2QB2A

Structural studies reveal the inactivation of e. coli l-aspartate aminotransferase by (s)-4,5-dihydro-2thiophenecarboylic acid (sadta) via two mechanisms (at ph 7.0).
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
395
structure length
381
Chain Sequence
FENITAAPDLFRAKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Inactivation of Escherichia coli L-aspartate aminotransferase by (S)-4-amino-4,5-dihydro-2-thiophenecarboxylic acid reveals "a tale of two mechanisms".
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 145
structure length 381
sequence length 395
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2qb2A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2qb2A01
1G4XA 2HOXA 3NU7A 7AATA 3B1EA 2FYFA 2W7MA 3A9ZA 3GZDA 2D7ZA 3HQTA 2WK7A 1CQ8A 2CTZA 4ITXA 3E2FA 3FCRA 3HVYA 4GSAA 4RM1A 1JF9A 5EAAA 4ATPA 1SZUA 3A8UX 3DXWA 1M32A 5IWQA 4F5GA 1CQ6A 3OP7A 3RUYA 2ZY3A 1TOJA 3LVLB 2CANA 4GDYA 2VLFA 3PD6A 3QN6A 4LNJA 2BIEA 2VI8A 3QGUA 5G0AA 1YJYA 3JTXA 1ZC9A 1W7MA 3A2BA 3LVKA 4RLGA 2EO5A 1LC5A 1AMSA 2VMZA 3G7QA 1VJOA 1GD9A 2W8UA 1TARA 5DB5A 3JW9A 1RV3A 3AELA 4WYAA 1JS3A 3FDDA 2BI5A 2FN6A 5G2PA 2C0RA 1RV4A 4ZDLA 4XK1A 1ASBA 2BWOA 2C7TA 3DRDA 1W7LA 4WXGA 4WYGA 4EFFA 2V1PA 3FFHA 2YOBA 2NMPA 3TFUA 1B8GA 4CXRA 1XI9A 1ELQA 3WLXA 2CINA 4A0GA 1SPAA 1B5PA 2QA3A 2GQNA 1AHGA 4Y0DA 2YCNA 5EIGB 4XJOA 4KXKA 3AOVA 1O69A 2R2NA 3WCOA 4A72A 2E54A 3NNKA 4IYOA 5G09A 4IX8A 1MAQA 2FM1A 4BQ0A 1BJWA 3KGWA 2YKUA 5D5SA 4IXSA 1W23A 4ZLVA 1DJUA 3LG0A 3MAUA 4GRXA 2EGYA 1QITA 4K2BA 4LW2A 3ZRPA 1ZOBA 2D65A 3MBBA 3NRAA 4R5FA 1P3WA 3VAXA 4CBSA 3E2YA 1WYVA 3TFTA 4AZKA 4RAEA 4F4EA 2YCTA 2R5CB 4XQ2A 2DGLA 1V2FA 3JWBA 3BCXA 4ADBA 1C0NA 4UHNA 2YKYA 3MKJA 1CJ0A 4JEVA 3PGYA 4NOGA 2ZY5A 4GE9A 1AICA 4U1TA 3AV7A 2PB2A 1Y4IA 3WY7A 2XH1A 3FDBA 1N8PA 1BJ4A 2VMOA 2BYJA 5M4DA 4OMAA 4XJPA 2OKJA 2ORDA 3FZ6A 2JJGA 2W8TA 1WKGA 1DFOA 2VMPA 2R0TA 2VGVA 4WYFA 1J32A 2VMWA 2BI1A 1MDOA 4F5FA 1MGVA 1I29A 4UHMA 3BCAA 3ASBA 3I4JA 3AENB 4Q6RA 3N0LA 3K7YA 4F5KA 2CJHA 1B9HA 1IVRA 1AMAA 1AX4A 1IBJA 2PB0A 2V0YA 3IF2A 3PDBA 3N5MA 4MKKA 2W7HA 3EI8A 3AEMA 4PFFA 2VGSA 3GWPA 2AY9A 1O61A 4ZDOA 2GB3A 1M7YA 2W7DA 1C7NA 1X2AA 3BN1A 1VP4A 1ARSA 4BMKA 3BV0A 1WYTB 3UAKA 3F6TA 1CZEA 3PJ0A 3GZDC 4WXBA 3FQAA 2C44A 2XBNA 4JF1A 3WZFA 4F5LA 2OGAA 1YJZA 3CAIA 3H7FA 4GE7A 3NUBA 1D7SA 2OATA 2JG2A 3FVXA 3FQ7A 4ADDA 2OKKA 2DGMA 1V72A 2HOYA 1AHXA 1S09A 2QB2A 2W7EA 3PPLA 3BWOA 4IY7A 3K28A 4I8AA 4R8DA 4Q75A 5F9SA 2X5FA 1IAXA 1X0MA 2JJFA 1EQBA 3NYUA 2RFVA 3OKSA 1FG3A 3UWCA 1YIZA 3B1DA 3FKDA 2QB3A 1V2DA 1GC0A 3MEBA 2YKVA 1PFFA 1AHYA 3L8AA 4R2NA 4JEWA 2Z1ZA 1EJIA 2FNIA 2AY2A 1MLZA 2VGTA 1IX6A 1SFFA 3FVSA 2HP1A 3PD6B 4J5UA 1D7UA 2O0RA 4OC9A 4ZASA 3VK4A 2JISA 3EI7A 4RKDA 2VGUA 1J04A 1AKBA 2G6WA 4W91A 1MLYA 2VMXA 4ZWVA 3F0HA 2CY8A 5E5IA 2GMUA 2YRIA 2CH1A 1M0OA 3MAFB 1X29A 5K8BA 3NYSA 3QHXA 4BA5A 1AIAA 1YJSA 2CJDA 5EFSA 3BWNA 4W1VA 1KKJA 4M2KA 1Z3ZA 3GJUA 3HL2A 4ZWMA 4K2IA 2PO3A 4OBVA 5G4IA 1I43A 3P1TA 3WGCA 4JE5D 5M49A 2W8WA 4ZSWA 4RITA 2DKBA 3RQ1A 1PMOA 4HF8A 3KE3A 2DOUA 3HMUA 4A0HA 4OBUA 1IX7A 5EAVA 2CH2A 3CQ4A 4JE5A 1I41A 1YNUA 3CQ5A 2ZSLA 4IYOB 1D7VA 1IUGA 3HT4A 4JEYA 4F5HA 1T3IA 3P6KA 5AX8A 1LS3A 2D7YA 3JZLA 3G0TA 3DXVA 4W5KA 5E4ZA 2Z9XA 3AEPA 1KL1A 2AY5A 1OXPA 4DQ6A 1FG7A 4KAMA 1E5EA 2ZC0A 3DODA 4WYEA 5HDMA 4E1OA 3ZRRA 1I48A 3RCHA 1WYVB 1ORDA 3G8MA 3E77A 1TOEA 5DX5A 4P3MA 3ACZA 2Z9WA 2HP2A 3E2ZA 3QM2A 2W8JA 1M6SA 3QI6A 4P7YA 2HUUA 1AY5A 1ASCA 2W7LA 5JAYA 1U08A 3GR9A 2BIGA 5TF5A 4A6TA 4B9BA 4E77A 1V2EA 2BHXA 1AY4A 1TATA 2HUFA 3AEMC 1AMQA 1G7WA 2AATA 2D5YA 2DR1A 5C6UA 1ASMA 3EI5A 2AY7A 9AATA 5M46A 2ZJGA 3NDNA 2E7JA 3NU8A 3CQ6A 3W1JA 5DJ9A 1AKCA 2VGWA 4AH3A 1TOIA 2ZYJA 3A9XA 3NTJA 3DYDA 2CSTA 2FQ6A 3ASAA 1AY8A 4WD2A 1BQAA 3A9YA 1MDZA 5E3KA 1ASNA 3B1CA 4ITGA 2WK9A 4JEXA 3USFA 2DKJA 4A00A 2OQXA 1PG8A 2HOZA 2ZP7A 1IAYA 1W7NA 3PDBB 2O7CA 1C9CA 4J8LA 4Q76A 4ZSYA 5BJ4A 1TOGA 5F8VA 2D64A 5FT5A 1ZODA 3WCNA 1AJSA 4W1XA 4EMYA 1LC7A 1S06A 1UU2A 2AEVA 2AY6A 3FTBA 4F5JA 4WB0A 1BT4A 5J8QA 3ELPA 4Y0HA 5I92A 4CBRA 1CQ7A 2AY4A 2AY8A 3T32A 3EIBA 1GDEA 4PFNA 2F8JA 5EUEA 1BJOA 4Q31A 1KL2A 1CZCA 1OXOA 4LNMA 1AHFA 3MC6A 4RJ0A 4ZAHA 2Z1YA 1WKHA 5BJ3A 1S08A 4TN4A 3NUIA 2BWPA 1GEWA 1MAPA 3WX9A 2D61A 3LVMA 3B46A 1ARTA 3B8XA 3WKSA 1DGEA 5LH9A 1E5FA 1QGNA 4RIZA 5FT6A 2TPLA 1SVVA 1AJRA 1M0QA 3H14A 4LNLA 2QLRA 4KYOA 3R4TA 2VIAA 3LV2A 4JF0A 3BWNC 2JGTA 4ZM3A 2VGZA 3AATA 4LW4A 3COGA 3GETA 3FQ8A 2EH6A 3GSBA 1DGDA 3UE8A 1AMRA 3BS8A 3PA9A 3VK3A 2CFBA 1BKGA 2YHKA 4OTLA 5EUNA 3VK2A 2W7IA 2VMTA 4L0OA 3N75A 1AKAA 2QMAA 4PVFA 4EU1A 4ZDPA 2E7IA 1H1CA 1B9IA 1UU0A 2X3LA 4UQVA 3FZ7A 5G2QA 2BKWA 2HUIA 1TASA 4MY5A 1YAAA 3QPGA 5LHAA 2E7UA 4MGRA 4ADEA 1WYUA 4OCAA 2YCPA 4AOAA 2Z20A 3EUCA 1GC4A 1N2TA 1D7RA 4MQPA 1GEXA 2QBTA 2CB1A 2O1BA 3Q8NA 3ATHA 3IHJA 1GC2A 1LK9A 2X5DA 1B4XA 3AOWA 3BCBA 1PMMA 1XEYA 2R5EA 4TV7A 2EZ2A 4K2MA 2VYCA 4ZM4A 1DKAA 1ASLA 4BHDA 4W1WA 2OGEA 4ADCA 4HVKA 3DZZA 3EIAA 3PDXA 3ECDA 1CL2A 3II0A 1TOKA 1Z7DA 4MSOA 3TQXA 4TMRA 3JU7A 1JG8A 4MQQA 2ZUKA 4AZJA 1M0PA 4WYDA 4A6UA 4DGTA 1S07A 3RCHB 3RBFA 3FSLA 4GEBA 5G4JA 1ECXA 3KGXA 5DJ1A 2BIAA 4XJMA 2VMNA 1AIBA 3AEJA 2VMVA 3PAAA 3E2ZB 1ASGA 1ASFA 1YOOA 1DJ9A 2YKXA 3LY1A 1TPLA 1GC3A 1LKCA 4N0WA 1M0NA 3CBFA 3MAFA 1EG5A 3FVUA 3EZSA 2Z67A 3HLMA 3D6KA 3GBXA 4A0RA 3JWAA 1RVUA 1RVYA 2GSAA 2AY1A 1SZKA 1ASEA 4M2MA 1OATA 4E3RA 4EB7A 1ARHA 3FRKA 4XEWA 3VOMA 1W3UA 1AHEA 1X28A 3RI6A 2W7JA 2BYLA 3BC8A 1DTYA 2FNUA 5FT4A 2VMSA 2DGKA 3FFRA 3WKRA 3R9AA 2EPJA 3LWSA 2JJEA 4WLJA 4WLHA 3TATA 1DJEA 1D2FA 4BA4A 1ARGA 2ZSMA 1LW5A 3W1HA 1ARIA 2X8UA 2AEUA 3MC6C 1KMKA 2D66A 4OT8A 5EIGA 4F5IA 2AY3A 4F5MA 2BI9A 3FZ8A 4PIWA 4UOYA 1AJSB 1LC8A 4N0BA 3KKIA 3LVJA 4DBCA 3W1IA 4IXZA 1SF2A 1MDXA 4WB0B 4QGRA 3ZRQA 8AATA 5M4BA 1BJNA 1FC4A 1GBNA 1B5OA 5FT8A 1QISA 1QJ3A 3MADA 4H51A 2W7FA 1CL1A 4R5ZA 4MQRA 1M4NA 