2QB2A

Structural studies reveal the inactivation of e. coli l-aspartate aminotransferase by (s)-4,5-dihydro-2thiophenecarboylic acid (sadta) via two mechanisms (at ph 7.0).
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
395
structure length
381
Chain Sequence
FENITAAPDLFRAKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Inactivation of Escherichia coli L-aspartate aminotransferase by (S)-4-amino-4,5-dihydro-2-thiophenecarboxylic acid reveals "a tale of two mechanisms".
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 145
structure length 381
sequence length 395
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2qb2A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2qb2A01
2VLFA 4BA4A 3AEMC 3DR4A 1KKJA 2EGYA 1AHXA 3A9YA 4W1XA 4WYAA 4A0FA 8AATA 2ZY4A 1FG7A 2FYFA 3KKIA 4MQQA 4AZJA 1CS1A 3P1TA 4R8DA 1WYTB 2ZP7A 4B98A 1AIBA 1SZKA 3T32A 3BC8A 2VMVA 1ARIA 1EG5A 1GC0A 2AY9A 3FDBA 1ARGA 3QM2A 3MAUA 2AY2A 1V2FA 1W3UA 4WYDA 3NX3A 3DC1A 3PD6B 3MC6C 3N75A 3FTBA 4P3MA 4ZWVA 1GC4A 3WGCA 4GE9A 3EIBA 2E54A 4UHNA 4RIZA 3ELEA 1WSTA 2NMPA 3IF2A 3EI7A 4Q6RA 4XJLA 4WXGA 1CL1A 4F5LA 2BWOA 4RAEA 2HP2A 3FVXA 1H1CA 2QB2A 2BI5A 1B5OA 1ARTA 3QN6A 2JJHA 3GZDC 3ECDA 4F5GA 1D7RA 3MAFA 1SFFA 3A8UX 1MDZA 3WCOA 2CSTA 3BB8A 4WLJA 5JAYA 1TASA 3HQTA 5D5SA 1YNUA 3RI6A 5G09A 3E2YA 2QMAA 1AHGA 1D2FA 5EAAA 3AEPA 1VP4A 2X5FA 2VGTA 1DJEA 2VMXA 5DX5A 1PMMA 2W7HA 1XI9A 1PG8A 1CZEA 5G2QA 1GC3A 4CBRA 1BW0A 2W7EA 4ADCA 2CFBA 3RBLA 2VMTA 2WKAA 3VK3A 1V72A 5FT8A 4E77A 3A9XA 3BV0A 1ASGA 1QZ9A 2YKYA 2ZY3A 1O69A 4A72A 3FDDA 1TOEA 4CVQA 3OP7A 2ZC0A 2X5DA 2W8UA 2Z20A 3PIUA 4ZAHA 4PFFA 5F8VA 3TQXA 4DQ6A 4ZM3A 2OQXA 3FZ8A 1AJSB 3PPLA 1V2DA 1Y4IA 1AHEA 3AENB 3K40A 1QIRA 4ZM4A 4A0HA 1IX7A 1OATA 4MY5A 2VMRA 3FZ7A 2C44A 3ZRPA 1TOGA 1B9IA 1SVVA 1LC7A 2JGTA 3MEBA 4WYEA 3FZ6A 3COGA 3GSBA 5G2PA 3PDBA 2VMZA 4ZWMA 4OMAA 4UHMA 1DFOA 1KL2A 1X29A 4O6ZA 5F9SA 1DGDA 1ASFA 1M6SA 2DGKA 1M0QA 1W7NA 4XJPA 5DJ9A 3JZLA 2BYJA 4EB7A 3L44A 2ZSMA 4WYFA 3LVLB 5EIGA 3EIAA 2YCPA 3EI9A 4FFCA 3I16A 1IAYA 4XQ2A 3F0HA 1I29A 3WCNA 4ZLVA 4ZSYA 4IY7A 5C6UA 4MKJA 2DOUA 3G0TA 3TCMA 1ECXA 4E3RA 1GBNA 3A2BA 4GRXA 4ISYA 2VIAA 1G4XA 5AX8A 3ZZKA 1GD9A 4F5MA 4OBVA 2ZY5A 1VJOA 5FT5A 4GDYA 4WLHA 2YKUA 4AO9A 1W7MA 5M49A 3CQ5A 4F5HA 3FFHA 1BJOA 1ASLA 2DGMA 3DR7A 4HVKA 3PJ0A 5M4DA 1PFFA 1GEXA 2VMQA 1WYUB 4M2KA 1P3WA 4L0OA 4JE5D 3AEOA 4Q75A 4QGRA 1DJUA 1N31A 3USFA 2C7TA 2W7KA 4IXSA 5EUDA 4GEBA 1TPLA 2BIGA 1AAWA 3NUIA 1AMRA 2C81A 3JW9A 2QA3A 2JG2A 2W7JA 1LK9A 1WYVB 5K8BA 3ASBA 1I41A 4EMYA 1ORDA 3RCHB 2JISA 2E7JA 4U2HA 1AY4A 4AO4A 1B9HA 5G4IA 1C9CA 1I48A 4GE4A 3HBXA 4JE5A 2FN6A 1ASBA 1OHWA 1BT4A 2F8JA 3LG0A 4XAUA 4IYOB 1ASEA 1S06A 5BJ4A 4CBSA 4TN4A 2AY4A 2Z67A 2W7LA 2CINA 1AKCA 4W5KA 4A6TA 3AOVA 1RVYA 3E9KA 1CQ6A 1QGNA 3B46A 3BWNA 1DJ9A 2AY3A 2VGUA 3IHJA 4DGTA 1BJWA 2R5CA 4F5IA 2Z9UA 2AY5A 3F9TA 3MKJA 3E77A 2VLHA 3ZRRA 1C4KA 2EPJA 1AY8A 1RVUA 4WB0B 4WXFA 3F6TA 3W1HA 4EFFA 3E2ZA 4ADEA 1BJ4A 4Q31A 3VP6A 1TOJA 1KKPA 1X0MA 3QI6A 1WYTA 1MAPA 1UU1A 4ITXA 2OKJA 1YJSA 3NRAA 2Z9WA 1DKAA 4ZDLA 2FNUA 2Z9VA 3AEJA 2CH1A 2O7CA 3NU8A 1YIYA 4GE7A 1WKGA 4XJMA 4P7YA 4E3QA 3PD6A 1AICA 5E3KA 1Z7DA 5E5IA 1JG8A 3CQ4A 3HLMA 5LHAA 1PMOA 2CH2A 2VMUA 1AMAA 2BI2A 2C0RA 3UWCA 2Z1ZA 2OGEA 2D61A 1O62A 1JS6A 1ZC9A 1ASMA 2D5YA 4J8LA 2AY7A 4XJOA 3CBFA 1TARA 2AATA 5IWQA 3NDNA 4WYCA 1JF9A 2YKVA 4JEYA 3A9ZA 1ARHA 5G0AA 4JEWA 2Z61A 2GSAA 2O0RA 3NUBA 3OKSA 1H0CA 2V1PA 3QGUA 3B1DA 1ASNA 3FFRA 3WZFA 2PB0A 5EUNA 2BWPA 1E5EA 1UKJA 3H14A 4F4EA 1V2EA 3AEMA 3FD0A 4PIWA 3MADA 3G8MA 3WX9A 4MQRA 1YJZA 4E1OA 2VMNA 3MBBA 4KXKA 2R5EA 3FRKA 4OC9A 2GQNA 3LV2A 1E5FA 1CJ0A 4N0WA 3AOWA 1AX4A 1I43A 4ATPA 1MDOA 3Q8NA 1QISA 3N0LA 4W1VA 3DXVA 3TATA 2CTZA 2FM1A 1D7VA 2W7FA 4OTLA 3MC6A 4ADBA 3ISLA 3FVSA 3NYUA 2HUFA 5M4BA 3PGYA 1C7OA 1AJSA 3BCXA 3D6KA 3W1JA 3K28A 3AENA 1S09A 5EAVA 3HL2A 1KMKA 2DGLA 3RQ1A 1W23A 4AH3A 1GDEA 3DODA 4R5ZA 1MAQA 5HHYA 2DKBA 3AELA 1S0AA 2YOBA 3HMUA 2YRRA 4W1WA 4BQ0A 2HUUA 4RLGA 4A6UA 1X2AA 2X8UA 3UE8A 1YOOA 4TV7A 3BN1A 3ZRQA 1YIZA 2VGSA 3I4JA 3JWAA 3HVYA 3EI5A 2CJGA 2ZY2A 1CL2A 4RKCA 3GZDA 2QB3A 2ZYJA 2AY8A 4IX8A 1LKCA 2VGZA 3VAXA 4M2MA 1TOKA 4FL0A 1UU2A 4LW4A 1AY5A 1Z3ZA 2D66A 1B5PA 2CB1A 4AZKA 3H7FA 2BWNA 3NU7A 1LS3A 1BJNA 3AATA 3II0A 3KE3A 1GC2A 1M32A 2D64A 2G6WA 3B1EA 3BS8A 1IVRA 1D7SA 3VOMA 3GJUA 4OBUA 5FT6A 1ASAA 1LW4A 3W1IA 2ZJGA 3WGBA 1ASCA 1IX6A 1YJYA 3EI8A 4LNMA 4BMKA 5FT4A 3LY1A 1GEYA 1N2TA 4OT8A 4RM1A 1N8PA 1B4XA 3P6KA 4ITGA 1OXPA 5DB5A 3WLXA 1U08A 3R4TA 1WYUA 1W7LA 3FKDA 1AAMA 5EFSA 1CQ7A 1KMJA 1IUGA 3EI6A 2WK9A 5DJ1A 1GCKA 2W8JA 1G7WA 2VGVA 3KGXA 2V0YA 2YRIA 1WYVA 4WBTA 3N5MA 4WYGA 1AMQA 3BWOA 1MLZA 4RJ0A 4EU1A 4PFNA 2YKXA 2FQ6A 3RCHA 5EQCA 2BIEA 4U1TA 2JJEA 4EB5A 3FVUA 2Z9XA 3DRDA 4TMRA 3LVMA 4I8AA 3QHXA 3PA9A 3DYDA 2ORDA 2AY1A 4IYOA 4R2NA 1ELUA 2BI1A 1TATA 1O4SA 1M0NA 2X3LA 4ZDPA 4CXQA 2HOZA 2W7IA 4PVFA 2W7MA 1B8GA 3E6GA 4MQPA 5G4JA 4RJYA 1M0OA 1SZUA 1CQ8A 1IX8A 2ZSLA 4JEZA 3HT4A 4RITA 4ZASA 2BIAA 2D65A 2WK7A 3JTXA 3MAFB 4ZSWA 4Y0HA 2BI9A 2E7UA 2YCNA 3TFTA 1C7GA 3K7YA 2EZ2A 1VEFA 3WKSA 2PO3A 3QBOA 3DU4A 2WK8A 5E4ZA 5EUEA 2D7ZA 2D63A 2ZUKA 4J5UA 4WB0A 3WY7A 1S07A 1AKBA 1IJIA 1QJ3A 2FNIA 3ZZJA 4A0GA 4DBCA 4RKDA 4F5FA 1J32A 1MDXA 1G7XA 4W8IA 4LNJA 1ASDA 4WD2A 5BJ3A 2GMSA 5I92A 3ELPA 1BS0A 1M0PA 2W8VA 2D7YA 3ASAA 4WXBA 1AMSA 1ELQA 4LC3A 2OATA 2Z1YA 2QLRA 3KGWA 4K2MA 4XEWA 2QBTA 4BA5A 4LNLA 1RV4A 3B8XA 4XK1A 1OXOA 2HOYA 3GZCA 2VMSA 1OHVA 2VMYA 5J8QA 2OGAA 1YAAA 3VK2A 2VYCA 3LVKA 3PDBB 4HF8A 4LW2A 4UQVA 2JJFA 1S08A 2CJHA 2VI9A 2XH1A 1SF2A 2O1BA 3WKRA 2Q7WA 2AEVA 4UHOA 3FQ7A 1MGVA 2YHKA 1G4VA 3CQ6A 1BKGA 4K2IA 3LWSA 4A6RA 1FC4A 1EQBA 1FG3A 5EIGB 2EO5A 2HORA 1XEYA 1AIAA 2PB2A 2VMOA 1M7YA 1LC5A 1ZOBA 3EUCA 3CAIA 3EZSA 1IBJA 2JJGA 3L8AA 4JF1A 1AJRA 1RV3A 4JEXA 1X28A 4MKKA 7AATA 1QITA 3GR9A 1QJ5A 1TOIA 3BWNC 4B9BA 3B1CA 