3MC6 A;  3AV7 A;  3KE3 A;  3FDD A;  1WYV A;  4LC3 A;  4IYO B;  3E2Z B;  1AKC A;  1AJR A;  2HOZ A;  1PMM A;  2O1B A;  1MDO A;  2BI1 A;  3GJU A;  2BWP A;  1AHF A;  2ZYJ A;  3FD0 A;  3NU8 A;  1D7R A;  1O4S A;  3EIA A;  3WY7 A;  5EAV A;  5KTB A;  4TMR A;  3B1D A;  2R5C A;  5EAA A;  4GDY A;  5DB5 A;  2D66 A;  2OKK A;  5M46 A;  2WK9 A;  5G0A A;  3WCN A;  9AAT A;  3GZD A;  3E77 A;  4GE4 A;  4AZJ A;  3FQ7 A;  3NNK A;  3VAX A;  3ELE A;  2C81 A;  1KAF A;  2Z9V A;  3TFU A;  4JE5 A;  1LC8 A;  2JJH A;  2GMU A;  1ASN A;  4ADC A;  4F5M A;  3MBB A;  1T3I A;  2W8T A;  3NYT A;  2EYQ A;  2BI2 A;  2X5D A;  3QI6 A;  4WYG A;  3AOW A;  2R5E A;  1X2A A;  2VGU A;  3H14 A;  2CFB A;  4OBU A;  3IF2 A;  2AEV A;  2JG2 A;  1IAY A;  4U1T A;  3COG A;  1G7X A;  2QMA A;  2VMZ A;  3R9A A;  3G7Q A;  1FC4 A;  2EZ1 A;  4H63 Q;  4E3R A;  2CJD A;  4IY7 A;  3ELP A;  1BT4 A;  3NX3 A;  4GE7 A;  3WX9 A;  3MAF A;  3PD6 A;  4WP0 A;  2W8J A;  2W7L A;  2QSR A;  2VGS A;  1GEY A;  3NTJ A;  1WKH A;  2YRR A;  4MSO A;  4JEW A;  1WYT A;  2AY1 A;  4EB5 A;  2BI9 A;  4MY5 A;  2R2N A;  1RVY A;  3MAD A;  1AIA A;  4O6Z A;  1AHY A;  2BI5 A;  3AOV A;  1RVU A;  2HUI A;  1LW4 A;  2BWO A;  4KXK A;  4MQQ A;  4AO9 A;  1OXP A;  1PG8 A;  1ARG A;  4HF8 A;  4F5F A;  1DKA A;  3HT4 A;  2AY8 A;  2DR1 A;  2QBT A;  1YJZ A;  1BJO B;  4UOY A;  4KYO A;  4DQ6 A;  4M2M A;  2BIG A;  2AY6 A;  2QB2 A;  1ASB A;  4MQP A;  3KGX A;  2VGZ A;  2VMQ A;  3LVM A;  3FDB A;  2Z20 A;  3N4X A;  1B9I A;  3DR7 A;  3PJ0 A;  1AHG A;  1QJ5 A;  3EIB A;  1CZE A;  4ZM3 A;  2VIA A;  2CJH A;  4I8A A;  1QIT A;  1C9C A;  3FZ6 A;  1VP4 A;  2AY2 A;  2R5C B;  1VJO A;  1ASE A;  5M4B A;  4J5U A;  2ORD A;  2D61 A;  2W7D A;  3ASB A;  1I48 A;  2BWN A;  4ZWM A;  1M0P A;  2AY4 A;  3PPL A;  1AMS A;  1Z3Z A;  4W5K A;  3RQ1 A;  1AAM A;  3HBX A;  5G09 A;  3TAT A;  1IAX A;  2W7K A;  4H51 A;  1Z7D A;  1S0A A;  1ASF A;  4Q31 A;  4AOA A;  5M49 A;  2HOR A;  3D6K A;  2WK8 A;  1B9H A;  1DGE A;  2A1V A;  1YJS A;  1GDE A;  5J8Q A;  1ASM A;  1Y4I A;  3EZ1 A;  1KMK A;  