4WXGA

Crystal structure of l-serine hydroxymethyltransferase in complex with a mixture of l-allo-threonine and glycine
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
410
structure length
410
Chain Sequence
b'DYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVISGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIRGDVKVLTDAFPLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine hydroxymethyltransferase
publication title Engineered L-Serine Hydroxymethyltransferase from Streptococcus thermophilus for the Synthesis of alpha , alpha-Dialkyl-alpha-Amino Acids.
pubmed doi rcsb
source organism Streptococcus thermophilus
molecule tags Transferase
total genus 160
structure length 410
sequence length 410
chains with identical sequence C
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4wxgA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4wxgA01
1YNUA 1GDEA 1ASEA 3TCMA 4J8LA 3UE8A 4BA5A 2BIAA 2D64A 4TMRA 4RKCA 4N0WA 4ADDA 2AEVA 3AENA 1AJRA 4LC3A 5TF5A 1GEYA 1XI9A 4F5JA 4RKDA 5M46A 4WYGA 1WYVB 3JWAA 1CQ6A 2CFBA 1B9HA 5EFSA 1PMMA 3EI6A 2OKJA 1CZCA 1M4NA 1XEYA 4F5LA 4XJOA 1AHXA 3AEJA 5E4ZA 3RI6A 2BYJA 1LW4A 4ZDLA 1VJOA 3MADA 3QN6A 4ATPA 1AJSB 3QPGA 4K2BA 1O62A 1TOIA 4MGRA 3MKJA 4RJYA 1B4XA 1FG3A 4GE9A 4W5KA 3K7YA 2PB0A 1BQAA 3IHJA 1JF9A 1ZC9A 2HUIA 2FM1A 2VI9A 4IXOA 1AMAA 4W8IA 1M0OA 4GDYA 3VK2A 4CXQA 4AO4A 4DQ6A 3PDXA 4OT8A 5M4DA 3BCXA 5EUDA 1D7VA 1WKHA 4A0FA 2W8UA 3BCBA 4XK1A 3PDBB 3G8MA 2QLRA 3PD6B 1PG8A 1UU2A 3ASBA 1GC4A 4ATQA 4R2NA 3NUIA 3P1TA 4WXBA 1N31A 1KMJA 2W8VA 1ECXA 1G4XA 1IAXA 4KXKA 2FQ6A 1ASBA 1M0NA 1QGNA 1BS0A 2JJHA 3FDBA 1P3WA 4TV7A 3RQ1A 2E7IA 3EI7A 3MEBA 2JISA 4J5UA 1KMKA 2Z20A 3FSLA 3NRAA 5G09A 1AHEA 3A9XA 1D7UA 2X5DA 5F9SA 1V2DA 1I41A 3BN1A 1AX4A 3HVYA 2GQNA 3WX9A 4M2KA 1AIAA 4XEWA 2EZ2A 3AENB 3ISLA 1TOJA 4JF1A 3WGBA 3DC1A 3DR7A 4A72A 3AEMA 2Z61A 3LVJA 3N75A 4Q31A 3T32A 1C7NA 3UWCA 3VAXA 4HVKA 4ZWMA 4WP0A 1D7RA 2VMZA 1AHFA 4K2IA 4LNLA 1LC7A 2W8JA 4ADCA 3ASAA 2BWNA 2CJHA 2BI1A 4LW4A 2VMNA 1D7SA 1MAPA 4JEXA 3D6KA 3RBLA 3NYUA 3F6TA 3LVLB 3WGCA 4E3RA 1B5PA 2VGTA 4PIWA 1AAMA 5G4IA 4ZM3A 1OHYA 1QZ9A 3LV2A 4PVFA 1G4VA 1MLZA 5IWQA 1H1CA 1ASGA 1ZODA 2VI8A 2VLHA 2D61A 4TN4A 3ZZKA 4DBCA 2EZ1A 3B46A 3N0LA 1U08A 5C6UA 5EQCA 4DGTA 1C4KA 1KL2A 3LWSA 4UHOA 1TARA 1V72A 1LW5A 1VEFA 1IJIA 3JTXA 2BI9A 2BWPA 1MLYA 1BKGA 1RVUA 3QM2A 4WLHA 3NDNA 5D95A 2QA3A 3QHXA 2E7JA 3DYDA 2JJFA 2XH1A 2CB1A 3KE3A 4JEZA 2EH6A 5BJ4A 3GSBA 2OGAA 2XBNA 4WYFA 5DX5A 2OATA 3WCOA 1GEXA 4CXRA 3P6KA 3FVSA 3FKDA 5DB5A 1X29A 2CJGA 2YCPA 5I92A 4A0RA 1W7NA 3GBXA 2YKVA 4OCAA 3TQXA 3MAFA 1TOGA 1X2AA 2HOYA 4FL0A 2X3LA 5G4JA 1O61A 1MDZA 1S08A 1BQDA 3CQ4A 4UHMA 2AY9A 1ASDA 3G0TA 4WYEA 1DGDA 2R5CA 3B8XA 2GMSA 3EIAA 2R2NA 3I16A 4GRXA 4WYAA 4ITXA 3AOVA 1ARSA 1YJYA 1RVYA 3BB8A 3F9TA 2VMUA 4F5MA 3A8UX 4ZSYA 4GSAA 5M49A 2HOZA 4IX8A 1RV4A 3M5UA 2W7HA 1G7XA 4Q76A 3H7FA 3COGA 3DRDA 1KKPA 4R8DA 1IBJA 3GJUA 3MC6A 1LKCA 4A0HA 5D5SA 4ZWVA 1ZOBA 4Y0IA 2YKYA 4ISYA 2HP1A 2V1PA 2Z9UA 4IY7A 2WK9A 2VGZA 2R5EA 3H14A 4MKJA 4WXFA 5BJ3A 4F5KA 3R9AA 2D5YA 2AY6A 1OHWA 4W91A 3DODA 3FZ6A 2BIGA 1PFFA 2ORDA 3FVXA 3DXVA 1IX7A 4IW7A 4XJMA 4XJLA 1EQBA 1ELQA 3RCHA 2CTZA 4B9BA 3OP7A 3CBFA 1ASMA 3NU7A 1FC4A 1ARTA 2AY7A 4WBTA 2X5FA 3ELPA 1I43A 2VMPA 3BS8A 4EB7A 1ARGA 2BI2A 1ELUA 2VGWA 4P3MA 2ZJGA 1AY8A 2QMAA 1ARHA 1I29A 1Y4IA 4Q75A 3B1DA 1ASLA 1V2EA 1Z3ZA 4K2MA 4U1TA 3WKRA 5JAYA 1BJNA 1SZKA 4XJPA 4OBUA 3FDDA 2HUFA 2Q7WA 2PB2A 3KGXA 3GR9A 2W7FA 3EI8A 2CH2A 4WXGA 3TATA 3MAFB 3JZLA 1DTYA 1GEWA 3GZDA 2W7JA 4R5FA 2W8WA 1AICA 3EI5A 4RIZA 1SF2A 4UQVA 2JJEA 4NOGA 5G2QA 3FQ8A 3I5TA 2BWOA 1CQ7A 3AV7A 2ZP7A 4GE7A 2W7GA 2R5CB 2YOBA 1UKJA 4E77A 3QI6A 1ARIA 5LHAA 2C44A 4ZLVA 2BIEA 4JF0A 4RAEA 3HBXA 3E2YA 2YCTA 2Z67A 1AKCA 1DJ9A 1W3UA 1CS1A 1AIBA 3BWNA 4ADBA 1BT4A 1S07A 2AY1A 2C0RA 4H51A 3DR4A 5EUEA 3FFRA 3JWBA 4F4EA 1LC5A 3L44A 3LG0A 5F8VA 4M2MA 2BI3A 3NTJA 2F8JA 1X0MA 4JEYA 2AY2A 4EFFA 5EIGA 4M2JA 5E3KA 1IAYA 3W1JA 4IYOA 1C9CA 3PA9A 3RUYA 3RCHB 2X8UA 3PAAA 2E7UA 3VOMA 1M0PA 1S06A 2ZSLA 2BHXA 3LY1A 3EI9A 1DFOA 3G7QA 3BC8A 3FFHA 2VMVA 1YIZA 3ECDA 3FD0A 4BMKA 1N8PA 1SZSA 2HUUA 3HMUA 1YJSA 2FN6A 4OYTA 1QITA 4QGRA 4A00A 2CINA 3E2FA 5HXXA 1KKJA 3BV0A 1Z7DA 4OMAA 1N2TA 2CSTA 3AEJC 1E5EA 1O4SA 1BJWA 2AY5A 2QB3A 1GC3A 4MY5A 1W23A 2V0YA 2BI5A 1I48A 1ASNA 3EZ1A 3L8AA 1BJOA 3AOWA 2VMTA 4IXSA 3E77A 3KKIA 5DJ1A 2AATA 2DR1A 3DU4A 3GETA 2HP2A 3B1CA 1LC8A 1M7YA 4ZM4A 3FCRA 1H0CA 3TFUA 2VIAA 1SVVA 4ZDPA 4L0OA 2AY8A 4GE4A 4PFFA 1ASFA 4FFCA 4ZASA 7AATA 3K28A 1IUGA 2VMXA 4RITA 2WK7A 2BKWA 3EUCA 2HZPA 5HDMA 4A6RA 3ZRQA 1IVRA 1C7GA 2AY4A 4Y0DA 1ASCA 4W1VA 3JW9A 1E5FA 4W1XA 4AO9A 1JG8A 4ZSWA 4CBRA 3IF2A 1ORDA 2RFVA 2VMWA 4RM1A 5EIGB 3BWOA 1B8GA 1W7MA 3ELEA 3RBFA 1WYUA 4IYOB 5M4BA 1AHYA 3F0HA 2GB3A 1DGEA 2YHKA 3ZZJA 1AAWA 2DKBA 5FT5A 1OATA 2W7DA 3ZRRA 1AKAA 1LK9A 1TOEA 4E1OA 4EU1A 1CL2A 1AKBA 2D65A 3AEMC 4IXZA 4OTLA 3ATHA 3HQTA 4Y0HA 2HOXA 2JJGA 2QBTA 3HT4A 1QJ3A 2OQXA 3WY7A 3VK3A 2O1BA 4MQRA 4WD2A 5FT6A 3WZFA 3ZRPA 1OXOA 2DGMA 4F5FA 3HLMA 1B9IA 2JGTA 5EUNA 2D63A 3FRKA 2OKKA 4AH3A 2DGLA 5HHYA 4LNJA 4F5IA 1BJOB 3AELA 3A9YA 1QISA 3EZSA 1SZUA 1IX6A 4JEVA 1IX8A 5E5IA 2O0RA 1VP4A 3CQ5A 2Z1YA 3GWPA 3NNKA 4LW2A 1YAAA 3USFA 3OKSA 1MAQA 2WK8A 2E54A 1T3IA 2VMYA 3WKSA 1OHVA 1DJEA 4RJ0A 5LH9A 1CQ8A 3KGWA 3VK4A 1FG7A 4KYOA 4MSOA 3MBBA 1SFFA 1UU1A 1W7LA 4AZKA 1M6SA 1D2FA 5G2PA 3CQ6A 1X28A 2YRIA 4UOYA 2W8TA 1AY4A 3GZCA 4BQ0A 1AY5A 2GMUA 2Z1ZA 3MAUA 1B5OA 3WCNA 5DJ9A 4KAMA 2ZUKA 1BJ4A 4I8AA 1G7WA 3R4TA 1CJ0A 1MGVA 1J32A 2W7LA 2ZSMA 1YOOA 3DXWA 1TASA 2CANA 2D66A 1KL1A 2VMRA 1QIRA 3E2ZA 3N5MA 4P7YA 2D7ZA 4XQ2A 4CVQA 1AMRA 1LS3A 3PPLA 3HL2A 4EMYA 1TOKA 3A2BA 1WYUB 3AEOA 2FNUA 5K8BA 3AEPA 3W1IA 2VYCA 1AMSA 5EAVA 1GD9A 2O7CA 4MQQA 1O69A 1S09A 2WKAA 1M0QA 1CZEA 1MDOA 2Z9WA 4ITGA 3HDOA 4WB0A 4WYDA 2D7YA 4R5ZA 4BA4A 4W1WA 4CBSA 4E3QA 3FVUA 2ZC0A 