1AICA

Structural basis for the catalytic activity of aspartate aminotransferase k258h lacking the pyridoxal-5'-phosphate binding lysine residue
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSHNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Structural basis for the catalytic activity of aspartate aminotransferase K258H lacking the pyridoxal 5'-phosphate-binding lysine residue.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
total genus 140
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1994-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1aicA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1aicA01
1AJSB 3MADA 2CINA 4IX8A 3WCOA 1LC5A 4ZSWA 1J04A 2VGWA 3AATA 1DKAA 3QPGA 3EI7A 3ZZKA 4BA4A 2JISA 1SZSA 2W8JA 3HQTA 4JEVA 1C7NA 1E5EA 1RV3A 4ITGA 4W1VA 4WBTA 5FT5A 4EMYA 1UKJA 3F6TA 1BJOA 3TFUA 5TF5A 2DKJA 4RKDA 4W1XA 4W91A 5HXXA 1JG8A 4IXOA 1AHFA 4ISYA 2ZSLA 3DODA 7AATA 3H7FA 2W8WA 4PFFA 1V2DA 3ELEA 2JJGA 1CS1A 8AATA 2Z61A 2E7UA 1ARGA 4AZKA 3WX9A 2YOBA 2DOUA 2QB2A 4UHMA 1O62A 4MSOA 4JEYA 1YJSA 1M0OA 1QGNA 1QJ5A 2CJHA 4KAMA 1FG7A 3HMUA 4RLGA 3P1TA 3B8XA 2DKBA 1AKCA 3G7QA 3WY7A 2ZY2A 3QBOA 4WD2A 4M2JA 2E7JA 4MQPA 3LG0A 3FKDA 4E1OA 4XJMA 1GEXA 2BYJA 2BWPA 4U1TA 2W7HA 1TOJA 2JJFA 3VAXA 5E4ZA 2W7DA 1LK9A 3AOWA 3EI6A 2ZC0A 2OGEA 1IVRA 2BI1A 3UWCA 1IX7A 1AMSA 1ASFA 1TOIA 2QBTA 4LNMA 4EB5A 3ELPA 1C0NA 2TPLA 1VEFA 1N2TA 2O1BA 4GE4A 3RCHB 4ATQA 4ZDLA 1AKBA 3CAIA 1YNUA 5I92A 4RKCA 1AMAA 3RCHA 2XH1A 3GWPA 3AEPA 4GE9A 3GZDC 1M6SA 1ASLA 2W7KA 4LNLA 4W5KA 1S08A 3JZLA 2Z20A 2EZ1A 3FZ8A 2Z9UA 4OT8A 4QGRA 2AY5A 1WYUB 2GQNA 3ATHA 1GC2A 1RV4A 2GB3A 3BWNC 5M4DA 2F8JA 5LHAA 2R5CA 2E54A 1B5OA 2VMPA 5EIGB 1QIRA 3AEMA 2C44A 1Z7DA 2W7LA 1VJOA 1WYVB 1CQ7A 3VP6A 4WB0B 3ECDA 4GE7A 1RVUA 1WYVA 3HDOA 3GETA 2HOXA 4UQVA 3PA9A 3AV7A 4CXRA 2AY1A 2D64A 1KMJA 1AJRA 2Q7WA 4WYEA 5EAVA 2VLHA 1CQ6A 1PMMA 3LVKA 3MC6C 1I41A 2JJEA 1BJWA 1UU0A 5EFSA 1LS3A 2VMXA 4XJLA 3VK4A 1TOKA 2AY7A 1EJIA 2D5YA 3QN6A 1X29A 1WKGA 5HDMA 4JE5A 2YRRA 4ZWVA 4AZJA 3RBLA 1D7RA 1FC4A 1W7MA 1MLZA 3RQ1A 3FFRA 2HP1A 2CJDA 4EU1A 1EQBA 2EH6A 1U08A 3DZZA 3E2FA 3FZ7A 4A6TA 1CL1A 4E3RA 1O69A 2FYFA 2W7MA 3USFA 3K28A 1D7SA 4JEXA 1QITA 2ZSMA 2VMYA 3A8UX 3MKJA 4K2MA 4Q6RA 4CVQA 2R2NA 1DJEA 2QMAA 3LWSA 1S0AA 1ASEA 1TASA 3FVSA 1V72A 5FT4A 2V1PA 4RM1A 3ZRQA 2CTZA 1G7WA 4WXGA 4ADDA 1T3IA 5DJ1A 3WKSA 1WSTA 3NRAA 2GSAA 1OHVA 2VMVA 2WK8A 3E2ZB 3NX3A 2JGTA 3FQAA 2PO3A 4LW4A 5FT8A 4L0OA 1G7XA 2AATA 4K2BA 4OTLA 2C7TA 3KE3A 2YKUA 4I8AA 1YAAA 5D5SA 3RBFA 1JS3A 2ZP7A 4IXSA 3BWOA 2XBNA 1KL1A 1AHGA 3BCAA 4IXZA 5C6UA 1LC7A 1AHYA 1KL2A 2HZPA 4WXBA 5M46A 5F8VA 2G6WA 1QISA 1AJSA 3MEBA 1GBNA 3BB8A 3FDDA 2WK7A 2ZUKA 1SPAA 1DGEA 3GZDA 2BI9A 1W7NA 2X3LA 3BC8A 1GDEA 1TOGA 3B1EA 1WYTB 2VGSA 3JTXA 3PJ0A 4F5FA 3DYDA 4A00A 4XQ2A 1N8PA 5IWQA 3R4TA 3UE8A 3BWNA 1O61A 4RITA 2BIAA 4EFFA 1LW5A 2W8VA 4J8LA 3EIAA 1AY4A 3ACZA 3GR9A 4E77A 3AEJA 3KKIA 1CL2A 1CJ0A 2DR1A 1AY8A 2VMSA 4RIZA 5K8BA 2EPJA 1ELQA 1Y4IA 2R0TA 1MAQA 2CFBA 4GEBA 4JF1A 3WGBA 2BI5A 2YKXA 1MLYA 2W7JA 4UHNA 4Y0DA 3WGCA 3MC6A 1ZC9A 1ORDA 1ARTA 2HUFA 4IYOB 2EGYA 2VMNA 5EQCA 4B9BA 4BA5A 2Z9WA 1DJUA 2DGMA 4Y0IA 3NNKA 2JJHA 3WCNA 3OP7A 2HOYA 1GCKA 4KYOA 4AO4A 4R2NA 2VGVA 4K2IA 1TPLA 3NYUA 3GSBA 1SFFA 2W7IA 1AMQA 3NU7A 1J32A 3COGA 2W8TA 3BCXA 3JU7A 3IHJA 3LY1A 4R5FA 1S07A 2VGTA 3NU8A 1ARHA 1GC3A 3BCBA 4WXFA 5M4BA 4MY5A 4BHDA 4TMRA 5BJ4A 1ASGA 1TOEA 2X5FA 1C7OA 4PFNA 4XEWA 3W1JA 5D95A 3UAKA 1TARA 1X0MA 2C0RA 2BKWA 3DR4A 1GC0A 4N0WA 2YCNA 2YKVA 1BS0A 2D65A 3NDNA 3QHXA 5DJ9A 2W7FA 1KKJA 4MKJA 2BI3A 1WYUA 3ISLA 1AMRA 4OBUA 1BT4A 2JG2A 2Z9VA 1YIZA 2OATA 3AEJC 3HVYA 5LH9A 4E3QA 1ASDA 2HUUA 5EIGA 3R9AA 3NYSA 4KXKA 3BV0A 1WKHA 3L8AA 2CB1A 2FQ6A 3AELA 4FL0A 2W8UA 1ASCA 3PPLA 4WB0A 4WYGA 3HL2A 1CZCA 2BI2A 1PG8A 5G09A 3FDBA 4WLHA 2DGLA 3CQ4A 1W7LA 5G0AA 3NUIA 2VMWA 3IF2A 4JEWA 2RFVA 1BJNA 2EO5A 4XJOA 3T32A 1C7GA 4PVFA 4O6ZA 3PD6B 2VGZA 4MQQA 4JE5D 4N0BA 3FD0A 4ATPA 1AY5A 3PD6A 3FQ7A 3AOVA 1ASBA 2CH2A 2DGKA 4GSAA 4DBCA 2BIEA 1W23A 3WZFA 4A0GA 4F5KA 1W3UA 2VMRA 1IBJA 2Z67A 1I29A 1OXPA 4F5IA 2VLFA 2CY8A 1C4KA 4ADEA 3B1CA 4W8IA 1PMOA 3EIBA 2CJGA 3ASBA 1YJYA 1AAWA 4MQRA 4M2KA 1UU2A 5G4JA 4XK1A 4CXQA 1B4XA 3PDBB 2ZY3A 4ZLVA 2PB0A 3EZ1A 3PDBA 3FFHA 1ASAA 3JWAA 1CQ8A 3E2ZA 3K40A 4OYTA 3N0LA 4P3MA 4WLJA 1KMKA 2AEUA 3EI5A 4JEZA 3N5MA 2HOZA 5F9SA 2OGAA 2AY2A 3FRKA 1AX4A 3TFTA 2R5EA 4R8DA 3NYTA 1MDZA 3AENB 4F5JA 1OATA 3DXVA 1MDXA 1LKCA 2W7EA 3PDXA 2Z1YA 3FVUA 4JF0A 4H51A 1DGDA 3DU4A 1D2FA 3LVMA 3G0TA 1ASNA 3ZRRA 2OKJA 5G2PA 1QJ3A 1M0QA 1YOOA 3ASAA 4RJYA 3BS8A 3E9KA 1ELUA 1DFOA 1G4XA 2OKKA 3FZ6A 4A0FA 1I43A 1Z3ZA 2O7CA 1M4NA 2AY8A 2QA3A 5BJ3A 1WYTA 3AEOA 4DQ6A 3G8MA 3MAFB 4M2MA 2AY9A 2FNUA 1DTYA 4WYFA 4ZSYA 4ZDPA 1I48A 3H14A 3HLMA 1BW0A 1ECXA 1JF9A 1M7YA 2AEVA 2BWNA 3K7YA 2VYCA 3DC1A 3RUYA 2GMUA 4ADCA 3W1IA 3WKRA 5FT6A 2E7IA 1AIBA 1SZKA 4J5UA 2CSTA 1M0PA 2C81A 4ZWMA 4HVKA 1V2EA 2BHXA 3EZSA 4OCAA 1AKAA 3I4JA 3B1DA 3MBBA 1SVVA 1D7VA 5E5IA 1MDOA 1QZ9A 1BJOB 2VMOA 3FQ8A 3E77A 4Q75A 1PFFA 2VI9A 4IYOA 1IX8A 2YRIA 2PB2A 3NUBA 1O4SA 1LC8A 2D61A 4NOGA 2FNIA 3RI6A 3OKSA 4GRXA 4R5ZA 4XJPA 4AH3A 3DXWA 4MKKA 1X2AA 4A0HA 1IUGA 4XAUA 1OHYA 2VMZA 1H1CA 2BIGA 3F0HA 3GBXA 5EUDA 1GC4A 3LVJA 2ORDA 1KKPA 1MAPA 2BWOA 1B9HA 5EAAA 3Q8NA 4U2HA 5HHYA 1IX6A 4Q31A 4WYDA 1XI9A 2YCPA 1B8GA 1OHWA 2ZY4A 3DRDA 3A2BA 1M32A 3PIUA 1X28A 3ZZJA 2X5DA 4IY7A 3L44A 2V0YA 4PIWA 3VK2A 4BQ0A 2BYLA 1CZEA 1FG3A 1BQDA 1AHXA 4F5HA 4HF8A 1UU1A 5DX5A 5EUNA 2D63A 4RAEA 1XEYA 2HUIA 2HORA 1VP4A 3F9TA 4TV7A 2W7GA 4UHOA 1AHEA 1OXOA 2GMSA 4ZAHA 3HBXA 2WKAA 3II0A 2WK9A 4RJ0A 5JAYA 1ASMA 2Z1ZA 3EI8A 4OBVA 4F5MA 3CQ5A 4ZDOA 1GEYA 3E6GA 3M5UA 3I16A 3FVXA 4BMKA 3CQ6A 4OMAA 4LW2A 1YJZA 4Q76A 1SF2A 1TATA 1MGVA 4ZASA 3LVLB 5EUEA 3ZRPA 4OC9A 3D6KA 3TCMA 2R5CB 4ADBA 3EI9A 3MAUA 4A0RA 3B46A 3VK3A 1S06A 2D7ZA 3FTBA 4F5LA 3GZCA 1D7UA 4P7YA 4WYAA 4A6RA 1RVYA 1IAXA 2CH1A 1GEWA 2YHKA 1JS6A 3CBFA 4WP0A 2AY4A 2D7YA 2O0RA 3FCRA 4CBRA 4A72A 4CBSA 1P3WA 2X8UA 2VMQA 2YKYA 3A9YA 5J8QA 2FM1A 3QI6A 2ZY5A 1AAMA 1M0NA 4GDYA 1LW4A 5M49A 4ITXA 1YIYA 1ZOBA 4FFCA 1N31A 4DGTA 2YCTA 3TATA 4TN4A 3W1HA 4ZM3A 1EG5A 2ZJGA 4B98A 3PAAA 1BKGA 3QM2A 1B9IA 3KGXA 4A6UA 4Y0HA 3DR7A 3WLXA 2FN6A 5G4IA 2ZYJA 4EB7A 1BQAA 4F5GA 2AY3A 1ARIA 2VMTA 5AX8A 1IJIA 3LV2A 4WYCA 2D66A 2HP2A 3KGWA 3TQXA 3NTJA 1IAYA 4MGRA 4ZM4A 4LC3A 3AENA 1DJ9A 1GD9A 2CANA 2EZ2A 2VI8A 2QLRA 2VMUA 1AIAA 3HT4A 9AATA 5G2QA 2QB3A 1ZODA 4IW7A 3JW9A 4AO9A 2NMPA 3EUCA 1E5FA 1V2FA 3VOMA 4F4EA 1AICA 5E3KA 1G4VA 3I5TA 1B5PA 1H0CA 3FSLA 1S09A 1C9CA 3E2YA 3JWBA 3P6KA 1BJ4A 3GJUA 2VIBA 3PGYA 1SZUA 4LNJA 2VGUA 4W1WA 4AOAA 2OQXA 3BN1A 3MAFA 3QGUA 3N75A 5DB5A 2VIAA 3A9XA 2AY6A 3AEMC 3A9ZA 2Z9XA 4UOYA 1ARSA