3DXWA 4CXRA 4IXZA 5HDMA 2GMUA 4JF0A 3VK4A 4NOGA 3HDOA 1KL1A 2W8TA 2CANA 1C0NA 5TF5A 3TFUA 1BJOB 4W91A 3NTJA 1ARSA 1SPAA 4Y0DA 1LC8A 2BYLA 1ZODA 2HZPA 3JWBA 3GWPA 3GBXA 4H51A 4KAMA 2RFVA 3JU7A 4Y0IA 3BCAA 3FQ8A 4OYTA 2DKJA 4K2BA 4OCAA 1UU0A 4ADDA 1WKHA 3FSLA 2DR1A 1BQDA 2GB3A 4WP0A 1T3IA 4IXOA 1J04A 1CZCA 2HOXA 3G7QA 1AKAA 2AY6A 2BKWA 2YCTA 3PDXA 3M5UA 3FCRA 2XBNA 3ATHA 4UOYA 4M2JA 2VMPA 3LVJA 4A0RA 3AEJC 3AV7A 1O61A 3RUYA 1SZSA 3UAKA 1MLYA 2VMWA 1BQAA 4AOAA 2HP1A 3EZ1A 1OHYA 3NYTA 4IW7A 2VI8A 1LW5A 3NNKA 1IAXA 4ATQA 1C7NA 2W8WA 1M4NA 5LH9A 4KYOA 2VGWA 2E7IA 2BI3A 2W7DA 4JEVA 5D95A 4F5KA 2BHXA 3GETA 3I5TA 2EZ1A 4ZDOA 1JS3A 3DZZA 2W7GA 2CY8A 4N0BA 4GSAA 4BHDA 1D7UA 4A00A 3RBFA 2R5CB 2VIBA 2TPLA 4R5FA 9AATA 5HXXA 3NYSA 3QPGA 1AHYA 3PAAA 1DGEA 3R9AA 4Q76A 3ACZA 2CJDA 1GEWA 2HUIA 4F5JA 5M46A 1AHFA 2OKKA 2R2NA 2R0TA 3BCBA 1EJIA 3FQAA 2AEUA 3E2FA 4MSOA 1DTYA 2EH6A 3E2ZB 4MGRA
chains in the Genus database with same CATH superfamily
2VLFA 4BA4A 3AEMC 3DR4A 1KKJA 2EGYA 1AHXA 3A9YA 4W1XA 4WYAA 4A0FA 8AATA 2ZY4A 1FG7A 2FYFA 3KKIA 4MQQA 4AZJA 1CS1A 3P1TA 4R8DA 1WYTB 2ZP7A 4B98A 3N7NA 1AIBA 1SZKA 3T32A 3BC8A 2VMVA 1ARIA 1EG5A 1GC0A 2AY9A 3FDBA 1ARGA 3QM2A 3MAUA 2AY2A 1V2FA 1W3UA 4WYDA 3NX3A 3DC1A 3PD6B 3MC6C 3N75A 3N4RA 3FTBA 4P3MA 4ZWVA 1GC4A 3WGCA 4GE9A 3EIBA 2E54A 4UHNA 4RIZA 3ELEA 1WSTA 2NMPA 3IF2A 3EI7A 4Q6RA 4XJLA 4WXGA 1CL1A 4F5LA 2BWOA 4RAEA 2HP2A 3FVXA 1H1CA 2QB2A 2BI5A 1B5OA 1ARTA 3QN6A 2JJHA 3GZDC 3ECDA 4F5GA 1D7RA 3MAFA 1SFFA 3A8UX 1MDZA 3WCOA 2CSTA 3BB8A 4WLJA 5JAYA 1TASA 3HQTA 5D5SA 1YNUA 3RI6A 5G09A 3E2YA 2QMAA 1AHGA 1D2FA 5EAAA 3AEPA 1VP4A 2X5FA 2VGTA 1DJEA 2VMXA 5DX5A 1PMMA 2W7HA 1XI9A 1PG8A 1CZEA 5G2QA 1GC3A 4CBRA 1BW0A 2W7EA 4ADCA 2CFBA 3RBLA 2VMTA 2WKAA 3VK3A 1V72A 5FT8A 4E77A 3A9XA 3BV0A 1ASGA 1QZ9A 2YKYA 2ZY3A 1O69A 4A72A 3FDDA 1TOEA 4CVQA 3OP7A 2ZC0A 2X5DA 2W8UA 2Z20A 3PIUA 4ZAHA 4PFFA 5F8VA 3TQXA 4DQ6A 4ZM3A 2OQXA 3FZ8A 1AJSB 3PPLA 1V2DA 1Y4IA 1AHEA 3AENB 3K40A 1QIRA 4ZM4A 4A0HA 1IX7A 1OATA 4MY5A 2VMRA 3FZ7A 2C44A 3ZRPA 1TOGA 1B9IA 1SVVA 1LC7A 2JGTA 3MEBA 4WYEA 3FZ6A 3COGA 3GSBA 5G2PA 3PDBA 2VMZA 4ZWMA 4OMAA 4UHMA 1DFOA 1KL2A 1X29A 4O6ZA 5F9SA 1DGDA 1ASFA 1M6SA 2DGKA 1M0QA 1W7NA 4XJPA 5DJ9A 3JZLA 2BYJA 4EB7A 3L44A 2ZSMA 4WYFA 3LVLB 5EIGA 3EIAA 2YCPA 3EI9A 4FFCA 3I16A 1IAYA 4XQ2A 3F0HA 1I29A 3WCNA 4ZLVA 4ZSYA 4IY7A 5C6UA 4MKJA 2DOUA 3G0TA 3TCMA 1ECXA 4E3RA 1GBNA 3A2BA 4GRXA 4ISYA 2VIAA 1G4XA 5AX8A 3ZZKA 1GD9A 4F5MA 4OBVA 2ZY5A 1VJOA 5FT5A 4GDYA 4WLHA 2YKUA 4AO9A 1W7MA 5M49A 3CQ5A 4F5HA 3FFHA 1BJOA 1ASLA 2DGMA 3DR7A 4HVKA 3PJ0A 5M4DA 1PFFA 1GEXA 2VMQA 1WYUB 4M2KA 1P3WA 4L0OA 4JE5D 3AEOA 4Q75A 4QGRA 1DJUA 1N31A 3USFA 2C7TA 2W7KA 4IXSA 5EUDA 4GEBA 1TPLA 2BIGA 1AAWA 3NUIA 1AMRA 2C81A 3JW9A 2QA3A 2JG2A 2W7JA 1LK9A 1WYVB 5K8BA 3ASBA 1I41A 4EMYA 1ORDA 3RCHB 2JISA 2E7JA 4U2HA 1AY4A 4AO4A 1B9HA 5G4IA 1C9CA 1I48A 4GE4A 3HBXA 4JE5A 2FN6A 1ASBA 1OHWA 1BT4A 2F8JA 3LG0A 4XAUA 4IYOB 1ASEA 1S06A 5BJ4A 4CBSA 4TN4A 2AY4A 2Z67A 4K05A 2W7LA 2CINA 1AKCA 4W5KA 4A6TA 3AOVA 1RVYA 3E9KA 1CQ6A 1QGNA 3B46A 3BWNA 1DJ9A 2AY3A 2VGUA 3IHJA 4DGTA 1BJWA 2R5CA 4F5IA 2Z9UA 2AY5A 3F9TA 3MKJA 3E77A 2VLHA 3ZRRA 1C4KA 2EPJA 1AY8A 1RVUA 4WB0B 4WXFA 3F6TA 3W1HA 4EFFA 3E2ZA 4ADEA 1BJ4A 4Q31A 3VP6A 1TOJA 1KKPA 1X0MA 3QI6A 1WYTA 1MAPA 1UU1A 4ITXA 2OKJA 1YJSA 3NRAA 2Z9WA 1DKAA 4ZDLA 2FNUA 2Z9VA 3AEJA 2CH1A 2O7CA 3NU8A 1YIYA 4GE7A 1WKGA 4XJMA 4P7YA 4E3QA 3PD6A 1AICA 5E3KA 1Z7DA 5E5IA 1JG8A 3CQ4A 3HLMA 5LHAA 1PMOA 2CH2A 2VMUA 1AMAA 2BI2A 2C0RA 3UWCA 2Z1ZA 2QSRA 2OGEA 2D61A 1O62A 1JS6A 1ZC9A 1ASMA 2D5YA 4J8LA 2AY7A 4XJOA 3CBFA 1TARA 2AATA 5IWQA 3NDNA 4WYCA 1JF9A 2YKVA 4JEYA 3A9ZA 1ARHA 5G0AA 4JEWA 2Z61A 2GSAA 2O0RA 3NUBA 3OKSA 1H0CA 2V1PA 3QGUA 3B1DA 1ASNA 3FFRA 3WZFA 2FKIA 2PB0A 5EUNA 2BWPA 1E5EA 1UKJA 3H14A 4F4EA 1V2EA 3AEMA 3FD0A 4PIWA 3MADA 3G8MA 3WX9A 4MQRA 1YJZA 4E1OA 2VMNA 3MBBA 4KXKA 2R5EA 3FRKA 4OC9A 2G7JA 2GQNA 3LV2A 1E5FA 1CJ0A 4N0WA 3N4SA 3AOWA 1AX4A 1I43A 4ATPA 1MDOA 3Q8NA 1QISA 3N0LA 4W1VA 3DXVA 3TATA 2CTZA 2FM1A 1D7VA 2W7FA 4OTLA 3MC6A 4ADBA 3ISLA 3FVSA 3NYUA 2HUFA 5M4BA 3PGYA 1C7OA 1AJSA 3BCXA 3D6KA 3W1JA 3K28A 3AENA 1S09A 5EAVA 3HL2A 1KMKA 2DGLA 3RQ1A 1W23A 4AH3A 1GDEA 3DODA 4R5ZA 1MAQA 5HHYA 2DKBA 3AELA 1S0AA 2YOBA 3HMUA 2YRRA 4W1WA 4BQ0A 2HUUA 4RLGA 4A6UA 1X2AA 2X8UA 3UE8A 1YOOA 4TV7A 3BN1A 3ZRQA 1YIZA 2VGSA 3I4JA 3JWAA 3HVYA 3EI5A 2CJGA 2ZY2A 1CL2A 4RKCA 3GZDA 2QB3A 2ZYJA 2AY8A 4IX8A 2KFPA 1LKCA 2VGZA 3VAXA 4M2MA 1TOKA 4FL0A 1UU2A 4LW4A 1AY5A 1Z3ZA 2D66A 1B5PA 2CB1A 4AZKA 3H7FA 2BWNA 3NU7A 1LS3A 1BJNA 3AATA 3II0A 3KE3A 1GC2A 1M32A 2D64A 2G6WA 3B1EA 3BS8A 1IVRA 1D7SA 3VOMA 1KAFA 3GJUA 4OBUA 5FT6A 1ASAA 1LW4A 3W1IA 2ZJGA 3WGBA 3H9XA 1ASCA 1IX6A 1YJYA 3EI8A 4LNMA 4BMKA 5FT4A 3LY1A 1GEYA 1N2TA 4OT8A 4RM1A 1N8PA 1B4XA 3P6KA 4ITGA 1OXPA 5DB5A 3WLXA 1U08A 3R4TA 1WYUA 1W7LA 3FKDA 1AAMA 5EFSA 1CQ7A 1KMJA 1IUGA 3EI6A 2WK9A 5DJ1A 1GCKA 2W8JA 1G7WA 2VGVA 3KGXA 2V0YA 2YRIA 1WYVA 4WBTA 3N5MA 4WYGA 1AMQA 3BWOA 1MLZA 4RJ0A 4EU1A 4PFNA 2YKXA 2FQ6A 3RCHA 5EQCA 2BIEA 4U1TA 2JJEA 4EB5A 3FVUA 2Z9XA 3DRDA 4TMRA 3LVMA 4I8AA 3QHXA 3PA9A 3DYDA 2ORDA 2AY1A 4IYOA 4R2NA 1ELUA 2BI1A 1TATA 1O4SA 1M0NA 2X3LA 4ZDPA 4CXQA 2HOZA 2W7IA 4PVFA 2W7MA 1B8GA 3E6GA 4MQPA 5G4JA 4RJYA 1M0OA 1SZUA 1CQ8A 1IX8A 2ZSLA 4JEZA 3HT4A 4RITA 4ZASA 2BIAA 2D65A 2WK7A 3JTXA 3MAFB 4ZSWA 4Y0HA 2BI9A 2E7UA 2YCNA 3TFTA 1C7GA 3K7YA 2EZ2A 2EYQA 1VEFA 3WKSA 2PO3A 3QBOA 3DU4A 2WK8A 5E4ZA 5EUEA 2D7ZA 2D63A 2ZUKA 4J5UA 4WB0A 3WY7A 1S07A 2WB6A 1AKBA 1IJIA 1QJ3A 2FNIA 3ZZJA 4A0GA 4DBCA 2A1VA 4RKDA 4F5FA 1J32A 1MDXA 1G7XA 4W8IA 4LNJA 1ASDA 4WD2A 5BJ3A 2GMSA 5I92A 3ELPA 1BS0A 1M0PA 2W8VA 2D7YA 3ASAA 4WXBA 1AMSA 1ELQA 4LC3A 2OATA 2Z1YA 2QLRA 3KGWA 4K2MA 4XEWA 2QBTA 4BA5A 4LNLA 1RV4A 3B8XA 4XK1A 1OXOA 5KTBA 2HOYA 3GZCA 2VMSA 1OHVA 2VMYA 5J8QA 2OGAA 1YAAA 3VK2A 2VYCA 3LVKA 3PDBB 4HF8A 4LW2A 4UQVA 