1TOI A;  4RJY A;  1JS6 A;  3LY1 A;  3GSB A;  4IXO A;  4JF0 A;  4K2M A;  1W7L A;  8AAT A;  4A0R A;  3FRK A;  1EG5 A;  4CVQ A;  4RIT A;  1ASA A;  2VI8 A;  2GSA A;  3VK3 A;  2V1P A;  3QBO A;  5BJ4 A;  1EQB A;  1KKP A;  1SZU A;  3ZRQ A;  2W7J A;  3EI7 A;  4JEZ A;  4XQ2 A;  4Y0H A;  5HHY A;  2DGK A;  2Z9W A;  3MAF B;  3FSL A;  3B1E A;  3PD6 B;  4MGR A;  1N31 A;  1JG8 A;  3LVK A;  1V72 A;  1BQA A;  4F5J A;  1G4V A;  1OHV A;  4WYD A;  3ZZJ A;  2BYJ A;  2NMP A;  3GWP A;  4IW7 A;  1SFF A;  2AY9 A;  1C7O A;  1D7S A;  2JGT A;  4OCA A;  4K2I A;  2GQN A;  4MKK A;  1KMJ A;  2AY7 A;  1U08 A;  1AY4 A;  2VGT A;  2WK7 A;  4CBS A;  5DX5 A;  2HOY A;  3II0 A;  4XJO A;  1BJO A;  2VMN A;  3QPG A;  1UU2 A;  2FQ6 A;  4XJP A;  3A8U X;  5D95 A;  3P6K A;  3FZ7 A;  1SZK A;  1IVR A;  3QM2 A;  5E5I A;  3E2F A;  3UE8 A;  4CXQ A;  4UQV A;  3NYU A;  4GEB A;  2F8J A;  1M6S A;  5G4I A;  1ASD A;  2CB1 A;  1W7N A;  3FFH A;  1GEX A;  3GR9 A;  3NU7 A;  1M32 A;  4RKD A;  1IX8 A;  4ITX A;  3VOM A;  4RKC A;  3MEB A;  1CS1 A;  1AMA A;  2C0R A;  1ZOD A;  3HLM A;  3M5U A;  3USF A;  4ADE A;  3FQA A;  2YCT A;  1E5F A;  2CST A;  1YNU A;  1LW5 A;  1DFO A;  3PDB A;  4AZK A;  4W1V A;  3ZZK A;  4RLG A;  1IUG A;  2DKJ A;  4XJM A;  4R5Z A;  3HMU A;  3I5T A;  3B46 A;  3BCB A;  1XI9 A;  2OKJ A;  5EIG A;  4XJL A;  3BN1 A;  3DU4 A;  3OKS A;  2BIE A;  4WB0 A;  5D5S A;  1GD9 A;  2W7E A;  1FG3 A;  4UHM A;  3P1T A;  1QIR A;  2YKX A;  2EPJ A;  1M7Y A;  3WGC A;  1V2F A;  4A6R A;  3ACZ A;  1MAP A;  1S07 A;  2QA3 A;  3EI9 A;  1SPA A;  4WLJ A;  4UHN A;  5EUE A;  5EUN A;  4GE9 A;  1B5O A;  3PAA A;  4F5H A;  2VMV A;  2OAT A;  2VYC A;  3EUC A;  3HVY A;  5G2P A;  1I43 A;  2VMO A;  3A2B A;  4JEX A;  4BA4 A;  4FFC A;  3K7Y A;  1BJW A;  3JWB A;  3F6T A;  4OT8 A;  4A0F A;  3RBF A;  2OGA A;  2ZC0 A;  3AAT A;  3CQ5 A;  4A72 A;  2JJE A;  1AHE A;  4Q76 A;  2GB3 A;  1P3W A;  2VLF A;  2YKV A;  4DGT A;  3OP7 A;  2AAT A;  2FYF A;  2TPL A;  5F8V A;  2HP2 A;  1KL1 A;  3FVU A;  3FZ8 A;  1I29 A;  2CIN A;  5FT5 A;  3AEJ A;  3UAK