chains in the Genus database with same CATH superfamily
1AJSB 3MADA 2CINA 4IX8A 3WCOA 1LC5A 4ZSWA 1J04A 2VGWA 3AATA 1DKAA 3QPGA 3EI7A 3ZZKA 4BA4A 2JISA 1SZSA 2W8JA 3HQTA 4JEVA 1C7NA 1E5EA 1RV3A 4ITGA 4W1VA 4WBTA 5FT5A 4EMYA 1UKJA 3F6TA 1BJOA 3TFUA 5TF5A 2DKJA 4RKDA 4W1XA 4W91A 5HXXA 1JG8A 4IXOA 1AHFA 4ISYA 2ZSLA 3DODA 7AATA 3H7FA 2W8WA 4PFFA 1V2DA 3ELEA 2JJGA 1CS1A 8AATA 2Z61A 2E7UA 1ARGA 4AZKA 3WX9A 2YOBA 2WB6A 2DOUA 2QB2A 4UHMA 1O62A 4MSOA 4JEYA 1YJSA 1M0OA 1QGNA 1QJ5A 2CJHA 4KAMA 1FG7A 3HMUA 4RLGA 3P1TA 3B8XA 2DKBA 1AKCA 3G7QA 3WY7A 2ZY2A 3QBOA 4WD2A 4M2JA 2E7JA 4MQPA 3LG0A 3FKDA 4E1OA 4XJMA 1GEXA 2BYJA 2BWPA 4U1TA 4K05A 2W7HA 1TOJA 2JJFA 3VAXA 5E4ZA 2W7DA 1LK9A 3AOWA 3EI6A 2ZC0A 2OGEA 1IVRA 2BI1A 3UWCA 1IX7A 1AMSA 1ASFA 1TOIA 2QBTA 4LNMA 4EB5A 3ELPA 1C0NA 2TPLA 1VEFA 1N2TA 2O1BA 4GE4A 3RCHB 4ATQA 4ZDLA 1AKBA 3CAIA 1YNUA 5I92A 4RKCA 1AMAA 3RCHA 2XH1A 3GWPA 3AEPA 4GE9A 3GZDC 1M6SA 1ASLA 2W7KA 4LNLA 4W5KA 1S08A 3JZLA 2Z20A 2EZ1A 3FZ8A 2Z9UA 4OT8A 4QGRA 2AY5A 1WYUB 2GQNA 3ATHA 1GC2A 1RV4A 2GB3A 3BWNC 5M4DA 2F8JA 5LHAA 2R5CA 2E54A 1B5OA 5KTBA 2VMPA 5EIGB 1QIRA 3AEMA 2C44A 1Z7DA 2W7LA 1VJOA 1WYVB 1CQ7A 3VP6A 4WB0B 3ECDA 4GE7A 1RVUA 1WYVA 3HDOA 3GETA 2HOXA 4UQVA 3PA9A 3AV7A 4CXRA 2AY1A 2D64A 1KMJA 1AJRA 2Q7WA 4WYEA 5EAVA 2VLHA 1CQ6A 1PMMA 3LVKA 3MC6C 1I41A 2JJEA 1BJWA 1UU0A 5EFSA 1LS3A 2VMXA 4XJLA 3VK4A 1KAFA 1TOKA 2AY7A 1EJIA 2D5YA 3QN6A 2QSRA 1X29A 1WKGA 5HDMA 4JE5A 2YRRA 4ZWVA 4AZJA 3RBLA 1D7RA 1FC4A 1W7MA 1MLZA 3RQ1A 3FFRA 2HP1A 2CJDA 4EU1A 1EQBA 2EH6A 1U08A 3DZZA 3E2FA 3FZ7A 4A6TA 1CL1A 4E3RA 1O69A 2FYFA 2W7MA 3USFA 3K28A 1D7SA 4JEXA 1QITA 2ZSMA 2VMYA 3A8UX 3MKJA 4K2MA 4Q6RA 4CVQA 2R2NA 1DJEA 2QMAA 3LWSA 1S0AA 1ASEA 1TASA 3FVSA 1V72A 5FT4A 2V1PA 4RM1A 3ZRQA 2CTZA 1G7WA 4WXGA 4ADDA 1T3IA 5DJ1A 3WKSA 1WSTA 3NRAA 2GSAA 1OHVA 2VMVA 2WK8A 3E2ZB 3NX3A 3N4RA 2JGTA 3FQAA 2PO3A 4LW4A 5FT8A 4L0OA 1G7XA 2AATA 4K2BA 4OTLA 2C7TA 3KE3A 2YKUA 4I8AA 1YAAA 5D5SA 3RBFA 1JS3A 2ZP7A 4IXSA 3BWOA 2XBNA 1KL1A 1AHGA 3BCAA 4IXZA 5C6UA 1LC7A 1AHYA 1KL2A 2HZPA 4WXBA 5M46A 5F8VA 2G6WA 1QISA 1AJSA 3MEBA 1GBNA 3BB8A 3FDDA 2WK7A 2ZUKA 1SPAA 1DGEA 3GZDA 2BI9A 1W7NA 2X3LA 3BC8A 1GDEA 1TOGA 3B1EA 1WYTB 2VGSA 3JTXA 3PJ0A 4F5FA 3DYDA 4A00A 4XQ2A 1N8PA 5IWQA 3R4TA 3UE8A 3BWNA 1O61A 4RITA 2BIAA 4EFFA 1LW5A 2W8VA 4J8LA 3EIAA 1AY4A 3ACZA 3GR9A 4E77A 3AEJA 3KKIA 1CL2A 1CJ0A 2DR1A 1AY8A 2FKIA 2VMSA 4RIZA 5K8BA 2EPJA 1ELQA 1Y4IA 2R0TA 1MAQA 2CFBA 4GEBA 4JF1A 4H63Q 3WGBA 2BI5A 2YKXA 1MLYA 2W7JA 4UHNA 4Y0DA 3WGCA 3MC6A 1ZC9A 1ORDA 1ARTA 2HUFA 4IYOB 2EGYA 2VMNA 5EQCA 4B9BA 3N7NA 4BA5A 2Z9WA 1DJUA 2DGMA 4Y0IA 3NNKA 2JJHA 3WCNA 3OP7A 2HOYA 1GCKA 4KYOA 4AO4A 4R2NA 2VGVA 4K2IA 1TPLA 3NYUA 3GSBA 1SFFA 2W7IA 1AMQA 3NU7A 1J32A 3COGA 2W8TA 3BCXA 3JU7A 3IHJA 3LY1A 4R5FA 1S07A 2VGTA 3NU8A 1ARHA 1GC3A 3BCBA 4WXFA 5M4BA 4MY5A 4BHDA 4TMRA 5BJ4A 1ASGA 1TOEA 2X5FA 1C7OA 4PFNA 4XEWA 3W1JA 5D95A 3UAKA 1TARA 1X0MA 2C0RA 2BKWA 3DR4A 1GC0A 4N0WA 2YCNA 2YKVA 1BS0A 2D65A 3NDNA 3QHXA 5DJ9A 2W7FA 1KKJA 4MKJA 2BI3A 1WYUA 3ISLA 1AMRA 4OBUA 1BT4A 2JG2A 2Z9VA 1YIZA 2OATA 3AEJC 3HVYA 5LH9A 4E3QA 1ASDA 2HUUA 5EIGA 3R9AA 3NYSA 4KXKA 3BV0A 1WKHA 3L8AA 2CB1A 2FQ6A 3AELA 4FL0A 2W8UA 1ASCA 3PPLA 4WB0A 4WYGA 3HL2A 1CZCA 2BI2A 1PG8A 5G09A 3FDBA 4WLHA 2DGLA 3CQ4A 1W7LA 5G0AA 3NUIA 2VMWA 3IF2A 4JEWA 2RFVA 1BJNA 2EO5A 4XJOA 3T32A 1C7GA 4PVFA 4O6ZA 3PD6B 2VGZA 4MQQA 4JE5D 4N0BA 3FD0A 4ATPA 1AY5A 3PD6A 3FQ7A 3AOVA 1ASBA 2CH2A 2DGKA 4GSAA 4DBCA 2BIEA 1W23A 3WZFA 4A0GA 4F5KA 1W3UA 2VMRA 1IBJA 2Z67A 1I29A 1OXPA 4F5IA 2VLFA 2CY8A 1C4KA 4ADEA 3B1CA 4W8IA 1PMOA 3EIBA 2CJGA 3ASBA 1YJYA 1AAWA 4MQRA 4M2KA 1UU2A 5G4JA 4XK1A 4CXQA 1B4XA 3PDBB 2ZY3A 4ZLVA 2PB0A 3EZ1A 3PDBA 3FFHA 1ASAA 3JWAA 1CQ8A 3E2ZA 3K40A 4OYTA 3N0LA 4P3MA 4WLJA 1KMKA 2AEUA 3EI5A 4JEZA 3N5MA 2HOZA 5F9SA 2OGAA 2AY2A 3FRKA 1AX4A 3TFTA 2R5EA 4R8DA 3NYTA 1MDZA 3AENB 4F5JA 1OATA 3DXVA 1MDXA 1LKCA 2W7EA 3PDXA 2Z1YA 3FVUA 4JF0A 4H51A 1DGDA 3DU4A 1D2FA 3LVMA 3G0TA 1ASNA 3ZRRA 2OKJA 5G2PA 1QJ3A 1M0QA 1YOOA 3ASAA 4RJYA 3BS8A 3E9KA 1ELUA 1DFOA 1G4XA 2OKKA 3FZ6A 4A0FA 1I43A 1Z3ZA 2O7CA 1M4NA 2AY8A 2QA3A 5BJ3A 1WYTA 3AEOA 4DQ6A 2KFPA 3G8MA 3MAFB 4M2MA 2AY9A 2FNUA 1DTYA 4WYFA 4ZSYA 4ZDPA 1I48A 3H14A 3HLMA 1BW0A 1ECXA 1JF9A 1M7YA 2AEVA 2BWNA 3K7YA 2VYCA 3DC1A 3RUYA 2GMUA 4ADCA 3W1IA 3WKRA 5FT6A 2E7IA 1AIBA 1SZKA 4J5UA 2CSTA 1M0PA 2C81A 4ZWMA 4HVKA 1V2EA 2BHXA 3EZSA 4OCAA 1AKAA 3I4JA 3B1DA 3MBBA 1SVVA 1D7VA 5E5IA 1MDOA 1QZ9A 1BJOB 2VMOA 3FQ8A 3E77A 4Q75A 1PFFA 2VI9A 4IYOA 1IX8A 2YRIA 2PB2A 3NUBA 1O4SA 1LC8A 2D61A 4NOGA 2FNIA 3RI6A 3OKSA 4GRXA 2G7JA 4R5ZA 4XJPA 3N4XA 4AH3A 3DXWA 4MKKA 1X2AA 4A0HA 1IUGA 4XAUA 1OHYA 2VMZA 1H1CA 2BIGA 3F0HA 3GBXA 5EUDA 1GC4A 3LVJA 2ORDA 1KKPA 1MAPA 2BWOA 1B9HA 5EAAA 3Q8NA 4U2HA 5HHYA 1IX6A 4Q31A 2A1VA 3H9XA 4WYDA 1XI9A 2YCPA 1B8GA 1OHWA 2ZY4A 3DRDA 3A2BA 1M32A 3PIUA 1X28A 3ZZJA 2X5DA 4IY7A 3L44A 2V0YA 4PIWA 3VK2A 4BQ0A 2BYLA 1CZEA 1FG3A 1BQDA 1AHXA 4F5HA 4HF8A 1UU1A 5DX5A 5EUNA 2D63A 4RAEA 1XEYA 2HUIA 2HORA 