4WXGA

Crystal structure of l-serine hydroxymethyltransferase in complex with a mixture of l-allo-threonine and glycine
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
410
structure length
410
Chain Sequence
DYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVISGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIRGDVKVLTDAFPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine hydroxymethyltransferase
publication title Engineered L-Serine Hydroxymethyltransferase from Streptococcus thermophilus for the Synthesis of alpha , alpha-Dialkyl-alpha-Amino Acids.
pubmed doi rcsb
source organism Streptococcus thermophilus
molecule tags Transferase
total genus 160
structure length 410
sequence length 410
chains with identical sequence C
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4wxgA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4wxgA01
1CS1A 4PVFA 1CQ6A 4AZJA 2BIAA 1D7VA 2GMSA 1YNUA 4WLJA 4DBCA 1DTYA 3BN1A 1MLYA 5EAAA 3BCAA 5TF5A 1AX4A 3QI6A 2ZSMA 1H1CA 3WCOA 2Z1ZA 4Q75A 2X8UA 2Z9WA 3BWNC 4P3MA 3H7FA 3PGYA 4U2HA 3EZ1A 4MQRA 4BMKA 1X2AA 2CH1A 1LC8A 1KKJA 1E5FA 1AIAA 1AKBA 1OHVA 3GETA 1AHYA 4LC3A 2ZYJA 2W7EA 1AAWA 1IX6A 1O61A 3CAIA 2W7LA 1ZOBA 2FNUA 1WSTA 4RITA 4TN4A 3JU7A 2HUIA 5EQCA 4LNLA 4E77A 3K7YA 1TOIA 1J32A 1LC7A 1GC3A 5FT4A 3TFUA 1LS3A 2Q7WA 3FDDA 3HT4A 2VMPA 3AOVA 2EH6A 2GSAA 3IHJA 2PO3A 2YRIA 4WYFA 1ARIA 5I92A 5AX8A 3L44A 2W8JA 3PAAA 2BHXA 4M2JA 2X5FA 1MLZA 3FCRA 2CINA 2D5YA 4WXFA 4E3RA 4ZDPA 4ADCA 3MEBA 2VMQA 1W7LA 3LVKA 2C81A 2X5DA 3GZDC 1O4SA 3HLMA 4ITXA 4DGTA 4DQ6A 2VYCA 4IW7A 2HOYA 1YJSA 1SZSA 2VGSA 1GCKA 2TPLA 3GBXA 3VK4A 3ASAA 4TMRA 1ARHA 1W7MA 2EPJA 2Z1YA 1DGDA 2VGVA 3FVXA 3KE3A 2QB2A 2W7JA 2Z9UA 2W8TA 4CBSA 4F5FA 1IX7A 3BCBA 5LH9A 4ZWMA 2VMRA 3PD6B 3BWNA 3ZRRA 4OTLA 4QGRA 1BJOB 2Z67A 1C9CA 3I4JA 1ASEA 4W1XA 3WY7A 3DC1A 1AMRA 1G7XA 1H0CA 1PFFA 2E7JA 1TASA 3N75A 2W7DA 3PDBA 3PIUA 5G0AA 3EI8A 1QJ3A 2O7CA 1C4KA 3G7QA 3WKSA 2D65A 5EAVA 1MGVA 4IY7A 1KMJA 4GE4A 4F5LA 1WYVA 1E5EA 1WKHA 3F0HA 4A0HA 2VIBA 2FM1A 3AEOA 4GEBA 3CQ5A 2VMWA 3WZFA 3RQ1A 2QBTA 4CBRA 3TATA 9AATA 4TV7A 5E3KA 3VK2A 4ZDLA 2W7KA 3EI5A 1RVYA 1KL2A 2BI2A 2BWNA 3EIBA 3P6KA 1I29A 2FNIA 1EJIA 2AY5A 2QB3A 1VP4A 3BB8A 1EG5A 3GZDA 5DB5A 4XAUA 4F5MA 4OBVA 1DKAA 4EB5A 1BT4A 2VI8A 3A2BA 4BA4A 1B4XA 3GJUA 4WP0A 3FFHA 1B8GA 3PA9A 1IUGA 1TOJA 4XK1A 4K2IA 