2JJFA 1S08A 2CJHA 2VI9A 2XH1A 1SF2A 2O1BA 3WKRA 2Q7WA 2AEVA 4UHOA 3FQ7A 1MGVA 2YHKA 1G4VA 3CQ6A 1BKGA 4K2IA 3LWSA 4A6RA 1FC4A 3N4XA 1EQBA 1FG3A 5EIGB 2EO5A 2HORA 1XEYA 1AIAA 2PB2A 2VMOA 1M7YA 1LC5A 1ZOBA 3EUCA 3CAIA 3EZSA 1IBJA 2JJGA 3L8AA 4JF1A 1AJRA 1RV3A 4JEXA 1X28A 4MKKA 4H63Q 7AATA 1QITA 3GR9A 1QJ5A 1TOIA 3BWNC 4B9BA 3B1CA 3DXWA 4CXRA 4IXZA 5HDMA 2GMUA 4JF0A 3VK4A 4NOGA 3HDOA 1KL1A 2W8TA 2CANA 1C0NA 5TF5A 3TFUA 1BJOB 4W91A 3NTJA 1ARSA 1SPAA 4Y0DA 1LC8A 2BYLA 1ZODA 2HZPA 3JWBA 3GWPA 3GBXA 4H51A 4KAMA 2RFVA 3JU7A 4Y0IA 3BCAA 3FQ8A 4OYTA 2DKJA 4K2BA 4OCAA 1UU0A 4ADDA 1WKHA 3FSLA 2DR1A 1BQDA 2GB3A 4WP0A 1T3IA 4IXOA 1J04A 1CZCA 2HOXA 3G7QA 1AKAA 2AY6A 2BKWA 2YCTA 3PDXA 3M5UA 3FCRA 2XBNA 3ATHA 4UOYA 4M2JA 2VMPA 3LVJA 4A0RA 3AEJC 3AV7A 1O61A 3RUYA 1SZSA 3UAKA 1MLYA 2VMWA 1BQAA 4AOAA 2HP1A 3EZ1A 1OHYA 3NYTA 4IW7A 2VI8A 1LW5A 3NNKA 1IAXA 4ATQA 1C7NA 2W8WA 1M4NA 5LH9A 4KYOA 2VGWA 2E7IA 2BI3A 2W7DA 4JEVA 5D95A 4F5KA 2BHXA 3GETA 3I5TA 2EZ1A 4ZDOA 1JS3A 3DZZA 2W7GA 2CY8A 4N0BA 4GSAA 4BHDA 1D7UA 4A00A 3RBFA 2R5CB 2VIBA 2TPLA 4R5FA 9AATA 5HXXA 3NYSA 3QPGA 1AHYA 3PAAA 1DGEA 3R9AA 4Q76A 3ACZA 2CJDA 1GEWA 2HUIA 4F5JA 5M46A 1AHFA 2OKKA 2R2NA 2R0TA 3BCBA 1EJIA 3FQAA 2AEUA 3E2FA 4MSOA 1DTYA 2EH6A 3E2ZB 4MGRA
chains in the Genus database with same CATH topology
2VLFA 4BA4A 3AEMC 3DR4A 1KKJA 2EGYA 1AHXA 3A9YA 4W1XA 4WYAA 4A0FA 8AATA 2ZY4A 1FG7A 2FYFA 3KKIA 4MQQA 4AZJA 1CS1A 3P1TA 4R8DA 1WYTB 2ZP7A 4B98A 3N7NA 1AIBA 1SZKA 3T32A 3BC8A 2VMVA 1ARIA 1EG5A 1GC0A 2AY9A 3FDBA 1ARGA 3QM2A 3MAUA 2AY2A 1V2FA 1W3UA 4WYDA 3NX3A 3DC1A 3PD6B 3MC6C 3N75A 3N4RA 3FTBA 4P3MA 4ZWVA 1GC4A 3WGCA 4GE9A 3EIBA 2E54A 4UHNA 4RIZA 3ELEA 1WSTA 2NMPA 3IF2A 3EI7A 4Q6RA 4XJLA 4WXGA 1CL1A 4F5LA 2BWOA 4RAEA 2HP2A 3FVXA 1H1CA 2QB2A 2BI5A 1B5OA 1ARTA 3QN6A 2JJHA 3GZDC 3ECDA 4F5GA 1D7RA 3MAFA 1SFFA 3A8UX 1MDZA 3WCOA 2CSTA 3BB8A 4WLJA 5JAYA 1TASA 3HQTA 5D5SA 1YNUA 3RI6A 5G09A 3E2YA 2QMAA 1AHGA 1D2FA 5EAAA 3AEPA 1VP4A 2X5FA 2VGTA 1DJEA 2VMXA 5DX5A 1PMMA 2W7HA 1XI9A 1PG8A 1CZEA 5G2QA 1GC3A 4CBRA 1BW0A 2W7EA 4ADCA 2CFBA 3RBLA 2VMTA 2WKAA 3VK3A 1V72A 5FT8A 4E77A 3A9XA 3BV0A 1ASGA 1QZ9A 2YKYA 2ZY3A 1O69A 4A72A 3FDDA 1TOEA 4CVQA 3OP7A 2ZC0A 2X5DA 2W8UA 2Z20A 3PIUA 4ZAHA 4PFFA 5F8VA 3TQXA 4DQ6A 4ZM3A 2OQXA 3FZ8A 1AJSB 3PPLA 1V2DA 1Y4IA 1AHEA 3AENB 3K40A 1QIRA 4ZM4A 4A0HA 1IX7A 1OATA 4MY5A 2VMRA 3FZ7A 2C44A 3ZRPA 1TOGA 1B9IA 1SVVA 1LC7A 2JGTA 3MEBA 4WYEA 3FZ6A 3COGA 3GSBA 5G2PA 3PDBA 2VMZA 4ZWMA 4OMAA 4UHMA 1DFOA 1KL2A 1X29A 4O6ZA 5F9SA 1DGDA 1ASFA 1M6SA 2DGKA 1M0QA 1W7NA 4XJPA 5DJ9A 3JZLA 2BYJA 4EB7A 3L44A 2ZSMA 4WYFA 3LVLB 5EIGA 3EIAA 2YCPA 3EI9A 4FFCA 3I16A 1IAYA 4XQ2A 3F0HA 1I29A 3WCNA 4ZLVA 4ZSYA 4IY7A 5C6UA 4MKJA 2DOUA 3G0TA 3TCMA 1ECXA 4E3RA 1GBNA 3A2BA 4GRXA 4ISYA 2VIAA 1G4XA 5AX8A 3ZZKA 1GD9A 4F5MA 4OBVA 2ZY5A 1VJOA 5FT5A 4GDYA 4WLHA 2YKUA 4AO9A 1W7MA 5M49A 3CQ5A 4F5HA 3FFHA 1BJOA 1ASLA 2DGMA 3DR7A 4HVKA 3PJ0A 5M4DA 1PFFA 1GEXA 2VMQA 1WYUB 4M2KA 1P3WA 4L0OA 4JE5D 3AEOA 4Q75A 4QGRA 1DJUA 1N31A 3USFA 2C7TA 2W7KA 4IXSA 5EUDA 4GEBA 1TPLA 2BIGA 1AAWA 3NUIA 1AMRA 2C81A 3JW9A 2QA3A 2JG2A 2W7JA 1LK9A 1WYVB 5K8BA 3ASBA 1I41A 4EMYA 1ORDA 3RCHB 2JISA 2E7JA 4U2HA 1AY4A 4AO4A 1B9HA 5G4IA 1C9CA 1I48A 4GE4A 3HBXA 4JE5A 2FN6A 1ASBA 1OHWA 1BT4A 2F8JA 3LG0A 4XAUA 4IYOB 1ASEA 1S06A 5BJ4A 4CBSA 4TN4A 2AY4A 2Z67A 4K05A 2W7LA 2CINA 1AKCA 4W5KA 4A6TA 3AOVA 1RVYA 3E9KA 1CQ6A 1QGNA 3B46A 3BWNA 1DJ9A 2AY3A 2VGUA 3IHJA 4DGTA 1BJWA 2R5CA 4F5IA 2Z9UA 2AY5A 3F9TA 3MKJA 3E77A 2VLHA 3ZRRA 1C4KA 2EPJA 1AY8A 1RVUA 4WB0B 4WXFA 3F6TA 3W1HA 4EFFA 3E2ZA 4ADEA 1BJ4A 4Q31A 3VP6A 1TOJA 1KKPA 1X0MA 3QI6A 1WYTA 1MAPA 1UU1A 4ITXA 2OKJA 1YJSA 3NRAA 2Z9WA 1DKAA 4ZDLA 2FNUA 2Z9VA 3AEJA 2CH1A 2O7CA 3NU8A 1YIYA 4GE7A 1WKGA 4XJMA 4P7YA 4E3QA 3PD6A 1AICA 5E3KA 1Z7DA 5E5IA 1JG8A 3CQ4A 3HLMA 5LHAA 1PMOA 2CH2A 2VMUA 1AMAA 2BI2A 2C0RA 3UWCA 2Z1ZA 2QSRA 2OGEA 2D61A 1O62A 1JS6A 1ZC9A 1ASMA 2D5YA 4J8LA 2AY7A 4XJOA 3CBFA 1TARA 2AATA 5IWQA 3NDNA 4WYCA 1JF9A 2YKVA 4JEYA 3A9ZA 1ARHA 5G0AA 4JEWA 2Z61A 2GSAA 2O0RA 3NUBA 3OKSA 1H0CA 2V1PA 3QGUA 3B1DA 1ASNA 3FFRA 3WZFA 2FKIA 2PB0A 5EUNA 2BWPA 1E5EA 1UKJA 3H14A 4F4EA 1V2EA 3AEMA 3FD0A 4PIWA 3MADA 3G8MA 3WX9A 4MQRA 1YJZA 4E1OA 2VMNA 3MBBA 4KXKA 2R5EA 3FRKA 4OC9A 2G7JA 2GQNA 3LV2A 1E5FA 1CJ0A 4N0WA 3N4SA 3AOWA 1AX4A 1I43A 4ATPA 1MDOA 3Q8NA 1QISA 3N0LA 4W1VA 3DXVA 3TATA 2CTZA 2FM1A 1D7VA 2W7FA 4OTLA 3MC6A 4ADBA 3ISLA 3FVSA 3NYUA 2HUFA 5M4BA 3PGYA 1C7OA 1AJSA 3BCXA 3D6KA 3W1JA 3K28A 3AENA 1S09A 5EAVA 3HL2A 1KMKA 2DGLA 3RQ1A 1W23A 4AH3A 1GDEA 3DODA 4R5ZA 1MAQA 5HHYA 2DKBA 3AELA 1S0AA 2YOBA 3HMUA 2YRRA 4W1WA 4BQ0A 2HUUA 4RLGA 4A6UA 1X2AA 2X8UA 3UE8A 1YOOA 4TV7A 3BN1A 3ZRQA 1YIZA 2VGSA 3I4JA 3JWAA 3HVYA 3EI5A 2CJGA 2ZY2A 1CL2A 4RKCA 3GZDA 2QB3A 2ZYJA 2AY8A 4IX8A 2KFPA 1LKCA 2VGZA 3VAXA 4M2MA 1TOKA 4FL0A 1UU2A 4LW4A 1AY5A 1Z3ZA 2D66A 1B5PA 2CB1A 4AZKA 3H7FA 2BWNA 3NU7A 1LS3A 1BJNA 3AATA 3II0A 3KE3A 1GC2A 1M32A 2D64A 2G6WA 3B1EA 3BS8A 1IVRA 1D7SA 3VOMA 3GJUA 4OBUA 5FT6A 1ASAA 1LW4A 3W1IA 2ZJGA 3WGBA 3H9XA 1ASCA 1IX6A 1YJYA 3EI8A 4LNMA 4BMKA 5FT4A 3LY1A 1GEYA 1N2TA 4OT8A 4RM1A 1N8PA 1B4XA 3P6KA 4ITGA 1OXPA 5DB5A 3WLXA 1U08A 3R4TA 1WYUA 1W7LA 3FKDA 1AAMA 5EFSA 1CQ7A 1KMJA 1IUGA 3EI6A 2WK9A 5DJ1A 1GCKA 2W8JA 1G7WA 2VGVA 3KGXA 2V0YA 2YRIA 1WYVA 4WBTA 3N5MA 4WYGA 1AMQA 3BWOA 1MLZA 4RJ0A 4EU1A 4PFNA 2YKXA 2FQ6A 3RCHA 5EQCA 2BIEA 4U1TA 2JJEA 4EB5A 3FVUA 2Z9XA 3DRDA 4TMRA 3LVMA 4I8AA 3QHXA 3PA9A 3DYDA 2ORDA 2AY1A 4IYOA 4R2NA 1ELUA 2BI1A 1TATA 1O4SA 1M0NA 2X3LA 4ZDPA 4CXQA 2HOZA 2W7IA 4PVFA 2W7MA 1B8GA 3E6GA 4MQPA 5G4JA 4RJYA 1M0OA 1SZUA 1CQ8A 1IX8A 2ZSLA 4JEZA 3HT4A 4RITA 4ZASA 2BIAA 2D65A 2WK7A 3JTXA 3MAFB 4ZSWA 4Y0HA 2BI9A 2E7UA 2YCNA 3TFTA 1C7GA 3K7YA 2EZ2A 2EYQA 1VEFA 3WKSA 2PO3A 3QBOA 3DU4A 2WK8A 5E4ZA 5EUEA 2D7ZA 2D63A 2ZUKA 4J5UA 4WB0A 3WY7A 1S07A 2WB6A 1AKBA 1IJIA 1QJ3A 2FNIA 3ZZJA 4A0GA 