1VP4A 3F9TA 4TV7A 2W7GA 4UHOA 1AHEA 1OXOA 2GMSA 4ZAHA 3HBXA 2WKAA 3II0A 2WK9A 4RJ0A 5JAYA 1ASMA 2Z1ZA 3EI8A 4OBVA 4F5MA 3CQ5A 4ZDOA 1GEYA 3E6GA 3M5UA 3I16A 3FVXA 4BMKA 3CQ6A 4OMAA 4LW2A 1YJZA 4Q76A 1SF2A 1TATA 1MGVA 4ZASA 3LVLB 5EUEA 3ZRPA 2EYQA 4OC9A 3D6KA 3TCMA 2R5CB 4ADBA 3EI9A 3MAUA 4A0RA 3B46A 3VK3A 1S06A 2D7ZA 3FTBA 4F5LA 3GZCA 1D7UA 4P7YA 4WYAA 4A6RA 1RVYA 1IAXA 2CH1A 1GEWA 2YHKA 1JS6A 3CBFA 4WP0A 2AY4A 2D7YA 2O0RA 3FCRA 4CBRA 4A72A 4CBSA 1P3WA 2X8UA 2VMQA 2YKYA 3A9YA 5J8QA 2FM1A 3QI6A 2ZY5A 1AAMA 1M0NA 4GDYA 1LW4A 5M49A 4ITXA 1YIYA 1ZOBA 4FFCA 1N31A 4DGTA 2YCTA 3TATA 4TN4A 3W1HA 4ZM3A 1EG5A 2ZJGA 4B98A 3PAAA 1BKGA 3QM2A 1B9IA 3KGXA 4A6UA 4Y0HA 3DR7A 3WLXA 2FN6A 5G4IA 2ZYJA 4EB7A 1BQAA 4F5GA 2AY3A 1ARIA 2VMTA 5AX8A 1IJIA 3LV2A 4WYCA 2D66A 2HP2A 3KGWA 3TQXA 3NTJA 1IAYA 4MGRA 4ZM4A 4LC3A 3AENA 1DJ9A 1GD9A 2CANA 2EZ2A 2VI8A 2QLRA 2VMUA 1AIAA 3HT4A 9AATA 5G2QA 2QB3A 1ZODA 4IW7A 3JW9A 4AO9A 2NMPA 3EUCA 1E5FA 1V2FA 3VOMA 4F4EA 1AICA 5E3KA 1G4VA 3I5TA 1B5PA 1H0CA 3FSLA 1S09A 1C9CA 3E2YA 3JWBA 3P6KA 1BJ4A 3GJUA 2VIBA 3PGYA 1SZUA 4LNJA 2VGUA 4W1WA 4AOAA 2OQXA 3BN1A 3MAFA 3QGUA 3N75A 5DB5A 2VIAA 3A9XA 2AY6A 3AEMC 3A9ZA 2Z9XA 4UOYA 3N4SA 1ARSA
chains in the Genus database with same CATH topology
1AJSB 3MADA 2CINA 4IX8A 3WCOA 1LC5A 4ZSWA 1J04A 2VGWA 3AATA 1DKAA 3QPGA 3EI7A 3ZZKA 4BA4A 2JISA 1SZSA 2W8JA 3HQTA 4JEVA 1C7NA 1E5EA 1RV3A 4ITGA 4W1VA 4WBTA 5FT5A 4EMYA 1UKJA 3F6TA 1BJOA 3TFUA 5TF5A 2DKJA 4RKDA 4W1XA 4W91A 5HXXA 1JG8A 4IXOA 1AHFA 4ISYA 2ZSLA 3DODA 7AATA 3H7FA 2W8WA 4PFFA 1V2DA 3ELEA 2JJGA 1CS1A 8AATA 2Z61A 2E7UA 1ARGA 4AZKA 3WX9A 2YOBA 2WB6A 2DOUA 2QB2A 4UHMA 1O62A 4MSOA 4JEYA 1YJSA 1M0OA 1QGNA 1QJ5A 2CJHA 4KAMA 1FG7A 3HMUA 4RLGA 3P1TA 3B8XA 2DKBA 1AKCA 3G7QA 3WY7A 2ZY2A 3QBOA 4WD2A 4M2JA 2E7JA 4MQPA 3LG0A 3FKDA 4E1OA 4XJMA 1GEXA 2BYJA 2BWPA 4U1TA 4K05A 2W7HA 1TOJA 2JJFA 3VAXA 5E4ZA 2W7DA 1LK9A 3AOWA 3EI6A 2ZC0A 2OGEA 1IVRA 2BI1A 3UWCA 1IX7A 1AMSA 1ASFA 1TOIA 2QBTA 4LNMA 4EB5A 3ELPA 1C0NA 2TPLA 1VEFA 1N2TA 2O1BA 4GE4A 3RCHB 4ATQA 4ZDLA 1AKBA 3CAIA 1YNUA 5I92A 4RKCA 1AMAA 3RCHA 2XH1A 3GWPA 3AEPA 4GE9A 3GZDC 1M6SA 1ASLA 2W7KA 4LNLA 4W5KA 1S08A 3JZLA 2Z20A 2EZ1A 3FZ8A 2Z9UA 4OT8A 4QGRA 2AY5A 1WYUB 2GQNA 3ATHA 1GC2A 1RV4A 2GB3A 3BWNC 5M4DA 2F8JA 5LHAA 2R5CA 2E54A 1B5OA 5KTBA 2VMPA 5EIGB 1QIRA 3AEMA 2C44A 1Z7DA 2W7LA 1VJOA 1WYVB 1CQ7A 3VP6A 4WB0B 3ECDA 4GE7A 1RVUA 1WYVA 3HDOA 3GETA 2HOXA 4UQVA 3PA9A 3AV7A 4CXRA 2AY1A 2D64A 1KMJA 1AJRA 2Q7WA 4WYEA 5EAVA 2VLHA 1CQ6A 1PMMA 3LVKA 3MC6C 1I41A 2JJEA 1BJWA 1UU0A 5EFSA 1LS3A 2VMXA 4XJLA 3VK4A 1TOKA 2AY7A 1EJIA 2D5YA 3QN6A 2QSRA 1X29A 1WKGA 5HDMA 4JE5A 2YRRA 4ZWVA 4AZJA 3RBLA 1D7RA 1FC4A 1W7MA 1MLZA 3RQ1A 3FFRA 2HP1A 2CJDA 4EU1A 1EQBA 2EH6A 1U08A 3DZZA 3E2FA 3FZ7A 4A6TA 1CL1A 4E3RA 1O69A 2FYFA 2W7MA 3USFA 3K28A 1D7SA 4JEXA 1QITA 2ZSMA 2VMYA 3A8UX 3MKJA 4K2MA 4Q6RA 4CVQA 2R2NA 1DJEA 2QMAA 3LWSA 1S0AA 1ASEA 1TASA 3FVSA 1V72A 5FT4A 2V1PA 4RM1A 3ZRQA 2CTZA 1G7WA 4WXGA 4ADDA 1T3IA 5DJ1A 3WKSA 1WSTA 3NRAA 2GSAA 1OHVA 2VMVA 2WK8A 3E2ZB 3NX3A 3N4RA 2JGTA 3FQAA 2PO3A 4LW4A 5FT8A 4L0OA 1G7XA 2AATA 4K2BA 4OTLA 2C7TA 3KE3A 2YKUA 4I8AA 1YAAA 5D5SA 3RBFA 1JS3A 2ZP7A 4IXSA 3BWOA 2XBNA 1KL1A 1AHGA 3BCAA 4IXZA 5C6UA 1LC7A 1AHYA 1KL2A 2HZPA 4WXBA 5M46A 5F8VA 2G6WA 1QISA 1AJSA 3MEBA 1GBNA 3BB8A 3FDDA 2WK7A 2ZUKA 1SPAA 1DGEA 3GZDA 2BI9A 1W7NA 2X3LA 3BC8A 1GDEA 1TOGA 3B1EA 1WYTB 2VGSA 3JTXA 3PJ0A 4F5FA 3DYDA 4A00A 4XQ2A 1N8PA 5IWQA 3R4TA 3UE8A 3BWNA 1O61A 4RITA 2BIAA 4EFFA 1LW5A 2W8VA 4J8LA 3EIAA 1AY4A 3ACZA 3GR9A 4E77A 3AEJA 3KKIA 1CL2A 1CJ0A 2DR1A 1AY8A 2FKIA 2VMSA 4RIZA 5K8BA 2EPJA 1ELQA 1Y4IA 2R0TA 1MAQA 2CFBA 4GEBA 4JF1A 4H63Q 3WGBA 2BI5A 2YKXA 1MLYA 2W7JA 4UHNA 4Y0DA 3WGCA 3MC6A 1ZC9A 1ORDA 1ARTA 2HUFA 4IYOB 2EGYA 2VMNA 5EQCA 4B9BA 3N7NA 4BA5A 2Z9WA 1DJUA 2DGMA 4Y0IA 3NNKA 2JJHA 3WCNA 3OP7A 2HOYA 1GCKA 4KYOA 4AO4A 4R2NA 2VGVA 4K2IA 1TPLA 3NYUA 3GSBA 1SFFA 2W7IA 1AMQA 3NU7A 1J32A 3COGA 2W8TA 3BCXA 3JU7A 3IHJA 3LY1A 4R5FA 1S07A 2VGTA 3NU8A 1ARHA 1GC3A 3BCBA 4WXFA 5M4BA 4MY5A 4BHDA 4TMRA 5BJ4A 1ASGA 1TOEA 2X5FA 1C7OA 4PFNA 4XEWA 3W1JA 5D95A 3UAKA 1TARA 1X0MA 2C0RA 2BKWA 3DR4A 1GC0A 4N0WA 2YCNA 2YKVA 1BS0A 2D65A 3NDNA 3QHXA 5DJ9A 2W7FA 1KKJA 4MKJA 2BI3A 1WYUA 3ISLA 1AMRA 4OBUA 1BT4A 2JG2A 2Z9VA 1YIZA 2OATA 3AEJC 3HVYA 5LH9A 4E3QA 1ASDA 2HUUA 5EIGA 3R9AA 3NYSA 4KXKA 3BV0A 1WKHA 3L8AA 2CB1A 2FQ6A 3AELA 4FL0A 2W8UA 1ASCA 3PPLA 4WB0A 4WYGA 3HL2A 1CZCA 2BI2A 1PG8A 5G09A 3FDBA 4WLHA 2DGLA 3CQ4A 1W7LA 5G0AA 3NUIA 2VMWA 3IF2A 4JEWA 2RFVA 1BJNA 2EO5A 4XJOA 3T32A 1C7GA 4PVFA 4O6ZA 3PD6B 2VGZA 4MQQA 4JE5D 4N0BA 3FD0A 4ATPA 1AY5A 3PD6A 3FQ7A 3AOVA 1ASBA 2CH2A 2DGKA 4GSAA 4DBCA 2BIEA 1W23A 3WZFA 4A0GA 4F5KA 1W3UA 2VMRA 1IBJA 2Z67A 1I29A 1OXPA 4F5IA 2VLFA 2CY8A 1C4KA 4ADEA 3B1CA 4W8IA 1PMOA 3EIBA 2CJGA 3ASBA 1YJYA 1AAWA 4MQRA 4M2KA 1UU2A 5G4JA 4XK1A 4CXQA 1B4XA 3PDBB 2ZY3A 4ZLVA 2PB0A 3EZ1A 3PDBA 3FFHA 1ASAA 3JWAA 1CQ8A 3E2ZA 3K40A 4OYTA 3N0LA 4P3MA 4WLJA 1KMKA 2AEUA 3EI5A 4JEZA 3N5MA 2HOZA 5F9SA 2OGAA 2AY2A 3FRKA 1AX4A 3TFTA 2R5EA 4R8DA 3NYTA 1MDZA 3AENB 4F5JA 1OATA 3DXVA 1MDXA 1LKCA 2W7EA 3PDXA 2Z1YA 3FVUA 4JF0A 4H51A 1DGDA 3DU4A 1D2FA 3LVMA 3G0TA 1ASNA 3ZRRA 2OKJA 5G2PA 1QJ3A 1M0QA 1YOOA 3ASAA 4RJYA 3BS8A 3E9KA 1ELUA 1DFOA 1G4XA 2OKKA 3FZ6A 4A0FA 1I43A 1Z3ZA 2O7CA 1M4NA 2AY8A 2QA3A 5BJ3A 1WYTA 3AEOA 4DQ6A 2KFPA 3G8MA 3MAFB 4M2MA 2AY9A 2FNUA 1DTYA 4WYFA 4ZSYA 4ZDPA 1I48A 3H14A 3HLMA 1BW0A 1ECXA 1JF9A 1M7YA 2AEVA 2BWNA 3K7YA 2VYCA 3DC1A 3RUYA 2GMUA 4ADCA 3W1IA 3WKRA 5FT6A 2E7IA 1AIBA 1SZKA 4J5UA 2CSTA 1M0PA 2C81A 4ZWMA 4HVKA 1V2EA 2BHXA 3EZSA 4OCAA 1AKAA 3I4JA 3B1DA 3MBBA 1SVVA 1D7VA 5E5IA 1MDOA 1QZ9A 1BJOB 2VMOA 3FQ8A 3E77A 4Q75A 1PFFA 2VI9A 4IYOA 1IX8A 2YRIA 2PB2A 3NUBA 1O4SA 1LC8A 2D61A 4NOGA 2FNIA 3RI6A 3OKSA 4GRXA 2G7JA 4R5ZA 4XJPA 3N4XA 4AH3A 3DXWA 4MKKA 1X2AA 4A0HA 1IUGA 4XAUA 1OHYA 