2DGKA 3A9ZA 4A6UA 2ZY4A 4GEBA 1GC0A 2VIBA 5FT8A 3QGUA 5AX8A 2DKJA 1AHGA 2EO5A 1WSTA 3EIBA 3JU7A 2EPJA 1MDXA 3MC6C 2VLFA 3FQ7A 3PGYA 1OXPA 2W7MA 4PFNA 4WLJA 4ZAHA 8AATA 2PO3A 2W7KA 3FZ8A 2BYLA 3I4JA 2EGYA 4F5HA 3II0A 4JE5A 3WLXA 1GBNA 1S0AA 1RV3A 3FQAA 3NUBA 1TATA 2FYFA 3FZ7A 1WYTA 2AEUA 4O6ZA 1EG5A 3DZZA 3ACZA 3PJ0A 5FT4A 2YKXA 3VP6A 1WKGA 9AATA 1YJZA 3QBOA 2G6WA 3UAKA 1M32A 4N0BA 4Q6RA 2VGVA 1JS6A 2VMQA 1SPAA 2YRRA 1WYVA 2W7EA 4BHDA 3NX3A 4RLGA 2DOUA 4JE5D 5EAAA 2VGUA 3AATA 3PIUA 1PMOA 2NMPA 4OBVA 4AOAA 1C7OA 2VMOA 4ZDOA 1UU0A 2FNIA 1GCKA 2ZYJA 3NYSA 4F5GA 3E2ZB 2GSAA 2CH1A 4JEWA 3LVMA 2OGEA 2ZY3A 1AJSA 1CL1A 2VGSA 3FTBA 3GZDC 2TPLA 4U2HA 4EB5A 3BCAA 3E6GA 4UHNA 4AZJA 3E9KA 1YIYA 2W7IA 4OC9A 2C81A 4A6TA 2CY8A 3Q8NA 2ZY2A 1JS3A 4WB0B 2YKUA 5J8QA 4HF8A 3W1HA 3NU8A 3PDBA 4ADEA 4A0GA 3CAIA 2QB2A 1ASAA 1J04A 1C0NA 2Z9XA 3PD6A 4MKKA 2YCNA 1TPLA 2Z9VA 1DJUA 1QJ5A 3LVKA 4WYCA 2R0TA 3BWNC 2AY3A 1DKAA 4B98A 1GC2A 1BW0A 1V2FA 2VMSA 3NYTA 4LNMA 1EJIA 4XAUA 1AMQA 2CJDA 2JG2A 3TFTA 2HORA 4MQPA 2ZY5A 3B1EA 2C7TA 5G0AA 3K40A 1WYTB
chains in the Genus database with same CATH superfamily
1YNUA 1GDEA 1ASEA 3TCMA 4J8LA 3UE8A 4BA5A 2BIAA 2D64A 4TMRA 4RKCA 4N0WA 4ADDA 2AEVA 3AENA 1AJRA 4LC3A 5TF5A 1GEYA 1XI9A 4F5JA 4RKDA 5M46A 4WYGA 1WYVB 3JWAA 2WB6A 1CQ6A 2CFBA 1B9HA 5EFSA 1PMMA 3EI6A 2OKJA 1CZCA 1M4NA 1XEYA 4F5LA 4XJOA 1AHXA 3AEJA 5E4ZA 3RI6A 2BYJA 1LW4A 4ZDLA 1VJOA 3MADA 3QN6A 4ATPA 1AJSB 3QPGA 4K2BA 1O62A 1TOIA 4MGRA 3MKJA 4RJYA 1B4XA 1FG3A 4GE9A 4W5KA 3K7YA 2PB0A 1BQAA 3IHJA 1JF9A 1ZC9A 2HUIA 2FM1A 2VI9A 4IXOA 1AMAA 4W8IA 1M0OA 4GDYA 3VK2A 4CXQA 4AO4A 4DQ6A 3PDXA 4OT8A 5M4DA 3BCXA 5EUDA 1D7VA 1WKHA 4A0FA 2W8UA 3BCBA 4XK1A 3PDBB 3G8MA 2QLRA 3PD6B 1PG8A 1UU2A 3ASBA 1GC4A 4ATQA 4R2NA 3NUIA 3P1TA 4WXBA 1N31A 1KMJA 2W8VA 1ECXA 1G4XA 1IAXA 4KXKA 2FQ6A 1ASBA 2FKIA 1M0NA 1QGNA 1BS0A 2JJHA 3FDBA 1P3WA 4TV7A 3RQ1A 2E7IA 3EI7A 3MEBA 2JISA 4J5UA 1KMKA 2Z20A 3FSLA 3NRAA 5G09A 1AHEA 3A9XA 1D7UA 2X5DA 5F9SA 1V2DA 1I41A 3BN1A 1AX4A 3HVYA 2GQNA 3WX9A 4M2KA 1AIAA 4XEWA 2EZ2A 3AENB 3ISLA 1TOJA 4JF1A 3WGBA 3DC1A 3DR7A 4A72A 3AEMA 2Z61A 3LVJA 3N75A 4Q31A 3T32A 1C7NA 3UWCA 3VAXA 4HVKA 4ZWMA 4WP0A 1D7RA 2VMZA 1AHFA 4K2IA 4LNLA 1LC7A 2W8JA 4ADCA 3ASAA 2BWNA 2CJHA 2BI1A 4LW4A 2VMNA 1D7SA 1MAPA 4JEXA 3D6KA 3RBLA 3NYUA 3F6TA 3LVLB 3WGCA 4E3RA 1B5PA 2VGTA 4PIWA 1AAMA 5G4IA 4ZM3A 1OHYA 1QZ9A 3LV2A 4PVFA 1G4VA 1MLZA 5IWQA 1H1CA 1ASGA 1ZODA 2VI8A 2VLHA 2D61A 4TN4A 3ZZKA 4DBCA 2EZ1A 3B46A 3N0LA 1U08A 5C6UA 5EQCA 4DGTA 1C4KA 1KL2A 3LWSA 4UHOA 1TARA 1V72A 1LW5A 1VEFA 1IJIA 3JTXA 2BI9A 2BWPA 1MLYA 1BKGA 1RVUA 3QM2A 4WLHA 3NDNA 5D95A 2QA3A 3QHXA 2E7JA 3DYDA 2JJFA 2XH1A 2CB1A 3KE3A 4JEZA 2EH6A 5BJ4A 3GSBA 2OGAA 2XBNA 4WYFA 5DX5A 2OATA 3WCOA 1GEXA 4CXRA 3P6KA 3FVSA 3FKDA 5DB5A 1X29A 2CJGA 2YCPA 5I92A 4A0RA 1W7NA 3GBXA 2YKVA 4OCAA 3TQXA 3MAFA 1TOGA 1X2AA 2HOYA 4FL0A 2X3LA 5G4JA 1O61A 1MDZA 1S08A 1BQDA 3CQ4A 4UHMA 2AY9A 1ASDA 3G0TA 4WYEA 1DGDA 2R5CA 3B8XA 2GMSA 3EIAA 2R2NA 3I16A 4GRXA 4WYAA 4ITXA 3AOVA 1ARSA 1YJYA 1RVYA 3BB8A 3F9TA 2VMUA 4F5MA 3A8UX 4ZSYA 4GSAA 5M49A 2HOZA 4IX8A 1RV4A 3M5UA 2W7HA 1G7XA 4Q76A 3H7FA 3COGA 3DRDA 1KKPA 4R8DA 1IBJA 3GJUA 3MC6A 1LKCA 4A0HA 5D5SA 4ZWVA 1ZOBA 4Y0IA 3N7NA 4K05A 2YKYA 4ISYA 2HP1A 2V1PA 2Z9UA 4IY7A 2WK9A 2VGZA 2R5EA 3H14A 4MKJA 4WXFA 5BJ3A 4H63Q 4F5KA 3R9AA 2D5YA 2AY6A 1OHWA 4W91A 3DODA 3FZ6A 2BIGA 1PFFA 2ORDA 3FVXA 3DXVA 1IX7A 4IW7A 4XJMA 4XJLA 1EQBA 1ELQA 3RCHA 2CTZA 4B9BA 3OP7A 3CBFA 1ASMA 3NU7A 1FC4A 1ARTA 2AY7A 4WBTA 2X5FA 3ELPA 1I43A 2VMPA 3BS8A 4EB7A 1ARGA 2BI2A 1ELUA 2VGWA 4P3MA 2ZJGA 1AY8A 2QMAA 1ARHA 1I29A 1Y4IA 4Q75A 3B1DA 1ASLA 1V2EA 1Z3ZA 4K2MA 4U1TA 3WKRA 5JAYA 1BJNA 1SZKA 4XJPA 4OBUA 3FDDA 2HUFA 2Q7WA 2PB2A 3KGXA 3GR9A 2W7FA 3EI8A 2CH2A 4WXGA 3TATA 3MAFB 3JZLA 3N4RA 1DTYA 1GEWA 3GZDA 2W7JA 4R5FA 2W8WA 1AICA 3EI5A 4RIZA 1SF2A 4UQVA 2JJEA 4NOGA 5G2QA 3FQ8A 3I5TA 2BWOA 1CQ7A 3AV7A 2ZP7A 4GE7A 2W7GA 2R5CB 2YOBA 1UKJA 4E77A 3QI6A 1ARIA 5LHAA 2C44A 4ZLVA 2BIEA 4JF0A 4RAEA 3HBXA 3E2YA 2YCTA 2Z67A 1AKCA 1DJ9A 1W3UA 1CS1A 1AIBA 3BWNA 4ADBA 1BT4A 1S07A 2AY1A 2C0RA 4H51A 3DR4A 5EUEA 3FFRA 3JWBA 4F4EA 1LC5A 3L44A 3LG0A 5F8VA 4M2MA 2BI3A 3NTJA 2F8JA 1X0MA 4JEYA 2AY2A 4EFFA 5EIGA 4M2JA 5E3KA 1IAYA 3W1JA 4IYOA 1C9CA 3PA9A 3RUYA 3RCHB 2X8UA 3PAAA 2E7UA 3VOMA 1M0PA 1S06A 2ZSLA 2BHXA 3LY1A 3EI9A 1DFOA 3G7QA 3BC8A 3FFHA 2VMVA 1YIZA 3ECDA 3FD0A 4BMKA 1N8PA 1SZSA 2HUUA 3HMUA 1YJSA 2FN6A 4OYTA 1QITA 4QGRA 4A00A 2CINA 3E2FA 5HXXA 2EYQA 1KKJA 3BV0A 1Z7DA 4OMAA 1N2TA 2CSTA 3AEJC 1E5EA 1O4SA 1BJWA 2AY5A 2QB3A 1GC3A 4MY5A 1W23A 2V0YA 2BI5A 1I48A 1ASNA 3EZ1A 3L8AA 1BJOA 3AOWA 2VMTA 4IXSA 3E77A 3KKIA 5DJ1A 2AATA 2DR1A 3DU4A 3GETA 2HP2A 3B1CA 1LC8A 1M7YA 4ZM4A 3FCRA 1H0CA 3TFUA 2VIAA 1SVVA 4ZDPA 4L0OA 2AY8A 4GE4A 4PFFA 1ASFA 4FFCA 4ZASA 7AATA 3K28A 1IUGA 2VMXA 4RITA 2WK7A 2BKWA 3EUCA 2HZPA 5HDMA 4A6RA 3ZRQA 1IVRA 1C7GA 2AY4A 4Y0DA 1ASCA 4W1VA 3JW9A 1E5FA 4W1XA 4AO9A 1JG8A 4ZSWA 4CBRA 3IF2A 1ORDA 2RFVA 2VMWA 4RM1A 5EIGB 3BWOA 1B8GA 1W7MA 3ELEA 3RBFA 1WYUA 4IYOB 5M4BA 1AHYA 3F0HA 2GB3A 1DGEA 2YHKA 3ZZJA 1AAWA 2DKBA 5FT5A 1OATA 2W7DA 3ZRRA 1AKAA 1LK9A 1TOEA 4E1OA 4EU1A 1CL2A 1AKBA 2D65A 3AEMC 4IXZA 4OTLA 3ATHA 3HQTA 4Y0HA 2HOXA 2JJGA 2QBTA 3HT4A 1QJ3A 2A1VA 2OQXA 3WY7A 3VK3A 2O1BA 4MQRA 4WD2A 5FT6A 3WZFA 3ZRPA 1OXOA 2DGMA 4F5FA 3HLMA 1B9IA 2JGTA 5EUNA 2D63A 3FRKA 2OKKA 4AH3A 2DGLA 5HHYA 4LNJA 4F5IA 1BJOB 3AELA 3A9YA 1QISA 3EZSA 1SZUA 1IX6A 4JEVA 1IX8A 5E5IA 2O0RA 1VP4A 3CQ5A 2Z1YA 3GWPA 3NNKA 4LW2A 1YAAA 3USFA 3OKSA 1MAQA 2WK8A 2E54A 1T3IA 2VMYA 3WKSA 1OHVA 1DJEA 4RJ0A 3N4XA 5LH9A 1CQ8A 3KGWA 3VK4A 1FG7A 4KYOA 4MSOA 3MBBA 1SFFA 1UU1A 2G7JA 1W7LA 4AZKA 1M6SA 1D2FA 5G2PA 3CQ6A 1X28A 2YRIA 4UOYA 2W8TA 1AY4A 3GZCA 4BQ0A 1AY5A 2KFPA 2GMUA 2Z1ZA 3MAUA 1B5OA 3WCNA 5DJ9A 4KAMA 2ZUKA 1BJ4A 4I8AA 1G7WA 3R4TA 1CJ0A 1MGVA 1J32A 2W7LA 2ZSMA 1YOOA 3DXWA 1TASA 2CANA 2D66A 1KL1A 