A;  5E3K A;  4TV7 A;  1DJU A;  2FM1 A;  1TAS A;  2O0R A;  4IXS A;  3PIU A;  3JU7 A;  3ZRP A;  2VMY A;  3CQ6 A;  3HQT A;  3RI6 A;  1M0O A;  2JJF A;  3E6G A;  2AEU A;  1YOO A;  2D7Z A;  4JF1 A;  1DJ9 A;  3GBX A;  1B4X A;  1TAT A;  2CJG A;  1ARI A;  3BCA A;  2PO3 A;  2AY5 A;  2VIB A;  1YJY A;  3FQ8 A;  1DTY A;  1ORD A;  3ISL A;  4L0O A;  3T32 A;  5BJ3 A;  5JAY A;  3H9X A;  5HXX A;  3CBF A;  4LW4 A;  5EQC A;  1RV4 A;  1UU0 A;  3HDO A;  1ART A;  1CZC A;  1M0N A;  1PMO A;  3A9Z A;  2XH1 A;  7AAT A;  3NDN A;  4EB7 A;  4ZM4 A;  1AKA A;  1AIC A;  3IHJ A;  5E4Z A;  2Z9X A;  1D7U A;  1O61 A;  3KKI A;  3PGY A;  4CBR A;  2ZUK A;  1O69 A;  4A00 A;  3PDB B;  2W7F A;  4PIW A;  1DJE A;  3I16 A;  1TOE A;  1ZC9 A;  4UHO A;  4M2K A;  1AAW A;  3F0H A;  3W1H A;  3NYS A;  5AX8 A;  4EMY A;  1AHX A;  1C7N A;  5EIG B;  2BI3 A;  2FN6 A;  2Z9U A;  4WB0 B;  4WYF A;  1GC3 A;  3ZRR A;  4WYA A;  2VMW A;  3WCO A;  2ZJG A;  2Z1Z A;  1S09 A;  2FNU A;  3JZL A; 
#chains in the Genus database with same CATH homology
 4WBT A;  2DGM A;  3RCH B;  3RUY A;  4A6U A;  2KFP A;  1ASG A;  4ADD A;  4RJ0 A;  4K05 A;  1IBJ A;  3ATH A;  2VMP A;  3DOD A;  4GSA A;  4EFF A;  1IX7 A;  2QB3 A;  1MLY A;  3EI6 A;  4N0B A;  2W8V A;  3G8M A;  2VMX A;  4W1W A;  2W7I A;  1CQ6 A;  3L8A A;  2G6W A;  3EI8 A;  2AY3 A;  2X8U A;  4IXZ A;  4OMA A;  1AJS A;  4ZAH A;  2E7I A;  1SZS A;  3VK4 A;  4Y0I A;  3N7N A;  4JEV A;  1YAA A;  1W23 A;  2EGY A;  3WKS A;  2DKB A;  4P3M A;  1C0N A;  3CAI A;  1LK9 A;  1H0C A;  1SVV A;  3BV0 A;  4ATP A;  3E9K A;  4KAM A;  5LHA A;  4PFF A;  4RM1 A;  2ZY3 A;  2YCP A;  4CXR A;  3R4T A;  3B8X A;  2VGV A;  3NRA A;  2VMT A;  3FVX A;  2VMU A;  2XBN A;  3FVS A;  2PB0 A;  1G7W A;  3W1I A;  2D64 A;  3MAU A;  2JIS A;  4WXB A;  1BQD A;  4B98 A;  4TN4 A;  4RIZ A;  2W7G A;  4ZDL A;  4XK1 A;  1D7V A;  1GCK A;  3BCX A;  4M2J A;  3AEJ C;  1CL1 A;  2HUU A;  3AEM C;  3AEN A;  2W8W A;  4MKJ A;  1XEY A;  4ZLV A;  4F5L A;  2CH1 A;  2BYL A;  2D63 A;  3PDX A;  2HOX A;  1TAR A;  3N0L A;  1QJ3 A;  1ARH