2VMZA 1H1CA 2BIGA 3F0HA 3GBXA 5EUDA 1GC4A 3LVJA 2ORDA 1KKPA 1MAPA 2BWOA 1B9HA 5EAAA 3Q8NA 4U2HA 5HHYA 1IX6A 4Q31A 2A1VA 3H9XA 4WYDA 1XI9A 2YCPA 1B8GA 1OHWA 2ZY4A 3DRDA 3A2BA 1M32A 3PIUA 1X28A 3ZZJA 2X5DA 4IY7A 3L44A 2V0YA 4PIWA 3VK2A 4BQ0A 2BYLA 1CZEA 1FG3A 1BQDA 1AHXA 4F5HA 4HF8A 1UU1A 5DX5A 5EUNA 2D63A 4RAEA 1XEYA 2HUIA 2HORA 1VP4A 3F9TA 4TV7A 2W7GA 4UHOA 1AHEA 1OXOA 2GMSA 4ZAHA 3HBXA 2WKAA 3II0A 2WK9A 4RJ0A 5JAYA 1ASMA 2Z1ZA 3EI8A 4OBVA 4F5MA 3CQ5A 4ZDOA 1GEYA 3E6GA 3M5UA 3I16A 3FVXA 4BMKA 3CQ6A 4OMAA 4LW2A 1YJZA 4Q76A 1SF2A 1TATA 1MGVA 4ZASA 3LVLB 5EUEA 3ZRPA 2EYQA 4OC9A 3D6KA 3TCMA 2R5CB 4ADBA 3EI9A 3MAUA 4A0RA 3B46A 3VK3A 1S06A 2D7ZA 3FTBA 4F5LA 3GZCA 1D7UA 4P7YA 4WYAA 4A6RA 1RVYA 1IAXA 2CH1A 1GEWA 2YHKA 1JS6A 3CBFA 4WP0A 2AY4A 2D7YA 2O0RA 3FCRA 4CBRA 4A72A 4CBSA 1P3WA 2X8UA 2VMQA 2YKYA 3A9YA 5J8QA 2FM1A 3QI6A 2ZY5A 1AAMA 1M0NA 4GDYA 1LW4A 5M49A 4ITXA 1YIYA 1ZOBA 4FFCA 1N31A 4DGTA 2YCTA 3TATA 4TN4A 3W1HA 4ZM3A 1EG5A 2ZJGA 4B98A 3PAAA 1BKGA 3QM2A 1B9IA 3KGXA 4A6UA 4Y0HA 3DR7A 3WLXA 2FN6A 5G4IA 2ZYJA 4EB7A 1BQAA 4F5GA 2AY3A 1ARIA 2VMTA 5AX8A 1IJIA 3LV2A 4WYCA 2D66A 2HP2A 3KGWA 3TQXA 3NTJA 1IAYA 4MGRA 4ZM4A 4LC3A 3AENA 1DJ9A 1GD9A 2CANA 2EZ2A 2VI8A 2QLRA 2VMUA 1AIAA 3HT4A 9AATA 5G2QA 2QB3A 1ZODA 4IW7A 3JW9A 4AO9A 2NMPA 3EUCA 1E5FA 1V2FA 3VOMA 4F4EA 1AICA 5E3KA 1G4VA 3I5TA 1B5PA 1H0CA 3FSLA 1S09A 1C9CA 3E2YA 3JWBA 3P6KA 1BJ4A 3GJUA 2VIBA 3PGYA 1SZUA 4LNJA 2VGUA 4W1WA 4AOAA 2OQXA 3BN1A 3MAFA 3QGUA 3N75A 5DB5A 2VIAA 3A9XA 2AY6A 3AEMC 3A9ZA 2Z9XA 4UOYA 3N4SA 1ARSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJS B;  3MAD A;  2CIN A;  4IX8 A;  3WCO A;  1LC5 A;  4ZSW A;  1J04 A;  2VGW A;  3AAT A;  1DKA A;  3QPG A;  3EI7 A;  3ZZK A;  4BA4 A;  2JIS A;  1SZS A;  2W8J A;  3HQT A;  4JEV A;  1C7N A;  1E5E A;  1RV3 A;  4ITG A;  4W1V A;  4WBT A;  5FT5 A;  4EMY A;  1UKJ A;  3F6T A;  1BJO A;  3TFU A;  5TF5 A;  2DKJ A;  4RKD A;  4W1X A;  4W91 A;  5HXX A;  1JG8 A;  4IXO A;  1AHF A;  4ISY A;  2ZSL A;  3DOD A;  7AAT A;  3H7F A;  2W8W A;  4PFF A;  1V2D A;  3ELE A;  2JJG A;  1CS1 A;  8AAT A;  2Z61 A;  2E7U A;  1ARG A;  4AZK A;  3WX9 A;  2YOB A;  2DOU A;  2QB2 A;  4UHM A;  1O62 A;  4MSO A;  4JEY A;  1YJS A;  1M0O A;  1QGN A;  1QJ5 A;  2CJH A;  4KAM A;  1FG7 A;  3HMU A;  4RLG A;  3P1T A;  3B8X A;  2DKB A;  1AKC A;  3G7Q A;  3WY7 A;  2ZY2 A;  3QBO A;  4WD2 A;  4M2J A;  2E7J A;  4MQP A;  3LG0 A;  3FKD A;  4E1O A;  4XJM A;  1GEX A;  2BYJ A;  2BWP A;  4U1T A;  2W7H A;  1TOJ A;  2JJF A;  3VAX A;  5E4Z A;  2W7D A;  1LK9 A;  3AOW A;  3EI6 A;  2ZC0 A;  2OGE A;  1IVR A;  2BI1 A;  3UWC A;  1IX7 A;  1AMS A;  1ASF A;  1TOI A;  2QBT A;  4LNM A;  4EB5 A;  3ELP A;  1C0N A;  2TPL A;  1VEF A;  1N2T A;  2O1B A;  4GE4 A;  3RCH B;  4ATQ A;  4ZDL A;  1AKB A;  3CAI A;  1YNU A;  5I92 A;  4RKC A;  1AMA A;  3RCH A;  2XH1 A;  3GWP A;  3AEP A;  4GE9 A;  3GZD C;  1M6S A;  1ASL A;  2W7K A;  4LNL A;  4W5K A;  1S08 A;  3JZL A;  2Z20 A;  2EZ1 A;  3FZ8 A;  2Z9U A;  4OT8 A;  4QGR A;  2AY5 A;  1WYU B;  2GQN A;  3ATH A;  1GC2 A;  1RV4 A;  2GB3 A;  3BWN C;  5M4D A;  2F8J A;  5LHA A;  2R5C A;  2E54 A;  1B5O A;  2VMP A;  5EIG B;  1QIR A;  3AEM A;  2C44 A;  1Z7D A;  2W7L A;  1VJO A;  1WYV B;  1CQ7 A;  3VP6 A;  4WB0 B;  3ECD A;  4GE7 A;  1RVU A;  1WYV A;  3HDO A;  3GET A;  2HOX A;  4UQV A;  3PA9 A;  3AV7 A;  4CXR A;  2AY1 A;  2D64 A;  1KMJ A;  1AJR A;  2Q7W A;  4WYE A;  5EAV A;  2VLH A;  1CQ6 A;  1PMM A;  3LVK A;  3MC6 C;  1I41 A;  2JJE A;  1BJW A;  1UU0 A;  5EFS A;  1LS3 A;  2VMX A;  4XJL A;  3VK4 A;  1TOK A;  2AY7 A;  1EJI A;  2D5Y A;  3QN6 A;  1X29 A;  1WKG A;  5HDM A;  4JE5 A;  2YRR A;  4ZWV A;  4AZJ A;  3RBL A;  1D7R A;  1FC4 A;  1W7M A;  1MLZ A;  3RQ1 A;  3FFR A;  2HP1 A;  2CJD A;  4EU1 A;  1EQB A;  2EH6 A;  1U08 A;  3DZZ A;  3E2F A;  3FZ7 A;  4A6T A;  1CL1 A;  4E3R A;  1O69 A;  2FYF A;  2W7M A;  3USF A;  3K28 A;  1D7S A;  4JEX A;  1QIT A;  2ZSM A;  2VMY A;  3A8U X;  3MKJ A;  4K2M A;  4Q6R A;  4CVQ A;  2R2N A;  1DJE A;  2QMA A;  3LWS A;  1S0A A;  1ASE A;  1TAS A;  3FVS A;  1V72 A;  5FT4 A;  2V1P A;  4RM1 A;  3ZRQ A;  2CTZ A;  1G7W A;  4WXG A;  4ADD A;  1T3I A;  5DJ1 A;  3WKS A;  1WST A;  3NRA A;  2GSA A;  1OHV A;  2VMV A;  2WK8 A;  3E2Z B;  3NX3 A;  2JGT A;  3FQA A;  2PO3 A;  4LW4 A;  5FT8 A;  4L0O A;  1G7X A;  2AAT A;  4K2B A;  4OTL A;  2C7T A;  3KE3 A;  2YKU A;  4I8A A;  1YAA A;  5D5S A;  3RBF A;  1JS3 A;  2ZP7 A;  4IXS A;  3BWO A;  2XBN A;  1KL1 A;  1AHG A;  3BCA A;  4IXZ A;  5C6U A;  1LC7 A;  1AHY A;  1KL2 A;  2HZP A;  4WXB A;  5M46 A;  5F8V A;  2G6W A;  1QIS A;  1AJS A;  3MEB A;  1GBN A;  3BB8 A;  3FDD A;  2WK7 A;  2ZUK A;  1SPA A;  1DGE A;  3GZD A;  2BI9 A;  1W7N A;  2X3L A;  3BC8 A;  1GDE A;  1TOG A;  3B1E A;  1WYT B;  2VGS A;  3JTX A;  3PJ0 A;  4F5F A;  3DYD A;  4A00 A;  4XQ2 A;  1N8P A;  5IWQ A;  3R4T A;  3UE8 A;  3BWN A;  1O61 A;  4RIT A;  2BIA A;  4EFF A;  1LW5 A;  2W8V A;  4J8L A;  3EIA A;  1AY4 A;  3ACZ A;  3GR9 A;  4E77 A;  3AEJ A;  3KKI A;  1CL2 A;  1CJ0 A;  2DR1 A;  1AY8 A;  2VMS A;  4RIZ A;  5K8B A;  2EPJ A;  1ELQ A;  1Y4I A;  2R0T A;  1MAQ A;  2CFB A;  4GEB A;  4JF1 A;  3WGB A;  2BI5 A;  2YKX A;  1MLY A;  2W7J A;  4UHN A;  4Y0D A;  3WGC A;  3MC6 A;  1ZC9 A;  1ORD A;  1ART A;  2HUF A;  4IYO B;  2EGY A;  2VMN A;  5EQC A;  4B9B A;  4BA5 A;  2Z9W A;  1DJU A;  2DGM A;  4Y0I A;  3NNK A;  2JJH A;  3WCN A;  3OP7 A;  2HOY A;  1GCK A;  4KYO A;  4AO4 A;  4R2N A;  2VGV A;  4K2I A;  1TPL A;  3NYU A;  3GSB A;  1SFF A;  2W7I A;  1AMQ A;  3NU7 A;  1J32 A;  3COG A;  2W8T A;  3BCX A;  3JU7 A;  3IHJ A;  3LY1 A;  4R5F A;  1S07 A;  2VGT A;  3NU8 A;  1ARH A;  1GC3 A;  3BCB A;  4WXF A;  5M4B A;  4MY5 A;  4BHD A;  4TMR A;  5BJ4 A;  1ASG A;  1TOE A;  2X5F A;  1C7O A;  4PFN A;  4XEW A;  3W1J A;  5D95 A;  3UAK A;  1TAR A;  1X0M A;  2C0R A;  2BKW A;  3DR4 A;  1GC0 