2VMRA 1QIRA 3E2ZA 3N5MA 4P7YA 2D7ZA 4XQ2A 4CVQA 1AMRA 1LS3A 3PPLA 3HL2A 4EMYA 1TOKA 3A2BA 1WYUB 3AEOA 2FNUA 5K8BA 3AEPA 3W1IA 2VYCA 1AMSA 5EAVA 1GD9A 2O7CA 4MQQA 1O69A 1S09A 2WKAA 1M0QA 1CZEA 1MDOA 2Z9WA 4ITGA 3HDOA 4WB0A 4WYDA 2D7YA 4R5ZA 4BA4A 4W1WA 4CBSA 4E3QA 3FVUA 2ZC0A 2DGKA 3A9ZA 4A6UA 2ZY4A 4GEBA 1GC0A 2VIBA 5FT8A 3QGUA 5AX8A 2DKJA 1AHGA 2EO5A 1WSTA 3EIBA 3JU7A 2EPJA 1MDXA 3MC6C 2VLFA 3FQ7A 3PGYA 1OXPA 2W7MA 4PFNA 4WLJA 4ZAHA 8AATA 5KTBA 2PO3A 2W7KA 3FZ8A 2BYLA 3I4JA 2EGYA 3H9XA 4F5HA 3II0A 4JE5A 3WLXA 1GBNA 1S0AA 1RV3A 3FQAA 3NUBA 1TATA 2FYFA 3FZ7A 1WYTA 2AEUA 4O6ZA 1EG5A 3DZZA 3ACZA 3PJ0A 5FT4A 2YKXA 3VP6A 1WKGA 9AATA 1YJZA 3QBOA 2G6WA 3UAKA 3N4SA 1M32A 4N0BA 4Q6RA 2VGVA 1JS6A 2VMQA 1SPAA 2YRRA 1WYVA 2W7EA 4BHDA 3NX3A 4RLGA 2DOUA 4JE5D 5EAAA 2VGUA 3AATA 3PIUA 1PMOA 2NMPA 4OBVA 4AOAA 1C7OA 2VMOA 4ZDOA 1UU0A 2FNIA 1GCKA 2ZYJA 3NYSA 4F5GA 3E2ZB 2GSAA 2CH1A 4JEWA 3LVMA 2OGEA 2ZY3A 1AJSA 1CL1A 2VGSA 3FTBA 3GZDC 2TPLA 4U2HA 4EB5A 3BCAA 3E6GA 4UHNA 4AZJA 3E9KA 1YIYA 2W7IA 4OC9A 2C81A 4A6TA 2CY8A 3Q8NA 2ZY2A 1JS3A 4WB0B 2YKUA 5J8QA 4HF8A 3W1HA 3NU8A 3PDBA 4ADEA 4A0GA 3CAIA 2QB2A 1ASAA 1J04A 1C0NA 2Z9XA 3PD6A 4MKKA 2YCNA 1TPLA 2Z9VA 1DJUA 2QSRA 1QJ5A 3LVKA 4WYCA 2R0TA 3BWNC 2AY3A 1DKAA 4B98A 1GC2A 1BW0A 1V2FA 2VMSA 3NYTA 4LNMA 1EJIA 4XAUA 1KAFA 1AMQA 2CJDA 2JG2A 3TFTA 2HORA 4MQPA 2ZY5A 3B1EA 2C7TA 5G0AA 3K40A 1WYTB
chains in the Genus database with same CATH topology
1YNUA 1GDEA 1ASEA 3TCMA 4J8LA 3UE8A 4BA5A 2BIAA 2D64A 4TMRA 4RKCA 4N0WA 4ADDA 2AEVA 3AENA 1AJRA 4LC3A 5TF5A 1GEYA 1XI9A 4F5JA 4RKDA 5M46A 4WYGA 1WYVB 3JWAA 2WB6A 1CQ6A 2CFBA 1B9HA 5EFSA 1PMMA 3EI6A 2OKJA 1CZCA 1M4NA 1XEYA 4F5LA 4XJOA 1AHXA 3AEJA 5E4ZA 3RI6A 2BYJA 1LW4A 4ZDLA 1VJOA 3MADA 3QN6A 4ATPA 1AJSB 3QPGA 4K2BA 1O62A 1TOIA 4MGRA 3MKJA 4RJYA 1B4XA 1FG3A 4GE9A 4W5KA 3K7YA 2PB0A 1BQAA 3IHJA 1JF9A 1ZC9A 2HUIA 2FM1A 2VI9A 4IXOA 1AMAA 4W8IA 1M0OA 4GDYA 3VK2A 4CXQA 4AO4A 4DQ6A 3PDXA 4OT8A 5M4DA 3BCXA 5EUDA 1D7VA 1WKHA 4A0FA 2W8UA 3BCBA 4XK1A 3PDBB 3G8MA 2QLRA 3PD6B 1PG8A 1UU2A 3ASBA 1GC4A 4ATQA 4R2NA 3NUIA 3P1TA 4WXBA 1N31A 1KMJA 2W8VA 1ECXA 1G4XA 1IAXA 4KXKA 2FQ6A 1ASBA 2FKIA 1M0NA 1QGNA 1BS0A 2JJHA 3FDBA 1P3WA 4TV7A 3RQ1A 2E7IA 3EI7A 3MEBA 2JISA 4J5UA 1KMKA 2Z20A 3FSLA 3NRAA 5G09A 1AHEA 3A9XA 1D7UA 2X5DA 5F9SA 1V2DA 1I41A 3BN1A 1AX4A 3HVYA 2GQNA 3WX9A 4M2KA 1AIAA 4XEWA 2EZ2A 3AENB 3ISLA 1TOJA 4JF1A 3WGBA 3DC1A 3DR7A 4A72A 3AEMA 2Z61A 3LVJA 3N75A 4Q31A 3T32A 1C7NA 3UWCA 3VAXA 4HVKA 4ZWMA 4WP0A 1D7RA 2VMZA 1AHFA 4K2IA 4LNLA 1LC7A 2W8JA 4ADCA 3ASAA 2BWNA 2CJHA 2BI1A 4LW4A 2VMNA 1D7SA 1MAPA 4JEXA 3D6KA 3RBLA 3NYUA 3F6TA 3LVLB 3WGCA 4E3RA 1B5PA 2VGTA 4PIWA 1AAMA 5G4IA 4ZM3A 1OHYA 1QZ9A 3LV2A 4PVFA 1G4VA 1MLZA 5IWQA 1H1CA 1ASGA 1ZODA 2VI8A 2VLHA 2D61A 4TN4A 3ZZKA 4DBCA 2EZ1A 3B46A 3N0LA 1U08A 5C6UA 5EQCA 4DGTA 1C4KA 1KL2A 3LWSA 4UHOA 1TARA 1V72A 1LW5A 1VEFA 1IJIA 3JTXA 2BI9A 2BWPA 1MLYA 1BKGA 1RVUA 3QM2A 4WLHA 3NDNA 5D95A 2QA3A 3QHXA 2E7JA 3DYDA 2JJFA 2XH1A 2CB1A 3KE3A 4JEZA 2EH6A 5BJ4A 3GSBA 2OGAA 2XBNA 4WYFA 5DX5A 2OATA 3WCOA 1GEXA 4CXRA 3P6KA 3FVSA 3FKDA 5DB5A 1X29A 2CJGA 2YCPA 5I92A 4A0RA 1W7NA 3GBXA 2YKVA 4OCAA 3TQXA 3MAFA 1TOGA 1X2AA 2HOYA 4FL0A 2X3LA 5G4JA 1O61A 1MDZA 1S08A 1BQDA 3CQ4A 4UHMA 2AY9A 1ASDA 3G0TA 4WYEA 1DGDA 2R5CA 3B8XA 2GMSA 3EIAA 2R2NA 3I16A 4GRXA 4WYAA 4ITXA 3AOVA 1ARSA 1YJYA 1RVYA 3BB8A 3F9TA 2VMUA 4F5MA 3A8UX 4ZSYA 4GSAA 5M49A 2HOZA 4IX8A 1RV4A 3M5UA 2W7HA 1G7XA 4Q76A 3H7FA 3COGA 3DRDA 1KKPA 4R8DA 1IBJA 3GJUA 3MC6A 1LKCA 4A0HA 5D5SA 4ZWVA 1ZOBA 4Y0IA 3N7NA 4K05A 2YKYA 4ISYA 2HP1A 2V1PA 2Z9UA 4IY7A 2WK9A 2VGZA 2R5EA 3H14A 4MKJA 4WXFA 5BJ3A 4H63Q 4F5KA 3R9AA 2D5YA 2AY6A 1OHWA 4W91A 3DODA 3FZ6A 2BIGA 1PFFA 2ORDA 3FVXA 3DXVA 1IX7A 4IW7A 4XJMA 4XJLA 1EQBA 1ELQA 3RCHA 2CTZA 4B9BA 3OP7A 3CBFA 1ASMA 3NU7A 1FC4A 1ARTA 2AY7A 4WBTA 2X5FA 3ELPA 1I43A 2VMPA 3BS8A 4EB7A 1ARGA 2BI2A 1ELUA 2VGWA 4P3MA 2ZJGA 1AY8A 2QMAA 1ARHA 1I29A 1Y4IA 4Q75A 3B1DA 1ASLA 1V2EA 1Z3ZA 4K2MA 4U1TA 3WKRA 5JAYA 1BJNA 1SZKA 4XJPA 4OBUA 3FDDA 2HUFA 2Q7WA 2PB2A 3KGXA 3GR9A 2W7FA 3EI8A 2CH2A 4WXGA 3TATA 3MAFB 3JZLA 3N4RA 1DTYA 1GEWA 3GZDA 2W7JA 4R5FA 2W8WA 1AICA 3EI5A 4RIZA 1SF2A 4UQVA 2JJEA 4NOGA 5G2QA 3FQ8A 3I5TA 2BWOA 1CQ7A 3AV7A 2ZP7A 4GE7A 2W7GA 2R5CB 2YOBA 1UKJA 4E77A 3QI6A 1ARIA 5LHAA 2C44A 4ZLVA 2BIEA 4JF0A 4RAEA 3HBXA 3E2YA 2YCTA 2Z67A 1AKCA 1DJ9A 1W3UA 1CS1A 1AIBA 3BWNA 4ADBA 1BT4A 1S07A 2AY1A 2C0RA 4H51A 3DR4A 5EUEA 3FFRA 3JWBA 4F4EA 1LC5A 3L44A 3LG0A 5F8VA 4M2MA 2BI3A 3NTJA 2F8JA 1X0MA 4JEYA 2AY2A 4EFFA 5EIGA 4M2JA 5E3KA 1IAYA 3W1JA 4IYOA 1C9CA 3PA9A 3RUYA 3RCHB 2X8UA 3PAAA 2E7UA 3VOMA 1M0PA 1S06A 2ZSLA 2BHXA 3LY1A 3EI9A 1DFOA 3G7QA 3BC8A 3FFHA 2VMVA 1YIZA 3ECDA 3FD0A 4BMKA 1N8PA 1SZSA 2HUUA 3HMUA 1YJSA 2FN6A 4OYTA 1QITA 4QGRA 4A00A 2CINA 3E2FA 5HXXA 2EYQA 1KKJA 3BV0A 1Z7DA 4OMAA 1N2TA 2CSTA 3AEJC 1E5EA 1O4SA 1BJWA 2AY5A 2QB3A 1GC3A 4MY5A 1W23A 2V0YA 2BI5A 1I48A 1ASNA 3EZ1A 3L8AA 1BJOA 3AOWA 2VMTA 4IXSA 3E77A 3KKIA 5DJ1A 2AATA 2DR1A 3DU4A 3GETA 2HP2A 3B1CA 1LC8A 1M7YA 4ZM4A 3FCRA 1H0CA 3TFUA 2VIAA 1SVVA 4ZDPA 4L0OA 2AY8A 4GE4A 4PFFA 1ASFA 4FFCA 4ZASA 7AATA 3K28A 1IUGA 2VMXA 4RITA 2WK7A 2BKWA 3EUCA 2HZPA 5HDMA 4A6RA 3ZRQA 1IVRA 1C7GA 2AY4A 4Y0DA 1ASCA 4W1VA 3JW9A 1E5FA 4W1XA 4AO9A 1JG8A 4ZSWA 4CBRA 3IF2A 1ORDA 2RFVA 2VMWA 4RM1A 5EIGB 3BWOA 1B8GA 1W7MA 3ELEA 3RBFA 1WYUA 4IYOB 5M4BA 1AHYA 3F0HA 2GB3A 1DGEA 2YHKA 3ZZJA 1AAWA 2DKBA 5FT5A 1OATA 2W7DA 3ZRRA 1AKAA 1LK9A 1TOEA 4E1OA 4EU1A 1CL2A 1AKBA 2D65A 3AEMC 4IXZA 4OTLA 3ATHA 3HQTA 4Y0HA 2HOXA 2JJGA 2QBTA 3HT4A 1QJ3A 2A1VA 2OQXA 3WY7A 3VK3A 2O1BA 4MQRA 4WD2A 5FT6A 3WZFA 3ZRPA 1OXOA 2DGMA 4F5FA 3HLMA 1B9IA 2JGTA 5EUNA 2D63A 3FRKA 2OKKA 4AH3A 2DGLA 5HHYA 4LNJA 4F5IA 1BJOB 3AELA 3A9YA 1QISA 3EZSA 1SZUA 1IX6A 4JEVA 1IX8A 5E5IA 2O0RA 1VP4A 3CQ5A 2Z1YA 3GWPA 3NNKA 4LW2A 1YAAA 3USFA 3OKSA 1MAQA 2WK8A 2E54A 1T3IA 2VMYA 3WKSA 1OHVA 1DJEA 4RJ0A 