A;  1TPL A;  3FKD A;  2CH2 A;  3B1C A;  4JE5 D;  2ZSL A;  2JJG A;  5FT4 A;  2Z67 A;  3QHX A;  5EUD A;  3K40 A;  3LWS A;  5F9S A;  2W7M A;  3Q8N A;  1W3U A;  1PFF A;  4WLH A;  4F5G A;  2Z1Y A;  3A9Y A;  3WZF A;  3F9T A;  2CTZ A;  3BC8 A;  4W8I A;  3VP6 A;  1ELQ A;  1UKJ A;  1TOK A;  5FT6 A;  5DJ9 A;  4B9B A;  4E77 A;  3L44 A;  1N8P A;  3RBL A;  3RCH A;  2X3L A;  1GC4 A;  4IX8 A;  1MDZ A;  4BQ0 A;  1AIB A;  5I92 A;  1B8G A;  4BMK A;  2FNI A;  2E54 A;  3ECD A;  5FT8 A;  3KGW A;  4E1O A;  1MLZ A;  5M4D A;  1BKG A;  4ZDO A;  2D7Y A;  2CAN A;  3BWO A;  2Z61 A;  1AY8 A;  3EZS A;  1BS0 A;  1JF9 A;  1S08 A;  1V2E A;  1V2D A;  2EH6 A;  4LNL A;  4ADB A;  3EI5 A;  4AO4 A;  4GRX A;  3DYD A;  2VLH A;  5EFS A;  1BW0 A;  1W7M A;  2EZ2 A;  3LV2 A;  1M4N A;  4BHD A;  3HL2 A;  1TOJ A;  5LH9 A;  1AJS B;  1O62 A;  1MAQ A;  4OBV A;  1YIY A;  3BWN C;  4R5F A;  5TF5 A;  3BB8 A;  3LG0 A;  3DRD A;  1BJ4 A;  1OXO A;  2W7H A;  3GZC A;  3WLX A;  4K2B A;  2BHX A;  3TQX A;  4ZAS A;  4A6T A;  5DJ1 A;  1AX4 A;  3AEM A;  1AMR A;  4XAU A;  3TCM A;  3ASA A;  4ZWV A;  1WST A;  4U2H A;  4Q75 A;  4WYE A;  3QN6 A;  1WYU A;  2VMR A;  2C44 A;  2YCN A;  2ZY5 A;  1X29 A;  3AEO A;  4LNJ A;  3W1J A;  4W91 A;  2WB6 A;  2EO5 A;  3GET A;  2E7U A;  5G2Q A;  4E3Q A;  3UWC A;  3JTX A;  1KL2 A;  3AEP A;  2ZY2 A;  2YHK A;  2D65 A;  4R2N A;  3DXV A;  4A0G A;  1J32 A;  4R8D A;  3I4J A;  1GEW A;  1QZ9 A;  1AY5 A;  3DR4 A;  4OTL A;  1E5E A;  3NUB A;  1TOG A;  3QGU A;  2HP1 A;  4WXG A;  1LC7 A;  2BIA A;  2R0T A;  5G4J A;  3WGB A;  1YIZ A;  5K8B A;  2CY8 A;  1JS3 A;  3AEN B;  2YKY A;  4J8L A;  4N0W A;  4LNM A;  4IYO A;  4PFN A;  1WYV B;  1D2F A;  3E2Z A;  2FKI A;  4ATQ A;  2YRI A;  3E2Y A;  3LVJ A;  4DBC A;  2ZY4 A;  2RFV A;  2W8U A;  1DGD A;  1I41 A;  1M0Q A;  3AEL A;  2ZSM A;  1X0M A;  2HUF A;  3H7F A;  4JEY A;  3N4S A;  2DGL A;  1ASC A;  3CQ4 A;  1S06 A;  3N5M A;  1IX6 A;  4P7Y A;  1BJN A;  4A0H A;  2G7J A;  1GC0 A;  4Q6R A;  4ISY A;  3N4R A;  1ASL A;  2D5Y A;  1CQ7 A;  5C6U A;  3MC6 C;  5IWQ A;  