4DBCA 2A1VA 4RKDA 4F5FA 1J32A 1MDXA 1G7XA 4W8IA 4LNJA 1ASDA 4WD2A 5BJ3A 2GMSA 5I92A 3ELPA 1BS0A 1M0PA 2W8VA 2D7YA 3ASAA 4WXBA 1AMSA 1ELQA 4LC3A 2OATA 2Z1YA 2QLRA 3KGWA 4K2MA 4XEWA 2QBTA 4BA5A 4LNLA 1RV4A 3B8XA 4XK1A 1OXOA 5KTBA 2HOYA 3GZCA 2VMSA 1OHVA 2VMYA 5J8QA 2OGAA 1YAAA 3VK2A 2VYCA 3LVKA 3PDBB 4HF8A 4LW2A 4UQVA 2JJFA 1S08A 2CJHA 2VI9A 2XH1A 1SF2A 2O1BA 3WKRA 2Q7WA 2AEVA 4UHOA 3FQ7A 1MGVA 2YHKA 1G4VA 3CQ6A 1BKGA 4K2IA 3LWSA 4A6RA 1FC4A 3N4XA 1EQBA 1FG3A 5EIGB 2EO5A 2HORA 1XEYA 1AIAA 2PB2A 2VMOA 1M7YA 1LC5A 1ZOBA 3EUCA 3CAIA 3EZSA 1IBJA 2JJGA 3L8AA 4JF1A 1AJRA 1RV3A 4JEXA 1X28A 4MKKA 4H63Q 7AATA 1QITA 3GR9A 1QJ5A 1TOIA 3BWNC 4B9BA 3B1CA 3DXWA 4CXRA 4IXZA 5HDMA 2GMUA 4JF0A 3VK4A 4NOGA 3HDOA 1KL1A 2W8TA 2CANA 1C0NA 5TF5A 3TFUA 1BJOB 4W91A 3NTJA 1ARSA 1SPAA 4Y0DA 1LC8A 2BYLA 1ZODA 2HZPA 3JWBA 3GWPA 3GBXA 4H51A 4KAMA 2RFVA 3JU7A 4Y0IA 3BCAA 3FQ8A 4OYTA 2DKJA 4K2BA 4OCAA 1UU0A 4ADDA 1WKHA 3FSLA 2DR1A 1BQDA 2GB3A 4WP0A 1T3IA 4IXOA 1J04A 1CZCA 2HOXA 3G7QA 1AKAA 2AY6A 2BKWA 2YCTA 3PDXA 3M5UA 3FCRA 2XBNA 3ATHA 4UOYA 4M2JA 2VMPA 3LVJA 4A0RA 3AEJC 3AV7A 1O61A 3RUYA 1SZSA 3UAKA 1MLYA 2VMWA 1BQAA 4AOAA 2HP1A 3EZ1A 1OHYA 3NYTA 4IW7A 2VI8A 1LW5A 3NNKA 1IAXA 4ATQA 1C7NA 2W8WA 1M4NA 5LH9A 4KYOA 2VGWA 2E7IA 2BI3A 2W7DA 4JEVA 5D95A 4F5KA 2BHXA 3GETA 3I5TA 2EZ1A 4ZDOA 1JS3A 3DZZA 2W7GA 2CY8A 4N0BA 4GSAA 4BHDA 1D7UA 4A00A 3RBFA 2R5CB 2VIBA 2TPLA 4R5FA 9AATA 5HXXA 3NYSA 3QPGA 1AHYA 3PAAA 1DGEA 3R9AA 4Q76A 3ACZA 2CJDA 1GEWA 2HUIA 4F5JA 5M46A 1AHFA 2OKKA 2R2NA 2R0TA 3BCBA 1EJIA 3FQAA 2AEUA 3E2FA 4MSOA 1DTYA 2EH6A 3E2ZB 4MGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLF A;  4BA4 A;  3AEM C;  3DR4 A;  1KKJ A;  2EGY A;  1AHX A;  3A9Y A;  4W1X A;  4WYA A;  4A0F A;  8AAT A;  2ZY4 A;  1FG7 A;  2FYF A;  3KKI A;  4MQQ A;  4AZJ A;  1CS1 A;  3P1T A;  4R8D A;  1WYT B;  2ZP7 A;  4B98 A;  1AIB A;  1SZK A;  3T32 A;  3BC8 A;  2VMV A;  1ARI A;  1EG5 A;  1GC0 A;  2AY9 A;  3FDB A;  1ARG A;  3QM2 A;  3MAU A;  2AY2 A;  1V2F A;  1W3U A;  4WYD A;  3NX3 A;  3DC1 A;  3PD6 B;  3MC6 C;  3N75 A;  3FTB A;  4P3M A;  4ZWV A;  1GC4 A;  3WGC A;  4GE9 A;  3EIB A;  2E54 A;  4UHN A;  4RIZ A;  3ELE A;  1WST A;  2NMP A;  3IF2 A;  3EI7 A;  4Q6R A;  4XJL A;  4WXG A;  1CL1 A;  4F5L A;  2BWO A;  4RAE A;  2HP2 A;  3FVX A;  1H1C A;  2QB2 A;  2BI5 A;  1B5O A;  1ART A;  3QN6 A;  2JJH A;  3GZD C;  3ECD A;  4F5G A;  1D7R A;  3MAF A;  1SFF A;  3A8U X;  1MDZ A;  3WCO A;  2CST A;  3BB8 A;  4WLJ A;  5JAY A;  1TAS A;  3HQT A;  5D5S A;  1YNU A;  3RI6 A;  5G09 A;  3E2Y A;  2QMA A;  1AHG A;  1D2F A;  5EAA A;  3AEP A;  1VP4 A;  2X5F A;  2VGT A;  1DJE A;  2VMX A;  5DX5 A;  1PMM A;  2W7H A;  1XI9 A;  1PG8 A;  1CZE A;  5G2Q A;  1GC3 A;  4CBR A;  1BW0 A;  2W7E A;  4ADC A;  2CFB A;  3RBL A;  2VMT A;  2WKA A;  3VK3 A;  1V72 A;  5FT8 A;  4E77 A;  3A9X A;  3BV0 A;  1ASG A;  1QZ9 A;  2YKY A;  2ZY3 A;  1O69 A;  4A72 A;  3FDD A;  1TOE A;  4CVQ A;  3OP7 A;  2ZC0 A;  2X5D A;  2W8U A;  2Z20 A;  3PIU A;  4ZAH A;  4PFF A;  5F8V A;  3TQX A;  4DQ6 A;  4ZM3 A;  2OQX A;  3FZ8 A;  1AJS B;  3PPL A;  1V2D A;  1Y4I A;  1AHE A;  3AEN B;  3K40 A;  1QIR A;  4ZM4 A;  4A0H A;  1IX7 A;  1OAT A;  4MY5 A;  2VMR A;  3FZ7 A;  2C44 A;  3ZRP A;  1TOG A;  1B9I A;  1SVV A;  1LC7 A;  2JGT A;  3MEB A;  4WYE A;  3FZ6 A;  3COG A;  3GSB A;  5G2P A;  3PDB A;  2VMZ A;  4ZWM A;  4OMA A;  4UHM A;  1DFO A;  1KL2 A;  1X29 A;  4O6Z A;  5F9S A;  1DGD A;  1ASF A;  1M6S A;  2DGK A;  1M0Q A;  1W7N A;  4XJP A;  5DJ9 A;  3JZL A;  2BYJ A;  4EB7 A;  3L44 A;  2ZSM A;  4WYF A;  3LVL B;  5EIG A;  3EIA A;  2YCP A;  3EI9 A;  4FFC A;  3I16 A;  1IAY A;  4XQ2 A;  3F0H A;  1I29 A;  3WCN A;  4ZLV A;  4ZSY A;  4IY7 A;  5C6U A;  4MKJ A;  2DOU A;  3G0T A;  3TCM A;  1ECX A;  4E3R A;  1GBN A;  3A2B A;  4GRX A;  4ISY A;  2VIA A;  1G4X A;  5AX8 A;  3ZZK A;  1GD9 A;  4F5M A;  4OBV A;  2ZY5 A;  1VJO A;  5FT5 A;  4GDY A;  4WLH A;  2YKU A;  4AO9 A;  1W7M A;  5M49 A;  3CQ5 A;  4F5H A;  3FFH A;  1BJO A;  1ASL A;  2DGM A;  3DR7 A;  4HVK A;  3PJ0 A;  5M4D A;  1PFF A;  1GEX A;  2VMQ A;  1WYU B;  4M2K A;  1P3W A;  4L0O A;  4JE5 D;  3AEO A;  4Q75 A;  4QGR A;  1DJU A;  1N31 A;  3USF A;  2C7T A;  2W7K A;  4IXS A;  5EUD A;  4GEB A;  1TPL A;  2BIG A;  1AAW A;  3NUI A;  1AMR A;  2C81 A;  3JW9 A;  2QA3 A;  2JG2 A;  2W7J A;  1LK9 A;  1WYV B;  5K8B A;  3ASB A;  1I41 A;  4EMY A;  1ORD A;  3RCH B;  2JIS A;  2E7J A;  4U2H A;  1AY4 A;  4AO4 A;  1B9H A;  5G4I A;  1C9C A;  1I48 A;  4GE4 A;  3HBX A;  4JE5 A;  2FN6 A;  1ASB A;  1OHW A;  1BT4 A;  2F8J A;  3LG0 A;  4XAU A;  4IYO B;  1ASE A;  1S06 A;  5BJ4 A;  4CBS A;  4TN4 A;  2AY4 A;  2Z67 A;  2W7L A;  2CIN A;  1AKC A;  4W5K A;  4A6T A;  3AOV A;  1RVY A;  3E9K A;  1CQ6 A;  1QGN A;  3B46 A;  3BWN A;  1DJ9 A;  2AY3 A;  2VGU A;  3IHJ A;  4DGT A;  1BJW A;  2R5C A;  4F5I A;  2Z9U A;  2AY5 A;  3F9T A;  3MKJ A;  3E77 A;  2VLH A;  3ZRR A;  1C4K A;  2EPJ A;  1AY8 A;  1RVU A;  4WB0 B;  4WXF A;  3F6T A;  3W1H A;  4EFF A;  3E2Z A;  4ADE A;  1BJ4 A;  4Q31 A;  3VP6 A;  1TOJ A;  1KKP A;  1X0M A;  3QI6 A;  1WYT A;  1MAP A;  1UU1 A;  4ITX A;  2OKJ A;  1YJS A;  3NRA A;  2Z9W A;  1DKA A;  4ZDL A;  2FNU A;  2Z9V A;  3AEJ A;  2CH1 A;  2O7C A;  3NU8 A;  1YIY A;  4GE7 A;  1WKG A;  4XJM A;  4P7Y A;  4E3Q A;  3PD6 A;  1AIC A;  5E3K A;  1Z7D A;  5E5I A;  1JG8 A;  3CQ4 A;  3HLM A;  5LHA A;  1PMO A;  2CH2 A;  2VMU A;  1AMA A;  2BI2 A;  2C0R A;  3UWC A;  2Z1Z A;  2OGE A;  2D61 A;  1O62 A;  1JS6 A;  1ZC9 A;  1ASM A;  2D5Y A;  4J8L A;  2AY7 A;  4XJO A;  3CBF A;  1TAR A;  2AAT A;  5IWQ A;  3NDN A;  4WYC A;  1JF9 A;  2YKV A;  4JEY A;  3A9Z A;  1ARH A;  5G0A A;  4JEW A;  2Z61 A;  2GSA A;  2O0R A;  3NUB A;  3OKS A;  1H0C A;  2V1P A;  3QGU A;  3B1D A;  1ASN A;  3FFR A;  3WZF A;  2PB0 A;  5EUN A;  2BWP A;  1E5E A;  1UKJ A;  3H14 A;  4F4E A;  1V2E A;  3AEM A;  3FD0 