A;  4N0W A;  2YCN A;  2YKV A;  1BS0 A;  2D65 A;  3NDN A;  3QHX A;  5DJ9 A;  2W7F A;  1KKJ A;  4MKJ A;  2BI3 A;  1WYU A;  3ISL A;  1AMR A;  4OBU A;  1BT4 A;  2JG2 A;  2Z9V A;  1YIZ A;  2OAT A;  3AEJ C;  3HVY A;  5LH9 A;  4E3Q A;  1ASD A;  2HUU A;  5EIG A;  3R9A A;  3NYS A;  4KXK A;  3BV0 A;  1WKH A;  3L8A A;  2CB1 A;  2FQ6 A;  3AEL A;  4FL0 A;  2W8U A;  1ASC A;  3PPL A;  4WB0 A;  4WYG A;  3HL2 A;  1CZC A;  2BI2 A;  1PG8 A;  5G09 A;  3FDB A;  4WLH A;  2DGL A;  3CQ4 A;  1W7L A;  5G0A A;  3NUI A;  2VMW A;  3IF2 A;  4JEW A;  2RFV A;  1BJN A;  2EO5 A;  4XJO A;  3T32 A;  1C7G A;  4PVF A;  4O6Z A;  3PD6 B;  2VGZ A;  4MQQ A;  4JE5 D;  4N0B A;  3FD0 A;  4ATP A;  1AY5 A;  3PD6 A;  3FQ7 A;  3AOV A;  1ASB A;  2CH2 A;  2DGK A;  4GSA A;  4DBC A;  2BIE A;  1W23 A;  3WZF A;  4A0G A;  4F5K A;  1W3U A;  2VMR A;  1IBJ A;  2Z67 A;  1I29 A;  1OXP A;  4F5I A;  2VLF A;  2CY8 A;  1C4K A;  4ADE A;  3B1C A;  4W8I A;  1PMO A;  3EIB A;  2CJG A;  3ASB A;  1YJY A;  1AAW A;  4MQR A;  4M2K A;  1UU2 A;  5G4J A;  4XK1 A;  4CXQ A;  1B4X A;  3PDB B;  2ZY3 A;  4ZLV A;  2PB0 A;  3EZ1 A;  3PDB A;  3FFH A;  1ASA A;  3JWA A;  1CQ8 A;  3E2Z A;  3K40 A;  4OYT A;  3N0L A;  4P3M A;  4WLJ A;  1KMK A;  2AEU A;  3EI5 A;  4JEZ A;  3N5M A;  2HOZ A;  5F9S A;  2OGA A;  2AY2 A;  3FRK A;  1AX4 A;  3TFT A;  2R5E A;  4R8D A;  3NYT A;  1MDZ A;  3AEN B;  4F5J A;  1OAT A;  3DXV A;  1MDX A;  1LKC A;  2W7E A;  3PDX A;  2Z1Y A;  3FVU A;  4JF0 A;  4H51 A;  1DGD A;  3DU4 A;  1D2F A;  3LVM A;  3G0T A;  1ASN A;  3ZRR A;  2OKJ A;  5G2P A;  1QJ3 A;  1M0Q A;  1YOO A;  3ASA A;  4RJY A;  3BS8 A;  3E9K A;  1ELU A;  1DFO A;  1G4X A;  2OKK A;  3FZ6 A;  4A0F A;  1I43 A;  1Z3Z A;  2O7C A;  1M4N A;  2AY8 A;  2QA3 A;  5BJ3 A;  1WYT A;  3AEO A;  4DQ6 A;  3G8M A;  3MAF B;  4M2M A;  2AY9 A;  2FNU A;  1DTY A;  4WYF A;  4ZSY A;  4ZDP A;  1I48 A;  3H14 A;  3HLM A;  1BW0 A;  1ECX A;  1JF9 A;  1M7Y A;  2AEV A;  2BWN A;  3K7Y A;  2VYC A;  3DC1 A;  3RUY A;  2GMU A;  4ADC A;  3W1I A;  3WKR A;  5FT6 A;  2E7I A;  1AIB A;  1SZK A;  4J5U A;  2CST A;  1M0P A;  2C81 A;  4ZWM A;  4HVK A;  1V2E A;  2BHX A;  3EZS A;  4OCA A;  1AKA A;  3I4J A;  3B1D A;  3MBB A;  1SVV A;  1D7V A;  5E5I A;  1MDO A;  1QZ9 A;  1BJO B;  2VMO A;  3FQ8 A;  3E77 A;  4Q75 A;  1PFF A;  2VI9 A;  4IYO A;  1IX8 A;  2YRI A;  2PB2 A;  3NUB A;  1O4S A;  1LC8 A;  2D61 A;  4NOG A;  2FNI A;  3RI6 A;  3OKS A;  4GRX A;  4R5Z A;  4XJP A;  4AH3 A;  3DXW A;  4MKK A;  1X2A A;  4A0H A;  1IUG A;  4XAU A;  1OHY A;  2VMZ A;  1H1C A;  2BIG A;  3F0H A;  3GBX A;  5EUD A;  1GC4 A;  3LVJ A;  2ORD A;  1KKP A;  1MAP A;  2BWO A;  1B9H A;  5EAA A;  3Q8N A;  4U2H A;  5HHY A;  1IX6 A;  4Q31 A;  4WYD A;  1XI9 A;  2YCP A;  1B8G A;  1OHW A;  2ZY4 A;  3DRD A;  3A2B A;  1M32 A;  3PIU A;  1X28 A;  3ZZJ A;  2X5D A;  4IY7 A;  3L44 A;  2V0Y A;  4PIW A;  3VK2 A;  4BQ0 A;  2BYL A;  1CZE A;  1FG3 A;  1BQD A;  1AHX A;  4F5H A;  4HF8 A;  1UU1 A;  5DX5 A;  5EUN A;  2D63 A;  4RAE A;  1XEY A;  2HUI A;  2HOR A;  1VP4 A;  3F9T A;  4TV7 A;  2W7G A;  4UHO A;  1AHE A;  1OXO A;  2GMS A;  4ZAH A;  3HBX A;  2WKA A;  3II0 A;  2WK9 A;  4RJ0 A;  5JAY A;  1ASM A;  2Z1Z A;  3EI8 A;  4OBV A;  4F5M A;  3CQ5 A;  4ZDO A;  1GEY A;  3E6G A;  3M5U A;  3I16 A;  3FVX A;  4BMK A;  3CQ6 A;  4OMA A;  4LW2 A;  1YJZ A;  4Q76 A;  1SF2 A;  1TAT A;  1MGV A;  4ZAS A;  3LVL B;  5EUE A;  3ZRP A;  4OC9 A;  3D6K A;  3TCM A;  2R5C B;  4ADB A;  3EI9 A;  3MAU A;  4A0R A;  3B46 A;  3VK3 A;  1S06 A;  2D7Z A;  3FTB A;  4F5L A;  3GZC A;  1D7U A;  4P7Y A;  4WYA A;  4A6R A;  1RVY A;  1IAX A;  2CH1 A;  1GEW A;  2YHK A;  1JS6 A;  3CBF A;  4WP0 A;  2AY4 A;  2D7Y A;  2O0R A;  3FCR A;  4CBR A;  4A72 A;  4CBS A;  1P3W A;  2X8U A;  2VMQ A;  2YKY A;  3A9Y A;  5J8Q A;  2FM1 A;  3QI6 A;  2ZY5 A;  1AAM A;  1M0N A;  4GDY A;  1LW4 A;  5M49 A;  4ITX A;  1YIY A;  1ZOB A;  4FFC A;  1N31 A;  4DGT A;  2YCT A;  3TAT A;  4TN4 A;  3W1H A;  4ZM3 A;  1EG5 A;  2ZJG A;  4B98 A;  3PAA A;  1BKG A;  3QM2 A;  1B9I A;  3KGX A;  4A6U A;  4Y0H A;  3DR7 A;  3WLX A;  2FN6 A;  5G4I A;  2ZYJ A;  4EB7 A;  1BQA A;  4F5G A;  2AY3 A;  1ARI A;  2VMT A;  5AX8 A;  1IJI A;  3LV2 A;  4WYC A;  2D66 A;  2HP2 A;  3KGW A;  3TQX A;  3NTJ A;  1IAY A;  4MGR A;  4ZM4 A;  4LC3 A;  3AEN A;  1DJ9 A;  1GD9 A;  2CAN A;  2EZ2 A;  2VI8 A;  2QLR A;  2VMU A;  1AIA A;  3HT4 A;  9AAT A;  5G2Q A;  2QB3 A;  1ZOD A;  4IW7 A;  3JW9 A;  4AO9 A;  2NMP A;  3EUC A;  1E5F A;  1V2F A;  3VOM A;  4F4E A;  1AIC A;  5E3K A;  1G4V A;  3I5T A;  1B5P A;  1H0C A;  3FSL A;  1S09 A;  1C9C A;  3E2Y A;  3JWB A;  3P6K A;  1BJ4 A;  3GJU A;  2VIB A;  3PGY A;  1SZU A;  4LNJ A;  2VGU A;  4W1W A;  4AOA A;  2OQX A;  3BN1 A;  3MAF A;  3QGU A;  3N75 A;  5DB5 A;  2VIA A;  3A9X A;  2AY6 A;  3AEM C;  3A9Z A;  2Z9X A;  4UOY A;  1ARS A; 
#chains in the Genus database with same CATH topology
 1AJS B;  3MAD A;  2CIN A;  4IX8 A;  3WCO A;  1LC5 A;  4ZSW A;  1J04 A;  2VGW A;  3AAT A;  1DKA A;  3QPG A;  3EI7 A;  3ZZK A;  4BA4 A;  2JIS A;  1SZS A;  2W8J A;  3HQT A;  4JEV A;  1C7N A;  1E5E A;  1RV3 A;  4ITG A;  4W1V A;  4WBT A;  5FT5 A;  4EMY A;  1UKJ A;  3F6T A;  1BJO A;  3TFU A;  5TF5 A;  2DKJ A;  4RKD A;  4W1X A;  4W91 A;  5HXX A;  1JG8 A;  4IXO A;  1AHF A;  4ISY A;  2ZSL A;  3DOD A;  7AAT A;  3H7F A;  2W8W A;  4PFF A;  1V2D A;  3ELE A;  2JJG A;  1CS1 A;  8AAT A;  2Z61 A;  2E7U A;  1ARG A;  4AZK A;  3WX9 A;  2YOB A;  2WB6 A;  2DOU A;  2QB2 A;  4UHM A;  1O62 A;  4MSO A;  4JEY A;  1YJS A;  1M0O A;  1QGN A;  1QJ5 A;  2CJH A;  4KAM A;  1FG7 A;  3HMU A;  4RLG A;  3P1T A;  3B8X A;  2DKB A;  1AKC A;  3G7Q A;  3WY7 A;  2ZY2 A;  3QBO A;  4WD2 A;  4M2J A;  2E7J A;  4MQP A;  3LG0 A;  3FKD A;  4E1O A;  4XJM A;  1GEX A;  2BYJ A;  2BWP A;  4U1T A;  4K05 A;  2W7H A;  1TOJ A;  2JJF A;  3VAX A;  5E4Z A;  2W7D A;  1LK9 A;  3AOW A;  