1BJOB 3I16A 4CXQA 1OHYA 2Q7WA 3K40A 4FFCA 2GMSA 1S0AA 3I5TA 4IXOA 2ZY4A 3DR4A 5D95A 2VIBA 3RBLA 5HHYA 1VEFA 1BW0A 1G7XA 1CS1A 1SZSA 3L44A 4JEZA 2W7GA 2R5CA 3E6GA 2WKAA 3EI9A 4U2HA 2BWNA 4WYCA 3BB8A 2JJHA 3HDOA 4IW7A 4ISYA 3VP6A 2HZPA 4OYTA 4WXFA 4B98A 4RKCA 3TCMA 4WP0A 4AO9A 2Z61A 1ASDA 1OHVA 3HBXA 1GCKA 3ZZKA 4A0FA 1H0CA 2YRRA 2W8VA 1ASAA 2EZ1A 3EI6A 4GE4A 1C7GA 4LC3A 1N31A 4M2JA 1AAWA 1IX8A 1G4VA 1UU1A 2VI9A 2Z9UA 3M5UA 4FL0A 3FD0A 1AAMA 1GEYA 2C81A 3NYTA 1QIRA 1OHWA 4W8IA 1UKJA 2VLHA 4A6RA 1KMJA 4MKJA 4O6ZA 3AENA 3DU4A 3DC1A 3GZCA 2VMUA 2BI2A 3F9TA 5EQCA 2W7KA 5HXXA 1JS6A 1C7OA 3AEOA 1IJIA 1ELUA 4EB5A 1QZ9A 2D63A 1QJ5A 4RJYA 1O4SA 5EUDA 2ZY2A 4ATQA 1WYUB 3DR7A 1KKPA 4UHOA 1YIYA 3QBOA 4XAUA 1O62A 1WYTA 4WBTA 4CVQA 1LW4A 1BS0A 2WK8A 2HORA 2BI3A 2CJGA 2Z9VA 3WGBA 1WSTA 3ELEA 3ZZJA 3AEJC 4XJLA 3ISLA 2VMRA 3PIUA 2VMYA 3EZ1A 3NX3A 4E3QA 4Y0IA 1BQDA 4AO4A 2VMQA 3E9KA 1C4KA
chains in the Genus database with same CATH superfamily
1G4XA 2HOXA 3NU7A 7AATA 3B1EA 2FYFA 2W7MA 3A9ZA 3GZDA 2D7ZA 3HQTA 2WK7A 1CQ8A 2CTZA 4ITXA 3E2FA 3FCRA 3HVYA 4GSAA 4RM1A 1JF9A 5EAAA 4ATPA 1SZUA 3A8UX 3DXWA 1M32A 5IWQA 4F5GA 1CQ6A 3OP7A 3RUYA 2ZY3A 1TOJA 3LVLB 2CANA 4GDYA 2VLFA 3PD6A 3QN6A 4LNJA 2BIEA 2VI8A 3QGUA 5G0AA 1YJYA 3JTXA 1ZC9A 1W7MA 3A2BA 3LVKA 4RLGA 2EO5A 1LC5A 1AMSA 2VMZA 3G7QA 1VJOA 1GD9A 2W8UA 1TARA 5DB5A 3JW9A 1RV3A 3AELA 4WYAA 1JS3A 3FDDA 2BI5A 2FN6A 5G2PA 2C0RA 1RV4A 4ZDLA 4XK1A 1ASBA 2BWOA 2C7TA 3DRDA 1W7LA 4WXGA 4WYGA 4EFFA 2V1PA 3FFHA 2YOBA 2NMPA 3TFUA 1B8GA 4CXRA 1XI9A 1ELQA 3WLXA 2CINA 4A0GA 1SPAA 1B5PA 2QA3A 2GQNA 1AHGA 4Y0DA 2YCNA 5EIGB 4XJOA 4KXKA 3AOVA 1O69A 2R2NA 3WCOA 4A72A 2E54A 3NNKA 4IYOA 5G09A 4IX8A 1MAQA 2FM1A 4BQ0A 1BJWA 3KGWA 2YKUA 5D5SA 4IXSA 1W23A 4ZLVA 1DJUA 3LG0A 3MAUA 4GRXA 2EGYA 1QITA 4K2BA 4LW2A 3ZRPA 1ZOBA 2D65A 3MBBA 3NRAA 4R5FA 1P3WA 3VAXA 4CBSA 3E2YA 1WYVA 3TFTA 4AZKA 4RAEA 4F4EA 2YCTA 2R5CB 4XQ2A 2DGLA 1V2FA 3JWBA 3BCXA 4ADBA 1C0NA 4UHNA 2YKYA 3MKJA 1CJ0A 4JEVA 3PGYA 4NOGA 2ZY5A 4GE9A 1AICA 4U1TA 3AV7A 2PB2A 1Y4IA 3WY7A 2XH1A 3FDBA 1N8PA 1BJ4A 2VMOA 2BYJA 5M4DA 4OMAA 4XJPA 2OKJA 2ORDA 3FZ6A 2JJGA 2W8TA 1WKGA 1DFOA 2VMPA 2R0TA 2VGVA 4WYFA 1J32A 2VMWA 2BI1A 1MDOA 4F5FA 1MGVA 1I29A 4UHMA 3BCAA 3ASBA 3I4JA 3AENB 4Q6RA 3N0LA 3K7YA 4F5KA 2CJHA 1B9HA 1IVRA 1AMAA 1AX4A 1IBJA 2PB0A 2V0YA 3IF2A 3PDBA 3N5MA 4MKKA 2W7HA 3EI8A 3AEMA 4PFFA 2VGSA 3GWPA 2AY9A 1O61A 4ZDOA 2GB3A 1M7YA 2W7DA 1C7NA 1X2AA 3BN1A 1VP4A 1ARSA 4BMKA 3BV0A 1WYTB 3UAKA 3F6TA 1CZEA 3PJ0A 3GZDC 4WXBA 3FQAA 2C44A 2XBNA 4JF1A 3WZFA 4F5LA 2OGAA 1YJZA 3CAIA 3H7FA 4GE7A 3NUBA 1D7SA 2OATA 2JG2A 3FVXA 3FQ7A 4ADDA 2OKKA 2DGMA 1V72A 2HOYA 1AHXA 1S09A 2QB2A 2W7EA 3PPLA 3BWOA 4IY7A 3K28A 4I8AA 4R8DA 4Q75A 5F9SA 2X5FA 1IAXA 1X0MA 2JJFA 1EQBA 3NYUA 2RFVA 3OKSA 1FG3A 3UWCA 1YIZA 3B1DA 3FKDA 2QB3A 1V2DA 1GC0A 3MEBA 2YKVA 1PFFA 1AHYA 3L8AA 4R2NA 4JEWA 2Z1ZA 1EJIA 2FNIA 2AY2A 1MLZA 2VGTA 1IX6A 1SFFA 3FVSA 2HP1A 3PD6B 4J5UA 1D7UA 2O0RA 4OC9A 4ZASA 3VK4A 2JISA 3EI7A 4RKDA 2VGUA 1J04A 1AKBA 2G6WA 4W91A 1MLYA 2VMXA 4ZWVA 3F0HA 2CY8A 5E5IA 2GMUA 2YRIA 2CH1A 1M0OA 3MAFB 1X29A 5K8BA 3NYSA 3QHXA 4BA5A 1AIAA 1YJSA 2CJDA 5EFSA 3BWNA 4W1VA 1KKJA 4M2KA 1Z3ZA 3GJUA 3HL2A 4ZWMA 4K2IA 2PO3A 4OBVA 5G4IA 1I43A 3P1TA 3WGCA 4JE5D 5M49A 2W8WA 4ZSWA 4RITA 2DKBA 3RQ1A 1PMOA 4HF8A 3KE3A 2FKIA 2DOUA 3HMUA 4A0HA 4OBUA 1IX7A 5EAVA 2CH2A 3CQ4A 4JE5A 3N7NA 1I41A 1YNUA 3CQ5A 2ZSLA 4IYOB 1D7VA 1IUGA 3HT4A 4JEYA 4F5HA 1T3IA 3P6KA 5AX8A 1LS3A 2D7YA 3JZLA 3G0TA 3DXVA 4W5KA 5E4ZA 2Z9XA 3AEPA 1KL1A 2AY5A 1OXPA 4DQ6A 1FG7A 4KAMA 1E5EA 2ZC0A 3DODA 4WYEA 5HDMA 4E1OA 3ZRRA 1I48A 3RCHA 1WYVB 1ORDA 3G8MA 3E77A 1TOEA 5DX5A 4P3MA 3ACZA 2Z9WA 2HP2A 3E2ZA 3QM2A 2W8JA 1M6SA 3QI6A 4P7YA 2HUUA 1AY5A 1ASCA 2W7LA 5JAYA 1U08A 3GR9A 2BIGA 5TF5A 4A6TA 4B9BA 4E77A 1V2EA 2BHXA 1AY4A 1TATA 2HUFA 3AEMC 1AMQA 1G7WA 2AATA 2D5YA 2DR1A 5C6UA 1ASMA 3EI5A 2AY7A 9AATA 5M46A 2ZJGA 3NDNA 2E7JA 3NU8A 3CQ6A 3W1JA 5DJ9A 1AKCA 2VGWA 4AH3A 2A1VA 1TOIA 2ZYJA 3A9XA 3NTJA 3DYDA 2CSTA 2FQ6A 3ASAA 1AY8A 4WD2A 1BQAA 3A9YA 1MDZA 5E3KA 1ASNA 3B1CA 4ITGA 2WK9A 4JEXA 3USFA 2DKJA 4A00A 2OQXA 1PG8A 2HOZA 2ZP7A 1IAYA 1W7NA 3PDBB 2O7CA 1C9CA 4J8LA 4Q76A 4ZSYA 5BJ4A 1TOGA 5F8VA 2D64A 5FT5A 1ZODA 3WCNA 1AJSA 4W1XA 4EMYA 1LC7A 1S06A 1UU2A 2AEVA 2AY6A 3FTBA 4F5JA 2QSRA 4WB0A 1BT4A 5J8QA 3ELPA 4Y0HA 5I92A 4CBRA 1CQ7A 2AY4A 2AY8A 3T32A 3EIBA 1GDEA 4PFNA 2F8JA 5EUEA 1BJOA 4Q31A 1KL2A 1CZCA 1OXOA 4LNMA 1AHFA 3MC6A 4RJ0A 4ZAHA 2Z1YA 1WKHA 5BJ3A 1S08A 4TN4A 3NUIA 2BWPA 1GEWA 1MAPA 3WX9A 2D61A 3LVMA 3B46A 1ARTA 3B8XA 3WKSA 1DGEA 5LH9A 1E5FA 4H63Q 1QGNA 4RIZA 5FT6A 2TPLA 1SVVA 1AJRA 1M0QA 3H14A 4LNLA 2QLRA 4KYOA 3R4TA 2VIAA 3LV2A 4JF0A 3BWNC 2JGTA 4ZM3A 2VGZA 3AATA 4LW4A 3COGA 3GETA 3FQ8A 2EH6A 3GSBA 2WB6A 1DGDA 3UE8A 1AMRA 3BS8A 3PA9A 3VK3A 2CFBA 1BKGA 2YHKA 4OTLA 5EUNA 3VK2A 2W7IA 2VMTA 4L0OA 3N75A 1AKAA 2QMAA 4PVFA 4EU1A 4ZDPA 2E7IA 1H1CA 1B9IA 1UU0A 2X3LA 4UQVA 3FZ7A 5G2QA 2BKWA 3H9XA 2HUIA 1TASA 4MY5A 1YAAA 3QPGA 5LHAA 2E7UA 4MGRA 4ADEA 1WYUA 4OCAA 2YCPA 4AOAA 2Z20A 3EUCA 1GC4A 1KAFA 1N2TA 1D7RA 4MQPA 1GEXA 2QBTA 2EYQA 2CB1A 2O1BA 3Q8NA 3ATHA 3IHJA 1GC2A 1LK9A 2X5DA 1B4XA 3AOWA 3BCBA 1PMMA 1XEYA 2R5EA 4TV7A 2EZ2A 2G7JA 4K2MA 2VYCA 4ZM4A 1DKAA 1ASLA 4BHDA 4W1WA 2OGEA 4ADCA 4HVKA 3DZZA 3EIAA 3PDXA 3ECDA 1CL2A 3II0A 1TOKA 1Z7DA 4MSOA 3TQXA 4TMRA 3JU7A 1JG8A 4MQQA 2ZUKA 4AZJA 1M0PA 4WYDA 4A6UA 4DGTA 2KFPA 1S07A 3RCHB 3RBFA 3FSLA 4GEBA 5G4JA 1ECXA 3KGXA 5DJ1A 2BIAA 4XJMA 2VMNA 1AIBA 3AEJA 2VMVA 3PAAA 3E2ZB 1ASGA 1ASFA 1YOOA 1DJ9A 2YKXA 3LY1A 1TPLA 1GC3A 1LKCA 4N0WA 1M0NA 3CBFA 3N4SA 3MAFA 1EG5A 3FVUA 3EZSA 2Z67A 3HLMA 3D6KA 3GBXA 4A0RA 3JWAA 1RVUA 1RVYA 2GSAA 2AY1A 1SZKA 1ASEA 4M2MA 1OATA 4E3RA 4EB7A 1ARHA 3FRKA 4XEWA 3VOMA 1W3UA 1AHEA 1X28A 3RI6A 2W7JA 2BYLA 3BC8A 1DTYA 2FNUA 5FT4A 2VMSA 2DGKA 3FFRA 3WKRA 3R9AA 2EPJA 3LWSA 3N4XA 2JJEA 4WLJA 4WLHA 