A;  4PIW A;  3MAD A;  3G8M A;  3WX9 A;  4MQR A;  1YJZ A;  4E1O A;  2VMN A;  3MBB A;  4KXK A;  2R5E A;  3FRK A;  4OC9 A;  2GQN A;  3LV2 A;  1E5F A;  1CJ0 A;  4N0W A;  3AOW A;  1AX4 A;  1I43 A;  4ATP A;  1MDO A;  3Q8N A;  1QIS A;  3N0L A;  4W1V A;  3DXV A;  3TAT A;  2CTZ A;  2FM1 A;  1D7V A;  2W7F A;  4OTL A;  3MC6 A;  4ADB A;  3ISL A;  3FVS A;  3NYU A;  2HUF A;  5M4B A;  3PGY A;  1C7O A;  1AJS A;  3BCX A;  3D6K A;  3W1J A;  3K28 A;  3AEN A;  1S09 A;  5EAV A;  3HL2 A;  1KMK A;  2DGL A;  3RQ1 A;  1W23 A;  4AH3 A;  1GDE A;  3DOD A;  4R5Z A;  1MAQ A;  5HHY A;  2DKB A;  3AEL A;  1S0A A;  2YOB A;  3HMU A;  2YRR A;  4W1W A;  4BQ0 A;  2HUU A;  4RLG A;  4A6U A;  1X2A A;  2X8U A;  3UE8 A;  1YOO A;  4TV7 A;  3BN1 A;  3ZRQ A;  1YIZ A;  2VGS A;  3I4J A;  3JWA A;  3HVY A;  3EI5 A;  2CJG A;  2ZY2 A;  1CL2 A;  4RKC A;  3GZD A;  2QB3 A;  2ZYJ A;  2AY8 A;  4IX8 A;  1LKC A;  2VGZ A;  3VAX A;  4M2M A;  1TOK A;  4FL0 A;  1UU2 A;  4LW4 A;  1AY5 A;  1Z3Z A;  2D66 A;  1B5P A;  2CB1 A;  4AZK A;  3H7F A;  2BWN A;  3NU7 A;  1LS3 A;  1BJN A;  3AAT A;  3II0 A;  3KE3 A;  1GC2 A;  1M32 A;  2D64 A;  2G6W A;  3B1E A;  3BS8 A;  1IVR A;  1D7S A;  3VOM A;  3GJU A;  4OBU A;  5FT6 A;  1ASA A;  1LW4 A;  3W1I A;  2ZJG A;  3WGB A;  1ASC A;  1IX6 A;  1YJY A;  3EI8 A;  4LNM A;  4BMK A;  5FT4 A;  3LY1 A;  1GEY A;  1N2T A;  4OT8 A;  4RM1 A;  1N8P A;  1B4X A;  3P6K A;  4ITG A;  1OXP A;  5DB5 A;  3WLX A;  1U08 A;  3R4T A;  1WYU A;  1W7L A;  3FKD A;  1AAM A;  5EFS A;  1CQ7 A;  1KMJ A;  1IUG A;  3EI6 A;  2WK9 A;  5DJ1 A;  1GCK A;  2W8J A;  1G7W A;  2VGV A;  3KGX A;  2V0Y A;  2YRI A;  1WYV A;  4WBT A;  3N5M A;  4WYG A;  1AMQ A;  3BWO A;  1MLZ A;  4RJ0 A;  4EU1 A;  4PFN A;  2YKX A;  2FQ6 A;  3RCH A;  5EQC A;  2BIE A;  4U1T A;  2JJE A;  4EB5 A;  3FVU A;  2Z9X A;  3DRD A;  4TMR A;  3LVM A;  4I8A A;  3QHX A;  3PA9 A;  3DYD A;  2ORD A;  2AY1 A;  4IYO A;  4R2N A;  1ELU A;  2BI1 A;  1TAT A;  1O4S A;  1M0N A;  2X3L A;  4ZDP A;  4CXQ A;  2HOZ A;  2W7I A;  4PVF A;  2W7M A;  1B8G A;  3E6G A;  4MQP A;  5G4J A;  4RJY A;  1M0O A;  1SZU A;  1CQ8 A;  1IX8 A;  2ZSL A;  4JEZ A;  3HT4 A;  4RIT A;  4ZAS A;  2BIA A;  2D65 A;  2WK7 A;  3JTX A;  3MAF B;  4ZSW A;  4Y0H A;  2BI9 A;  2E7U A;  2YCN A;  3TFT A;  1C7G A;  3K7Y A;  2EZ2 A;  1VEF A;  3WKS A;  2PO3 A;  3QBO A;  3DU4 A;  2WK8 A;  5E4Z A;  5EUE A;  2D7Z A;  2D63 A;  2ZUK A;  4J5U A;  4WB0 A;  3WY7 A;  1S07 A;  1AKB A;  1IJI A;  1QJ3 A;  2FNI A;  3ZZJ A;  4A0G A;  4DBC A;  4RKD A;  4F5F A;  1J32 A;  1MDX A;  1G7X A;  4W8I A;  4LNJ A;  1ASD A;  4WD2 A;  5BJ3 A;  2GMS A;  5I92 A;  3ELP A;  1BS0 A;  1M0P A;  2W8V A;  2D7Y A;  3ASA A;  4WXB A;  1AMS A;  1ELQ A;  4LC3 A;  2OAT A;  2Z1Y A;  2QLR A;  3KGW A;  4K2M A;  4XEW A;  2QBT A;  4BA5 A;  4LNL A;  1RV4 A;  3B8X A;  4XK1 A;  1OXO A;  2HOY A;  3GZC A;  2VMS A;  1OHV A;  2VMY A;  5J8Q A;  2OGA A;  1YAA A;  3VK2 A;  2VYC A;  3LVK A;  3PDB B;  4HF8 A;  4LW2 A;  4UQV A;  2JJF A;  1S08 A;  2CJH A;  2VI9 A;  2XH1 A;  1SF2 A;  2O1B A;  3WKR A;  2Q7W A;  2AEV A;  4UHO A;  3FQ7 A;  1MGV A;  2YHK A;  1G4V A;  3CQ6 A;  1BKG A;  4K2I A;  3LWS A;  4A6R A;  1FC4 A;  1EQB A;  1FG3 A;  5EIG B;  2EO5 A;  2HOR A;  1XEY A;  1AIA A;  2PB2 A;  2VMO A;  1M7Y A;  1LC5 A;  1ZOB A;  3EUC A;  3CAI A;  3EZS A;  1IBJ A;  2JJG A;  3L8A A;  4JF1 A;  1AJR A;  1RV3 A;  4JEX A;  1X28 A;  4MKK A;  7AAT A;  1QIT A;  3GR9 A;  1QJ5 A;  1TOI A;  3BWN C;  4B9B A;  3B1C A;  3DXW A;  4CXR A;  4IXZ A;  5HDM A;  2GMU A;  4JF0 A;  3VK4 A;  4NOG A;  3HDO A;  1KL1 A;  2W8T A;  2CAN A;  1C0N A;  5TF5 A;  3TFU A;  1BJO B;  4W91 A;  3NTJ A;  1ARS A;  1SPA A;  4Y0D A;  1LC8 A;  2BYL A;  1ZOD A;  2HZP A;  3JWB A;  3GWP A;  3GBX A;  4H51 A;  4KAM A;  2RFV A;  3JU7 A;  4Y0I A;  3BCA A;  3FQ8 A;  4OYT A;  2DKJ A;  4K2B A;  4OCA A;  1UU0 A;  4ADD A;  1WKH A;  3FSL A;  2DR1 A;  1BQD A;  2GB3 A;  4WP0 A;  1T3I A;  4IXO A;  1J04 A;  1CZC A;  2HOX A;  3G7Q A;  1AKA A;  2AY6 A;  2BKW A;  2YCT A;  3PDX A;  3M5U A;  3FCR A;  2XBN A;  3ATH A;  4UOY A;  4M2J A;  2VMP A;  3LVJ A;  4A0R A;  3AEJ C;  3AV7 A;  1O61 A;  3RUY A;  1SZS A;  3UAK A;  1MLY A;  2VMW A;  1BQA A;  4AOA A;  2HP1 A;  3EZ1 A;  1OHY A;  3NYT A;  4IW7 A;  2VI8 A;  1LW5 A;  3NNK A;  1IAX A;  4ATQ A;  1C7N A;  2W8W A;  1M4N A;  5LH9 A;  4KYO A;  2VGW A;  2E7I A;  2BI3 A;  2W7D A;  4JEV A;  5D95 A;  4F5K A;  2BHX A;  3GET A;  3I5T A;  2EZ1 A;  4ZDO A;  1JS3 A;  3DZZ A;  2W7G A;  2CY8 A;  4N0B A;  4GSA A;  4BHD A;  1D7U A;  4A00 A;  3RBF A;  2R5C B;  2VIB A;  2TPL A;  4R5F A;  9AAT A;  5HXX A;  3NYS A;  3QPG A;  1AHY A;  3PAA A;  1DGE A;  3R9A A;  4Q76 A;  3ACZ A;  2CJD A;  1GEW A;  2HUI A;  4F5J A;  5M46 A;  1AHF A;  2OKK A;  2R2N A;  2R0T A;  3BCB A;  1EJI A;  3FQA A;  2AEU A;  3E2F A;  4MSO A;  1DTY A;  2EH6 A;  3E2Z B;  4MGR A; 
#chains in the Genus database with same CATH topology
 2VLF A;  4BA4 A;  3AEM C;  3DR4 A;  1KKJ A;  2EGY A;  1AHX A;  3A9Y A;  4W1X A;  4WYA A;  4A0F A;  8AAT A;  2ZY4 A;  1FG7 A;  2FYF A;  3KKI A;  4MQQ A;  4AZJ A;  1CS1 A;  3P1T A;  4R8D A;  1WYT B;  2ZP7 A;  4B98 A;  3N7N A;  1AIB A;  1SZK A;  3T32 A;  3BC8 A;  2VMV A;  1ARI A;  1EG5 A;  1GC0 A;  2AY9 A;  3FDB A;  1ARG A;  3QM2 A;  3MAU A;  2AY2 A;  1V2F A;  1W3U A;  4WYD A;  3NX3 A;  3DC1 A;  3PD6 B;  3MC6 C;  3N75 A;  3N4R A;  3FTB A;  4P3M A;  4ZWV A;  1GC4 A;  3WGC A;  4GE9 A;  3EIB A;  2E54 A;  4UHN A;  4RIZ A;  3ELE A;  1WST A;  2NMP A;  3IF2 A;  3EI7 A;  4Q6R A;  4XJL A;  4WXG A;  1CL1 A;  4F5L A;  2BWO A;  4RAE A;  2HP2 A;  3FVX A;  1H1C A;  2QB2 A;  2BI5 A;  1B5O A;  1ART A;  3QN6 A;  2JJH A;  3GZD C;  3ECD A;  4F5G A;  1D7R A;  3MAF A;  1SFF A;  3A8U X;  1MDZ A;  3WCO A;  2CST A;  3BB8 A;  4WLJ A;  5JAY A;  1TAS A;  3HQT A;  5D5S A;  1YNU A;  3RI6 A;  5G09 A;  3E2Y A;  2QMA A;  1AHG A;  1D2F