3N4XA 5LH9A 1CQ8A 3KGWA 3VK4A 1FG7A 4KYOA 4MSOA 3MBBA 1SFFA 1UU1A 2G7JA 1W7LA 4AZKA 1M6SA 1D2FA 5G2PA 3CQ6A 1X28A 2YRIA 4UOYA 2W8TA 1AY4A 3GZCA 4BQ0A 1AY5A 2KFPA 2GMUA 2Z1ZA 3MAUA 1B5OA 3WCNA 5DJ9A 4KAMA 2ZUKA 1BJ4A 4I8AA 1G7WA 3R4TA 1CJ0A 1MGVA 1J32A 2W7LA 2ZSMA 1YOOA 3DXWA 1TASA 2CANA 2D66A 1KL1A 2VMRA 1QIRA 3E2ZA 3N5MA 4P7YA 2D7ZA 4XQ2A 4CVQA 1AMRA 1LS3A 3PPLA 3HL2A 4EMYA 1TOKA 3A2BA 1WYUB 3AEOA 2FNUA 5K8BA 3AEPA 3W1IA 2VYCA 1AMSA 5EAVA 1GD9A 2O7CA 4MQQA 1O69A 1S09A 2WKAA 1M0QA 1CZEA 1MDOA 2Z9WA 4ITGA 3HDOA 4WB0A 4WYDA 2D7YA 4R5ZA 4BA4A 4W1WA 4CBSA 4E3QA 3FVUA 2ZC0A 2DGKA 3A9ZA 4A6UA 2ZY4A 4GEBA 1GC0A 2VIBA 5FT8A 3QGUA 5AX8A 2DKJA 1AHGA 2EO5A 1WSTA 3EIBA 3JU7A 2EPJA 1MDXA 3MC6C 2VLFA 3FQ7A 3PGYA 1OXPA 2W7MA 4PFNA 4WLJA 4ZAHA 8AATA 5KTBA 2PO3A 2W7KA 3FZ8A 2BYLA 3I4JA 2EGYA 3H9XA 4F5HA 3II0A 4JE5A 3WLXA 1GBNA 1S0AA 1RV3A 3FQAA 3NUBA 1TATA 2FYFA 3FZ7A 1WYTA 2AEUA 4O6ZA 1EG5A 3DZZA 3ACZA 3PJ0A 5FT4A 2YKXA 3VP6A 1WKGA 9AATA 1YJZA 3QBOA 2G6WA 3UAKA 3N4SA 1M32A 4N0BA 4Q6RA 2VGVA 1JS6A 2VMQA 1SPAA 2YRRA 1WYVA 2W7EA 4BHDA 3NX3A 4RLGA 2DOUA 4JE5D 5EAAA 2VGUA 3AATA 3PIUA 1PMOA 2NMPA 4OBVA 4AOAA 1C7OA 2VMOA 4ZDOA 1UU0A 2FNIA 1GCKA 2ZYJA 3NYSA 4F5GA 3E2ZB 2GSAA 2CH1A 4JEWA 3LVMA 2OGEA 2ZY3A 1AJSA 1CL1A 2VGSA 3FTBA 3GZDC 2TPLA 4U2HA 4EB5A 3BCAA 3E6GA 4UHNA 4AZJA 3E9KA 1YIYA 2W7IA 4OC9A 2C81A 4A6TA 2CY8A 3Q8NA 2ZY2A 1JS3A 4WB0B 2YKUA 5J8QA 4HF8A 3W1HA 3NU8A 3PDBA 4ADEA 4A0GA 3CAIA 2QB2A 1ASAA 1J04A 1C0NA 2Z9XA 3PD6A 4MKKA 2YCNA 1TPLA 2Z9VA 1DJUA 2QSRA 1QJ5A 3LVKA 4WYCA 2R0TA 3BWNC 2AY3A 1DKAA 4B98A 1GC2A 1BW0A 1V2FA 2VMSA 3NYTA 4LNMA 1EJIA 4XAUA 1AMQA 2CJDA 2JG2A 3TFTA 2HORA 4MQPA 2ZY5A 3B1EA 2C7TA 5G0AA 3K40A 1WYTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNU A;  1GDE A;  1ASE A;  3TCM A;  4J8L A;  3UE8 A;  4BA5 A;  2BIA A;  2D64 A;  4TMR A;  4RKC A;  4N0W A;  4ADD A;  2AEV A;  3AEN A;  1AJR A;  4LC3 A;  5TF5 A;  1GEY A;  1XI9 A;  4F5J A;  4RKD A;  5M46 A;  4WYG A;  1WYV B;  3JWA A;  1CQ6 A;  2CFB A;  1B9H A;  5EFS A;  1PMM A;  3EI6 A;  2OKJ A;  1CZC A;  1M4N A;  1XEY A;  4F5L A;  4XJO A;  1AHX A;  3AEJ A;  5E4Z A;  3RI6 A;  2BYJ A;  1LW4 A;  4ZDL A;  1VJO A;  3MAD A;  3QN6 A;  4ATP A;  1AJS B;  3QPG A;  4K2B A;  1O62 A;  1TOI A;  4MGR A;  3MKJ A;  4RJY A;  1B4X A;  1FG3 A;  4GE9 A;  4W5K A;  3K7Y A;  2PB0 A;  1BQA A;  3IHJ A;  1JF9 A;  1ZC9 A;  2HUI A;  2FM1 A;  2VI9 A;  4IXO A;  1AMA A;  4W8I A;  1M0O A;  4GDY A;  3VK2 A;  4CXQ A;  4AO4 A;  4DQ6 A;  3PDX A;  4OT8 A;  5M4D A;  3BCX A;  5EUD A;  1D7V A;  1WKH A;  4A0F A;  2W8U A;  3BCB A;  4XK1 A;  3PDB B;  3G8M A;  2QLR A;  3PD6 B;  1PG8 A;  1UU2 A;  3ASB A;  1GC4 A;  4ATQ A;  4R2N A;  3NUI A;  3P1T A;  4WXB A;  1N31 A;  1KMJ A;  2W8V A;  1ECX A;  1G4X A;  1IAX A;  4KXK A;  2FQ6 A;  1ASB A;  1M0N A;  1QGN A;  1BS0 A;  2JJH A;  3FDB A;  1P3W A;  4TV7 A;  3RQ1 A;  2E7I A;  3EI7 A;  3MEB A;  2JIS A;  4J5U A;  1KMK A;  2Z20 A;  3FSL A;  3NRA A;  5G09 A;  1AHE A;  3A9X A;  1D7U A;  2X5D A;  5F9S A;  1V2D A;  1I41 A;  3BN1 A;  1AX4 A;  3HVY A;  2GQN A;  3WX9 A;  4M2K A;  1AIA A;  4XEW A;  2EZ2 A;  3AEN B;  3ISL A;  1TOJ A;  4JF1 A;  3WGB A;  3DC1 A;  3DR7 A;  4A72 A;  3AEM A;  2Z61 A;  3LVJ A;  3N75 A;  4Q31 A;  3T32 A;  1C7N A;  3UWC A;  3VAX A;  4HVK A;  4ZWM A;  4WP0 A;  1D7R A;  2VMZ A;  1AHF A;  4K2I A;  4LNL A;  1LC7 A;  2W8J A;  4ADC A;  3ASA A;  2BWN A;  2CJH A;  2BI1 A;  4LW4 A;  2VMN A;  1D7S A;  1MAP A;  4JEX A;  3D6K A;  3RBL A;  3NYU A;  3F6T A;  3LVL B;  3WGC A;  4E3R A;  1B5P A;  2VGT A;  4PIW A;  1AAM A;  5G4I A;  4ZM3 A;  1OHY A;  1QZ9 A;  3LV2 A;  4PVF A;  1G4V A;  1MLZ A;  5IWQ A;  1H1C A;  1ASG A;  1ZOD A;  2VI8 A;  2VLH A;  2D61 A;  4TN4 A;  3ZZK A;  4DBC A;  2EZ1 A;  3B46 A;  3N0L A;  1U08 A;  5C6U A;  5EQC A;  4DGT A;  1C4K A;  1KL2 A;  3LWS A;  4UHO A;  1TAR A;  1V72 A;  1LW5 A;  1VEF A;  1IJI A;  3JTX A;  2BI9 A;  2BWP A;  1MLY A;  1BKG A;  1RVU A;  3QM2 A;  4WLH A;  3NDN A;  5D95 A;  2QA3 A;  3QHX A;  2E7J A;  3DYD A;  2JJF A;  2XH1 A;  2CB1 A;  3KE3 A;  4JEZ A;  2EH6 A;  5BJ4 A;  3GSB A;  2OGA A;  2XBN A;  4WYF A;  5DX5 A;  2OAT A;  3WCO A;  1GEX A;  4CXR A;  3P6K A;  3FVS A;  3FKD A;  5DB5 A;  1X29 A;  2CJG A;  2YCP A;  5I92 A;  4A0R A;  1W7N A;  3GBX A;  2YKV A;  4OCA A;  3TQX A;  3MAF A;  1TOG A;  1X2A A;  2HOY A;  4FL0 A;  2X3L A;  5G4J A;  1O61 A;  1MDZ A;  1S08 A;  1BQD A;  3CQ4 A;  4UHM A;  2AY9 A;  1ASD A;  3G0T A;  4WYE A;  1DGD A;  2R5C A;  3B8X A;  2GMS A;  3EIA A;  2R2N A;  3I16 A;  4GRX A;  4WYA A;  4ITX A;  3AOV A;  1ARS A;  1YJY A;  1RVY A;  3BB8 A;  3F9T A;  2VMU A;  4F5M A;  3A8U X;  4ZSY A;  4GSA A;  5M49 A;  2HOZ A;  4IX8 A;  1RV4 A;  3M5U A;  2W7H A;  1G7X A;  4Q76 A;  3H7F A;  3COG A;  3DRD A;  1KKP A;  4R8D A;  1IBJ A;  3GJU A;  3MC6 A;  1LKC A;  4A0H A;  5D5S A;  4ZWV A;  1ZOB A;  4Y0I A;  2YKY A;  4ISY A;  2HP1 A;  2V1P A;  2Z9U A;  4IY7 A;  2WK9 A;  2VGZ A;  2R5E A;  3H14 A;  4MKJ A;  4WXF A;  5BJ3 A;  4F5K A;  3R9A A;  2D5Y A;  2AY6 A;  1OHW A;  4W91 A;  3DOD A;  3FZ6 A;  2BIG A;  1PFF A;  2ORD A;  3FVX A;  3DXV A;  1IX7 A;  4IW7 A;  4XJM A;  4XJL A;  1EQB A;  1ELQ A;  3RCH A;  2CTZ A;  4B9B A;  3OP7 A;  3CBF A;  1ASM A;  3NU7 A;  1FC4 A;  1ART A;  2AY7 A;  4WBT A;  2X5F A;  3ELP A;  1I43 A;  2VMP A;  3BS8 A;  4EB7 A;  1ARG A;  2BI2 A;  1ELU A;  2VGW A;  4P3M A;  2ZJG A;  1AY8 A;  2QMA A;  1ARH A;  1I29 A;  1Y4I A;  4Q75 A;  3B1D A;  1ASL A;  1V2E A;  1Z3Z A;  4K2M A;  4U1T A;  3WKR A;  5JAY A;  1BJN A;  1SZK A;  4XJP A;  4OBU A;  3FDD A;  2HUF A;  2Q7W A;  2PB2 A;  3KGX A;  3GR9 A;  2W7F A;  3EI8 A;  2CH2 A;  4WXG A;  3TAT A;  3MAF B;  3JZL A;  1DTY A;  1GEW A;  3GZD A;  2W7J A;  4R5F A;  2W8W A;  1AIC A;  3EI5 A;  4RIZ A;  1SF2 A;  4UQV A;  2JJE A;  4NOG A;  5G2Q A;  3FQ8 A;  3I5T A;  2BWO A;  1CQ7 A;  3AV7 A;  2ZP7 A;  4GE7 A;  