3TATA 1DJEA 1D2FA 4BA4A 1ARGA 2ZSMA 1LW5A 3W1HA 1ARIA 2X8UA 2AEUA 3MC6C 1KMKA 2D66A 4OT8A 5EIGA 4F5IA 2AY3A 4F5MA 3N4RA 2BI9A 3FZ8A 4PIWA 4UOYA 1AJSB 1LC8A 4N0BA 3KKIA 3LVJA 4DBCA 3W1IA 4IXZA 1SF2A 1MDXA 4WB0B 4QGRA 3ZRQA 8AATA 5M4BA 1BJNA 1FC4A 1GBNA 1B5OA 5FT8A 1QISA 1QJ3A 3MADA 4H51A 2W7FA 1CL1A 4R5ZA 4MQRA 1M4NA 1BJOB 3I16A 4CXQA 1OHYA 2Q7WA 3K40A 4FFCA 2GMSA 1S0AA 3I5TA 4IXOA 2ZY4A 3DR4A 5D95A 2VIBA 3RBLA 5HHYA 1VEFA 1BW0A 1G7XA 1CS1A 1SZSA 3L44A 4JEZA 5KTBA 2W7GA 2R5CA 3E6GA 2WKAA 3EI9A 4U2HA 2BWNA 4WYCA 3BB8A 2JJHA 3HDOA 4IW7A 4ISYA 3VP6A 2HZPA 4OYTA 4WXFA 4B98A 4RKCA 3TCMA 4WP0A 4AO9A 2Z61A 1ASDA 1OHVA 3HBXA 1GCKA 3ZZKA 4A0FA 1H0CA 2YRRA 2W8VA 1ASAA 2EZ1A 3EI6A 4GE4A 1C7GA 4LC3A 1N31A 4M2JA 1AAWA 1IX8A 1G4VA 1UU1A 2VI9A 2Z9UA 3M5UA 4FL0A 3FD0A 1AAMA 1GEYA 2C81A 3NYTA 1QIRA 4K05A 1OHWA 4W8IA 1UKJA 2VLHA 4A6RA 1KMJA 4MKJA 4O6ZA 3AENA 3DU4A 3DC1A 3GZCA 2VMUA 2BI2A 3F9TA 5EQCA 2W7KA 5HXXA 1JS6A 1C7OA 3AEOA 1IJIA 1ELUA 4EB5A 1QZ9A 2D63A 1QJ5A 4RJYA 1O4SA 5EUDA 2ZY2A 4ATQA 1WYUB 3DR7A 1KKPA 4UHOA 1YIYA 3QBOA 4XAUA 1O62A 1WYTA 4WBTA 4CVQA 1LW4A 1BS0A 2WK8A 2HORA 2BI3A 2CJGA 2Z9VA 3WGBA 1WSTA 3ELEA 3ZZJA 3AEJC 4XJLA 3ISLA 2VMRA 3PIUA 2VMYA 3EZ1A 3NX3A 4E3QA 4Y0IA 1BQDA 4AO4A 2VMQA 3E9KA 1C4KA
chains in the Genus database with same CATH topology
1G4XA 2HOXA 3NU7A 7AATA 3B1EA 2FYFA 2W7MA 3A9ZA 3GZDA 2D7ZA 3HQTA 2WK7A 1CQ8A 2CTZA 4ITXA 3E2FA 3FCRA 3HVYA 4GSAA 4RM1A 1JF9A 5EAAA 4ATPA 1SZUA 3A8UX 3DXWA 1M32A 5IWQA 4F5GA 1CQ6A 3OP7A 3RUYA 2ZY3A 1TOJA 3LVLB 2CANA 4GDYA 2VLFA 3PD6A 3QN6A 4LNJA 2BIEA 2VI8A 3QGUA 5G0AA 1YJYA 3JTXA 1ZC9A 1W7MA 3A2BA 3LVKA 4RLGA 2EO5A 1LC5A 1AMSA 2VMZA 3G7QA 1VJOA 1GD9A 2W8UA 1TARA 5DB5A 3JW9A 1RV3A 3AELA 4WYAA 1JS3A 3FDDA 2BI5A 2FN6A 5G2PA 2C0RA 1RV4A 4ZDLA 4XK1A 1ASBA 2BWOA 2C7TA 3DRDA 1W7LA 4WXGA 4WYGA 4EFFA 2V1PA 3FFHA 2YOBA 2NMPA 3TFUA 1B8GA 4CXRA 1XI9A 1ELQA 3WLXA 2CINA 4A0GA 1SPAA 1B5PA 2QA3A 2GQNA 1AHGA 4Y0DA 2YCNA 5EIGB 4XJOA 4KXKA 3AOVA 1O69A 2R2NA 3WCOA 4A72A 2E54A 3NNKA 4IYOA 5G09A 4IX8A 1MAQA 2FM1A 4BQ0A 1BJWA 3KGWA 2YKUA 5D5SA 4IXSA 1W23A 4ZLVA 1DJUA 3LG0A 3MAUA 4GRXA 2EGYA 1QITA 4K2BA 4LW2A 3ZRPA 1ZOBA 2D65A 3MBBA 3NRAA 4R5FA 1P3WA 3VAXA 4CBSA 3E2YA 1WYVA 3TFTA 4AZKA 4RAEA 4F4EA 2YCTA 2R5CB 4XQ2A 2DGLA 1V2FA 3JWBA 3BCXA 4ADBA 1C0NA 4UHNA 2YKYA 3MKJA 1CJ0A 4JEVA 3PGYA 4NOGA 2ZY5A 4GE9A 1AICA 4U1TA 3AV7A 2PB2A 1Y4IA 3WY7A 2XH1A 3FDBA 1N8PA 1BJ4A 2VMOA 2BYJA 5M4DA 4OMAA 4XJPA 2OKJA 2ORDA 3FZ6A 2JJGA 2W8TA 1WKGA 1DFOA 2VMPA 2R0TA 2VGVA 4WYFA 1J32A 2VMWA 2BI1A 1MDOA 4F5FA 1MGVA 1I29A 4UHMA 3BCAA 3ASBA 3I4JA 3AENB 4Q6RA 3N0LA 3K7YA 4F5KA 2CJHA 1B9HA 1IVRA 1AMAA 1AX4A 1IBJA 2PB0A 2V0YA 3IF2A 3PDBA 3N5MA 4MKKA 2W7HA 3EI8A 3AEMA 4PFFA 2VGSA 3GWPA 2AY9A 1O61A 4ZDOA 2GB3A 1M7YA 2W7DA 1C7NA 1X2AA 3BN1A 1VP4A 1ARSA 4BMKA 3BV0A 1WYTB 3UAKA 3F6TA 1CZEA 3PJ0A 3GZDC 4WXBA 3FQAA 2C44A 2XBNA 4JF1A 3WZFA 4F5LA 2OGAA 1YJZA 3CAIA 3H7FA 4GE7A 3NUBA 1D7SA 2OATA 2JG2A 3FVXA 3FQ7A 4ADDA 2OKKA 2DGMA 1V72A 2HOYA 1AHXA 1S09A 2QB2A 2W7EA 3PPLA 3BWOA 4IY7A 3K28A 4I8AA 4R8DA 4Q75A 5F9SA 2X5FA 1IAXA 1X0MA 2JJFA 1EQBA 3NYUA 2RFVA 3OKSA 1FG3A 3UWCA 1YIZA 3B1DA 3FKDA 2QB3A 1V2DA 1GC0A 3MEBA 2YKVA 1PFFA 1AHYA 3L8AA 4R2NA 4JEWA 2Z1ZA 1EJIA 2FNIA 2AY2A 1MLZA 2VGTA 1IX6A 1SFFA 3FVSA 2HP1A 3PD6B 4J5UA 1D7UA 2O0RA 4OC9A 4ZASA 3VK4A 2JISA 3EI7A 4RKDA 2VGUA 1J04A 1AKBA 2G6WA 4W91A 1MLYA 2VMXA 4ZWVA 3F0HA 2CY8A 5E5IA 2GMUA 2YRIA 2CH1A 1M0OA 3MAFB 1X29A 5K8BA 3NYSA 3QHXA 4BA5A 1AIAA 1YJSA 2CJDA 5EFSA 3BWNA 4W1VA 1KKJA 4M2KA 1Z3ZA 3GJUA 3HL2A 4ZWMA 4K2IA 2PO3A 4OBVA 5G4IA 1I43A 3P1TA 3WGCA 4JE5D 5M49A 2W8WA 4ZSWA 4RITA 2DKBA 3RQ1A 1PMOA 4HF8A 3KE3A 2FKIA 2DOUA 3HMUA 4A0HA 4OBUA 1IX7A 5EAVA 2CH2A 3CQ4A 4JE5A 3N7NA 1I41A 1YNUA 3CQ5A 2ZSLA 4IYOB 1D7VA 1IUGA 3HT4A 4JEYA 4F5HA 1T3IA 3P6KA 5AX8A 1LS3A 2D7YA 3JZLA 3G0TA 3DXVA 4W5KA 5E4ZA 2Z9XA 3AEPA 1KL1A 2AY5A 1OXPA 4DQ6A 1FG7A 4KAMA 1E5EA 2ZC0A 3DODA 4WYEA 5HDMA 4E1OA 3ZRRA 1I48A 3RCHA 1WYVB 1ORDA 3G8MA 3E77A 1TOEA 5DX5A 4P3MA 3ACZA 2Z9WA 2HP2A 3E2ZA 3QM2A 2W8JA 1M6SA 3QI6A 4P7YA 2HUUA 1AY5A 1ASCA 2W7LA 5JAYA 1U08A 3GR9A 2BIGA 5TF5A 4A6TA 4B9BA 4E77A 1V2EA 2BHXA 1AY4A 1TATA 2HUFA 3AEMC 1AMQA 1G7WA 2AATA 2D5YA 2DR1A 5C6UA 1ASMA 3EI5A 2AY7A 9AATA 5M46A 2ZJGA 3NDNA 2E7JA 3NU8A 3CQ6A 3W1JA 5DJ9A 1AKCA 2VGWA 4AH3A 2A1VA 1TOIA 2ZYJA 3A9XA 3NTJA 3DYDA 2CSTA 2FQ6A 3ASAA 1AY8A 4WD2A 1BQAA 3A9YA 1MDZA 5E3KA 1ASNA 3B1CA 4ITGA 2WK9A 4JEXA 3USFA 2DKJA 4A00A 2OQXA 1PG8A 2HOZA 2ZP7A 1IAYA 1W7NA 3PDBB 2O7CA 1C9CA 4J8LA 4Q76A 4ZSYA 5BJ4A 1TOGA 5F8VA 2D64A 5FT5A 1ZODA 3WCNA 1AJSA 4W1XA 4EMYA 1LC7A 1S06A 1UU2A 2AEVA 2AY6A 3FTBA 4F5JA 2QSRA 4WB0A 1BT4A 5J8QA 3ELPA 4Y0HA 5I92A 4CBRA 1CQ7A 2AY4A 2AY8A 3T32A 3EIBA 1GDEA 4PFNA 2F8JA 5EUEA 1BJOA 4Q31A 1KL2A 1CZCA 1OXOA 4LNMA 1AHFA 3MC6A 4RJ0A 4ZAHA 2Z1YA 1WKHA 5BJ3A 1S08A 4TN4A 3NUIA 2BWPA 1GEWA 1MAPA 3WX9A 2D61A 3LVMA 3B46A 1ARTA 3B8XA 3WKSA 1DGEA 5LH9A 1E5FA 4H63Q 1QGNA 4RIZA 5FT6A 2TPLA 1SVVA 1AJRA 1M0QA 3H14A 4LNLA 2QLRA 4KYOA 3R4TA 2VIAA 3LV2A 4JF0A 3BWNC 2JGTA 4ZM3A 2VGZA 3AATA 4LW4A 3COGA 3GETA 3FQ8A 2EH6A 3GSBA 2WB6A 1DGDA 3UE8A 1AMRA 3BS8A 3PA9A 3VK3A 2CFBA 1BKGA 2YHKA 4OTLA 5EUNA 3VK2A 2W7IA 2VMTA 4L0OA 3N75A 1AKAA 2QMAA 4PVFA 4EU1A 4ZDPA 2E7IA 1H1CA 1B9IA 1UU0A 2X3LA 4UQVA 3FZ7A 5G2QA 2BKWA 3H9XA 2HUIA 1TASA 4MY5A 1YAAA 3QPGA 5LHAA 2E7UA 4MGRA 4ADEA 1WYUA 4OCAA 2YCPA 4AOAA 2Z20A 3EUCA 1GC4A 1N2TA 1D7RA 4MQPA 1GEXA 2QBTA 2EYQA 2CB1A 2O1BA 3Q8NA 3ATHA 3IHJA 1GC2A 1LK9A 2X5DA 1B4XA 3AOWA 3BCBA 1PMMA 1XEYA 2R5EA 4TV7A 2EZ2A 2G7JA 4K2MA 2VYCA 4ZM4A 1DKAA 1ASLA 4BHDA 4W1WA 2OGEA 4ADCA 4HVKA 3DZZA 3EIAA 3PDXA 3ECDA 1CL2A 3II0A 1TOKA 1Z7DA 4MSOA 3TQXA 4TMRA 3JU7A 1JG8A 4MQQA 2ZUKA 4AZJA 1M0PA 4WYDA 4A6UA 4DGTA 2KFPA 1S07A 3RCHB 3RBFA 3FSLA 4GEBA 5G4JA 1ECXA 3KGXA 5DJ1A 2BIAA 4XJMA 2VMNA 1AIBA 3AEJA 2VMVA 3PAAA 3E2ZB 1ASGA 1ASFA 1YOOA 1DJ9A 2YKXA 