1RV3 A;  1GBN A;  3BWN A;  1AMQ A;  4WD2 A;  3JWA A;  1QIS A;  1OHY A;  4F5K A;  1CJ0 A;  1EJI A;  2DOU A;  2GMS A;  2VMS A;  1X28 A;  2Q7W A;  2BKW A;  4F5I A;  3DZZ A;  1ARS A;  2E7J A;  3TFT A;  2ZP7 A;  4F4E A;  3BS8 A;  1MDX A;  2PB2 A;  2V0Y A;  2VI9 A;  3JW9 A;  3MKJ A;  4FL0 A;  4NOG A;  1LC5 A;  4LW2 A;  1WKG A;  2O7C A;  3WKR A;  3K28 A;  3DXW A;  1MGV A;  1FG7 A;  2VGW A;  4WYC A;  3VK2 A;  3G0T A;  1J04 A;  1IJI A;  3PA9 A;  1G4X A;  2C7T A;  4PVF A;  4OC9 A;  1OAT A;  3GZD C;  3A9X A;  2YOB A;  1QGN A;  1VEF A;  4XEW A;  1ELU A;  1LKC A;  3NUI A;  2X5F A;  2OQX A;  4ITG A;  2OGE A;  1C4K A;  1H1C A;  1N2T A;  1C7G A;  4ZSY A;  1ECX A;  2QLR A;  1WYU B;  3LVL B;  4HVK A;  1AKB A;  1UU1 A;  4WXF A;  4AH3 A;  4EU1 A;  4ZDP A;  1B5P A;  3FFR A;  4RAE A;  3FTB A;  1CQ8 A;  1SF2 A;  5HDM A;  1CL2 A;  1KKJ A;  1WYT B;  2HZP A;  2YKU A;  4BA5 A;  1LS3 A;  4OYT A;  4W1X A;  4QGR A;  4ZSW A;  1GC2 A;  1ZOB A;  2WKA A;  4Y0D A;  3FCR A;  3DC1 A;  4MQR A;  1OHW A;  3N75 A;  3MC6 A;  3AV7 A;  3KE3 A;  3FDD A;  1WYV A;  4LC3 A;  4IYO B;  3E2Z B;  1AKC A;  1AJR A;  2HOZ A;  1PMM A;  2O1B A;  1MDO A;  2BI1 A;  3GJU A;  2BWP A;  1AHF A;  2ZYJ A;  3FD0 A;  3NU8 A;  1D7R A;  1O4S A;  3EIA A;  3WY7 A;  5EAV A;  5KTB A;  4TMR A;  3B1D A;  2R5C A;  5EAA A;  4GDY A;  5DB5 A;  2D66 A;  2OKK A;  5M46 A;  2WK9 A;  5G0A A;  3WCN A;  9AAT A;  3GZD A;  3E77 A;  4GE4 A;  4AZJ A;  3FQ7 A;  3NNK A;  3VAX A;  3ELE A;  2C81 A;  2Z9V A;  3TFU A;  4JE5 A;  1LC8 A;  2JJH A;  2GMU A;  1ASN A;  4ADC A;  4F5M A;  3MBB A;  1T3I A;  2W8T A;  3NYT A;  2EYQ A;  2BI2 A;  2X5D A;  3QI6 A;  4WYG A;  3AOW A;  2R5E A;  1X2A A;  2VGU A;  3H14 A;  2CFB A;  4OBU A;  3IF2 A;  2AEV A;  2JG2 A;  1IAY A;  4U1T A;  3COG A;  1G7X A;  2QMA A;  2VMZ A;  3R9A A;  3G7Q A;  1FC4 A;  2EZ1 A;  4H63 Q;  4E3R A;  2CJD A;  4IY7 A;  3ELP A;  1BT4 A;  3NX3 A;  4GE7 A;  3WX9 A;  3MAF A;  3PD6 A;  4WP0 A;  2W8J A;  2W7L A;  2QSR A;  2VGS A;  1GEY A;  3NTJ A;  1WKH A;  2YRR A;  4MSO A;  4JEW A;  