2W7G A;  2R5C B;  2YOB A;  1UKJ A;  4E77 A;  3QI6 A;  1ARI A;  5LHA A;  2C44 A;  4ZLV A;  2BIE A;  4JF0 A;  4RAE A;  3HBX A;  3E2Y A;  2YCT A;  2Z67 A;  1AKC A;  1DJ9 A;  1W3U A;  1CS1 A;  1AIB A;  3BWN A;  4ADB A;  1BT4 A;  1S07 A;  2AY1 A;  2C0R A;  4H51 A;  3DR4 A;  5EUE A;  3FFR A;  3JWB A;  4F4E A;  1LC5 A;  3L44 A;  3LG0 A;  5F8V A;  4M2M A;  2BI3 A;  3NTJ A;  2F8J A;  1X0M A;  4JEY A;  2AY2 A;  4EFF A;  5EIG A;  4M2J A;  5E3K A;  1IAY A;  3W1J A;  4IYO A;  1C9C A;  3PA9 A;  3RUY A;  3RCH B;  2X8U A;  3PAA A;  2E7U A;  3VOM A;  1M0P A;  1S06 A;  2ZSL A;  2BHX A;  3LY1 A;  3EI9 A;  1DFO A;  3G7Q A;  3BC8 A;  3FFH A;  2VMV A;  1YIZ A;  3ECD A;  3FD0 A;  4BMK A;  1N8P A;  1SZS A;  2HUU A;  3HMU A;  1YJS A;  2FN6 A;  4OYT A;  1QIT A;  4QGR A;  4A00 A;  2CIN A;  3E2F A;  5HXX A;  1KKJ A;  3BV0 A;  1Z7D A;  4OMA A;  1N2T A;  2CST A;  3AEJ C;  1E5E A;  1O4S A;  1BJW A;  2AY5 A;  2QB3 A;  1GC3 A;  4MY5 A;  1W23 A;  2V0Y A;  2BI5 A;  1I48 A;  1ASN A;  3EZ1 A;  3L8A A;  1BJO A;  3AOW A;  2VMT A;  4IXS A;  3E77 A;  3KKI A;  5DJ1 A;  2AAT A;  2DR1 A;  3DU4 A;  3GET A;  2HP2 A;  3B1C A;  1LC8 A;  1M7Y A;  4ZM4 A;  3FCR A;  1H0C A;  3TFU A;  2VIA A;  1SVV A;  4ZDP A;  4L0O A;  2AY8 A;  4GE4 A;  4PFF A;  1ASF A;  4FFC A;  4ZAS A;  7AAT A;  3K28 A;  1IUG A;  2VMX A;  4RIT A;  2WK7 A;  2BKW A;  3EUC A;  2HZP A;  5HDM A;  4A6R A;  3ZRQ A;  1IVR A;  1C7G A;  2AY4 A;  4Y0D A;  1ASC A;  4W1V A;  3JW9 A;  1E5F A;  4W1X A;  4AO9 A;  1JG8 A;  4ZSW A;  4CBR A;  3IF2 A;  1ORD A;  2RFV A;  2VMW A;  4RM1 A;  5EIG B;  3BWO A;  1B8G A;  1W7M A;  3ELE A;  3RBF A;  1WYU A;  4IYO B;  5M4B A;  1AHY A;  3F0H A;  2GB3 A;  1DGE A;  2YHK A;  3ZZJ A;  1AAW A;  2DKB A;  5FT5 A;  1OAT A;  2W7D A;  3ZRR A;  1AKA A;  1LK9 A;  1TOE A;  4E1O A;  4EU1 A;  1CL2 A;  1AKB A;  2D65 A;  3AEM C;  4IXZ A;  4OTL A;  3ATH A;  3HQT A;  4Y0H A;  2HOX A;  2JJG A;  2QBT A;  3HT4 A;  1QJ3 A;  2OQX A;  3WY7 A;  3VK3 A;  2O1B A;  4MQR A;  4WD2 A;  5FT6 A;  3WZF A;  3ZRP A;  1OXO A;  2DGM A;  4F5F A;  3HLM A;  1B9I A;  2JGT A;  5EUN A;  2D63 A;  3FRK A;  2OKK A;  4AH3 A;  2DGL A;  5HHY A;  4LNJ A;  4F5I A;  1BJO B;  3AEL A;  3A9Y A;  1QIS A;  3EZS A;  1SZU A;  1IX6 A;  4JEV A;  1IX8 A;  5E5I A;  2O0R A;  1VP4 A;  3CQ5 A;  2Z1Y A;  3GWP A;  3NNK A;  4LW2 A;  1YAA A;  3USF A;  3OKS A;  1MAQ A;  2WK8 A;  2E54 A;  1T3I A;  2VMY A;  3WKS A;  1OHV A;  1DJE A;  4RJ0 A;  5LH9 A;  1CQ8 A;  3KGW A;  3VK4 A;  1FG7 A;  4KYO A;  4MSO A;  3MBB A;  1SFF A;  1UU1 A;  1W7L A;  4AZK A;  1M6S A;  1D2F A;  5G2P A;  3CQ6 A;  1X28 A;  2YRI A;  4UOY A;  2W8T A;  1AY4 A;  3GZC A;  4BQ0 A;  1AY5 A;  2GMU A;  2Z1Z A;  3MAU A;  1B5O A;  3WCN A;  5DJ9 A;  4KAM A;  2ZUK A;  1BJ4 A;  4I8A A;  1G7W A;  3R4T A;  1CJ0 A;  1MGV A;  1J32 A;  2W7L A;  2ZSM A;  1YOO A;  3DXW A;  1TAS A;  2CAN A;  2D66 A;  1KL1 A;  2VMR A;  1QIR A;  3E2Z A;  3N5M A;  4P7Y A;  2D7Z A;  4XQ2 A;  4CVQ A;  1AMR A;  1LS3 A;  3PPL A;  3HL2 A;  4EMY A;  1TOK A;  3A2B A;  1WYU B;  3AEO A;  2FNU A;  5K8B A;  3AEP A;  3W1I A;  2VYC A;  1AMS A;  5EAV A;  1GD9 A;  2O7C A;  4MQQ A;  1O69 A;  1S09 A;  2WKA A;  1M0Q A;  1CZE A;  1MDO A;  2Z9W A;  4ITG A;  3HDO A;  4WB0 A;  4WYD A;  2D7Y A;  4R5Z A;  4BA4 A;  4W1W A;  4CBS A;  4E3Q A;  3FVU A;  2ZC0 A;  2DGK A;  3A9Z A;  4A6U A;  2ZY4 A;  4GEB A;  1GC0 A;  2VIB A;  5FT8 A;  3QGU A;  5AX8 A;  2DKJ A;  1AHG A;  2EO5 A;  1WST A;  3EIB A;  3JU7 A;  2EPJ A;  1MDX A;  3MC6 C;  2VLF A;  3FQ7 A;  3PGY A;  1OXP A;  2W7M A;  4PFN A;  4WLJ A;  4ZAH A;  8AAT A;  2PO3 A;  2W7K A;  3FZ8 A;  2BYL A;  3I4J A;  2EGY A;  4F5H A;  3II0 A;  4JE5 A;  3WLX A;  1GBN A;  1S0A A;  1RV3 A;  3FQA A;  3NUB A;  1TAT A;  2FYF A;  3FZ7 A;  1WYT A;  2AEU A;  4O6Z A;  1EG5 A;  3DZZ A;  3ACZ A;  3PJ0 A;  5FT4 A;  2YKX A;  3VP6 A;  1WKG A;  9AAT A;  1YJZ A;  3QBO A;  2G6W A;  3UAK A;  1M32 A;  4N0B A;  4Q6R A;  2VGV A;  1JS6 A;  2VMQ A;  1SPA A;  2YRR A;  1WYV A;  2W7E A;  4BHD A;  3NX3 A;  4RLG A;  2DOU A;  4JE5 D;  5EAA A;  2VGU A;  3AAT A;  3PIU A;  1PMO A;  2NMP A;  4OBV A;  4AOA A;  1C7O A;  2VMO A;  4ZDO A;  1UU0 A;  2FNI A;  1GCK A;  2ZYJ A;  3NYS A;  4F5G A;  3E2Z B;  2GSA A;  2CH1 A;  4JEW A;  3LVM A;  2OGE A;  2ZY3 A;  1AJS A;  1CL1 A;  2VGS A;  3FTB A;  3GZD C;  2TPL A;  4U2H A;  4EB5 A;  3BCA A;  3E6G A;  4UHN A;  4AZJ A;  3E9K A;  1YIY A;  2W7I A;  4OC9 A;  2C81 A;  4A6T A;  2CY8 A;  3Q8N A;  2ZY2 A;  1JS3 A;  4WB0 B;  2YKU A;  5J8Q A;  4HF8 A;  3W1H A;  3NU8 A;  3PDB A;  4ADE A;  4A0G A;  3CAI A;  2QB2 A;  1ASA A;  1J04 A;  1C0N A;  2Z9X A;  3PD6 A;  4MKK A;  2YCN A;  1TPL A;  2Z9V A;  1DJU A;  1QJ5 A;  3LVK A;  4WYC A;  2R0T A;  3BWN C;  2AY3 A;  1DKA A;  4B98 A;  1GC2 A;  1BW0 A;  1V2F A;  2VMS A;  3NYT A;  4LNM A;  1EJI A;  4XAU A;  1AMQ A;  2CJD A;  2JG2 A;  3TFT A;  2HOR A;  4MQP A;  2ZY5 A;  3B1E A;  2C7T A;  5G0A A;  3K40 A;  1WYT B; 
#chains in the Genus database with same CATH topology
 1YNU A;  1GDE A;  1ASE A;  3TCM A;  4J8L A;  3UE8 A;  4BA5 A;  2BIA A;  2D64 A;  4TMR A;  4RKC A;  4N0W A;  4ADD A;  2AEV A;  3AEN A;  1AJR A;  4LC3 A;  5TF5 A;  1GEY A;  1XI9 A;  4F5J A;  4RKD A;  5M46 A;  4WYG A;  1WYV B;  3JWA A;  2WB6 A;  1CQ6 A;  2CFB A;  1B9H A;  5EFS A;  1PMM A;  3EI6 A;  2OKJ A;  1CZC A;  1M4N A;  1XEY A;  4F5L A;  4XJO A;  1AHX A;  3AEJ A;  5E4Z A;  3RI6 A;  2BYJ A;  1LW4 A;  4ZDL A;  1VJO A;  3MAD A;  3QN6 A;  4ATP A;  1AJS B;  3QPG A;  4K2B A;  1O62 A;  1TOI A;  4MGR A;  3MKJ A;  4RJY A;  1B4X A;  1FG3 A;  4GE9 A;  4W5K A;  3K7Y A;  2PB0 A;  1BQA A;  3IHJ A;  1JF9 A;  1ZC9 A;  2HUI A;  2FM1 A;  2VI9 A;  4IXO A;  1AMA A;  4W8I A;  1M0O A;  4GDY A;  3VK2 A;  4CXQ A;  4AO4 A;  4DQ6 A;  3PDX A;  4OT8 A;  5M4D A;  3BCX A;  5EUD A;  1D7V A;  1WKH A;  4A0F A;  2W8U A;  3BCB A;  4XK1 A;  3PDB B;  3G8M A;  2QLR A;  3PD6 B;  1PG8 A;  1UU2 A;  3ASB A;  1GC4 A;  4ATQ A;  4R2N A;  3NUI A;  3P1T A;  4WXB A;  1N31 A;  1KMJ A;  2W8V A;  1ECX A;  1G4X A;  1IAX A;  4KXK A;  2FQ6 A;  1ASB A;  2FKI A;  1M0N A;  1QGN A;  1BS0 A;  2JJH A;  3FDB A;  1P3W A;  4TV7 A;  3RQ1 A;  2E7I A;  3EI7 A;  3MEB A;  2JIS A;  4J5U A;  1KMK A;  2Z20 A;  3FSL A;  3NRA A;  5G09 A;  1AHE A;  3A9X A;  1D7U A;  2X5D A;  5F9S A;  1V2D A;  1I41 A;  3BN1 A;  1AX4 A;  3HVY A;  2GQN A;  3WX9 A;  4M2K A;  1AIA A;  4XEW A;  2EZ2 A;  3AEN B;  3ISL A;  1TOJ A;  4JF1 A;  3WGB A;  3DC1 A;  3DR7 A;  4A72 A;  3AEM A;  2Z61 A;  3LVJ A;  3N75 A;  4Q31 A;  3T32 A;  1C7N A;  3UWC A;  3VAX A;  4HVK A;  4ZWM A;  4WP0 A;  1D7R A;  2VMZ A;  1AHF A;  4K2I A;  4LNL A;  1LC7 A;  2W8J A;  4ADC A;  3ASA A;  2BWN A;  2CJH A;  2BI1 A;  4LW4 A;  2VMN A;  1D7S A;  1MAP A;  4JEX A;  3D6K A;  3RBL A;  3NYU A;  3F6T A;  3LVL B;  3WGC A;  4E3R A;  1B5P A;  2VGT A;  4PIW A;  1AAM A;  5G4I A;  4ZM3 A;  1OHY A;  1QZ9 A;  3LV2 A;  4PVF A;  1G4V A;  1MLZ A;  5IWQ A;  1H1C A;  1ASG A;  1ZOD A;  2VI8 A;  2VLH A;  2D61 A;  4TN4 A;  3ZZK A;  4DBC A;  2EZ1 A;  3B46 A;  3N0L A;  1U08 A;  5C6U A;  5EQC A;  4DGT A;  1C4K A;  1KL2 A;  3LWS A;  4UHO A;  1TAR A;  1V72 A;  1LW5 A;  1VEF A;  1IJI A;  3JTX A;  2BI9 A;  2BWP A;  1MLY A;  1BKG A;  1RVU A;  3QM2 A;  4WLH A;  3NDN A;  5D95 A;  2QA3 A;  3QHX A;  2E7J A;  3DYD A;  2JJF A;  2XH1 A;  2CB1 A;  3KE3 A;  4JEZ A;  2EH6 A;  5BJ4 A;  3GSB A;  2OGA A;  2XBN A;  4WYF A;  5DX5 A;  2OAT A;  3WCO A;  1GEX A;  4CXR A;  3P6K A;  3FVS A;  3FKD A;  5DB5 A;  1X29 A;  2CJG A;  2YCP A;  5I92 A;  4A0R A;  1W7N A;  3GBX A;  2YKV A;  4OCA A;  3TQX A;  3MAF A;  1TOG A;  1X2A A;  2HOY A;  4FL0 A;  2X3L A;  5G4J A;  1O61 A;  1MDZ A;  1S08 A;  1BQD A;  3CQ4 A;  4UHM A;  2AY9 A;  1ASD A;  3G0T A;  4WYE A;  1DGD A;  2R5C A;  3B8X A;  2GMS A;  3EIA A;  2R2N A;  3I16 A;  4GRX A;  4WYA A;  4ITX A;  3AOV A;  1ARS A;  1YJY A;  1RVY A;  3BB8 A;  3F9T A;  2VMU A;  4F5M A;  3A8U X;  4ZSY A;  4GSA A;  5M49 A;  2HOZ A;  4IX8 A;  1RV4 A;  3M5U A;  2W7H A;  1G7X A;  4Q76 A;  3H7F A;  3COG A;  3DRD A;  1KKP A;  4R8D A;  1IBJ A;  3GJU A;  3MC6 A;  1LKC A;  4A0H A;  5D5S A;  4ZWV A;  1ZOB A;  4Y0I A;  3N7N A;  4K05 A;  2YKY A;  4ISY A;  2HP1 A;  2V1P A;  2Z9U A;  4IY7 A;  2WK9 A;  2VGZ A;  2R5E A;  3H14 A;  4MKJ A;  4WXF A;  5BJ3 A;  4H63 Q;  4F5K A;  3R9A A;  2D5Y A;  2AY6 A;  1OHW A;  4W91 A;  3DOD A;  3FZ6 A;  2BIG A;  1PFF A;  2ORD A;  3FVX A;  3DXV A;  1IX7 A;  4IW7 A;  4XJM A;  4XJL A;  1EQB A;  1ELQ A;  3RCH A;  2CTZ A;  4B9B A;  3OP7 A;  3CBF A;  1ASM A;  3NU7 A;  1FC4 A;  1ART A;  2AY7 A;  4WBT A;  2X5F A;  3ELP A;  1I43 A;  2VMP A;  3BS8 A;  4EB7 A;  1ARG A;  2BI2 A;  1ELU A;  2VGW A;  4P3M A;  2ZJG A;  1AY8 A;  2QMA A;  1ARH A;  1I29 A;  1Y4I A;  4Q75 A;  3B1D A;  1ASL A;  1V2E A;  1Z3Z A;  4K2M A;  4U1T A;  3WKR A;  5JAY A;  1BJN A;  1SZK A;  4XJP A;  4OBU A;  3FDD A;  2HUF A;  2Q7W A;  2PB2 A;  3KGX A;  3GR9 A;  2W7F A;  3EI8 A;  2CH2 A;  4WXG A;  3TAT A;  3MAF B;  3JZL A;  3N4R A;  1DTY A;  1GEW A;  3GZD A;  2W7J A;  4R5F A;  2W8W A;  1AIC A;  3EI5 A;  4RIZ A;  1SF2 A;  4UQV A;  2JJE A;  4NOG A;  5G2Q A;  3FQ8 A;  3I5T A;  2BWO A;  1CQ7 A;  3AV7 A;  2ZP7 A;  4GE7 A;  2W7G A;  2R5C B;  2YOB A;  1UKJ A;  4E77 A;  3QI6 A;  1ARI A;  5LHA A;  2C44 A;  4ZLV A;  2BIE A;  4JF0 A;  4RAE A;  3HBX A;  3E2Y A;  2YCT A;  2Z67 A;  1AKC A;  1DJ9 A;  1W3U A;  1CS1 A;  1AIB A;  3BWN A;  4ADB A;  1BT4 A;  1S07 A;  2AY1 A;  2C0R A;  4H51 A;  3DR4 A;  5EUE A;  3FFR A;  3JWB A;  4F4E A;  1LC5 A;  3L44 A;  3LG0 A;  5F8V A;  4M2M A;  2BI3 A;  3NTJ A;  2F8J A;  1X0M A;  4JEY A;  2AY2 A;  4EFF A;  5EIG A;  4M2J A;  5E3K A;  1IAY A;  3W1J A;  4IYO A;  1C9C A;  3PA9 A;  3RUY A;  3RCH B;  2X8U A;  3PAA A;  2E7U A;  3VOM A;  1M0P A;  1S06 A;  2ZSL A;  2BHX A;  3LY1 A;  3EI9 A;  1DFO A;  3G7Q A;  3BC8 A;  3FFH A;  2VMV A;  1YIZ A;  3ECD A;  3FD0 A;  4BMK A;  1N8P A;  1SZS A;  2HUU A;  3HMU A;  1YJS A;  2FN6 A;  4OYT A;  1QIT A;  4QGR A;  4A00 A;  2CIN A;  3E2F A;  5HXX A;  2EYQ A;  1KKJ A;  3BV0 A;  1Z7D A;  4OMA A;  1N2T A;  2CST A;  3AEJ C;  1E5E A;  1O4S A;  1BJW A;  2AY5 A;  2QB3 A;  1GC3 A;  4MY5 A;  1W23 A;  2V0Y A;  2BI5 A;  1I48 A;  1ASN A;  3EZ1 A;  3L8A A;  1BJO A;  3AOW A;  2VMT A;  4IXS A;  3E77 A;  3KKI A;  5DJ1 A;  2AAT A;  2DR1 A;  3DU4 A;  3GET A;  2HP2 A;  3B1C A;  1LC8 A;  1M7Y A;  4ZM4 A;  3FCR A;  1H0C A;  3TFU A;  2VIA A;  1SVV A;  4ZDP A;  4L0O A;  2AY8 A;  4GE4 A;  4PFF A;  1ASF A;  4FFC A;  4ZAS A;  7AAT A;  3K28 A;  1IUG A;  2VMX A;  4RIT A;  2WK7 A;  2BKW A;  3EUC A;  2HZP A;  5HDM A;  4A6R A;  3ZRQ A;  1IVR A;  1C7G A;  2AY4 A;  4Y0D A;  1ASC A;  4W1V A;  3JW9 A;  1E5F A;  4W1X A;  4AO9 A;  1JG8 A;  4ZSW A;  4CBR A;  3IF2 A;  1ORD A;  2RFV A;  2VMW A;  4RM1 A;  5EIG B;  3BWO A;  1B8G A;  1W7M A;  3ELE A;  3RBF A;  1WYU A;  4IYO B;  5M4B A;  1AHY A;  3F0H A;  2GB3 A;  1DGE A;  2YHK A;  3ZZJ A;  1AAW A;  2DKB A;  5FT5 A;  1OAT A;  2W7D A;  3ZRR A;  1AKA A;  1LK9 A;  1TOE A;  4E1O A;  4EU1 A;  1CL2 A;  1AKB A;  2D65 A;  3AEM C;  4IXZ A;  4OTL A;  3ATH A;  3HQT A;  4Y0H A;  2HOX A;  2JJG A;  2QBT A;  3HT4 A;  1QJ3 A;  2A1V A;  2OQX A;  3WY7 A;  3VK3 A;  2O1B A;  4MQR A;  4WD2 A;  5FT6 A;  3WZF A;  3ZRP A;  1OXO A;  2DGM A;  4F5F A;  3HLM A;  1B9I A;  2JGT A;  5EUN A;  2D63 A;  3FRK A;  2OKK A;  4AH3 A;  2DGL A;  5HHY A;  4LNJ A;  4F5I A;  1BJO B;  3AEL A;  3A9Y A;  1QIS A;  3EZS A;  1SZU A;  1IX6 A;  4JEV A;  1IX8 A;  5E5I A;  2O0R A;  1VP4 A;  3CQ5 A;  2Z1Y A;  3GWP A;  3NNK A;  4LW2 A;  1YAA A;  3USF A;  3OKS A;  1MAQ A;  2WK8 A;  2E54 A;  1T3I A;  2VMY A;  3WKS A;  1OHV A;  1DJE A;  4RJ0 A;  3N4X A;  5LH9 A;  1CQ8 A;  3KGW A;  3VK4 A;  1FG7 A;  4KYO A;  4MSO A;  3MBB A;  1SFF A;  1UU1 A;  2G7J A;  1W7L