3LY1A 1TPLA 1GC3A 1LKCA 4N0WA 1M0NA 3CBFA 3N4SA 3MAFA 1EG5A 3FVUA 3EZSA 2Z67A 3HLMA 3D6KA 3GBXA 4A0RA 3JWAA 1RVUA 1RVYA 2GSAA 2AY1A 1SZKA 1ASEA 4M2MA 1OATA 4E3RA 4EB7A 1ARHA 3FRKA 4XEWA 3VOMA 1W3UA 1AHEA 1X28A 3RI6A 2W7JA 2BYLA 3BC8A 1DTYA 2FNUA 5FT4A 2VMSA 2DGKA 3FFRA 3WKRA 3R9AA 2EPJA 3LWSA 3N4XA 2JJEA 4WLJA 4WLHA 3TATA 1DJEA 1D2FA 4BA4A 1ARGA 2ZSMA 1LW5A 3W1HA 1ARIA 2X8UA 2AEUA 3MC6C 1KMKA 2D66A 4OT8A 5EIGA 4F5IA 2AY3A 4F5MA 3N4RA 2BI9A 3FZ8A 4PIWA 4UOYA 1AJSB 1LC8A 4N0BA 3KKIA 3LVJA 4DBCA 3W1IA 4IXZA 1SF2A 1MDXA 4WB0B 4QGRA 3ZRQA 8AATA 5M4BA 1BJNA 1FC4A 1GBNA 1B5OA 5FT8A 1QISA 1QJ3A 3MADA 4H51A 2W7FA 1CL1A 4R5ZA 4MQRA 1M4NA 1BJOB 3I16A 4CXQA 1OHYA 2Q7WA 3K40A 4FFCA 2GMSA 1S0AA 3I5TA 4IXOA 2ZY4A 3DR4A 5D95A 2VIBA 3RBLA 5HHYA 1VEFA 1BW0A 1G7XA 1CS1A 1SZSA 3L44A 4JEZA 5KTBA 2W7GA 2R5CA 3E6GA 2WKAA 3EI9A 4U2HA 2BWNA 4WYCA 3BB8A 2JJHA 3HDOA 4IW7A 4ISYA 3VP6A 2HZPA 4OYTA 4WXFA 4B98A 4RKCA 3TCMA 4WP0A 4AO9A 2Z61A 1ASDA 1OHVA 3HBXA 1GCKA 3ZZKA 4A0FA 1H0CA 2YRRA 2W8VA 1ASAA 2EZ1A 3EI6A 4GE4A 1C7GA 4LC3A 1N31A 4M2JA 1AAWA 1IX8A 1G4VA 1UU1A 2VI9A 2Z9UA 3M5UA 4FL0A 3FD0A 1AAMA 1GEYA 2C81A 3NYTA 1QIRA 4K05A 1OHWA 4W8IA 1UKJA 2VLHA 4A6RA 1KMJA 4MKJA 4O6ZA 3AENA 3DU4A 3DC1A 3GZCA 2VMUA 2BI2A 3F9TA 5EQCA 2W7KA 5HXXA 1JS6A 1C7OA 3AEOA 1IJIA 1ELUA 4EB5A 1QZ9A 2D63A 1QJ5A 4RJYA 1O4SA 5EUDA 2ZY2A 4ATQA 1WYUB 3DR7A 1KKPA 4UHOA 1YIYA 3QBOA 4XAUA 1O62A 1WYTA 4WBTA 4CVQA 1LW4A 1BS0A 2WK8A 2HORA 2BI3A 2CJGA 2Z9VA 3WGBA 1WSTA 3ELEA 3ZZJA 3AEJC 4XJLA 3ISLA 2VMRA 3PIUA 2VMYA 3EZ1A 3NX3A 4E3QA 4Y0IA 1BQDA 4AO4A 2VMQA 3E9KA 1C4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4X A;  2HOX A;  3NU7 A;  7AAT A;  3B1E A;  2FYF A;  2W7M A;  3A9Z A;  3GZD A;  2D7Z A;  3HQT A;  2WK7 A;  1CQ8 A;  2CTZ A;  4ITX A;  3E2F A;  3FCR A;  3HVY A;  4GSA A;  4RM1 A;  1JF9 A;  5EAA A;  4ATP A;  1SZU A;  3A8U X;  3DXW A;  1M32 A;  5IWQ A;  4F5G A;  1CQ6 A;  3OP7 A;  3RUY A;  2ZY3 A;  1TOJ A;  3LVL B;  2CAN A;  4GDY A;  2VLF A;  3PD6 A;  3QN6 A;  4LNJ A;  2BIE A;  2VI8 A;  3QGU A;  5G0A A;  1YJY A;  3JTX A;  1ZC9 A;  1W7M A;  3A2B A;  3LVK A;  4RLG A;  2EO5 A;  1LC5 A;  1AMS A;  2VMZ A;  3G7Q A;  1VJO A;  1GD9 A;  2W8U A;  1TAR A;  5DB5 A;  3JW9 A;  1RV3 A;  3AEL A;  4WYA A;  1JS3 A;  3FDD A;  2BI5 A;  2FN6 A;  5G2P A;  2C0R A;  1RV4 A;  4ZDL A;  4XK1 A;  1ASB A;  2BWO A;  2C7T A;  3DRD A;  1W7L A;  4WXG A;  4WYG A;  4EFF A;  2V1P A;  3FFH A;  2YOB A;  2NMP A;  3TFU A;  1B8G A;  4CXR A;  1XI9 A;  1ELQ A;  3WLX A;  2CIN A;  4A0G A;  1SPA A;  1B5P A;  2QA3 A;  2GQN A;  1AHG A;  4Y0D A;  2YCN A;  5EIG B;  4XJO A;  4KXK A;  3AOV A;  1O69 A;  2R2N A;  3WCO A;  4A72 A;  2E54 A;  3NNK A;  4IYO A;  5G09 A;  4IX8 A;  1MAQ A;  2FM1 A;  4BQ0 A;  1BJW A;  3KGW A;  2YKU A;  5D5S A;  4IXS A;  1W23 A;  4ZLV A;  1DJU A;  3LG0 A;  3MAU A;  4GRX A;  2EGY A;  1QIT A;  4K2B A;  4LW2 A;  3ZRP A;  1ZOB A;  2D65 A;  3MBB A;  3NRA A;  4R5F A;  1P3W A;  3VAX A;  4CBS A;  3E2Y A;  1WYV A;  3TFT A;  4AZK A;  4RAE A;  4F4E A;  2YCT A;  2R5C B;  4XQ2 A;  2DGL A;  1V2F A;  3JWB A;  3BCX A;  4ADB A;  1C0N A;  4UHN A;  2YKY A;  3MKJ A;  1CJ0 A;  4JEV A;  3PGY A;  4NOG A;  2ZY5 A;  4GE9 A;  1AIC A;  4U1T A;  3AV7 A;  2PB2 A;  1Y4I A;  3WY7 A;  2XH1 A;  3FDB A;  1N8P A;  1BJ4 A;  2VMO A;  2BYJ A;  5M4D A;  4OMA A;  4XJP A;  2OKJ A;  2ORD A;  3FZ6 A;  2JJG A;  2W8T A;  1WKG A;  1DFO A;  2VMP A;  2R0T A;  2VGV A;  4WYF A;  1J32 A;  2VMW A;  2BI1 A;  1MDO A;  4F5F A;  1MGV A;  1I29 A;  4UHM A;  3BCA A;  3ASB A;  3I4J A;  3AEN B;  4Q6R A;  3N0L A;  3K7Y A;  4F5K A;  2CJH A;  1B9H A;  1IVR A;  1AMA A;  1AX4 A;  1IBJ A;  2PB0 A;  2V0Y A;  3IF2 A;  3PDB A;  3N5M A;  4MKK A;  2W7H A;  3EI8 A;  3AEM A;  4PFF A;  2VGS A;  3GWP A;  2AY9 A;  1O61 A;  4ZDO A;  2GB3 A;  1M7Y A;  2W7D A;  1C7N A;  1X2A A;  3BN1 A;  1VP4 A;  1ARS A;  4BMK A;  3BV0 A;  1WYT B;  3UAK A;  3F6T A;  1CZE A;  3PJ0 A;  3GZD C;  4WXB A;  3FQA A;  2C44 A;  2XBN A;  4JF1 A;  3WZF A;  4F5L A;  2OGA A;  1YJZ A;  3CAI A;  3H7F A;  4GE7 A;  3NUB A;  1D7S A;  2OAT A;  2JG2 A;  3FVX A;  3FQ7 A;  4ADD A;  2OKK A;  2DGM A;  1V72 A;  2HOY A;  1AHX A;  1S09 A;  2QB2 A;  2W7E A;  3PPL A;  3BWO A;  4IY7 A;  3K28 A;  4I8A A;  4R8D A;  4Q75 A;  5F9S A;  2X5F A;  1IAX A;  1X0M A;  2JJF A;  1EQB A;  3NYU A;  2RFV A;  3OKS A;  1FG3 A;  3UWC A;  1YIZ A;  3B1D A;  3FKD A;  2QB3 A;  1V2D A;  1GC0 A;  3MEB A;  2YKV A;  1PFF A;  1AHY A;  3L8A A;  4R2N A;  4JEW A;  2Z1Z A;  1EJI A;  2FNI A;  2AY2 A;  1MLZ A;  2VGT A;  1IX6 A;  1SFF A;  3FVS A;  2HP1 A;  3PD6 B;  4J5U A;  1D7U A;  2O0R A;  4OC9 A;  4ZAS A;  3VK4 A;  2JIS A;  3EI7 A;  4RKD A;  2VGU A;  1J04 A;  1AKB A;  2G6W A;  4W91 A;  1MLY A;  2VMX A;  4ZWV A;  3F0H A;  2CY8 A;  5E5I A;  2GMU A;  2YRI A;  2CH1 A;  1M0O A;  3MAF B;  1X29 A;  5K8B A;  3NYS A;  3QHX A;  4BA5 A;  1AIA A;  1YJS A;  2CJD A;  5EFS A;  3BWN A;  4W1V A;  1KKJ A;  4M2K A;  1Z3Z A;  3GJU A;  3HL2 A;  4ZWM A;  4K2I A;  2PO3 A;  4OBV A;  5G4I A;  1I43 A;  3P1T A;  3WGC A;  4JE5 D;  5M49 A;  2W8W A;  4ZSW A;  4RIT A;  2DKB A;  3RQ1 A;  1PMO A;  4HF8 A;  3KE3 A;  2DOU A;  3HMU A;  4A0H A;  4OBU A;  1IX7 A;  5EAV A;  2CH2 A;  3CQ4 A;  4JE5 A;  1I41 A;  1YNU A;  3CQ5 A;  2ZSL A;  4IYO B;  1D7V A;  1IUG A;  3HT4 A;  4JEY A;  4F5H A;  1T3I A;  3P6K A;  5AX8 A;  1LS3 A;  2D7Y A;  3JZL A;  3G0T A;  3DXV A;  4W5K A;  5E4Z A;  2Z9X A;  3AEP A;  1KL1 A;  2AY5 A;  1OXP A;  4DQ6 A;  1FG7 A;  4KAM A;  1E5E A;  2ZC0 A;  3DOD A;  4WYE A;  5HDM A;  4E1O A;  3ZRR A;  1I48 A;  3RCH A;  1WYV B;  1ORD A;  3G8M A;  3E77 A;  1TOE A;  5DX5 A;  4P3M A;  3ACZ A;  2Z9W A;  2HP2 A;  3E2Z A;  3QM2 A;  2W8J A;  1M6S A;  3QI6 A;  4P7Y A;  2HUU A;  1AY5 A;  1ASC A;  2W7L A;  5JAY A;  1U08 A;  3GR9 A;  2BIG A;  5TF5 A;  4A6T A;  4B9B A;  4E77 A;  1V2E A;  2BHX