1WYT A;  2AY1 A;  4EB5 A;  2BI9 A;  4MY5 A;  2R2N A;  1RVY A;  3MAD A;  1AIA A;  4O6Z A;  1AHY A;  2BI5 A;  3AOV A;  1RVU A;  2HUI A;  1LW4 A;  2BWO A;  4KXK A;  4MQQ A;  4AO9 A;  1OXP A;  1PG8 A;  1ARG A;  4HF8 A;  4F5F A;  1DKA A;  3HT4 A;  2AY8 A;  2DR1 A;  2QBT A;  1YJZ A;  1BJO B;  4UOY A;  4KYO A;  4DQ6 A;  4M2M A;  2BIG A;  2AY6 A;  2QB2 A;  1ASB A;  4MQP A;  3KGX A;  2VGZ A;  2VMQ A;  3LVM A;  3FDB A;  2Z20 A;  3N4X A;  1B9I A;  3DR7 A;  3PJ0 A;  1AHG A;  1QJ5 A;  3EIB A;  1CZE A;  4ZM3 A;  2VIA A;  2CJH A;  4I8A A;  1QIT A;  1C9C A;  3FZ6 A;  1VP4 A;  2AY2 A;  2R5C B;  1VJO A;  1ASE A;  5M4B A;  4J5U A;  2ORD A;  2D61 A;  2W7D A;  3ASB A;  1I48 A;  2BWN A;  4ZWM A;  1M0P A;  2AY4 A;  3PPL A;  1AMS A;  1Z3Z A;  4W5K A;  3RQ1 A;  1AAM A;  3HBX A;  5G09 A;  3TAT A;  1IAX A;  2W7K A;  4H51 A;  1Z7D A;  1S0A A;  1ASF A;  4Q31 A;  4AOA A;  5M49 A;  2HOR A;  3D6K A;  2WK8 A;  1B9H A;  1DGE A;  2A1V A;  1YJS A;  1GDE A;  5J8Q A;  1ASM A;  1Y4I A;  3EZ1 A;  1KMK A;  1TOI A;  4RJY A;  1JS6 A;  3LY1 A;  3GSB A;  4IXO A;  4JF0 A;  4K2M A;  1W7L A;  8AAT A;  4A0R A;  3FRK A;  1EG5 A;  4CVQ A;  4RIT A;  1ASA A;  2VI8 A;  2GSA A;  3VK3 A;  2V1P A;  3QBO A;  5BJ4 A;  1EQB A;  1KKP A;  1SZU A;  3ZRQ A;  2W7J A;  3EI7 A;  4JEZ A;  4XQ2 A;  4Y0H A;  5HHY A;  2DGK A;  2Z9W A;  3MAF B;  3FSL A;  3B1E A;  3PD6 B;  4MGR A;  1N31 A;  1JG8 A;  3LVK A;  1V72 A;  1BQA A;  4F5J A;  1G4V A;  1OHV A;  4WYD A;  3ZZJ A;  2BYJ A;  2NMP A;  3GWP A;  4IW7 A;  1SFF A;  2AY9 A;  1C7O A;  1D7S A;  2JGT A;  4OCA A;  4K2I A;  2GQN A;  4MKK A;  1KMJ A;  2AY7 A;  1U08 A;  1AY4 A;  2VGT A;  2WK7 A;  4CBS A;  5DX5 A;  2HOY A;  3II0 A;  4XJO A;  1BJO A;  2VMN A;  3QPG A;  1UU2 A;  2FQ6 A;  4XJP A;  3A8U X;  5D95 A;  3P6K A;  3FZ7 A;  1SZK A;  1IVR A;  3QM2 A;  5E5I A;  3E2F A;  3UE8 A;  4CXQ A;  4UQV A;  3NYU A;  4GEB A;  2F8J A;  1M6S A;  5G4I A;  1ASD A;  2CB1 A;  1W7N A;  3FFH A;  1GEX A;  3GR9 A;  3NU7 A;  1M32 A;  4RKD A;  1IX8 A;  4ITX A;  3VOM A;  4RKC A;  3MEB A;  1CS1 