A;  5EAA A;  3AEP A;  1VP4 A;  2X5F A;  2VGT A;  1DJE A;  2VMX A;  5DX5 A;  1PMM A;  2W7H A;  1XI9 A;  1PG8 A;  1CZE A;  5G2Q A;  1GC3 A;  4CBR A;  1BW0 A;  2W7E A;  4ADC A;  2CFB A;  3RBL A;  2VMT A;  2WKA A;  3VK3 A;  1V72 A;  5FT8 A;  4E77 A;  3A9X A;  3BV0 A;  1ASG A;  1QZ9 A;  2YKY A;  2ZY3 A;  1O69 A;  4A72 A;  3FDD A;  1TOE A;  4CVQ A;  3OP7 A;  2ZC0 A;  2X5D A;  2W8U A;  2Z20 A;  3PIU A;  4ZAH A;  4PFF A;  5F8V A;  3TQX A;  4DQ6 A;  4ZM3 A;  2OQX A;  3FZ8 A;  1AJS B;  3PPL A;  1V2D A;  1Y4I A;  1AHE A;  3AEN B;  3K40 A;  1QIR A;  4ZM4 A;  4A0H A;  1IX7 A;  1OAT A;  4MY5 A;  2VMR A;  3FZ7 A;  2C44 A;  3ZRP A;  1TOG A;  1B9I A;  1SVV A;  1LC7 A;  2JGT A;  3MEB A;  4WYE A;  3FZ6 A;  3COG A;  3GSB A;  5G2P A;  3PDB A;  2VMZ A;  4ZWM A;  4OMA A;  4UHM A;  1DFO A;  1KL2 A;  1X29 A;  4O6Z A;  5F9S A;  1DGD A;  1ASF A;  1M6S A;  2DGK A;  1M0Q A;  1W7N A;  4XJP A;  5DJ9 A;  3JZL A;  2BYJ A;  4EB7 A;  3L44 A;  2ZSM A;  4WYF A;  3LVL B;  5EIG A;  3EIA A;  2YCP A;  3EI9 A;  4FFC A;  3I16 A;  1IAY A;  4XQ2 A;  3F0H A;  1I29 A;  3WCN A;  4ZLV A;  4ZSY A;  4IY7 A;  5C6U A;  4MKJ A;  2DOU A;  3G0T A;  3TCM A;  1ECX A;  4E3R A;  1GBN A;  3A2B A;  4GRX A;  4ISY A;  2VIA A;  1G4X A;  5AX8 A;  3ZZK A;  1GD9 A;  4F5M A;  4OBV A;  2ZY5 A;  1VJO A;  5FT5 A;  4GDY A;  4WLH A;  2YKU A;  4AO9 A;  1W7M A;  5M49 A;  3CQ5 A;  4F5H A;  3FFH A;  1BJO A;  1ASL A;  2DGM A;  3DR7 A;  4HVK A;  3PJ0 A;  5M4D A;  1PFF A;  1GEX A;  2VMQ A;  1WYU B;  4M2K A;  1P3W A;  4L0O A;  4JE5 D;  3AEO A;  4Q75 A;  4QGR A;  1DJU A;  1N31 A;  3USF A;  2C7T A;  2W7K A;  4IXS A;  5EUD A;  4GEB A;  1TPL A;  2BIG A;  1AAW A;  3NUI A;  1AMR A;  2C81 A;  3JW9 A;  2QA3 A;  2JG2 A;  2W7J A;  1LK9 A;  1WYV B;  5K8B A;  3ASB A;  1I41 A;  4EMY A;  1ORD A;  3RCH B;  2JIS A;  2E7J A;  4U2H A;  1AY4 A;  4AO4 A;  1B9H A;  5G4I A;  1C9C A;  1I48 A;  4GE4 A;  3HBX A;  4JE5 A;  2FN6 A;  1ASB A;  1OHW A;  1BT4 A;  2F8J A;  3LG0 A;  4XAU A;  4IYO B;  1ASE A;  1S06 A;  5BJ4 A;  4CBS A;  4TN4 A;  2AY4 A;  2Z67 A;  4K05 A;  2W7L A;  2CIN A;  1AKC A;  4W5K A;  4A6T A;  3AOV A;  1RVY A;  3E9K A;  1CQ6 A;  1QGN A;  3B46 A;  3BWN A;  1DJ9 A;  2AY3 A;  2VGU A;  3IHJ A;  4DGT A;  1BJW A;  2R5C A;  4F5I A;  2Z9U A;  2AY5 A;  3F9T A;  3MKJ A;  3E77 A;  2VLH A;  3ZRR A;  1C4K A;  2EPJ A;  1AY8 A;  1RVU A;  4WB0 B;  4WXF A;  3F6T A;  3W1H A;  4EFF A;  3E2Z A;  4ADE A;  1BJ4 A;  4Q31 A;  3VP6 A;  1TOJ A;  1KKP A;  1X0M A;  3QI6 A;  1WYT A;  1MAP A;  1UU1 A;  4ITX A;  2OKJ A;  1YJS A;  3NRA A;  2Z9W A;  1DKA A;  4ZDL A;  2FNU A;  2Z9V A;  3AEJ A;  2CH1 A;  2O7C A;  3NU8 A;  1YIY A;  4GE7 A;  1WKG A;  4XJM A;  4P7Y A;  4E3Q A;  3PD6 A;  1AIC A;  5E3K A;  1Z7D A;  5E5I A;  1JG8 A;  3CQ4 A;  3HLM A;  5LHA A;  1PMO A;  2CH2 A;  2VMU A;  1AMA A;  2BI2 A;  2C0R A;  3UWC A;  2Z1Z A;  2QSR A;  2OGE A;  2D61 A;  1O62 A;  1JS6 A;  1ZC9 A;  1ASM A;  2D5Y A;  4J8L A;  2AY7 A;  4XJO A;  3CBF A;  1TAR A;  2AAT A;  5IWQ A;  3NDN A;  4WYC A;  1JF9 A;  2YKV A;  4JEY A;  3A9Z A;  1ARH A;  5G0A A;  4JEW A;  2Z61 A;  2GSA A;  2O0R A;  3NUB A;  3OKS A;  1H0C A;  2V1P A;  3QGU A;  3B1D A;  1ASN A;  3FFR A;  3WZF A;  2FKI A;  2PB0 A;  5EUN A;  2BWP A;  1E5E A;  1UKJ A;  3H14 A;  4F4E A;  1V2E A;  3AEM A;  3FD0 A;  4PIW A;  3MAD A;  3G8M A;  3WX9 A;  4MQR A;  1YJZ A;  4E1O A;  2VMN A;  3MBB A;  4KXK A;  2R5E A;  3FRK A;  4OC9 A;  2G7J A;  2GQN A;  3LV2 A;  1E5F A;  1CJ0 A;  4N0W A;  3N4S A;  3AOW A;  1AX4 A;  1I43 A;  4ATP A;  1MDO A;  3Q8N A;  1QIS A;  3N0L A;  4W1V A;  3DXV A;  3TAT A;  2CTZ A;  2FM1 A;  1D7V A;  2W7F A;  4OTL A;  3MC6 A;  4ADB A;  3ISL A;  3FVS A;  3NYU A;  2HUF A;  5M4B A;  3PGY A;  1C7O A;  1AJS A;  3BCX A;  3D6K A;  3W1J A;  3K28 A;  3AEN A;  1S09 A;  5EAV A;  3HL2 A;  1KMK A;  2DGL A;  3RQ1 A;  1W23 A;  4AH3 A;  1GDE A;  3DOD A;  4R5Z A;  1MAQ A;  5HHY A;  2DKB A;  3AEL A;  1S0A A;  2YOB A;  3HMU A;  2YRR A;  4W1W A;  4BQ0 A;  2HUU A;  4RLG A;  4A6U A;  1X2A A;  2X8U A;  3UE8 A;  1YOO A;  4TV7 A;  3BN1 A;  3ZRQ A;  1YIZ A;  2VGS A;  3I4J A;  3JWA A;  3HVY A;  3EI5 A;  2CJG A;  2ZY2 A;  1CL2 A;  4RKC A;  3GZD A;  2QB3 A;  2ZYJ A;  2AY8 A;  4IX8 A;  2KFP A;  1LKC A;  2VGZ A;  3VAX A;  4M2M A;  1TOK A;  4FL0 A;  1UU2 A;  4LW4 A;  1AY5 A;  1Z3Z A;  2D66 A;  1B5P A;  2CB1 A;  4AZK A;  3H7F A;  2BWN A;  3NU7 A;  1LS3 A;  1BJN A;  3AAT A;  3II0 A;  3KE3 A;  1GC2 A;  1M32 A;  2D64 A;  2G6W A;  3B1E A;  3BS8 A;  1IVR A;  1D7S A;  3VOM A;  1KAF A;  3GJU A;  4OBU A;  5FT6 A;  1ASA A;  1LW4 A;  3W1I A;  2ZJG A;  3WGB A;  3H9X A;  1ASC A;  1IX6 A;  1YJY A;  3EI8 A;  4LNM A;  4BMK A;  5FT4 A;  3LY1 A;  1GEY A;  1N2T A;  4OT8 A;  4RM1 A;  1N8P A;  1B4X A;  3P6K A;  4ITG A;  1OXP A;  5DB5 A;  3WLX A;  1U08 A;  3R4T A;  1WYU A;  1W7L A;  3FKD A;  1AAM A;  5EFS A;  1CQ7 A;  1KMJ A;  1IUG A;  3EI6 A;  2WK9 A;  5DJ1 A;  1GCK A;  2W8J A;  1G7W A;  2VGV A;  3KGX A;  2V0Y A;  2YRI A;  1WYV A;  4WBT A;  3N5M A;  4WYG A;  1AMQ A;  3BWO A;  1MLZ A;  4RJ0 A;  4EU1 A;  4PFN A;  2YKX A;  2FQ6 A;  3RCH A;  5EQC A;  2BIE A;  4U1T A;  2JJE A;  4EB5 A;  3FVU A;  2Z9X A;  3DRD A;  4TMR A;  3LVM A;  4I8A A;  3QHX A;  3PA9 A;  3DYD A;  2ORD A;  2AY1 A;  4IYO A;  4R2N A;  1ELU A;  2BI1 A;  1TAT A;  1O4S A;  1M0N A;  2X3L A;  4ZDP A;  4CXQ A;  2HOZ A;  2W7I A;  4PVF A;  2W7M A;  1B8G A;  3E6G A;  4MQP A;  5G4J A;  4RJY A;  1M0O A;  1SZU A;  1CQ8 A;  1IX8 A;  2ZSL A;  4JEZ A;  3HT4 A;  4RIT A;  4ZAS A;  2BIA A;  2D65 A;  2WK7 A;  3JTX A;  3MAF B;  4ZSW A;  4Y0H A;  2BI9 A;  2E7U A;  2YCN A;  3TFT A;  1C7G A;  3K7Y A;  2EZ2 A;  2EYQ A;  1VEF A;  3WKS A;  2PO3 A;  3QBO A;  3DU4 A;  2WK8 A;  5E4Z A;  5EUE A;  2D7Z A;  2D63 A;  2ZUK A;  4J5U A;  4WB0 A;  3WY7 A;  1S07 A;  2WB6 A;  1AKB A;  1IJI A;  1QJ3 A;  2FNI A;  3ZZJ A;  