A;  1AY4 A;  1TAT A;  2HUF A;  3AEM C;  1AMQ A;  1G7W A;  2AAT A;  2D5Y A;  2DR1 A;  5C6U A;  1ASM A;  3EI5 A;  2AY7 A;  9AAT A;  5M46 A;  2ZJG A;  3NDN A;  2E7J A;  3NU8 A;  3CQ6 A;  3W1J A;  5DJ9 A;  1AKC A;  2VGW A;  4AH3 A;  1TOI A;  2ZYJ A;  3A9X A;  3NTJ A;  3DYD A;  2CST A;  2FQ6 A;  3ASA A;  1AY8 A;  4WD2 A;  1BQA A;  3A9Y A;  1MDZ A;  5E3K A;  1ASN A;  3B1C A;  4ITG A;  2WK9 A;  4JEX A;  3USF A;  2DKJ A;  4A00 A;  2OQX A;  1PG8 A;  2HOZ A;  2ZP7 A;  1IAY A;  1W7N A;  3PDB B;  2O7C A;  1C9C A;  4J8L A;  4Q76 A;  4ZSY A;  5BJ4 A;  1TOG A;  5F8V A;  2D64 A;  5FT5 A;  1ZOD A;  3WCN A;  1AJS A;  4W1X A;  4EMY A;  1LC7 A;  1S06 A;  1UU2 A;  2AEV A;  2AY6 A;  3FTB A;  4F5J A;  4WB0 A;  1BT4 A;  5J8Q A;  3ELP A;  4Y0H A;  5I92 A;  4CBR A;  1CQ7 A;  2AY4 A;  2AY8 A;  3T32 A;  3EIB A;  1GDE A;  4PFN A;  2F8J A;  5EUE A;  1BJO A;  4Q31 A;  1KL2 A;  1CZC A;  1OXO A;  4LNM A;  1AHF A;  3MC6 A;  4RJ0 A;  4ZAH A;  2Z1Y A;  1WKH A;  5BJ3 A;  1S08 A;  4TN4 A;  3NUI A;  2BWP A;  1GEW A;  1MAP A;  3WX9 A;  2D61 A;  3LVM A;  3B46 A;  1ART A;  3B8X A;  3WKS A;  1DGE A;  5LH9 A;  1E5F A;  1QGN A;  4RIZ A;  5FT6 A;  2TPL A;  1SVV A;  1AJR A;  1M0Q A;  3H14 A;  4LNL A;  2QLR A;  4KYO A;  3R4T A;  2VIA A;  3LV2 A;  4JF0 A;  3BWN C;  2JGT A;  4ZM3 A;  2VGZ A;  3AAT A;  4LW4 A;  3COG A;  3GET A;  3FQ8 A;  2EH6 A;  3GSB A;  1DGD A;  3UE8 A;  1AMR A;  3BS8 A;  3PA9 A;  3VK3 A;  2CFB A;  1BKG A;  2YHK A;  4OTL A;  5EUN A;  3VK2 A;  2W7I A;  2VMT A;  4L0O A;  3N75 A;  1AKA A;  2QMA A;  4PVF A;  4EU1 A;  4ZDP A;  2E7I A;  1H1C A;  1B9I A;  1UU0 A;  2X3L A;  4UQV A;  3FZ7 A;  5G2Q A;  2BKW A;  2HUI A;  1TAS A;  4MY5 A;  1YAA A;  3QPG A;  5LHA A;  2E7U A;  4MGR A;  4ADE A;  1WYU A;  4OCA A;  2YCP A;  4AOA A;  2Z20 A;  3EUC A;  1GC4 A;  1N2T A;  1D7R A;  4MQP A;  1GEX A;  2QBT A;  2CB1 A;  2O1B A;  3Q8N A;  3ATH A;  3IHJ A;  1GC2 A;  1LK9 A;  2X5D A;  1B4X A;  3AOW A;  3BCB A;  1PMM A;  1XEY A;  2R5E A;  4TV7 A;  2EZ2 A;  4K2M A;  2VYC A;  4ZM4 A;  1DKA A;  1ASL A;  4BHD A;  4W1W A;  2OGE A;  4ADC A;  4HVK A;  3DZZ A;  3EIA A;  3PDX A;  3ECD A;  1CL2 A;  3II0 A;  1TOK A;  1Z7D A;  4MSO A;  3TQX A;  4TMR A;  3JU7 A;  1JG8 A;  4MQQ A;  2ZUK A;  4AZJ A;  1M0P A;  4WYD A;  4A6U A;  4DGT A;  1S07 A;  3RCH B;  3RBF A;  3FSL A;  4GEB A;  5G4J A;  1ECX A;  3KGX A;  5DJ1 A;  2BIA A;  4XJM A;  2VMN A;  1AIB A;  3AEJ A;  2VMV A;  3PAA A;  3E2Z B;  1ASG A;  1ASF A;  1YOO A;  1DJ9 A;  2YKX A;  3LY1 A;  1TPL A;  1GC3 A;  1LKC A;  4N0W A;  1M0N A;  3CBF A;  3MAF A;  1EG5 A;  3FVU A;  3EZS A;  2Z67 A;  3HLM A;  3D6K A;  3GBX A;  4A0R A;  3JWA A;  1RVU A;  1RVY A;  2GSA A;  2AY1 A;  1SZK A;  1ASE A;  4M2M A;  1OAT A;  4E3R A;  4EB7 A;  1ARH A;  3FRK A;  4XEW A;  3VOM A;  1W3U A;  1AHE A;  1X28 A;  3RI6 A;  2W7J A;  2BYL A;  3BC8 A;  1DTY A;  2FNU A;  5FT4 A;  2VMS A;  2DGK A;  3FFR A;  3WKR A;  3R9A A;  2EPJ A;  3LWS A;  2JJE A;  4WLJ A;  4WLH A;  3TAT A;  1DJE A;  1D2F A;  4BA4 A;  1ARG A;  2ZSM A;  1LW5 A;  3W1H A;  1ARI A;  2X8U A;  2AEU A;  3MC6 C;  1KMK A;  2D66 A;  4OT8 A;  5EIG A;  4F5I A;  2AY3 A;  4F5M A;  2BI9 A;  3FZ8 A;  4PIW A;  4UOY A;  1AJS B;  1LC8 A;  4N0B A;  3KKI A;  3LVJ A;  4DBC A;  3W1I A;  4IXZ A;  1SF2 A;  1MDX A;  4WB0 B;  4QGR A;  3ZRQ A;  8AAT A;  5M4B A;  1BJN A;  1FC4 A;  1GBN A;  1B5O A;  5FT8 A;  1QIS A;  1QJ3 A;  3MAD A;  4H51 A;  2W7F A;  1CL1 A;  4R5Z A;  4MQR A;  1M4N A;  1BJO B;  3I16 A;  4CXQ A;  1OHY A;  2Q7W A;  3K40 A;  4FFC A;  2GMS A;  1S0A A;  3I5T A;  4IXO A;  2ZY4 A;  3DR4 A;  5D95 A;  2VIB A;  3RBL A;  5HHY A;  1VEF A;  1BW0 A;  1G7X A;  1CS1 A;  1SZS A;  3L44 A;  4JEZ A;  2W7G A;  2R5C A;  3E6G A;  2WKA A;  3EI9 A;  4U2H A;  2BWN A;  4WYC A;  3BB8 A;  2JJH A;  3HDO A;  4IW7 A;  4ISY A;  3VP6 A;  2HZP A;  4OYT A;  4WXF A;  4B98 A;  4RKC A;  3TCM A;  4WP0 A;  4AO9 A;  2Z61 A;  1ASD A;  1OHV A;  3HBX A;  1GCK A;  3ZZK A;  4A0F A;  1H0C A;  2YRR A;  2W8V A;  1ASA A;  2EZ1 A;  3EI6 A;  4GE4 A;  1C7G A;  4LC3 A;  1N31 A;  4M2J A;  1AAW A;  1IX8 A;  1G4V A;  1UU1 A;  2VI9 A;  2Z9U A;  3M5U A;  4FL0 A;  3FD0 A;  1AAM A;  1GEY A;  2C81 A;  3NYT A;  1QIR A;  1OHW A;  4W8I A;  1UKJ A;  2VLH A;  4A6R A;  1KMJ A;  4MKJ A;  4O6Z A;  3AEN A;  3DU4 A;  3DC1 A;  3GZC A;  2VMU A;  2BI2 A;  3F9T A;  5EQC A;  2W7K A;  5HXX A;  1JS6 A;  1C7O A;  3AEO A;  1IJI A;  1ELU A;  4EB5 A;  1QZ9 A;  2D63 A;  1QJ5 A;  4RJY A;  1O4S A;  5EUD A;  2ZY2 A;  4ATQ A;  1WYU B;  3DR7 A;  1KKP A;  4UHO A;  1YIY A;  3QBO A;  4XAU A;  1O62 A;  1WYT A;  4WBT A;  4CVQ A;  1LW4 A;  1BS0 A;  2WK8 A;  2HOR A;  2BI3 A;  2CJG A;  2Z9V A;  3WGB A;  1WST A;  3ELE A;  3ZZJ A;  3AEJ C;  4XJL A;  3ISL A;  2VMR A;  3PIU A;  2VMY A;  3EZ1 A;  3NX3 A;  4E3Q A;  4Y0I A;  1BQD A;  4AO4 A;  2VMQ A;  3E9K A;  1C4K A; 
#chains in the Genus database with same CATH topology
 1G4X A;  2HOX A;  3NU7 A;  7AAT A;  3B1E A;  2FYF A;  2W7M A;  3A9Z A;  3GZD A;  2D7Z A;  3HQT A;  2WK7 A;  1CQ8 A;  2CTZ A;  4ITX A;  3E2F A;  3FCR A;  3HVY A;  4GSA A;  4RM1 A;  1JF9 A;  5EAA A;  4ATP A;  1SZU A;  3A8U X;  3DXW A;  1M32 A;  5IWQ A;  4F5G A;  1CQ6 A;  3OP7 A;  3RUY A;  2ZY3 A;  1TOJ A;  3LVL B;  2CAN A;  4GDY A;  2VLF A;  3PD6 A;  3QN6 A;  4LNJ A;  2BIE A;  2VI8 A;  3QGU A;  5G0A A;  1YJY A;  3JTX A;  1ZC9 A;  1W7M A;  3A2B A;  3LVK A;  4RLG A;  2EO5 A;  1LC5 A;  1AMS A;  2VMZ A;  3G7Q A;  1VJO A;  1GD9 A;  2W8U A;  1TAR A;  5DB5 A;  3JW9 A;  1RV3 A;  3AEL A;  4WYA A;  1JS3 A;  3FDD A;  2BI5 A;  2FN6 A;  5G2P A;  2C0R A;  1RV4 A;  4ZDL A;  4XK1 A;  1ASB A;  2BWO A;  2C7T A;  3DRD A;  1W7L A;  4WXG A;  4WYG A;  4EFF A;  2V1P A;  3FFH A;  2YOB A;  2NMP A;  3TFU A;  1B8G A;  4CXR A;  1XI9 A;  1ELQ A;  3WLX A;  2CIN A;  4A0G A;  1SPA A;  1B5P A;  2QA3 A;  2GQN A;  1AHG A;  4Y0D A;  2YCN