A;  1AMA A;  2C0R A;  1ZOD A;  3HLM A;  3M5U A;  3USF A;  4ADE A;  3FQA A;  2YCT A;  1E5F A;  2CST A;  1YNU A;  1LW5 A;  1DFO A;  3PDB A;  4AZK A;  4W1V A;  3ZZK A;  4RLG A;  1IUG A;  2DKJ A;  4XJM A;  4R5Z A;  3HMU A;  3I5T A;  3B46 A;  3BCB A;  1XI9 A;  2OKJ A;  5EIG A;  4XJL A;  3BN1 A;  3DU4 A;  3OKS A;  2BIE A;  4WB0 A;  5D5S A;  1GD9 A;  2W7E A;  1FG3 A;  4UHM A;  3P1T A;  1QIR A;  2YKX A;  2EPJ A;  1M7Y A;  3WGC A;  1V2F A;  4A6R A;  3ACZ A;  1MAP A;  1S07 A;  2QA3 A;  3EI9 A;  1SPA A;  4WLJ A;  4UHN A;  5EUE A;  5EUN A;  4GE9 A;  1B5O A;  3PAA A;  4F5H A;  2VMV A;  2OAT A;  2VYC A;  3EUC A;  3HVY A;  5G2P A;  1I43 A;  2VMO A;  3A2B A;  4JEX A;  4BA4 A;  4FFC A;  3K7Y A;  1BJW A;  3JWB A;  3F6T A;  4OT8 A;  4A0F A;  3RBF A;  2OGA A;  2ZC0 A;  3AAT A;  3CQ5 A;  4A72 A;  2JJE A;  1AHE A;  4Q76 A;  2GB3 A;  1P3W A;  2VLF A;  2YKV A;  4DGT A;  3OP7 A;  2AAT A;  2FYF A;  2TPL A;  5F8V A;  2HP2 A;  1KL1 A;  3FVU A;  3FZ8 A;  1I29 A;  2CIN A;  5FT5 A;  3AEJ A;  3UAK A;  5E3K A;  4TV7 A;  1DJU A;  2FM1 A;  1TAS A;  2O0R A;  4IXS A;  3PIU A;  3JU7 A;  3ZRP A;  2VMY A;  3CQ6 A;  3HQT A;  3RI6 A;  1M0O A;  2JJF A;  3E6G A;  2AEU A;  1YOO A;  2D7Z A;  4JF1 A;  1DJ9 A;  3GBX A;  1B4X A;  1TAT A;  2CJG A;  1ARI A;  3BCA A;  2PO3 A;  2AY5 A;  2VIB A;  1YJY A;  3FQ8 A;  1DTY A;  1ORD A;  3ISL A;  4L0O A;  3T32 A;  5BJ3 A;  5JAY A;  3H9X A;  5HXX A;  3CBF A;  4LW4 A;  5EQC A;  1RV4 A;  1UU0 A;  3HDO A;  1ART A;  1CZC A;  1M0N A;  1PMO A;  3A9Z A;  2XH1 A;  7AAT A;  3NDN A;  4EB7 A;  4ZM4 A;  1AKA A;  1AIC A;  3IHJ A;  5E4Z A;  2Z9X A;  1D7U A;  1O61 A;  3KKI A;  3PGY A;  4CBR A;  2ZUK A;  1O69 A;  4A00 A;  3PDB B;  2W7F A;  4PIW A;  1DJE A;  3I16 A;  1TOE A;  1ZC9 A;  4UHO A;  4M2K A;  1AAW A;  3F0H A;  3W1H A;  3NYS A;  5AX8 A;  4EMY A;  1AHX A;  1C7N A;  5EIG B;  2BI3 A;  2FN6 A;  2Z9U A;  4WB0 B;  4WYF A;  1GC3 A;  3ZRR A;  4WYA A;  2VMW A;  3WCO A;  2ZJG A;  2Z1Z A;  1S09 A;  2FNU A;  3JZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...