3EI6 A;  2ZC0 A;  2OGE A;  1IVR A;  2BI1 A;  3UWC A;  1IX7 A;  1AMS A;  1ASF A;  1TOI A;  2QBT A;  4LNM A;  4EB5 A;  3ELP A;  1C0N A;  2TPL A;  1VEF A;  1N2T A;  2O1B A;  4GE4 A;  3RCH B;  4ATQ A;  4ZDL A;  1AKB A;  3CAI A;  1YNU A;  5I92 A;  4RKC A;  1AMA A;  3RCH A;  2XH1 A;  3GWP A;  3AEP A;  4GE9 A;  3GZD C;  1M6S A;  1ASL A;  2W7K A;  4LNL A;  4W5K A;  1S08 A;  3JZL A;  2Z20 A;  2EZ1 A;  3FZ8 A;  2Z9U A;  4OT8 A;  4QGR A;  2AY5 A;  1WYU B;  2GQN A;  3ATH A;  1GC2 A;  1RV4 A;  2GB3 A;  3BWN C;  5M4D A;  2F8J A;  5LHA A;  2R5C A;  2E54 A;  1B5O A;  5KTB A;  2VMP A;  5EIG B;  1QIR A;  3AEM A;  2C44 A;  1Z7D A;  2W7L A;  1VJO A;  1WYV B;  1CQ7 A;  3VP6 A;  4WB0 B;  3ECD A;  4GE7 A;  1RVU A;  1WYV A;  3HDO A;  3GET A;  2HOX A;  4UQV A;  3PA9 A;  3AV7 A;  4CXR A;  2AY1 A;  2D64 A;  1KMJ A;  1AJR A;  2Q7W A;  4WYE A;  5EAV A;  2VLH A;  1CQ6 A;  1PMM A;  3LVK A;  3MC6 C;  1I41 A;  2JJE A;  1BJW A;  1UU0 A;  5EFS A;  1LS3 A;  2VMX A;  4XJL A;  3VK4 A;  1KAF A;  1TOK A;  2AY7 A;  1EJI A;  2D5Y A;  3QN6 A;  2QSR A;  1X29 A;  1WKG A;  5HDM A;  4JE5 A;  2YRR A;  4ZWV A;  4AZJ A;  3RBL A;  1D7R A;  1FC4 A;  1W7M A;  1MLZ A;  3RQ1 A;  3FFR A;  2HP1 A;  2CJD A;  4EU1 A;  1EQB A;  2EH6 A;  1U08 A;  3DZZ A;  3E2F A;  3FZ7 A;  4A6T A;  1CL1 A;  4E3R A;  1O69 A;  2FYF A;  2W7M A;  3USF A;  3K28 A;  1D7S A;  4JEX A;  1QIT A;  2ZSM A;  2VMY A;  3A8U X;  3MKJ A;  4K2M A;  4Q6R A;  4CVQ A;  2R2N A;  1DJE A;  2QMA A;  3LWS A;  1S0A A;  1ASE A;  1TAS A;  3FVS A;  1V72 A;  5FT4 A;  2V1P A;  4RM1 A;  3ZRQ A;  2CTZ A;  1G7W A;  4WXG A;  4ADD A;  1T3I A;  5DJ1 A;  3WKS A;  1WST A;  3NRA A;  2GSA A;  1OHV A;  2VMV A;  2WK8 A;  3E2Z B;  3NX3 A;  3N4R A;  2JGT A;  3FQA A;  2PO3 A;  4LW4 A;  5FT8 A;  4L0O A;  1G7X A;  2AAT A;  4K2B A;  4OTL A;  2C7T A;  3KE3 A;  2YKU A;  4I8A A;  1YAA A;  5D5S A;  3RBF A;  1JS3 A;  2ZP7 A;  4IXS A;  3BWO A;  2XBN A;  1KL1 A;  1AHG A;  3BCA A;  4IXZ A;  5C6U A;  1LC7 A;  1AHY A;  1KL2 A;  2HZP A;  4WXB A;  5M46 A;  5F8V A;  2G6W A;  1QIS A;  1AJS A;  3MEB A;  1GBN A;  3BB8 A;  3FDD A;  2WK7 A;  2ZUK A;  1SPA A;  1DGE A;  3GZD A;  2BI9 A;  1W7N A;  2X3L A;  3BC8 A;  1GDE A;  1TOG A;  3B1E A;  1WYT B;  2VGS A;  3JTX A;  3PJ0 A;  4F5F A;  3DYD A;  4A00 A;  4XQ2 A;  1N8P A;  5IWQ A;  3R4T A;  3UE8 A;  3BWN A;  1O61 A;  4RIT A;  2BIA A;  4EFF A;  1LW5 A;  2W8V A;  4J8L A;  3EIA A;  1AY4 A;  3ACZ A;  3GR9 A;  4E77 A;  3AEJ A;  3KKI A;  1CL2 A;  1CJ0 A;  2DR1 A;  1AY8 A;  2FKI A;  2VMS A;  4RIZ A;  5K8B A;  2EPJ A;  1ELQ A;  1Y4I A;  2R0T A;  1MAQ A;  2CFB A;  4GEB A;  4JF1 A;  4H63 Q;  3WGB A;  2BI5 A;  2YKX A;  1MLY A;  2W7J A;  4UHN A;  4Y0D A;  3WGC A;  3MC6 A;  1ZC9 A;  1ORD A;  1ART A;  2HUF A;  4IYO B;  2EGY A;  2VMN A;  5EQC A;  4B9B A;  3N7N A;  4BA5 A;  2Z9W A;  1DJU A;  2DGM A;  4Y0I A;  3NNK A;  2JJH A;  3WCN A;  3OP7 A;  2HOY A;  1GCK A;  4KYO A;  4AO4 A;  4R2N A;  2VGV A;  4K2I A;  1TPL A;  3NYU A;  3GSB A;  1SFF A;  2W7I A;  1AMQ A;  3NU7 A;  1J32 A;  3COG A;  2W8T A;  3BCX A;  3JU7 A;  3IHJ A;  3LY1 A;  4R5F A;  1S07 A;  2VGT A;  3NU8 A;  1ARH A;  1GC3 A;  3BCB A;  4WXF A;  5M4B A;  4MY5 A;  4BHD A;  4TMR A;  5BJ4 A;  1ASG A;  1TOE A;  2X5F A;  1C7O A;  4PFN A;  4XEW A;  3W1J A;  5D95 A;  3UAK A;  1TAR A;  1X0M A;  2C0R A;  2BKW A;  3DR4 A;  1GC0 A;  4N0W A;  2YCN A;  2YKV A;  1BS0 A;  2D65 A;  3NDN A;  3QHX A;  5DJ9 A;  2W7F A;  1KKJ A;  4MKJ A;  2BI3 A;  1WYU A;  3ISL A;  1AMR A;  4OBU A;  1BT4 A;  2JG2 A;  2Z9V A;  1YIZ A;  2OAT A;  3AEJ C;  3HVY A;  5LH9 A;  4E3Q A;  1ASD A;  2HUU A;  5EIG A;  3R9A A;  3NYS A;  4KXK A;  3BV0 A;  1WKH A;  3L8A A;  2CB1 A;  2FQ6 A;  3AEL A;  4FL0 A;  2W8U A;  1ASC A;  3PPL A;  4WB0 A;  4WYG A;  3HL2 A;  1CZC A;  2BI2 A;  1PG8 A;  5G09 A;  3FDB A;  4WLH A;  2DGL A;  3CQ4 A;  1W7L A;  5G0A A;  3NUI A;  2VMW A;  3IF2 A;  4JEW A;  2RFV A;  1BJN A;  2EO5 A;  4XJO A;  3T32 A;  1C7G A;  4PVF A;  4O6Z A;  3PD6 B;  2VGZ A;  4MQQ A;  4JE5 D;  4N0B A;  3FD0 A;  4ATP A;  1AY5 A;  3PD6 A;  3FQ7 A;  3AOV A;  1ASB A;  2CH2 A;  2DGK A;  4GSA A;  4DBC A;  2BIE A;  1W23 A;  3WZF A;  4A0G A;  4F5K A;  1W3U A;  2VMR A;  1IBJ A;  2Z67 A;  1I29 A;  1OXP A;  4F5I A;  2VLF A;  2CY8 A;  1C4K A;  4ADE A;  3B1C A;  4W8I A;  1PMO A;  3EIB A;  2CJG A;  3ASB A;  1YJY A;  1AAW A;  4MQR A;  4M2K A;  1UU2 A;  5G4J A;  4XK1 A;  4CXQ A;  1B4X A;  3PDB B;  2ZY3 A;  4ZLV A;  2PB0 A;  3EZ1 A;  3PDB A;  3FFH A;  1ASA A;  3JWA A;  1CQ8 A;  3E2Z A;  3K40 A;  4OYT A;  3N0L A;  4P3M A;  4WLJ A;  1KMK A;  2AEU A;  3EI5 A;  4JEZ A;  3N5M A;  2HOZ A;  5F9S A;  2OGA A;  2AY2 A;  3FRK A;  1AX4 A;  3TFT A;  2R5E A;  4R8D A;  3NYT A;  1MDZ A;  3AEN B;  4F5J A;  1OAT A;  3DXV A;  1MDX A;  1LKC A;  2W7E A;  3PDX A;  2Z1Y A;  3FVU A;  4JF0 A;  4H51 A;  1DGD A;  3DU4 A;  1D2F A;  3LVM A;  3G0T A;  1ASN A;  3ZRR A;  2OKJ A;  5G2P A;  1QJ3 A;  1M0Q A;  1YOO A;  3ASA A;  4RJY A;  3BS8 A;  3E9K A;  1ELU A;  1DFO A;  1G4X A;  2OKK A;  3FZ6 A;  4A0F A;  1I43 A;  1Z3Z A;  2O7C A;  1M4N A;  2AY8 A;  2QA3 A;  5BJ3 A;  1WYT A;  3AEO A;  4DQ6 A;  2KFP A;  3G8M A;  3MAF B;  4M2M A;  2AY9 A;  2FNU A;  1DTY A;  4WYF A;  4ZSY A;  4ZDP A;  1I48 A;  3H14 A;  3HLM A;  1BW0 A;  1ECX A;  1JF9 A;  1M7Y A;  2AEV A;  2BWN A;  3K7Y A;  2VYC A;  3DC1 A;  3RUY A;  2GMU A;  4ADC A;  3W1I A;  3WKR A;  5FT6 A;  2E7I A;  1AIB A;  1SZK A;  4J5U A;  2CST A;  1M0P A;  2C81 A;  4ZWM A;  4HVK A;  1V2E A;  2BHX A;  3EZS A;  4OCA A;  1AKA A;  3I4J A;  3B1D A;  3MBB A;  1SVV A;  1D7V A;  5E5I A;  1MDO A;  1QZ9 A;  1BJO B;  2VMO A;  3FQ8 A;  3E77 A;  4Q75 A;  1PFF A;  2VI9 A;  4IYO A;  1IX8 A;  2YRI A;  2PB2 A;  3NUB A;  1O4S A;  1LC8 A;  2D61 A;  4NOG A;  2FNI A;  3RI6 A;  3OKS A;  4GRX A;  2G7J A;  4R5Z A;  4XJP A;  3N4X A;  4AH3 A;  3DXW A;  