A;  4AZK A;  1M6S A;  1D2F A;  5G2P A;  3CQ6 A;  1X28 A;  2YRI A;  4UOY A;  2W8T A;  1AY4 A;  3GZC A;  4BQ0 A;  1AY5 A;  2KFP A;  2GMU A;  2Z1Z A;  3MAU A;  1B5O A;  3WCN A;  5DJ9 A;  4KAM A;  2ZUK A;  1BJ4 A;  4I8A A;  1G7W A;  3R4T A;  1CJ0 A;  1MGV A;  1J32 A;  2W7L A;  2ZSM A;  1YOO A;  3DXW A;  1TAS A;  2CAN A;  2D66 A;  1KL1 A;  2VMR A;  1QIR A;  3E2Z A;  3N5M A;  4P7Y A;  2D7Z A;  4XQ2 A;  4CVQ A;  1AMR A;  1LS3 A;  3PPL A;  3HL2 A;  4EMY A;  1TOK A;  3A2B A;  1WYU B;  3AEO A;  2FNU A;  5K8B A;  3AEP A;  3W1I A;  2VYC A;  1AMS A;  5EAV A;  1GD9 A;  2O7C A;  4MQQ A;  1O69 A;  1S09 A;  2WKA A;  1M0Q A;  1CZE A;  1MDO A;  2Z9W A;  4ITG A;  3HDO A;  4WB0 A;  4WYD A;  2D7Y A;  4R5Z A;  4BA4 A;  4W1W A;  4CBS A;  4E3Q A;  3FVU A;  2ZC0 A;  2DGK A;  3A9Z A;  4A6U A;  2ZY4 A;  4GEB A;  1GC0 A;  2VIB A;  5FT8 A;  3QGU A;  5AX8 A;  2DKJ A;  1AHG A;  2EO5 A;  1WST A;  3EIB A;  3JU7 A;  2EPJ A;  1MDX A;  3MC6 C;  2VLF A;  3FQ7 A;  3PGY A;  1OXP A;  2W7M A;  4PFN A;  4WLJ A;  4ZAH A;  8AAT A;  5KTB A;  2PO3 A;  2W7K A;  3FZ8 A;  2BYL A;  3I4J A;  2EGY A;  3H9X A;  4F5H A;  3II0 A;  4JE5 A;  3WLX A;  1GBN A;  1S0A A;  1RV3 A;  3FQA A;  3NUB A;  1TAT A;  2FYF A;  3FZ7 A;  1WYT A;  2AEU A;  4O6Z A;  1EG5 A;  3DZZ A;  3ACZ A;  3PJ0 A;  5FT4 A;  2YKX A;  3VP6 A;  1WKG A;  9AAT A;  1YJZ A;  3QBO A;  2G6W A;  3UAK A;  3N4S A;  1M32 A;  4N0B A;  4Q6R A;  2VGV A;  1JS6 A;  2VMQ A;  1SPA A;  2YRR A;  1WYV A;  2W7E A;  4BHD A;  3NX3 A;  4RLG A;  2DOU A;  4JE5 D;  5EAA A;  2VGU A;  3AAT A;  3PIU A;  1PMO A;  2NMP A;  4OBV A;  4AOA A;  1C7O A;  2VMO A;  4ZDO A;  1UU0 A;  2FNI A;  1GCK A;  2ZYJ A;  3NYS A;  4F5G A;  3E2Z B;  2GSA A;  2CH1 A;  4JEW A;  3LVM A;  2OGE A;  2ZY3 A;  1AJS A;  1CL1 A;  2VGS A;  3FTB A;  3GZD C;  2TPL A;  4U2H A;  4EB5 A;  3BCA A;  3E6G A;  4UHN A;  4AZJ A;  3E9K A;  1YIY A;  2W7I A;  4OC9 A;  2C81 A;  4A6T A;  2CY8 A;  3Q8N A;  2ZY2 A;  1JS3 A;  4WB0 B;  2YKU A;  5J8Q A;  4HF8 A;  3W1H A;  3NU8 A;  3PDB A;  4ADE A;  4A0G A;  3CAI A;  2QB2 A;  1ASA A;  1J04 A;  1C0N A;  2Z9X A;  3PD6 A;  4MKK A;  2YCN A;  1TPL A;  2Z9V A;  1DJU A;  2QSR A;  1QJ5 A;  3LVK A;  4WYC A;  2R0T A;  3BWN C;  2AY3 A;  1DKA A;  4B98 A;  1GC2 A;  1BW0 A;  1V2F A;  2VMS A;  3NYT A;  4LNM A;  1EJI A;  4XAU A;  1KAF A;  1AMQ A;  2CJD A;  2JG2 A;  3TFT A;  2HOR A;  4MQP A;  2ZY5 A;  3B1E A;  2C7T A;  5G0A A;  3K40 A;  1WYT B; 
#chains in the Genus database with same CATH homology
 1YNU A;  1GDE A;  1ASE A;  3TCM A;  4J8L A;  3UE8 A;  4BA5 A;  2BIA A;  2D64 A;  4TMR A;  4RKC A;  4N0W A;  4ADD A;  2AEV A;  3AEN A;  1AJR A;  4LC3 A;  5TF5 A;  1GEY A;  1XI9 A;  4F5J A;  4RKD A;  5M46 A;  4WYG A;  1WYV B;  3JWA A;  2WB6 A;  1CQ6 A;  2CFB A;  1B9H A;  5EFS A;  1PMM A;  3EI6 A;  2OKJ A;  1CZC A;  1M4N A;  1XEY A;  4F5L A;  4XJO A;  1AHX A;  3AEJ A;  5E4Z A;  3RI6 A;  2BYJ A;  1LW4 A;  4ZDL A;  1VJO A;  3MAD A;  3QN6 A;  4ATP A;  1AJS B;  3QPG A;  4K2B A;  1O62 A;  1TOI A;  4MGR A;  3MKJ A;  4RJY A;  1B4X A;  1FG3 A;  4GE9 A;  4W5K A;  3K7Y A;  2PB0 A;  1BQA A;  3IHJ A;  1JF9 A;  1ZC9 A;  2HUI A;  2FM1 A;  2VI9 A;  4IXO A;  1AMA A;  4W8I A;  1M0O A;  4GDY A;  3VK2 A;  4CXQ A;  4AO4 A;  4DQ6 A;  3PDX A;  4OT8 A;  5M4D A;  3BCX A;  5EUD A;  1D7V A;  1WKH A;  4A0F A;  2W8U A;  3BCB A;  4XK1 A;  3PDB B;  3G8M A;  2QLR A;  3PD6 B;  1PG8 A;  1UU2 A;  3ASB A;  1GC4 A;  4ATQ A;  4R2N A;  3NUI A;  3P1T A;  4WXB A;  1N31 A;  1KMJ A;  2W8V A;  1ECX A;  1G4X A;  1IAX A;  4KXK A;  2FQ6 A;  1ASB A;  2FKI A;  1M0N A;  1QGN A;  1BS0 A;  2JJH A;  3FDB A;  1P3W A;  4TV7 A;  3RQ1 A;  2E7I A;  3EI7 A;  3MEB A;  2JIS A;  4J5U A;  1KMK A;  2Z20 A;  3FSL A;  3NRA A;  5G09 A;  1AHE A;  3A9X A;  1D7U A;  2X5D A;  5F9S A;  1V2D A;  1I41 A;  3BN1 A;  1AX4 A;  3HVY A;  2GQN A;  3WX9 A;  4M2K A;  1AIA A;  4XEW A;  2EZ2 A;  3AEN B;  3ISL A;  1TOJ A;  4JF1 A;  3WGB A;  3DC1 A;  3DR7 A;  4A72 A;  3AEM A;  2Z61 A;  3LVJ A;  3N75 A;  4Q31 A;  3T32 A;  1C7N A;  3UWC A;  3VAX A;  4HVK A;  4ZWM A;  4WP0 A;  1D7R A;  2VMZ A;  1AHF A;  4K2I A;  4LNL A;  1LC7 A;  2W8J A;  4ADC A;  3ASA A;  2BWN A;  2CJH A;  2BI1 A;  4LW4 A;  2VMN A;  1D7S A;  1MAP A;  4JEX A;  3D6K A;  3RBL A;  3NYU A;  3F6T A;  3LVL B;  3WGC A;  4E3R A;  1B5P A;  2VGT A;  4PIW A;  1AAM A;  5G4I A;  4ZM3 A;  1OHY A;  1QZ9 A;  3LV2 A;  4PVF A;  1G4V A;  1MLZ A;  5IWQ A;  1H1C A;  1ASG A;  1ZOD A;  2VI8 A;  2VLH A;  2D61 A;  4TN4 A;  3ZZK A;  4DBC A;  2EZ1 A;  3B46 A;  3N0L A;  1U08 A;  5C6U A;  5EQC A;  4DGT A;  1C4K A;  1KL2 A;  3LWS A;  4UHO A;  1TAR A;  1V72 A;  1LW5 A;  1VEF A;  1IJI A;  3JTX A;  2BI9 A;  2BWP A;  1MLY A;  1BKG A;  1RVU A;  3QM2 A;  4WLH A;  3NDN A;  5D95 A;  2QA3 A;  3QHX A;  2E7J A;  3DYD A;  2JJF A;  2XH1 A;  2CB1 A;  3KE3 A;  4JEZ A;  2EH6 A;  5BJ4 A;  3GSB A;  2OGA A;  2XBN A;  4WYF A;  5DX5 A;  2OAT A;  3WCO A;  1GEX A;  4CXR A;  3P6K A;  3FVS A;  3FKD A;  5DB5 A;  1X29 A;  2CJG A;  2YCP A;  5I92 A;  4A0R A;  1W7N A;  3GBX A;  2YKV A;  4OCA A;  3TQX A;  3MAF A;  1TOG A;  1X2A A;  2HOY A;  4FL0 A;  2X3L A;  5G4J A;  1O61 A;  1MDZ A;  1S08 A;  1BQD A;  3CQ4 A;  4UHM A;  2AY9 A;  1ASD A;  3G0T A;  4WYE A;  1DGD A;  2R5C A;  3B8X A;  2GMS A;  3EIA A;  2R2N A;  3I16 A;  4GRX A;  4WYA A;  4ITX A;  3AOV A;  1ARS A;  1YJY A;  1RVY A;  3BB8 A;  3F9T A;  2VMU A;  4F5M A;  3A8U X;  4ZSY A;  4GSA A;  5M49 A;  2HOZ A;  4IX8 A;  1RV4 A;  3M5U A;  2W7H A;  1G7X A;  4Q76 A;  3H7F A;  3COG A;  3DRD A;  1KKP A;  4R8D A;  1IBJ A;  3GJU A;  3MC6 A;  1LKC A;  4A0H A;  5D5S A;  4ZWV A;  1ZOB A;  4Y0I A;  3N7N A;  4K05 A;  2YKY A;  4ISY A;  2HP1 A;  2V1P A;  2Z9U A;  4IY7 A;  2WK9 A;  2VGZ A;  2R5E A;  3H14 A;  4MKJ A;  4WXF A;  5BJ3 A;  4H63 Q;  4F5K A;  3R9A A;  2D5Y A;  2AY6 A;  1OHW A;  4W91 A;  3DOD A;  3FZ6 A;  2BIG A;  1PFF