A;  5EIG B;  4XJO A;  4KXK A;  3AOV A;  1O69 A;  2R2N A;  3WCO A;  4A72 A;  2E54 A;  3NNK A;  4IYO A;  5G09 A;  4IX8 A;  1MAQ A;  2FM1 A;  4BQ0 A;  1BJW A;  3KGW A;  2YKU A;  5D5S A;  4IXS A;  1W23 A;  4ZLV A;  1DJU A;  3LG0 A;  3MAU A;  4GRX A;  2EGY A;  1QIT A;  4K2B A;  4LW2 A;  3ZRP A;  1ZOB A;  2D65 A;  3MBB A;  3NRA A;  4R5F A;  1P3W A;  3VAX A;  4CBS A;  3E2Y A;  1WYV A;  3TFT A;  4AZK A;  4RAE A;  4F4E A;  2YCT A;  2R5C B;  4XQ2 A;  2DGL A;  1V2F A;  3JWB A;  3BCX A;  4ADB A;  1C0N A;  4UHN A;  2YKY A;  3MKJ A;  1CJ0 A;  4JEV A;  3PGY A;  4NOG A;  2ZY5 A;  4GE9 A;  1AIC A;  4U1T A;  3AV7 A;  2PB2 A;  1Y4I A;  3WY7 A;  2XH1 A;  3FDB A;  1N8P A;  1BJ4 A;  2VMO A;  2BYJ A;  5M4D A;  4OMA A;  4XJP A;  2OKJ A;  2ORD A;  3FZ6 A;  2JJG A;  2W8T A;  1WKG A;  1DFO A;  2VMP A;  2R0T A;  2VGV A;  4WYF A;  1J32 A;  2VMW A;  2BI1 A;  1MDO A;  4F5F A;  1MGV A;  1I29 A;  4UHM A;  3BCA A;  3ASB A;  3I4J A;  3AEN B;  4Q6R A;  3N0L A;  3K7Y A;  4F5K A;  2CJH A;  1B9H A;  1IVR A;  1AMA A;  1AX4 A;  1IBJ A;  2PB0 A;  2V0Y A;  3IF2 A;  3PDB A;  3N5M A;  4MKK A;  2W7H A;  3EI8 A;  3AEM A;  4PFF A;  2VGS A;  3GWP A;  2AY9 A;  1O61 A;  4ZDO A;  2GB3 A;  1M7Y A;  2W7D A;  1C7N A;  1X2A A;  3BN1 A;  1VP4 A;  1ARS A;  4BMK A;  3BV0 A;  1WYT B;  3UAK A;  3F6T A;  1CZE A;  3PJ0 A;  3GZD C;  4WXB A;  3FQA A;  2C44 A;  2XBN A;  4JF1 A;  3WZF A;  4F5L A;  2OGA A;  1YJZ A;  3CAI A;  3H7F A;  4GE7 A;  3NUB A;  1D7S A;  2OAT A;  2JG2 A;  3FVX A;  3FQ7 A;  4ADD A;  2OKK A;  2DGM A;  1V72 A;  2HOY A;  1AHX A;  1S09 A;  2QB2 A;  2W7E A;  3PPL A;  3BWO A;  4IY7 A;  3K28 A;  4I8A A;  4R8D A;  4Q75 A;  5F9S A;  2X5F A;  1IAX A;  1X0M A;  2JJF A;  1EQB A;  3NYU A;  2RFV A;  3OKS A;  1FG3 A;  3UWC A;  1YIZ A;  3B1D A;  3FKD A;  2QB3 A;  1V2D A;  1GC0 A;  3MEB A;  2YKV A;  1PFF A;  1AHY A;  3L8A A;  4R2N A;  4JEW A;  2Z1Z A;  1EJI A;  2FNI A;  2AY2 A;  1MLZ A;  2VGT A;  1IX6 A;  1SFF A;  3FVS A;  2HP1 A;  3PD6 B;  4J5U A;  1D7U A;  2O0R A;  4OC9 A;  4ZAS A;  3VK4 A;  2JIS A;  3EI7 A;  4RKD A;  2VGU A;  1J04 A;  1AKB A;  2G6W A;  4W91 A;  1MLY A;  2VMX A;  4ZWV A;  3F0H A;  2CY8 A;  5E5I A;  2GMU A;  2YRI A;  2CH1 A;  1M0O A;  3MAF B;  1X29 A;  5K8B A;  3NYS A;  3QHX A;  4BA5 A;  1AIA A;  1YJS A;  2CJD A;  5EFS A;  3BWN A;  4W1V A;  1KKJ A;  4M2K A;  1Z3Z A;  3GJU A;  3HL2 A;  4ZWM A;  4K2I A;  2PO3 A;  4OBV A;  5G4I A;  1I43 A;  3P1T A;  3WGC A;  4JE5 D;  5M49 A;  2W8W A;  4ZSW A;  4RIT A;  2DKB A;  3RQ1 A;  1PMO A;  4HF8 A;  3KE3 A;  2FKI A;  2DOU A;  3HMU A;  4A0H A;  4OBU A;  1IX7 A;  5EAV A;  2CH2 A;  3CQ4 A;  4JE5 A;  3N7N A;  1I41 A;  1YNU A;  3CQ5 A;  2ZSL A;  4IYO B;  1D7V A;  1IUG A;  3HT4 A;  4JEY A;  4F5H A;  1T3I A;  3P6K A;  5AX8 A;  1LS3 A;  2D7Y A;  3JZL A;  3G0T A;  3DXV A;  4W5K A;  5E4Z A;  2Z9X A;  3AEP A;  1KL1 A;  2AY5 A;  1OXP A;  4DQ6 A;  1FG7 A;  4KAM A;  1E5E A;  2ZC0 A;  3DOD A;  4WYE A;  5HDM A;  4E1O A;  3ZRR A;  1I48 A;  3RCH A;  1WYV B;  1ORD A;  3G8M A;  3E77 A;  1TOE A;  5DX5 A;  4P3M A;  3ACZ A;  2Z9W A;  2HP2 A;  3E2Z A;  3QM2 A;  2W8J A;  1M6S A;  3QI6 A;  4P7Y A;  2HUU A;  1AY5 A;  1ASC A;  2W7L A;  5JAY A;  1U08 A;  3GR9 A;  2BIG A;  5TF5 A;  4A6T A;  4B9B A;  4E77 A;  1V2E A;  2BHX A;  1AY4 A;  1TAT A;  2HUF A;  3AEM C;  1AMQ A;  1G7W A;  2AAT A;  2D5Y A;  2DR1 A;  5C6U A;  1ASM A;  3EI5 A;  2AY7 A;  9AAT A;  5M46 A;  2ZJG A;  3NDN A;  2E7J A;  3NU8 A;  3CQ6 A;  3W1J A;  5DJ9 A;  1AKC A;  2VGW A;  4AH3 A;  2A1V A;  1TOI A;  2ZYJ A;  3A9X A;  3NTJ A;  3DYD A;  2CST A;  2FQ6 A;  3ASA A;  1AY8 A;  4WD2 A;  1BQA A;  3A9Y A;  1MDZ A;  5E3K A;  1ASN A;  3B1C A;  4ITG A;  2WK9 A;  4JEX A;  3USF A;  2DKJ A;  4A00 A;  2OQX A;  1PG8 A;  2HOZ A;  2ZP7 A;  1IAY A;  1W7N A;  3PDB B;  2O7C A;  1C9C A;  4J8L A;  4Q76 A;  4ZSY A;  5BJ4 A;  1TOG A;  5F8V A;  2D64 A;  5FT5 A;  1ZOD A;  3WCN A;  1AJS A;  4W1X A;  4EMY A;  1LC7 A;  1S06 A;  1UU2 A;  2AEV A;  2AY6 A;  3FTB A;  4F5J A;  2QSR A;  4WB0 A;  1BT4 A;  5J8Q A;  3ELP A;  4Y0H A;  5I92 A;  4CBR A;  1CQ7 A;  2AY4 A;  2AY8 A;  3T32 A;  3EIB A;  1GDE A;  4PFN A;  2F8J A;  5EUE A;  1BJO A;  4Q31 A;  1KL2 A;  1CZC A;  1OXO A;  4LNM A;  1AHF A;  3MC6 A;  4RJ0 A;  4ZAH A;  2Z1Y A;  1WKH A;  5BJ3 A;  1S08 A;  4TN4 A;  3NUI A;  2BWP A;  1GEW A;  1MAP A;  3WX9 A;  2D61 A;  3LVM A;  3B46 A;  1ART A;  3B8X A;  3WKS A;  1DGE A;  5LH9 A;  1E5F A;  4H63 Q;  1QGN A;  4RIZ A;  5FT6 A;  2TPL A;  1SVV A;  1AJR A;  1M0Q A;  3H14 A;  4LNL A;  2QLR A;  4KYO A;  3R4T A;  2VIA A;  3LV2 A;  4JF0 A;  3BWN C;  2JGT A;  4ZM3 A;  2VGZ A;  3AAT A;  4LW4 A;  3COG A;  3GET A;  3FQ8 A;  2EH6 A;  3GSB A;  2WB6 A;  1DGD A;  3UE8 A;  1AMR A;  3BS8 A;  3PA9 A;  3VK3 A;  2CFB A;  1BKG A;  2YHK A;  4OTL A;  5EUN A;  3VK2 A;  2W7I A;  2VMT A;  4L0O A;  3N75 A;  1AKA A;  2QMA A;  4PVF A;  4EU1 A;  4ZDP A;  2E7I A;  1H1C A;  1B9I A;  1UU0 A;  2X3L A;  4UQV A;  3FZ7 A;  5G2Q A;  2BKW A;  3H9X A;  2HUI A;  1TAS A;  4MY5 A;  1YAA A;  3QPG A;  5LHA A;  2E7U A;  4MGR A;  4ADE A;  1WYU A;  4OCA A;  2YCP A;  4AOA A;  2Z20 A;  3EUC A;  1GC4 A;  1KAF A;  1N2T A;  1D7R A;  4MQP A;  1GEX A;  2QBT A;  2EYQ A;  2CB1 A;  2O1B A;  3Q8N A;  3ATH A;  3IHJ A;  1GC2 A;  1LK9 A;  2X5D A;  1B4X A;  3AOW A;  3BCB A;  1PMM A;  1XEY A;  2R5E A;  4TV7 A;  2EZ2 A;  2G7J A;  4K2M A;  2VYC A;  4ZM4 A;  1DKA A;  1ASL A;  4BHD A;  4W1W A;  2OGE A;  4ADC A;  4HVK A;  3DZZ A;  3EIA A;  3PDX A;  3ECD A;  1CL2 A;  3II0 A;  1TOK A;  1Z7D A;  4MSO A;  3TQX A;  4TMR A;  3JU7 A;  1JG8 A;  4MQQ A;  2ZUK A;  4AZJ A;  1M0P A;  4WYD A;  4A6U A;  4DGT A;  2KFP A;  1S07 A;  3RCH B;  3RBF A;  3FSL A;  4GEB A;  5G4J A;  1ECX A;  3KGX A;  5DJ1 A;  2BIA A;  4XJM A;  2VMN A;  1AIB A;  3AEJ A;  2VMV A;  3PAA A;  3E2Z B;  1ASG A;  1ASF A;  1YOO A;  1DJ9 A;  