4A0G A;  4DBC A;  2A1V A;  4RKD A;  4F5F A;  1J32 A;  1MDX A;  1G7X A;  4W8I A;  4LNJ A;  1ASD A;  4WD2 A;  5BJ3 A;  2GMS A;  5I92 A;  3ELP A;  1BS0 A;  1M0P A;  2W8V A;  2D7Y A;  3ASA A;  4WXB A;  1AMS A;  1ELQ A;  4LC3 A;  2OAT A;  2Z1Y A;  2QLR A;  3KGW A;  4K2M A;  4XEW A;  2QBT A;  4BA5 A;  4LNL A;  1RV4 A;  3B8X A;  4XK1 A;  1OXO A;  5KTB A;  2HOY A;  3GZC A;  2VMS A;  1OHV A;  2VMY A;  5J8Q A;  2OGA A;  1YAA A;  3VK2 A;  2VYC A;  3LVK A;  3PDB B;  4HF8 A;  4LW2 A;  4UQV A;  2JJF A;  1S08 A;  2CJH A;  2VI9 A;  2XH1 A;  1SF2 A;  2O1B A;  3WKR A;  2Q7W A;  2AEV A;  4UHO A;  3FQ7 A;  1MGV A;  2YHK A;  1G4V A;  3CQ6 A;  1BKG A;  4K2I A;  3LWS A;  4A6R A;  1FC4 A;  3N4X A;  1EQB A;  1FG3 A;  5EIG B;  2EO5 A;  2HOR A;  1XEY A;  1AIA A;  2PB2 A;  2VMO A;  1M7Y A;  1LC5 A;  1ZOB A;  3EUC A;  3CAI A;  3EZS A;  1IBJ A;  2JJG A;  3L8A A;  4JF1 A;  1AJR A;  1RV3 A;  4JEX A;  1X28 A;  4MKK A;  4H63 Q;  7AAT A;  1QIT A;  3GR9 A;  1QJ5 A;  1TOI A;  3BWN C;  4B9B A;  3B1C A;  3DXW A;  4CXR A;  4IXZ A;  5HDM A;  2GMU A;  4JF0 A;  3VK4 A;  4NOG A;  3HDO A;  1KL1 A;  2W8T A;  2CAN A;  1C0N A;  5TF5 A;  3TFU A;  1BJO B;  4W91 A;  3NTJ A;  1ARS A;  1SPA A;  4Y0D A;  1LC8 A;  2BYL A;  1ZOD A;  2HZP A;  3JWB A;  3GWP A;  3GBX A;  4H51 A;  4KAM A;  2RFV A;  3JU7 A;  4Y0I A;  3BCA A;  3FQ8 A;  4OYT A;  2DKJ A;  4K2B A;  4OCA A;  1UU0 A;  4ADD A;  1WKH A;  3FSL A;  2DR1 A;  1BQD A;  2GB3 A;  4WP0 A;  1T3I A;  4IXO A;  1J04 A;  1CZC A;  2HOX A;  3G7Q A;  1AKA A;  2AY6 A;  2BKW A;  2YCT A;  3PDX A;  3M5U A;  3FCR A;  2XBN A;  3ATH A;  4UOY A;  4M2J A;  2VMP A;  3LVJ A;  4A0R A;  3AEJ C;  3AV7 A;  1O61 A;  3RUY A;  1SZS A;  3UAK A;  1MLY A;  2VMW A;  1BQA A;  4AOA A;  2HP1 A;  3EZ1 A;  1OHY A;  3NYT A;  4IW7 A;  2VI8 A;  1LW5 A;  3NNK A;  1IAX A;  4ATQ A;  1C7N A;  2W8W A;  1M4N A;  5LH9 A;  4KYO A;  2VGW A;  2E7I A;  2BI3 A;  2W7D A;  4JEV A;  5D95 A;  4F5K A;  2BHX A;  3GET A;  3I5T A;  2EZ1 A;  4ZDO A;  1JS3 A;  3DZZ A;  2W7G A;  2CY8 A;  4N0B A;  4GSA A;  4BHD A;  1D7U A;  4A00 A;  3RBF A;  2R5C B;  2VIB A;  2TPL A;  4R5F A;  9AAT A;  5HXX A;  3NYS A;  3QPG A;  1AHY A;  3PAA A;  1DGE A;  3R9A A;  4Q76 A;  3ACZ A;  2CJD A;  1GEW A;  2HUI A;  4F5J A;  5M46 A;  1AHF A;  2OKK A;  2R2N A;  2R0T A;  3BCB A;  1EJI A;  3FQA A;  2AEU A;  3E2F A;  4MSO A;  1DTY A;  2EH6 A;  3E2Z B;  4MGR A; 
#chains in the Genus database with same CATH homology
 2VLF A;  4BA4 A;  3AEM C;  3DR4 A;  1KKJ A;  2EGY A;  1AHX A;  3A9Y A;  4W1X A;  4WYA A;  4A0F A;  8AAT A;  2ZY4 A;  1FG7 A;  2FYF A;  3KKI A;  4MQQ A;  4AZJ A;  1CS1 A;  3P1T A;  4R8D A;  1WYT B;  2ZP7 A;  4B98 A;  3N7N A;  1AIB A;  1SZK A;  3T32 A;  3BC8 A;  2VMV A;  1ARI A;  1EG5 A;  1GC0 A;  2AY9 A;  3FDB A;  1ARG A;  3QM2 A;  3MAU A;  2AY2 A;  1V2F A;  1W3U A;  4WYD A;  3NX3 A;  3DC1 A;  3PD6 B;  3MC6 C;  3N75 A;  3N4R A;  3FTB A;  4P3M A;  4ZWV A;  1GC4 A;  3WGC A;  4GE9 A;  3EIB A;  2E54 A;  4UHN A;  4RIZ A;  3ELE A;  1WST A;  2NMP A;  3IF2 A;  3EI7 A;  4Q6R A;  4XJL A;  4WXG A;  1CL1 A;  4F5L A;  2BWO A;  4RAE A;  2HP2 A;  3FVX A;  1H1C A;  2QB2 A;  2BI5 A;  1B5O A;  1ART A;  3QN6 A;  2JJH A;  3GZD C;  3ECD A;  4F5G A;  1D7R A;  3MAF A;  1SFF A;  3A8U X;  1MDZ A;  3WCO A;  2CST A;  3BB8 A;  4WLJ A;  5JAY A;  1TAS A;  3HQT A;  5D5S A;  1YNU A;  3RI6 A;  5G09 A;  3E2Y A;  2QMA A;  1AHG A;  1D2F A;  5EAA A;  3AEP A;  1VP4 A;  2X5F A;  2VGT A;  1DJE A;  2VMX A;  5DX5 A;  1PMM A;  2W7H A;  1XI9 A;  1PG8 A;  1CZE A;  5G2Q A;  1GC3 A;  4CBR A;  1BW0 A;  2W7E A;  4ADC A;  2CFB A;  3RBL A;  2VMT A;  2WKA A;  3VK3 A;  1V72 A;  5FT8 A;  4E77 A;  3A9X A;  3BV0 A;  1ASG A;  1QZ9 A;  2YKY A;  2ZY3 A;  1O69 A;  4A72 A;  3FDD A;  1TOE A;  4CVQ A;  3OP7 A;  2ZC0 A;  2X5D A;  2W8U A;  2Z20 A;  3PIU A;  4ZAH A;  4PFF A;  5F8V A;  3TQX A;  4DQ6 A;  4ZM3 A;  2OQX A;  3FZ8 A;  1AJS B;  3PPL A;  1V2D A;  1Y4I A;  1AHE A;  3AEN B;  3K40 A;  1QIR A;  4ZM4 A;  4A0H A;  1IX7 A;  1OAT A;  4MY5 A;  2VMR A;  3FZ7 A;  2C44 A;  3ZRP A;  1TOG A;  1B9I A;  1SVV A;  1LC7 A;  2JGT A;  3MEB A;  4WYE A;  3FZ6 A;  3COG A;  3GSB A;  5G2P A;  3PDB A;  2VMZ A;  4ZWM A;  4OMA A;  4UHM A;  1DFO A;  1KL2 A;  1X29 A;  4O6Z A;  5F9S A;  1DGD A;  1ASF A;  1M6S A;  2DGK A;  1M0Q A;  1W7N A;  4XJP A;  5DJ9 A;  3JZL A;  2BYJ A;  4EB7 A;  3L44 A;  2ZSM A;  4WYF A;  3LVL B;  5EIG A;  3EIA A;  2YCP A;  3EI9 A;  4FFC A;  3I16 A;  1IAY A;  4XQ2 A;  3F0H A;  1I29 A;  3WCN A;  4ZLV A;  4ZSY A;  4IY7 A;  5C6U A;  4MKJ A;  2DOU A;  3G0T A;  3TCM A;  1ECX A;  4E3R A;  1GBN A;  3A2B A;  4GRX A;  4ISY A;  2VIA A;  1G4X A;  5AX8 A;  3ZZK A;  1GD9 A;  4F5M A;  4OBV A;  2ZY5 A;  1VJO A;  5FT5 A;  4GDY A;  4WLH A;  2YKU A;  4AO9 A;  1W7M A;  5M49 A;  3CQ5 A;  4F5H A;  3FFH A;  1BJO A;  1ASL A;  2DGM A;  3DR7 A;  4HVK A;  3PJ0 A;  5M4D A;  1PFF A;  1GEX A;  2VMQ A;  1WYU B;  4M2K A;  1P3W A;  4L0O A;  4JE5 D;  3AEO A;  4Q75 A;  4QGR A;  1DJU A;  1N31 A;  3USF A;  2C7T A;  2W7K A;  4IXS A;  5EUD A;  4GEB A;  1TPL A;  2BIG A;  1AAW A;  3NUI A;  1AMR A;  2C81 A;  3JW9 A;  2QA3 A;  2JG2 A;  2W7J A;  1LK9 A;  1WYV B;  5K8B A;  3ASB A;  1I41 A;  4EMY A;  1ORD A;  3RCH B;  2JIS A;  2E7J A;  4U2H A;  1AY4 A;  4AO4 A;  1B9H A;  5G4I A;  1C9C A;  1I48 A;  4GE4 A;  3HBX A;  4JE5 A;  2FN6 A;  1ASB A;  1OHW A;  1BT4 A;  2F8J A;  3LG0 A;  4XAU A;  4IYO B;  1ASE A;  1S06 A;  5BJ4 A;  4CBS A;  4TN4 A;  2AY4 A;  2Z67 A;  4K05 A;  2W7L A;  2CIN A;  1AKC A;  4W5K A;  4A6T A;  3AOV A;  1RVY A;  3E9K A;  1CQ6 A;  1QGN A;  3B46 A;  3BWN A;  1DJ9 A;  2AY3 A;  2VGU A;  3IHJ A;  4DGT A;  1BJW A;  2R5C A;  4F5I A;  2Z9U A;  2AY5 A;  3F9T A;  3MKJ A;  3E77 A;  2VLH A;  3ZRR A;  1C4K A;  2EPJ A;  1AY8 A;  1RVU A;  4WB0 B;  4WXF A;  3F6T A;  3W1H A;  4EFF A;  3E2Z A;  4ADE A;  1BJ4 