A;  2ORD A;  3FVX A;  3DXV A;  1IX7 A;  4IW7 A;  4XJM A;  4XJL A;  1EQB A;  1ELQ A;  3RCH A;  2CTZ A;  4B9B A;  3OP7 A;  3CBF A;  1ASM A;  3NU7 A;  1FC4 A;  1ART A;  2AY7 A;  4WBT A;  2X5F A;  3ELP A;  1I43 A;  2VMP A;  3BS8 A;  4EB7 A;  1ARG A;  2BI2 A;  1ELU A;  2VGW A;  4P3M A;  2ZJG A;  1AY8 A;  2QMA A;  1ARH A;  1I29 A;  1Y4I A;  4Q75 A;  3B1D A;  1ASL A;  1V2E A;  1Z3Z A;  4K2M A;  4U1T A;  3WKR A;  5JAY A;  1BJN A;  1SZK A;  4XJP A;  4OBU A;  3FDD A;  2HUF A;  2Q7W A;  2PB2 A;  3KGX A;  3GR9 A;  2W7F A;  3EI8 A;  2CH2 A;  4WXG A;  3TAT A;  3MAF B;  3JZL A;  3N4R A;  1DTY A;  1GEW A;  3GZD A;  2W7J A;  4R5F A;  2W8W A;  1AIC A;  3EI5 A;  4RIZ A;  1SF2 A;  4UQV A;  2JJE A;  4NOG A;  5G2Q A;  3FQ8 A;  3I5T A;  2BWO A;  1CQ7 A;  3AV7 A;  2ZP7 A;  4GE7 A;  2W7G A;  2R5C B;  2YOB A;  1UKJ A;  4E77 A;  3QI6 A;  1ARI A;  5LHA A;  2C44 A;  4ZLV A;  2BIE A;  4JF0 A;  4RAE A;  3HBX A;  3E2Y A;  2YCT A;  2Z67 A;  1AKC A;  1DJ9 A;  1W3U A;  1CS1 A;  1AIB A;  3BWN A;  4ADB A;  1BT4 A;  1S07 A;  2AY1 A;  2C0R A;  4H51 A;  3DR4 A;  5EUE A;  3FFR A;  3JWB A;  4F4E A;  1LC5 A;  3L44 A;  3LG0 A;  5F8V A;  4M2M A;  2BI3 A;  3NTJ A;  2F8J A;  1X0M A;  4JEY A;  2AY2 A;  4EFF A;  5EIG A;  4M2J A;  5E3K A;  1IAY A;  3W1J A;  4IYO A;  1C9C A;  3PA9 A;  3RUY A;  3RCH B;  2X8U A;  3PAA A;  2E7U A;  3VOM A;  1M0P A;  1S06 A;  2ZSL A;  2BHX A;  3LY1 A;  3EI9 A;  1DFO A;  3G7Q A;  3BC8 A;  3FFH A;  2VMV A;  1YIZ A;  3ECD A;  3FD0 A;  4BMK A;  1N8P A;  1SZS A;  2HUU A;  3HMU A;  1YJS A;  2FN6 A;  4OYT A;  1QIT A;  4QGR A;  4A00 A;  2CIN A;  3E2F A;  5HXX A;  2EYQ A;  1KKJ A;  3BV0 A;  1Z7D A;  4OMA A;  1N2T A;  2CST A;  3AEJ C;  1E5E A;  1O4S A;  1BJW A;  2AY5 A;  2QB3 A;  1GC3 A;  4MY5 A;  1W23 A;  2V0Y A;  2BI5 A;  1I48 A;  1ASN A;  3EZ1 A;  3L8A A;  1BJO A;  3AOW A;  2VMT A;  4IXS A;  3E77 A;  3KKI A;  5DJ1 A;  2AAT A;  2DR1 A;  3DU4 A;  3GET A;  2HP2 A;  3B1C A;  1LC8 A;  1M7Y A;  4ZM4 A;  3FCR A;  1H0C A;  3TFU A;  2VIA A;  1SVV A;  4ZDP A;  4L0O A;  2AY8 A;  4GE4 A;  4PFF A;  1ASF A;  4FFC A;  4ZAS A;  7AAT A;  3K28 A;  1IUG A;  2VMX A;  4RIT A;  2WK7 A;  2BKW A;  3EUC A;  2HZP A;  5HDM A;  4A6R A;  3ZRQ A;  1IVR A;  1C7G A;  2AY4 A;  4Y0D A;  1ASC A;  4W1V A;  3JW9 A;  1E5F A;  4W1X A;  4AO9 A;  1JG8 A;  4ZSW A;  4CBR A;  3IF2 A;  1ORD A;  2RFV A;  2VMW A;  4RM1 A;  5EIG B;  3BWO A;  1B8G A;  1W7M A;  3ELE A;  3RBF A;  1WYU A;  4IYO B;  5M4B A;  1AHY A;  3F0H A;  2GB3 A;  1DGE A;  2YHK A;  3ZZJ A;  1AAW A;  2DKB A;  5FT5 A;  1OAT A;  2W7D A;  3ZRR A;  1AKA A;  1LK9 A;  1TOE A;  4E1O A;  4EU1 A;  1CL2 A;  1AKB A;  2D65 A;  3AEM C;  4IXZ A;  4OTL A;  3ATH A;  3HQT A;  4Y0H A;  2HOX A;  2JJG A;  2QBT A;  3HT4 A;  1QJ3 A;  2A1V A;  2OQX A;  3WY7 A;  3VK3 A;  2O1B A;  4MQR A;  4WD2 A;  5FT6 A;  3WZF A;  3ZRP A;  1OXO A;  2DGM A;  4F5F A;  3HLM A;  1B9I A;  2JGT A;  5EUN A;  2D63 A;  3FRK A;  2OKK A;  4AH3 A;  2DGL A;  5HHY A;  4LNJ A;  4F5I A;  1BJO B;  3AEL A;  3A9Y A;  1QIS A;  3EZS A;  1SZU A;  1IX6 A;  4JEV A;  1IX8 A;  5E5I A;  2O0R A;  1VP4 A;  3CQ5 A;  2Z1Y A;  3GWP A;  3NNK A;  4LW2 A;  1YAA A;  3USF A;  3OKS A;  1MAQ A;  2WK8 A;  2E54 A;  1T3I A;  2VMY A;  3WKS A;  1OHV A;  1DJE A;  4RJ0 A;  3N4X A;  5LH9 A;  1CQ8 A;  3KGW A;  3VK4 A;  1FG7 A;  4KYO A;  4MSO A;  3MBB A;  1SFF A;  1UU1 A;  2G7J A;  1W7L A;  4AZK A;  1M6S A;  1D2F A;  5G2P A;  3CQ6 A;  1X28 A;  2YRI A;  4UOY A;  2W8T A;  1AY4 A;  3GZC A;  4BQ0 A;  1AY5 A;  2KFP A;  2GMU A;  2Z1Z A;  3MAU A;  1B5O A;  3WCN A;  5DJ9 A;  4KAM A;  2ZUK A;  1BJ4 A;  4I8A A;  1G7W A;  3R4T A;  1CJ0 A;  1MGV A;  1J32 A;  2W7L A;  2ZSM A;  1YOO A;  3DXW A;  1TAS A;  2CAN A;  2D66 A;  1KL1 A;  2VMR A;  1QIR A;  3E2Z A;  3N5M A;  4P7Y A;  2D7Z A;  4XQ2 A;  4CVQ A;  1AMR A;  1LS3 A;  3PPL A;  3HL2 A;  4EMY A;  1TOK A;  3A2B A;  1WYU B;  3AEO A;  2FNU A;  5K8B A;  3AEP A;  3W1I A;  2VYC A;  1AMS A;  5EAV A;  1GD9 A;  2O7C A;  4MQQ A;  1O69 A;  1S09 A;  2WKA A;  1M0Q A;  1CZE A;  1MDO A;  2Z9W A;  4ITG A;  3HDO A;  4WB0 A;  4WYD A;  2D7Y A;  4R5Z A;  4BA4 A;  4W1W A;  4CBS A;  4E3Q A;  3FVU A;  2ZC0 A;  2DGK A;  3A9Z A;  4A6U A;  2ZY4 A;  4GEB A;  1GC0 A;  2VIB A;  5FT8 A;  3QGU A;  5AX8 A;  2DKJ A;  1AHG A;  2EO5 A;  1WST A;  3EIB A;  3JU7 A;  2EPJ A;  1MDX A;  3MC6 C;  2VLF A;  3FQ7 A;  3PGY A;  1OXP A;  2W7M A;  4PFN A;  4WLJ A;  4ZAH A;  8AAT A;  5KTB A;  2PO3 A;  2W7K A;  3FZ8 A;  2BYL A;  3I4J A;  2EGY A;  3H9X A;  4F5H A;  3II0 A;  4JE5 A;  3WLX A;  1GBN A;  1S0A A;  1RV3 A;  3FQA A;  3NUB A;  1TAT A;  2FYF A;  3FZ7 A;  1WYT A;  2AEU A;  4O6Z A;  1EG5 A;  3DZZ A;  3ACZ A;  3PJ0 A;  5FT4 A;  2YKX A;  3VP6 A;  1WKG A;  9AAT A;  1YJZ A;  3QBO A;  2G6W A;  3UAK A;  3N4S A;  1M32 A;  4N0B A;  4Q6R A;  2VGV A;  1JS6 A;  2VMQ A;  1SPA A;  2YRR A;  1WYV A;  2W7E A;  4BHD A;  3NX3 A;  4RLG A;  2DOU A;  4JE5 D;  5EAA A;  2VGU A;  3AAT A;  3PIU A;  1PMO A;  2NMP A;  4OBV A;  4AOA A;  1C7O A;  2VMO A;  4ZDO A;  1UU0 A;  2FNI A;  1GCK A;  2ZYJ A;  3NYS A;  4F5G A;  3E2Z B;  2GSA A;  2CH1 A;  4JEW A;  3LVM A;  2OGE A;  2ZY3 A;  1AJS A;  1CL1 A;  2VGS A;  3FTB A;  3GZD C;  2TPL A;  4U2H A;  4EB5 A;  3BCA A;  3E6G A;  4UHN A;  4AZJ A;  3E9K A;  1YIY A;  2W7I A;  4OC9 A;  2C81 A;  4A6T A;  2CY8 A;  3Q8N A;  2ZY2 A;  1JS3 A;  4WB0 B;  2YKU A;  5J8Q A;  4HF8 A;  3W1H A;  3NU8 A;  3PDB A;  4ADE A;  4A0G A;  3CAI A;  2QB2 A;  1ASA A;  1J04 A;  1C0N A;  2Z9X A;  3PD6 A;  4MKK A;  2YCN A;  1TPL A;  2Z9V A;  1DJU A;  2QSR A;  1QJ5 A;  3LVK A;  4WYC A;  2R0T A;  3BWN C;  2AY3 A;  1DKA A;  4B98 A;  1GC2 A;  1BW0 A;  1V2F A;  2VMS A;  3NYT A;  4LNM A;  1EJI A;  4XAU A;  1AMQ A;  2CJD A;  2JG2 A;  3TFT A;  2HOR A;  4MQP A;  2ZY5 A;  3B1E A;  2C7T A;  5G0A A;  3K40 A;  1WYT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...