2YKX A;  3LY1 A;  1TPL A;  1GC3 A;  1LKC A;  4N0W A;  1M0N A;  3CBF A;  3N4S A;  3MAF A;  1EG5 A;  3FVU A;  3EZS A;  2Z67 A;  3HLM A;  3D6K A;  3GBX A;  4A0R A;  3JWA A;  1RVU A;  1RVY A;  2GSA A;  2AY1 A;  1SZK A;  1ASE A;  4M2M A;  1OAT A;  4E3R A;  4EB7 A;  1ARH A;  3FRK A;  4XEW A;  3VOM A;  1W3U A;  1AHE A;  1X28 A;  3RI6 A;  2W7J A;  2BYL A;  3BC8 A;  1DTY A;  2FNU A;  5FT4 A;  2VMS A;  2DGK A;  3FFR A;  3WKR A;  3R9A A;  2EPJ A;  3LWS A;  3N4X A;  2JJE A;  4WLJ A;  4WLH A;  3TAT A;  1DJE A;  1D2F A;  4BA4 A;  1ARG A;  2ZSM A;  1LW5 A;  3W1H A;  1ARI A;  2X8U A;  2AEU A;  3MC6 C;  1KMK A;  2D66 A;  4OT8 A;  5EIG A;  4F5I A;  2AY3 A;  4F5M A;  3N4R A;  2BI9 A;  3FZ8 A;  4PIW A;  4UOY A;  1AJS B;  1LC8 A;  4N0B A;  3KKI A;  3LVJ A;  4DBC A;  3W1I A;  4IXZ A;  1SF2 A;  1MDX A;  4WB0 B;  4QGR A;  3ZRQ A;  8AAT A;  5M4B A;  1BJN A;  1FC4 A;  1GBN A;  1B5O A;  5FT8 A;  1QIS A;  1QJ3 A;  3MAD A;  4H51 A;  2W7F A;  1CL1 A;  4R5Z A;  4MQR A;  1M4N A;  1BJO B;  3I16 A;  4CXQ A;  1OHY A;  2Q7W A;  3K40 A;  4FFC A;  2GMS A;  1S0A A;  3I5T A;  4IXO A;  2ZY4 A;  3DR4 A;  5D95 A;  2VIB A;  3RBL A;  5HHY A;  1VEF A;  1BW0 A;  1G7X A;  1CS1 A;  1SZS A;  3L44 A;  4JEZ A;  5KTB A;  2W7G A;  2R5C A;  3E6G A;  2WKA A;  3EI9 A;  4U2H A;  2BWN A;  4WYC A;  3BB8 A;  2JJH A;  3HDO A;  4IW7 A;  4ISY A;  3VP6 A;  2HZP A;  4OYT A;  4WXF A;  4B98 A;  4RKC A;  3TCM A;  4WP0 A;  4AO9 A;  2Z61 A;  1ASD A;  1OHV A;  3HBX A;  1GCK A;  3ZZK A;  4A0F A;  1H0C A;  2YRR A;  2W8V A;  1ASA A;  2EZ1 A;  3EI6 A;  4GE4 A;  1C7G A;  4LC3 A;  1N31 A;  4M2J A;  1AAW A;  1IX8 A;  1G4V A;  1UU1 A;  2VI9 A;  2Z9U A;  3M5U A;  4FL0 A;  3FD0 A;  1AAM A;  1GEY A;  2C81 A;  3NYT A;  1QIR A;  4K05 A;  1OHW A;  4W8I A;  1UKJ A;  2VLH A;  4A6R A;  1KMJ A;  4MKJ A;  4O6Z A;  3AEN A;  3DU4 A;  3DC1 A;  3GZC A;  2VMU A;  2BI2 A;  3F9T A;  5EQC A;  2W7K A;  5HXX A;  1JS6 A;  1C7O A;  3AEO A;  1IJI A;  1ELU A;  4EB5 A;  1QZ9 A;  2D63 A;  1QJ5 A;  4RJY A;  1O4S A;  5EUD A;  2ZY2 A;  4ATQ A;  1WYU B;  3DR7 A;  1KKP A;  4UHO A;  1YIY A;  3QBO A;  4XAU A;  1O62 A;  1WYT A;  4WBT A;  4CVQ A;  1LW4 A;  1BS0 A;  2WK8 A;  2HOR A;  2BI3 A;  2CJG A;  2Z9V A;  3WGB A;  1WST A;  3ELE A;  3ZZJ A;  3AEJ C;  4XJL A;  3ISL A;  2VMR A;  3PIU A;  2VMY A;  3EZ1 A;  3NX3 A;  4E3Q A;  4Y0I A;  1BQD A;  4AO4 A;  2VMQ A;  3E9K A;  1C4K A; 
#chains in the Genus database with same CATH homology
 1G4X A;  2HOX A;  3NU7 A;  7AAT A;  3B1E A;  2FYF A;  2W7M A;  3A9Z A;  3GZD A;  2D7Z A;  3HQT A;  2WK7 A;  1CQ8 A;  2CTZ A;  4ITX A;  3E2F A;  3FCR A;  3HVY A;  4GSA A;  4RM1 A;  1JF9 A;  5EAA A;  4ATP A;  1SZU A;  3A8U X;  3DXW A;  1M32 A;  5IWQ A;  4F5G A;  1CQ6 A;  3OP7 A;  3RUY A;  2ZY3 A;  1TOJ A;  3LVL B;  2CAN A;  4GDY A;  2VLF A;  3PD6 A;  3QN6 A;  4LNJ A;  2BIE A;  2VI8 A;  3QGU A;  5G0A A;  1YJY A;  3JTX A;  1ZC9 A;  1W7M A;  3A2B A;  3LVK A;  4RLG A;  2EO5 A;  1LC5 A;  1AMS A;  2VMZ A;  3G7Q A;  1VJO A;  1GD9 A;  2W8U A;  1TAR A;  5DB5 A;  3JW9 A;  1RV3 A;  3AEL A;  4WYA A;  1JS3 A;  3FDD A;  2BI5 A;  2FN6 A;  5G2P A;  2C0R A;  1RV4 A;  4ZDL A;  4XK1 A;  1ASB A;  2BWO A;  2C7T A;  3DRD A;  1W7L A;  4WXG A;  4WYG A;  4EFF A;  2V1P A;  3FFH A;  2YOB A;  2NMP A;  3TFU A;  1B8G A;  4CXR A;  1XI9 A;  1ELQ A;  3WLX A;  2CIN A;  4A0G A;  1SPA A;  1B5P A;  2QA3 A;  2GQN A;  1AHG A;  4Y0D A;  2YCN A;  5EIG B;  4XJO A;  4KXK A;  3AOV A;  1O69 A;  2R2N A;  3WCO A;  4A72 A;  2E54 A;  3NNK A;  4IYO A;  5G09 A;  4IX8 A;  1MAQ A;  2FM1 A;  4BQ0 A;  1BJW A;  3KGW A;  2YKU A;  5D5S A;  4IXS A;  1W23 A;  4ZLV A;  1DJU A;  3LG0 A;  3MAU A;  4GRX A;  2EGY A;  1QIT A;  4K2B A;  4LW2 A;  3ZRP A;  1ZOB A;  2D65 A;  3MBB A;  3NRA A;  4R5F A;  1P3W A;  3VAX A;  4CBS A;  3E2Y A;  1WYV A;  3TFT A;  4AZK A;  4RAE A;  4F4E A;  2YCT A;  2R5C B;  4XQ2 A;  2DGL A;  1V2F A;  3JWB A;  3BCX A;  4ADB A;  1C0N A;  4UHN A;  2YKY A;  3MKJ A;  1CJ0 A;  4JEV A;  3PGY A;  4NOG A;  2ZY5 A;  4GE9 A;  1AIC A;  4U1T A;  3AV7 A;  2PB2 A;  1Y4I A;  3WY7 A;  2XH1 A;  3FDB A;  1N8P A;  1BJ4 A;  2VMO A;  2BYJ A;  5M4D A;  4OMA A;  4XJP A;  2OKJ A;  2ORD A;  3FZ6 A;  2JJG A;  2W8T A;  1WKG A;  1DFO A;  2VMP A;  2R0T A;  2VGV A;  4WYF A;  1J32 A;  2VMW A;  2BI1 A;  1MDO A;  4F5F A;  1MGV A;  1I29 A;  4UHM A;  3BCA A;  3ASB A;  3I4J A;  3AEN B;  4Q6R A;  3N0L A;  3K7Y A;  4F5K A;  2CJH A;  1B9H A;  1IVR A;  1AMA A;  1AX4 A;  1IBJ A;  2PB0 A;  2V0Y A;  3IF2 A;  3PDB A;  3N5M A;  4MKK A;  2W7H A;  3EI8 A;  3AEM A;  4PFF A;  2VGS A;  3GWP A;  2AY9 A;  1O61 A;  4ZDO A;  2GB3 A;  1M7Y A;  2W7D A;  1C7N A;  1X2A A;  3BN1 A;  1VP4 A;  1ARS A;  4BMK A;  3BV0 A;  1WYT B;  3UAK A;  3F6T A;  1CZE A;  3PJ0 A;  3GZD C;  4WXB A;  3FQA A;  2C44 A;  2XBN A;  4JF1 A;  3WZF A;  4F5L A;  2OGA A;  1YJZ A;  3CAI A;  3H7F A;  4GE7 A;  3NUB A;  1D7S A;  2OAT A;  2JG2 A;  3FVX A;  3FQ7 A;  4ADD A;  2OKK A;  2DGM A;  1V72 A;  2HOY A;  1AHX A;  1S09 A;  2QB2 A;  2W7E A;  3PPL A;  3BWO A;  4IY7 A;  3K28 A;  4I8A A;  4R8D A;  4Q75 A;  5F9S A;  2X5F A;  1IAX A;  1X0M A;  2JJF A;  1EQB A;  3NYU A;  2RFV A;  3OKS A;  1FG3 A;  3UWC A;  1YIZ A;  3B1D A;  3FKD A;  2QB3 A;  1V2D A;  1GC0 A;  3MEB A;  2YKV A;  1PFF A;  1AHY A;  3L8A A;  4R2N A;  4JEW A;  2Z1Z A;  1EJI A;  2FNI A;  2AY2 A;  1MLZ A;  2VGT A;  1IX6 A;  1SFF A;  3FVS A;  2HP1 A;  3PD6 B;  4J5U A;  1D7U A;  2O0R A;  4OC9 A;  4ZAS A;  3VK4 A;  2JIS A;  3EI7 A;  4RKD A;  2VGU A;  1J04 A;  1AKB A;  2G6W A;  4W91 A;  1MLY A;  2VMX A;  4ZWV A;  3F0H A;  2CY8 A;  5E5I A;  2GMU A;  2YRI A;  2CH1 A;  1M0O A;  3MAF B;  1X29 A;  5K8B A;  3NYS A;  3QHX A;  4BA5 A;  1AIA A;  1YJS A;  2CJD A;  5EFS A;  3BWN A;  4W1V A;  1KKJ A;  4M2K A;  1Z3Z A;  3GJU A;  3HL2 A;  4ZWM A;  4K2I A;  2PO3 A;  4OBV A;  5G4I A;  1I43 A;  3P1T