A;  4Q31 A;  3VP6 A;  1TOJ A;  1KKP A;  1X0M A;  3QI6 A;  1WYT A;  1MAP A;  1UU1 A;  4ITX A;  2OKJ A;  1YJS A;  3NRA A;  2Z9W A;  1DKA A;  4ZDL A;  2FNU A;  2Z9V A;  3AEJ A;  2CH1 A;  2O7C A;  3NU8 A;  1YIY A;  4GE7 A;  1WKG A;  4XJM A;  4P7Y A;  4E3Q A;  3PD6 A;  1AIC A;  5E3K A;  1Z7D A;  5E5I A;  1JG8 A;  3CQ4 A;  3HLM A;  5LHA A;  1PMO A;  2CH2 A;  2VMU A;  1AMA A;  2BI2 A;  2C0R A;  3UWC A;  2Z1Z A;  2QSR A;  2OGE A;  2D61 A;  1O62 A;  1JS6 A;  1ZC9 A;  1ASM A;  2D5Y A;  4J8L A;  2AY7 A;  4XJO A;  3CBF A;  1TAR A;  2AAT A;  5IWQ A;  3NDN A;  4WYC A;  1JF9 A;  2YKV A;  4JEY A;  3A9Z A;  1ARH A;  5G0A A;  4JEW A;  2Z61 A;  2GSA A;  2O0R A;  3NUB A;  3OKS A;  1H0C A;  2V1P A;  3QGU A;  3B1D A;  1ASN A;  3FFR A;  3WZF A;  2FKI A;  2PB0 A;  5EUN A;  2BWP A;  1E5E A;  1UKJ A;  3H14 A;  4F4E A;  1V2E A;  3AEM A;  3FD0 A;  4PIW A;  3MAD A;  3G8M A;  3WX9 A;  4MQR A;  1YJZ A;  4E1O A;  2VMN A;  3MBB A;  4KXK A;  2R5E A;  3FRK A;  4OC9 A;  2G7J A;  2GQN A;  3LV2 A;  1E5F A;  1CJ0 A;  4N0W A;  3N4S A;  3AOW A;  1AX4 A;  1I43 A;  4ATP A;  1MDO A;  3Q8N A;  1QIS A;  3N0L A;  4W1V A;  3DXV A;  3TAT A;  2CTZ A;  2FM1 A;  1D7V A;  2W7F A;  4OTL A;  3MC6 A;  4ADB A;  3ISL A;  3FVS A;  3NYU A;  2HUF A;  5M4B A;  3PGY A;  1C7O A;  1AJS A;  3BCX A;  3D6K A;  3W1J A;  3K28 A;  3AEN A;  1S09 A;  5EAV A;  3HL2 A;  1KMK A;  2DGL A;  3RQ1 A;  1W23 A;  4AH3 A;  1GDE A;  3DOD A;  4R5Z A;  1MAQ A;  5HHY A;  2DKB A;  3AEL A;  1S0A A;  2YOB A;  3HMU A;  2YRR A;  4W1W A;  4BQ0 A;  2HUU A;  4RLG A;  4A6U A;  1X2A A;  2X8U A;  3UE8 A;  1YOO A;  4TV7 A;  3BN1 A;  3ZRQ A;  1YIZ A;  2VGS A;  3I4J A;  3JWA A;  3HVY A;  3EI5 A;  2CJG A;  2ZY2 A;  1CL2 A;  4RKC A;  3GZD A;  2QB3 A;  2ZYJ A;  2AY8 A;  4IX8 A;  2KFP A;  1LKC A;  2VGZ A;  3VAX A;  4M2M A;  1TOK A;  4FL0 A;  1UU2 A;  4LW4 A;  1AY5 A;  1Z3Z A;  2D66 A;  1B5P A;  2CB1 A;  4AZK A;  3H7F A;  2BWN A;  3NU7 A;  1LS3 A;  1BJN A;  3AAT A;  3II0 A;  3KE3 A;  1GC2 A;  1M32 A;  2D64 A;  2G6W A;  3B1E A;  3BS8 A;  1IVR A;  1D7S A;  3VOM A;  3GJU A;  4OBU A;  5FT6 A;  1ASA A;  1LW4 A;  3W1I A;  2ZJG A;  3WGB A;  3H9X A;  1ASC A;  1IX6 A;  1YJY A;  3EI8 A;  4LNM A;  4BMK A;  5FT4 A;  3LY1 A;  1GEY A;  1N2T A;  4OT8 A;  4RM1 A;  1N8P A;  1B4X A;  3P6K A;  4ITG A;  1OXP A;  5DB5 A;  3WLX A;  1U08 A;  3R4T A;  1WYU A;  1W7L A;  3FKD A;  1AAM A;  5EFS A;  1CQ7 A;  1KMJ A;  1IUG A;  3EI6 A;  2WK9 A;  5DJ1 A;  1GCK A;  2W8J A;  1G7W A;  2VGV A;  3KGX A;  2V0Y A;  2YRI A;  1WYV A;  4WBT A;  3N5M A;  4WYG A;  1AMQ A;  3BWO A;  1MLZ A;  4RJ0 A;  4EU1 A;  4PFN A;  2YKX A;  2FQ6 A;  3RCH A;  5EQC A;  2BIE A;  4U1T A;  2JJE A;  4EB5 A;  3FVU A;  2Z9X A;  3DRD A;  4TMR A;  3LVM A;  4I8A A;  3QHX A;  3PA9 A;  3DYD A;  2ORD A;  2AY1 A;  4IYO A;  4R2N A;  1ELU A;  2BI1 A;  1TAT A;  1O4S A;  1M0N A;  2X3L A;  4ZDP A;  4CXQ A;  2HOZ A;  2W7I A;  4PVF A;  2W7M A;  1B8G A;  3E6G A;  4MQP A;  5G4J A;  4RJY A;  1M0O A;  1SZU A;  1CQ8 A;  1IX8 A;  2ZSL A;  4JEZ A;  3HT4 A;  4RIT A;  4ZAS A;  2BIA A;  2D65 A;  2WK7 A;  3JTX A;  3MAF B;  4ZSW A;  4Y0H A;  2BI9 A;  2E7U A;  2YCN A;  3TFT A;  1C7G A;  3K7Y A;  2EZ2 A;  2EYQ A;  1VEF A;  3WKS A;  2PO3 A;  3QBO A;  3DU4 A;  2WK8 A;  5E4Z A;  5EUE A;  2D7Z A;  2D63 A;  2ZUK A;  4J5U A;  4WB0 A;  3WY7 A;  1S07 A;  2WB6 A;  1AKB A;  1IJI A;  1QJ3 A;  2FNI A;  3ZZJ A;  4A0G A;  4DBC A;  2A1V A;  4RKD A;  4F5F A;  1J32 A;  1MDX A;  1G7X A;  4W8I A;  4LNJ A;  1ASD A;  4WD2 A;  5BJ3 A;  2GMS A;  5I92 A;  3ELP A;  1BS0 A;  1M0P A;  2W8V A;  2D7Y A;  3ASA A;  4WXB A;  1AMS A;  1ELQ A;  4LC3 A;  2OAT A;  2Z1Y A;  2QLR A;  3KGW A;  4K2M A;  4XEW A;  2QBT A;  4BA5 A;  4LNL A;  1RV4 A;  3B8X A;  4XK1 A;  1OXO A;  5KTB A;  2HOY A;  3GZC A;  2VMS A;  1OHV A;  2VMY A;  5J8Q A;  2OGA A;  1YAA A;  3VK2 A;  2VYC A;  3LVK A;  3PDB B;  4HF8 A;  4LW2 A;  4UQV A;  2JJF A;  1S08 A;  2CJH A;  2VI9 A;  2XH1 A;  1SF2 A;  2O1B A;  3WKR A;  2Q7W A;  2AEV A;  4UHO A;  3FQ7 A;  1MGV A;  2YHK A;  1G4V A;  3CQ6 A;  1BKG A;  4K2I A;  3LWS A;  4A6R A;  1FC4 A;  3N4X A;  1EQB A;  1FG3 A;  5EIG B;  2EO5 A;  2HOR A;  1XEY A;  1AIA A;  2PB2 A;  2VMO A;  1M7Y A;  1LC5 A;  1ZOB A;  3EUC A;  3CAI A;  3EZS A;  1IBJ A;  2JJG A;  3L8A A;  4JF1 A;  1AJR A;  1RV3 A;  4JEX A;  1X28 A;  4MKK A;  4H63 Q;  7AAT A;  1QIT A;  3GR9 A;  1QJ5 A;  1TOI A;  3BWN C;  4B9B A;  3B1C A;  3DXW A;  4CXR A;  4IXZ A;  5HDM A;  2GMU A;  4JF0 A;  3VK4 A;  4NOG A;  3HDO A;  1KL1 A;  2W8T A;  2CAN A;  1C0N A;  5TF5 A;  3TFU A;  1BJO B;  4W91 A;  3NTJ A;  1ARS A;  1SPA A;  4Y0D A;  1LC8 A;  2BYL A;  1ZOD A;  2HZP A;  3JWB A;  3GWP A;  3GBX A;  4H51 A;  4KAM A;  2RFV A;  3JU7 A;  4Y0I A;  3BCA A;  3FQ8 A;  4OYT A;  2DKJ A;  4K2B A;  4OCA A;  1UU0 A;  4ADD A;  1WKH A;  3FSL A;  2DR1 A;  1BQD A;  2GB3 A;  4WP0 A;  1T3I A;  4IXO A;  1J04 A;  1CZC A;  2HOX A;  3G7Q A;  1AKA A;  2AY6 A;  2BKW A;  2YCT A;  3PDX A;  3M5U A;  3FCR A;  2XBN A;  3ATH A;  4UOY A;  4M2J A;  2VMP A;  3LVJ A;  4A0R A;  3AEJ C;  3AV7 A;  1O61 A;  3RUY A;  1SZS A;  3UAK A;  1MLY A;  2VMW A;  1BQA A;  4AOA A;  2HP1 A;  3EZ1 A;  1OHY A;  3NYT A;  4IW7 A;  2VI8 A;  1LW5 A;  3NNK A;  1IAX A;  4ATQ A;  1C7N A;  2W8W A;  1M4N A;  5LH9 A;  4KYO A;  2VGW A;  2E7I A;  2BI3 A;  2W7D A;  4JEV A;  5D95 A;  4F5K A;  2BHX A;  3GET A;  3I5T A;  2EZ1 A;  4ZDO A;  1JS3 A;  3DZZ A;  2W7G A;  2CY8 A;  4N0B A;  4GSA A;  4BHD A;  1D7U A;  4A00 A;  3RBF A;  2R5C B;  2VIB A;  2TPL A;  4R5F A;  9AAT A;  5HXX A;  3NYS A;  3QPG A;  1AHY A;  3PAA A;  1DGE A;  3R9A A;  4Q76 A;  3ACZ A;  2CJD A;  1GEW A;  2HUI A;  4F5J A;  5M46 A;  1AHF A;  2OKK A;  2R2N A;  2R0T A;  3BCB A;  1EJI A;  3FQA A;  2AEU A;  3E2F A;  4MSO A;  1DTY A;  2EH6 A;  3E2Z B;  4MGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...