4MKK A;  1X2A A;  4A0H A;  1IUG A;  4XAU A;  1OHY A;  2VMZ A;  1H1C A;  2BIG A;  3F0H A;  3GBX A;  5EUD A;  1GC4 A;  3LVJ A;  2ORD A;  1KKP A;  1MAP A;  2BWO A;  1B9H A;  5EAA A;  3Q8N A;  4U2H A;  5HHY A;  1IX6 A;  4Q31 A;  2A1V A;  3H9X A;  4WYD A;  1XI9 A;  2YCP A;  1B8G A;  1OHW A;  2ZY4 A;  3DRD A;  3A2B A;  1M32 A;  3PIU A;  1X28 A;  3ZZJ A;  2X5D A;  4IY7 A;  3L44 A;  2V0Y A;  4PIW A;  3VK2 A;  4BQ0 A;  2BYL A;  1CZE A;  1FG3 A;  1BQD A;  1AHX A;  4F5H A;  4HF8 A;  1UU1 A;  5DX5 A;  5EUN A;  2D63 A;  4RAE A;  1XEY A;  2HUI A;  2HOR A;  1VP4 A;  3F9T A;  4TV7 A;  2W7G A;  4UHO A;  1AHE A;  1OXO A;  2GMS A;  4ZAH A;  3HBX A;  2WKA A;  3II0 A;  2WK9 A;  4RJ0 A;  5JAY A;  1ASM A;  2Z1Z A;  3EI8 A;  4OBV A;  4F5M A;  3CQ5 A;  4ZDO A;  1GEY A;  3E6G A;  3M5U A;  3I16 A;  3FVX A;  4BMK A;  3CQ6 A;  4OMA A;  4LW2 A;  1YJZ A;  4Q76 A;  1SF2 A;  1TAT A;  1MGV A;  4ZAS A;  3LVL B;  5EUE A;  3ZRP A;  2EYQ A;  4OC9 A;  3D6K A;  3TCM A;  2R5C B;  4ADB A;  3EI9 A;  3MAU A;  4A0R A;  3B46 A;  3VK3 A;  1S06 A;  2D7Z A;  3FTB A;  4F5L A;  3GZC A;  1D7U A;  4P7Y A;  4WYA A;  4A6R A;  1RVY A;  1IAX A;  2CH1 A;  1GEW A;  2YHK A;  1JS6 A;  3CBF A;  4WP0 A;  2AY4 A;  2D7Y A;  2O0R A;  3FCR A;  4CBR A;  4A72 A;  4CBS A;  1P3W A;  2X8U A;  2VMQ A;  2YKY A;  3A9Y A;  5J8Q A;  2FM1 A;  3QI6 A;  2ZY5 A;  1AAM A;  1M0N A;  4GDY A;  1LW4 A;  5M49 A;  4ITX A;  1YIY A;  1ZOB A;  4FFC A;  1N31 A;  4DGT A;  2YCT A;  3TAT A;  4TN4 A;  3W1H A;  4ZM3 A;  1EG5 A;  2ZJG A;  4B98 A;  3PAA A;  1BKG A;  3QM2 A;  1B9I A;  3KGX A;  4A6U A;  4Y0H A;  3DR7 A;  3WLX A;  2FN6 A;  5G4I A;  2ZYJ A;  4EB7 A;  1BQA A;  4F5G A;  2AY3 A;  1ARI A;  2VMT A;  5AX8 A;  1IJI A;  3LV2 A;  4WYC A;  2D66 A;  2HP2 A;  3KGW A;  3TQX A;  3NTJ A;  1IAY A;  4MGR A;  4ZM4 A;  4LC3 A;  3AEN A;  1DJ9 A;  1GD9 A;  2CAN A;  2EZ2 A;  2VI8 A;  2QLR A;  2VMU A;  1AIA A;  3HT4 A;  9AAT A;  5G2Q A;  2QB3 A;  1ZOD A;  4IW7 A;  3JW9 A;  4AO9 A;  2NMP A;  3EUC A;  1E5F A;  1V2F A;  3VOM A;  4F4E A;  1AIC A;  5E3K A;  1G4V A;  3I5T A;  1B5P A;  1H0C A;  3FSL A;  1S09 A;  1C9C A;  3E2Y A;  3JWB A;  3P6K A;  1BJ4 A;  3GJU A;  2VIB A;  3PGY A;  1SZU A;  4LNJ A;  2VGU A;  4W1W A;  4AOA A;  2OQX A;  3BN1 A;  3MAF A;  3QGU A;  3N75 A;  5DB5 A;  2VIA A;  3A9X A;  2AY6 A;  3AEM C;  3A9Z A;  2Z9X A;  4UOY A;  3N4S A;  1ARS A; 
#chains in the Genus database with same CATH homology
 1AJS B;  3MAD A;  2CIN A;  4IX8 A;  3WCO A;  1LC5 A;  4ZSW A;  1J04 A;  2VGW A;  3AAT A;  1DKA A;  3QPG A;  3EI7 A;  3ZZK A;  4BA4 A;  2JIS A;  1SZS A;  2W8J A;  3HQT A;  4JEV A;  1C7N A;  1E5E A;  1RV3 A;  4ITG A;  4W1V A;  4WBT A;  5FT5 A;  4EMY A;  1UKJ A;  3F6T A;  1BJO A;  3TFU A;  5TF5 A;  2DKJ A;  4RKD A;  4W1X A;  4W91 A;  5HXX A;  1JG8 A;  4IXO A;  1AHF A;  4ISY A;  2ZSL A;  3DOD A;  7AAT A;  3H7F A;  2W8W A;  4PFF A;  1V2D A;  3ELE A;  2JJG A;  1CS1 A;  8AAT A;  2Z61 A;  2E7U A;  1ARG A;  4AZK A;  3WX9 A;  2YOB A;  2WB6 A;  2DOU A;  2QB2 A;  4UHM A;  1O62 A;  4MSO A;  4JEY A;  1YJS A;  1M0O A;  1QGN A;  1QJ5 A;  2CJH A;  4KAM A;  1FG7 A;  3HMU A;  4RLG A;  3P1T A;  3B8X A;  2DKB A;  1AKC A;  3G7Q A;  3WY7 A;  2ZY2 A;  3QBO A;  4WD2 A;  4M2J A;  2E7J A;  4MQP A;  3LG0 A;  3FKD A;  4E1O A;  4XJM A;  1GEX A;  2BYJ A;  2BWP A;  4U1T A;  4K05 A;  2W7H A;  1TOJ A;  2JJF A;  3VAX A;  5E4Z A;  2W7D A;  1LK9 A;  3AOW A;  3EI6 A;  2ZC0 A;  2OGE A;  1IVR A;  2BI1 A;  3UWC A;  1IX7 A;  1AMS A;  1ASF A;  1TOI A;  2QBT A;  4LNM A;  4EB5 A;  3ELP A;  1C0N A;  2TPL A;  1VEF A;  1N2T A;  2O1B A;  4GE4 A;  3RCH B;  4ATQ A;  4ZDL A;  1AKB A;  3CAI A;  1YNU A;  5I92 A;  4RKC A;  1AMA A;  3RCH A;  2XH1 A;  3GWP A;  3AEP A;  4GE9 A;  3GZD C;  1M6S A;  1ASL A;  2W7K A;  4LNL A;  4W5K A;  1S08 A;  3JZL A;  2Z20 A;  2EZ1 A;  3FZ8 A;  2Z9U A;  4OT8 A;  4QGR A;  2AY5 A;  1WYU B;  2GQN A;  3ATH A;  1GC2 A;  1RV4 A;  2GB3 A;  3BWN C;  5M4D A;  2F8J A;  5LHA A;  2R5C A;  2E54 A;  1B5O A;  5KTB A;  2VMP A;  5EIG B;  1QIR A;  3AEM A;  2C44 A;  1Z7D A;  2W7L A;  1VJO A;  1WYV B;  1CQ7 A;  3VP6 A;  4WB0 B;  3ECD A;  4GE7 A;  1RVU A;  1WYV A;  3HDO A;  3GET A;  2HOX A;  4UQV A;  3PA9 A;  3AV7 A;  4CXR A;  2AY1 A;  2D64 A;  1KMJ A;  1AJR A;  2Q7W A;  4WYE A;  5EAV A;  2VLH A;  1CQ6 A;  1PMM A;  3LVK A;  3MC6 C;  1I41 A;  2JJE A;  1BJW A;  1UU0 A;  5EFS A;  1LS3 A;  2VMX A;  4XJL A;  3VK4 A;  1TOK A;  2AY7 A;  1EJI A;  2D5Y A;  3QN6 A;  2QSR A;  1X29 A;  1WKG A;  5HDM A;  4JE5 A;  2YRR A;  4ZWV A;  4AZJ A;  3RBL A;  1D7R A;  1FC4 A;  1W7M A;  1MLZ A;  3RQ1 A;  3FFR A;  2HP1 A;  2CJD A;  4EU1 A;  1EQB A;  2EH6 A;  1U08 A;  3DZZ A;  3E2F A;  3FZ7 A;  4A6T A;  1CL1 A;  4E3R A;  1O69 A;  2FYF A;  2W7M A;  3USF A;  3K28 A;  1D7S A;  4JEX A;  1QIT A;  2ZSM A;  2VMY A;  3A8U X;  3MKJ A;  4K2M A;  4Q6R A;  4CVQ A;  2R2N A;  1DJE A;  2QMA A;  3LWS A;  1S0A A;  1ASE A;  1TAS A;  3FVS A;  1V72 A;  5FT4 A;  2V1P A;  4RM1 A;  3ZRQ A;  2CTZ A;  1G7W A;  4WXG A;  4ADD A;  1T3I A;  5DJ1 A;  3WKS A;  1WST A;  3NRA A;  2GSA A;  1OHV A;  2VMV A;  2WK8 A;  3E2Z B;  3NX3 A;  3N4R A;  2JGT A;  3FQA A;  2PO3 A;  4LW4 A;  5FT8 A;  4L0O A;  1G7X A;  2AAT A;  4K2B A;  4OTL A;  2C7T A;  3KE3 A;  2YKU A;  4I8A A;  1YAA A;  5D5S A;  3RBF A;  1JS3 A;  2ZP7 A;  4IXS A;  3BWO A;  2XBN A;  1KL1 A;  1AHG A;  3BCA A;  4IXZ A;  5C6U A;  1LC7 A;  1AHY A;  1KL2 A;  2HZP A;  4WXB A;  5M46 A;  5F8V A;  2G6W A;  1QIS A;  1AJS A;  3MEB A;  1GBN A;  3BB8 A;  3FDD A;  2WK7 A;  2ZUK A;  1SPA A;  1DGE A;  3GZD A;  2BI9 A;  1W7N A;  2X3L A;  3BC8 A;  1GDE A;  1TOG A;  3B1E A;  1WYT B;  2VGS A;  3JTX A;  3PJ0 A;  4F5F A;  3DYD A;  4A00 A;  4XQ2 A;  1N8P A;  5IWQ A;  3R4T A;  3UE8 A;  3BWN A;  1O61 A;  4RIT A;  2BIA A;  4EFF A;  1LW5 A;  2W8V A;  4J8L A;  3EIA A;  1AY4 A;  3ACZ A;  3GR9 A;  4E77 A;  3AEJ A;  3KKI A;  1CL2 A;  1CJ0 A;  2DR1 A;  1AY8 A;  2FKI A;  2VMS A;  4RIZ A;  5K8B A;  2EPJ A;  1ELQ A;  1Y4I A;  2R0T A;  1MAQ A;  2CFB A;  4GEB A;  4JF1 A;  4H63 Q;  3WGB A;  2BI5 A;  2YKX A;  1MLY A;  2W7J A;  4UHN A;  4Y0D A;  3WGC A;  3MC6 A;  1ZC9 A;  1ORD A;  1ART A;  2HUF A;  4IYO B;  2EGY A;  2VMN A;  5EQC A;  4B9B A;  3N7N A;  4BA5 A;  2Z9W A;  1DJU A;  2DGM A;  4Y0I A;  3NNK A;  2JJH A;  3WCN A;  3OP7 A;  2HOY A;  1GCK A;  4KYO A;  4AO4 A;  4R2N A;  2VGV A;  4K2I A;  1TPL A;  3NYU A;  3GSB A;  1SFF A;  2W7I A;  1AMQ A;  3NU7 A;  1J32 A;  3COG A;  2W8T A;  3BCX A;  3JU7 A;  3IHJ A;  3LY1 A;  4R5F A;  1S07 A;  2VGT A;  3NU8 A;  1ARH A;  1GC3 A;  3BCB A;  4WXF A;  5M4B A;  4MY5 A;  4BHD A;  4TMR A;  5BJ4 A;  1ASG A;  1TOE A;  2X5F A;  1C7O A;  4PFN A;  4XEW A;  3W1J A;  5D95 A;  3UAK A;  1TAR A;  1X0M A;  2C0R A;  2BKW A;  3DR4 A;  1GC0 A;  4N0W A;  2YCN A;  2YKV A;  1BS0 A;  2D65 A;  3NDN A;  3QHX A;  5DJ9 A;  2W7F A;  1KKJ A;  4MKJ A;  2BI3 A;  1WYU A;  3ISL A;  1AMR A;  4OBU A;  1BT4 A;  2JG2 A;  2Z9V A;  1YIZ A;  2OAT A;  3AEJ C;  3HVY A;  5LH9 A;  4E3Q A;  1ASD A;  2HUU A;  5EIG A;  3R9A A;  3NYS A;  4KXK A;  3BV0 A;  1WKH A;  3L8A A;  2CB1 A;  2FQ6 A;  3AEL A;  4FL0 A;  2W8U A;  1ASC A;  3PPL A;  4WB0 A;  4WYG A;  3HL2 A;  1CZC A;  2BI2 A;  1PG8 A;  5G09 A;  3FDB A;  4WLH A;  2DGL A;  3CQ4 A;  1W7L A;  5G0A A;  3NUI A;  2VMW A;  3IF2 A;  4JEW A;  2RFV A;  1BJN A;  2EO5 A;  4XJO A;  3T32 A;  1C7G A;  4PVF A;  4O6Z A;  3PD6 B;  2VGZ A;  4MQQ A;  4JE5 D;  4N0B A;  3FD0 A;  4ATP A;  1AY5 A;  3PD6 A;  3FQ7 A;  3AOV A;  1ASB A;  2CH2 A;  2DGK A;  4GSA A;  4DBC A;  2BIE A;  1W23 A;  3WZF A;  4A0G A;  4F5K A;  1W3U A;  2VMR A;  1IBJ A;  2Z67 A;  1I29 A;  1OXP A;  4F5I A;  2VLF A;  2CY8 A;  1C4K A;  4ADE A;  3B1C A;  4W8I A;  1PMO A;  3EIB A;  2CJG A;  3ASB A;  1YJY A;  1AAW A;  4MQR A;  4M2K A;  1UU2 A;  5G4J A;  4XK1 A;  4CXQ A;  1B4X A;  3PDB B;  2ZY3 A;  4ZLV A;  2PB0 A;  3EZ1 A;  3PDB A;  3FFH A;  1ASA A;  3JWA A;  1CQ8 A;  3E2Z A;  3K40 A;  4OYT A;  3N0L A;  4P3M A;  4WLJ A;  1KMK A;  2AEU A;  3EI5 A;  4JEZ A;  3N5M A;  2HOZ A;  5F9S A;  2OGA A;  2AY2 A;  3FRK A;  1AX4 A;  3TFT A;  2R5E A;  4R8D A;  3NYT A;  1MDZ A;  3AEN B;  4F5J A;  1OAT A;  3DXV A;  1MDX A;  1LKC A;  2W7E A;  3PDX A;  2Z1Y A;  3FVU A;  4JF0 A;  4H51 A;  1DGD A;  3DU4 A;  1D2F A;  3LVM A;  3G0T A;  1ASN A;  3ZRR A;  2OKJ A;  5G2P A;  1QJ3 A;  1M0Q A;  1YOO A;  3ASA A;  4RJY A;  3BS8 A;  3E9K A;  1ELU A;  1DFO A;  1G4X A;  2OKK A;  3FZ6 A;  4A0F A;  1I43 A;  1Z3Z A;  2O7C A;  1M4N A;  2AY8 A;  2QA3 A;  5BJ3 A;  1WYT A;  3AEO A;  4DQ6 A;  2KFP A;  3G8M A;  3MAF B;  4M2M A;  2AY9 A;  2FNU A;  1DTY A;  4WYF A;  4ZSY A;  4ZDP A;  1I48 A;  3H14 A;  3HLM A;  1BW0 A;  1ECX A;  1JF9 A;  1M7Y A;  2AEV A;  2BWN A;  3K7Y A;  2VYC A;  3DC1 A;  3RUY A;  2GMU A;  4ADC A;  3W1I A;  3WKR A;  5FT6 A;  2E7I A;  1AIB A;  1SZK A;  4J5U A;  2CST A;  1M0P A;  2C81 A;  4ZWM A;  4HVK A;  1V2E A;  2BHX A;  3EZS A;  4OCA A;  1AKA A;  3I4J A;  3B1D A;  3MBB A;  1SVV A;  1D7V A;  5E5I A;  1MDO A;  1QZ9 A;  1BJO B;  2VMO A;  3FQ8 A;  3E77 A;  4Q75 A;  1PFF A;  2VI9 A;  4IYO A;  1IX8 A;  2YRI A;  2PB2 A;  3NUB A;  1O4S A;  1LC8 A;  2D61 A;  4NOG A;  2FNI A;  3RI6 A;  3OKS A;  4GRX A;  2G7J A;  4R5Z A;  4XJP A;  3N4X A;  4AH3 A;  3DXW A;  4MKK A;  1X2A A;  4A0H A;  1IUG A;  4XAU A;  1OHY A;  2VMZ A;  1H1C A;  2BIG A;  3F0H A;  3GBX A;  5EUD A;  1GC4 A;  3LVJ A;  2ORD A;  1KKP A;  1MAP A;  2BWO A;  1B9H A;  5EAA A;  3Q8N A;  4U2H A;  5HHY A;  1IX6 A;  4Q31 A;  2A1V A;  3H9X A;  4WYD A;  1XI9 A;  2YCP A;  1B8G A;  1OHW A;  2ZY4 A;  3DRD A;  3A2B A;  1M32 A;  3PIU A;  1X28 A;  3ZZJ A;  2X5D A;  4IY7 A;  3L44 A;  2V0Y A;  4PIW A;  3VK2 A;  4BQ0 A;  2BYL A;  1CZE A;  1FG3 A;  1BQD A;  1AHX A;  4F5H A;  4HF8 A;  1UU1 A;  5DX5 A;  5EUN A;  2D63 A;  4RAE A;  1XEY A;  2HUI A;  2HOR A;  1VP4 A;  3F9T A;  4TV7 A;  2W7G A;  4UHO A;  1AHE A;  1OXO A;  2GMS A;  4ZAH A;  3HBX A;  2WKA A;  3II0 A;  2WK9 A;  4RJ0 A;  5JAY A;  1ASM A;  2Z1Z A;  3EI8 A;  4OBV A;  4F5M A;  3CQ5 A;  4ZDO A;  1GEY A;  3E6G A;  3M5U A;  3I16 A;  3FVX A;  4BMK A;  3CQ6 A;  4OMA A;  4LW2 A;  1YJZ A;  4Q76 A;  1SF2 A;  1TAT A;  1MGV A;  4ZAS A;  3LVL B;  5EUE A;  3ZRP A;  2EYQ A;  4OC9 A;  3D6K A;  3TCM A;  2R5C B;  4ADB A;  3EI9 A;  3MAU A;  4A0R A;  3B46 A;  3VK3 A;  1S06 A;  2D7Z A;  3FTB A;  4F5L A;  3GZC A;  1D7U A;  4P7Y A;  4WYA A;  4A6R A;  1RVY A;  1IAX A;  2CH1 A;  1GEW A;  2YHK A;  1JS6 A;  3CBF A;  4WP0 A;  2AY4 A;  2D7Y A;  2O0R A;  3FCR A;  4CBR A;  4A72 A;  4CBS A;  1P3W A;  2X8U A;  2VMQ A;  2YKY A;  3A9Y A;  5J8Q A;  2FM1 A;  3QI6 A;  2ZY5 A;  1AAM A;  1M0N A;  4GDY A;  1LW4 A;  5M49 A;  4ITX A;  1YIY A;  1ZOB A;  4FFC A;  1N31 A;  4DGT A;  2YCT A;  3TAT A;  4TN4 A;  3W1H A;  4ZM3 A;  1EG5 A;  2ZJG A;  4B98 A;  3PAA A;  1BKG A;  3QM2 A;  1B9I A;  3KGX A;  4A6U A;  4Y0H A;  3DR7 A;  3WLX A;  2FN6 A;  5G4I A;  2ZYJ A;  4EB7 A;  1BQA A;  4F5G A;  2AY3 A;  1ARI A;  2VMT A;  5AX8 A;  1IJI A;  3LV2 A;  4WYC A;  2D66 A;  2HP2 A;  3KGW A;  3TQX A;  3NTJ A;  1IAY A;  4MGR A;  4ZM4 A;  4LC3 A;  3AEN A;  1DJ9 A;  1GD9 A;  2CAN A;  2EZ2 A;  2VI8 A;  2QLR A;  2VMU A;  1AIA A;  3HT4 A;  9AAT A;  5G2Q A;  2QB3 A;  1ZOD A;  4IW7 A;  3JW9 A;  4AO9 A;  2NMP A;  3EUC A;  1E5F A;  1V2F A;  3VOM A;  4F4E A;  1AIC A;  5E3K A;  1G4V A;  3I5T A;  1B5P A;  1H0C A;  3FSL A;  1S09 A;  1C9C A;  3E2Y A;  3JWB A;  3P6K A;  1BJ4 A;  3GJU A;  2VIB A;  3PGY A;  1SZU A;  4LNJ A;  2VGU A;  4W1W A;  4AOA A;  2OQX A;  3BN1 A;  3MAF A;  3QGU A;  3N75 A;  5DB5 A;  2VIA A;  3A9X A;  2AY6 A;  3AEM C;  3A9Z A;  2Z9X A;  4UOY A;  3N4S A;  1ARS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...