A;  3WGC A;  4JE5 D;  5M49 A;  2W8W A;  4ZSW A;  4RIT A;  2DKB A;  3RQ1 A;  1PMO A;  4HF8 A;  3KE3 A;  2FKI A;  2DOU A;  3HMU A;  4A0H A;  4OBU A;  1IX7 A;  5EAV A;  2CH2 A;  3CQ4 A;  4JE5 A;  3N7N A;  1I41 A;  1YNU A;  3CQ5 A;  2ZSL A;  4IYO B;  1D7V A;  1IUG A;  3HT4 A;  4JEY A;  4F5H A;  1T3I A;  3P6K A;  5AX8 A;  1LS3 A;  2D7Y A;  3JZL A;  3G0T A;  3DXV A;  4W5K A;  5E4Z A;  2Z9X A;  3AEP A;  1KL1 A;  2AY5 A;  1OXP A;  4DQ6 A;  1FG7 A;  4KAM A;  1E5E A;  2ZC0 A;  3DOD A;  4WYE A;  5HDM A;  4E1O A;  3ZRR A;  1I48 A;  3RCH A;  1WYV B;  1ORD A;  3G8M A;  3E77 A;  1TOE A;  5DX5 A;  4P3M A;  3ACZ A;  2Z9W A;  2HP2 A;  3E2Z A;  3QM2 A;  2W8J A;  1M6S A;  3QI6 A;  4P7Y A;  2HUU A;  1AY5 A;  1ASC A;  2W7L A;  5JAY A;  1U08 A;  3GR9 A;  2BIG A;  5TF5 A;  4A6T A;  4B9B A;  4E77 A;  1V2E A;  2BHX A;  1AY4 A;  1TAT A;  2HUF A;  3AEM C;  1AMQ A;  1G7W A;  2AAT A;  2D5Y A;  2DR1 A;  5C6U A;  1ASM A;  3EI5 A;  2AY7 A;  9AAT A;  5M46 A;  2ZJG A;  3NDN A;  2E7J A;  3NU8 A;  3CQ6 A;  3W1J A;  5DJ9 A;  1AKC A;  2VGW A;  4AH3 A;  2A1V A;  1TOI A;  2ZYJ A;  3A9X A;  3NTJ A;  3DYD A;  2CST A;  2FQ6 A;  3ASA A;  1AY8 A;  4WD2 A;  1BQA A;  3A9Y A;  1MDZ A;  5E3K A;  1ASN A;  3B1C A;  4ITG A;  2WK9 A;  4JEX A;  3USF A;  2DKJ A;  4A00 A;  2OQX A;  1PG8 A;  2HOZ A;  2ZP7 A;  1IAY A;  1W7N A;  3PDB B;  2O7C A;  1C9C A;  4J8L A;  4Q76 A;  4ZSY A;  5BJ4 A;  1TOG A;  5F8V A;  2D64 A;  5FT5 A;  1ZOD A;  3WCN A;  1AJS A;  4W1X A;  4EMY A;  1LC7 A;  1S06 A;  1UU2 A;  2AEV A;  2AY6 A;  3FTB A;  4F5J A;  2QSR A;  4WB0 A;  1BT4 A;  5J8Q A;  3ELP A;  4Y0H A;  5I92 A;  4CBR A;  1CQ7 A;  2AY4 A;  2AY8 A;  3T32 A;  3EIB A;  1GDE A;  4PFN A;  2F8J A;  5EUE A;  1BJO A;  4Q31 A;  1KL2 A;  1CZC A;  1OXO A;  4LNM A;  1AHF A;  3MC6 A;  4RJ0 A;  4ZAH A;  2Z1Y A;  1WKH A;  5BJ3 A;  1S08 A;  4TN4 A;  3NUI A;  2BWP A;  1GEW A;  1MAP A;  3WX9 A;  2D61 A;  3LVM A;  3B46 A;  1ART A;  3B8X A;  3WKS A;  1DGE A;  5LH9 A;  1E5F A;  4H63 Q;  1QGN A;  4RIZ A;  5FT6 A;  2TPL A;  1SVV A;  1AJR A;  1M0Q A;  3H14 A;  4LNL A;  2QLR A;  4KYO A;  3R4T A;  2VIA A;  3LV2 A;  4JF0 A;  3BWN C;  2JGT A;  4ZM3 A;  2VGZ A;  3AAT A;  4LW4 A;  3COG A;  3GET A;  3FQ8 A;  2EH6 A;  3GSB A;  2WB6 A;  1DGD A;  3UE8 A;  1AMR A;  3BS8 A;  3PA9 A;  3VK3 A;  2CFB A;  1BKG A;  2YHK A;  4OTL A;  5EUN A;  3VK2 A;  2W7I A;  2VMT A;  4L0O A;  3N75 A;  1AKA A;  2QMA A;  4PVF A;  4EU1 A;  4ZDP A;  2E7I A;  1H1C A;  1B9I A;  1UU0 A;  2X3L A;  4UQV A;  3FZ7 A;  5G2Q A;  2BKW A;  3H9X A;  2HUI A;  1TAS A;  4MY5 A;  1YAA A;  3QPG A;  5LHA A;  2E7U A;  4MGR A;  4ADE A;  1WYU A;  4OCA A;  2YCP A;  4AOA A;  2Z20 A;  3EUC A;  1GC4 A;  1N2T A;  1D7R A;  4MQP A;  1GEX A;  2QBT A;  2EYQ A;  2CB1 A;  2O1B A;  3Q8N A;  3ATH A;  3IHJ A;  1GC2 A;  1LK9 A;  2X5D A;  1B4X A;  3AOW A;  3BCB A;  1PMM A;  1XEY A;  2R5E A;  4TV7 A;  2EZ2 A;  2G7J A;  4K2M A;  2VYC A;  4ZM4 A;  1DKA A;  1ASL A;  4BHD A;  4W1W A;  2OGE A;  4ADC A;  4HVK A;  3DZZ A;  3EIA A;  3PDX A;  3ECD A;  1CL2 A;  3II0 A;  1TOK A;  1Z7D A;  4MSO A;  3TQX A;  4TMR A;  3JU7 A;  1JG8 A;  4MQQ A;  2ZUK A;  4AZJ A;  1M0P A;  4WYD A;  4A6U A;  4DGT A;  2KFP A;  1S07 A;  3RCH B;  3RBF A;  3FSL A;  4GEB A;  5G4J A;  1ECX A;  3KGX A;  5DJ1 A;  2BIA A;  4XJM A;  2VMN A;  1AIB A;  3AEJ A;  2VMV A;  3PAA A;  3E2Z B;  1ASG A;  1ASF A;  1YOO A;  1DJ9 A;  2YKX A;  3LY1 A;  1TPL A;  1GC3 A;  1LKC A;  4N0W A;  1M0N A;  3CBF A;  3N4S A;  3MAF A;  1EG5 A;  3FVU A;  3EZS A;  2Z67 A;  3HLM A;  3D6K A;  3GBX A;  4A0R A;  3JWA A;  1RVU A;  1RVY A;  2GSA A;  2AY1 A;  1SZK A;  1ASE A;  4M2M A;  1OAT A;  4E3R A;  4EB7 A;  1ARH A;  3FRK A;  4XEW A;  3VOM A;  1W3U A;  1AHE A;  1X28 A;  3RI6 A;  2W7J A;  2BYL A;  3BC8 A;  1DTY A;  2FNU A;  5FT4 A;  2VMS A;  2DGK A;  3FFR A;  3WKR A;  3R9A A;  2EPJ A;  3LWS A;  3N4X A;  2JJE A;  4WLJ A;  4WLH A;  3TAT A;  1DJE A;  1D2F A;  4BA4 A;  1ARG A;  2ZSM A;  1LW5 A;  3W1H A;  1ARI A;  2X8U A;  2AEU A;  3MC6 C;  1KMK A;  2D66 A;  4OT8 A;  5EIG A;  4F5I A;  2AY3 A;  4F5M A;  3N4R A;  2BI9 A;  3FZ8 A;  4PIW A;  4UOY A;  1AJS B;  1LC8 A;  4N0B A;  3KKI A;  3LVJ A;  4DBC A;  3W1I A;  4IXZ A;  1SF2 A;  1MDX A;  4WB0 B;  4QGR A;  3ZRQ A;  8AAT A;  5M4B A;  1BJN A;  1FC4 A;  1GBN A;  1B5O A;  5FT8 A;  1QIS A;  1QJ3 A;  3MAD A;  4H51 A;  2W7F A;  1CL1 A;  4R5Z A;  4MQR A;  1M4N A;  1BJO B;  3I16 A;  4CXQ A;  1OHY A;  2Q7W A;  3K40 A;  4FFC A;  2GMS A;  1S0A A;  3I5T A;  4IXO A;  2ZY4 A;  3DR4 A;  5D95 A;  2VIB A;  3RBL A;  5HHY A;  1VEF A;  1BW0 A;  1G7X A;  1CS1 A;  1SZS A;  3L44 A;  4JEZ A;  5KTB A;  2W7G A;  2R5C A;  3E6G A;  2WKA A;  3EI9 A;  4U2H A;  2BWN A;  4WYC A;  3BB8 A;  2JJH A;  3HDO A;  4IW7 A;  4ISY A;  3VP6 A;  2HZP A;  4OYT A;  4WXF A;  4B98 A;  4RKC A;  3TCM A;  4WP0 A;  4AO9 A;  2Z61 A;  1ASD A;  1OHV A;  3HBX A;  1GCK A;  3ZZK A;  4A0F A;  1H0C A;  2YRR A;  2W8V A;  1ASA A;  2EZ1 A;  3EI6 A;  4GE4 A;  1C7G A;  4LC3 A;  1N31 A;  4M2J A;  1AAW A;  1IX8 A;  1G4V A;  1UU1 A;  2VI9 A;  2Z9U A;  3M5U A;  4FL0 A;  3FD0 A;  1AAM A;  1GEY A;  2C81 A;  3NYT A;  1QIR A;  4K05 A;  1OHW A;  4W8I A;  1UKJ A;  2VLH A;  4A6R A;  1KMJ A;  4MKJ A;  4O6Z A;  3AEN A;  3DU4 A;  3DC1 A;  3GZC A;  2VMU A;  2BI2 A;  3F9T A;  5EQC A;  2W7K A;  5HXX A;  1JS6 A;  1C7O A;  3AEO A;  1IJI A;  1ELU A;  4EB5 A;  1QZ9 A;  2D63 A;  1QJ5 A;  4RJY A;  1O4S A;  5EUD A;  2ZY2 A;  4ATQ A;  1WYU B;  3DR7 A;  1KKP A;  4UHO A;  1YIY A;  3QBO A;  4XAU A;  1O62 A;  1WYT A;  4WBT A;  4CVQ A;  1LW4 A;  1BS0 A;  2WK8 A;  2HOR A;  2BI3 A;  2CJG A;  2Z9V A;  3WGB A;  1WST A;  3ELE A;  3ZZJ A;  3AEJ C;  4XJL A;  3ISL A;  2VMR A;  3PIU A;  2VMY A;  3EZ1 A;  3NX3 A;  4E3Q A;  4Y0I A;  1BQD A;  4AO4 A;  2VMQ A;  3E9K A;  1C4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...