1X0MA 3A9YA 3ELPA 3FKDA 4RIZA 3WLXA 5F9SA 2CJDA 4NOGA 1SVVA 4UHOA 4RJYA 2CTZA 4OMAA 1OHYA 5BJ4A 2AY1A 1WYTB 3GR9A 1P3WA 3E77A 4IXSA 4ZWVA 1CQ8A 5DJ1A 2HUUA 1M0NA 2JJFA 4LW2A 2BI5A 3E2ZB 4XJLA 1V2EA 2JGTA 3B8XA 1GD9A 1PG8A 2BIGA 4GE9A 4A00A 4A6UA 3AENB 4LNJA 4A72A 1ASNA 2XH1A 5LHAA 1AHFA 3BCXA 4ZASA 4RKCA 2CJGA 1B5PA 3NUBA 4WBTA 4ZDOA 2BIEA 3AATA 2W7FA 4WYCA 5D5SA 1AMAA 2AEVA 3WGCA 1G4XA 1C7OA 2GQNA 4WYAA 4Q31A 1DFOA 1CQ7A 4A6RA 1CJ0A 1AKAA 1C0NA 3G0TA 3LVJA 1JF9A 3ACZA 3LWSA 3QPGA 4GRXA 4AO9A 3BS8A 1CL1A 3LVLB 4K2MA 1TPLA 2JG2A 5C6UA 4KAMA 1QJ5A 2BI1A 2BI3A 4WXGA 3FZ6A 4F5JA 3GWPA 5F8VA 1GEWA 1ELQA 1LC5A 1O62A 1UKJA 4Q76A 3F6TA 3ZZJA 3DYDA 4Q6RA 1TATA 4AOAA 1D7UA 1D7RA 4BQ0A 4ZM3A 4LW4A 4W1VA 3DODA 4OT8A 2CH2A 3B1DA 3PPLA 2QMAA 3E9KA 3GZCA 1CL2A 1JS6A 3PDBB 3RBFA 4BA5A 2ZSLA 3VK3A 1AJSA 3II0A 4J5UA 4MKJA 2CFBA 3E2YA 4ATQA 1OHWA 4E3QA 1WYVB 1WYTA 1M7YA 4H51A 4XJMA 3CQ6A 1Z3ZA 3GSBA 4ZLVA 4BHDA 2W8UA 2YKUA 2C44A 2HOZA 4AO4A 3E2ZA 2D63A 3W1JA 2X3LA 1GEYA 3IF2A 3T32A 3AENA 3KKIA 4M2KA 3CBFA 4W5KA 4JEYA 4Y0IA 1DJUA 1W3UA 4UHMA 5EUEA 1AHEA 2ZUKA 4IXOA 4R5FA 4WYEA 3UWCA 3HVYA 2HOXA 2DGKA 3QN6A 5HHYA 1DGEA 1M32A 4WYDA 3RCHA 3NUIA 5EIGB 3MADA 2R5EA 1ASGA 4WYGA 2WK7A 1WYUB 2CB1A 2OKKA 2ZY3A 4EB7A 3NRAA 4MQPA 3AEJC 4RJ0A 3FDBA 5FT6A 1I48A 3LVMA 4A0RA 1GBNA 2HP2A 1RV3A 2GMUA 1AKCA 4XJOA 5M4DA 2HORA 3ATHA 2CY8A 1PMOA 5HDMA 4K2BA 1G7WA 4RKDA 1ORDA 2AY9A 2WKAA 3MAFA 4PIWA 3RI6A 2ZC0A 1YAAA 2YKXA 1ASBA 3A9ZA 2WK8A 3B46A 4XEWA 3ZRPA 4OC9A 4ZSYA 4AZKA 2VI9A 2AY6A 2VGWA 3FQAA 4U1TA 3TCMA 2BI9A 2CJHA 4F5IA 5G4JA 1AY4A 1TARA 1ZODA 2OGAA 1AJRA 3BC8A 1DJEA 2PB0A 1I41A 3H14A 4JF0A 3W1HA 2ZY4A 2VMYA 2EZ1A 2AATA 2VGZA 4MQQA 1GC0A 4I8AA 8AATA 1ARSA 3HL2A 1SF2A 1PMMA 3D6KA 4WB0A 2E7IA 3VP6A 1QITA 2Z9VA 1ECXA 1MAQA 5G4IA 3DU4A 2RFVA 5IWQA 4O6ZA 1I43A 3EI7A 1ASFA 3UE8A 1XEYA 5EIGA 2DGLA 3WX9A 1WYUA 2OATA 3AEJA 3P1TA 5DJ9A 3RBLA 1J04A 1OXOA 3JW9A 4RM1A 2W7IA 3JTXA 1V72A 1SZKA 1AJSB 3WKRA 3MKJA 1N31A 2BYJA 3NTJA 1B9HA 3NDNA 1ARTA 2EGYA 2AY3A 3FZ8A 1C7NA 4ZAHA 5K8BA 1BQAA 1JG8A 2QA3A 2R2NA 3G8MA 4MGRA 1AMSA 3KGWA 4A6TA 1FC4A 4A0GA 1GEXA 4HF8A 3ZZKA 1O69A 2AEUA 4AH3A 1KL1A 4EU1A 1AY8A 4FFCA 2C0RA 2R0TA 2AY4A 1ASAA 2HZPA 1ASMA 1ELUA 3AELA 1BJWA 4JEZA 4N0BA 5M46A 4ADBA 2BYLA 5FT8A 2VMNA 2DKJA 1KKPA 3RCHB 3PDXA 4IYOA 7AATA 4CXQA 1X28A 1AY5A 1AHGA 2D7ZA 2AY7A 1B9IA 3FTBA 2YKVA 1G4VA 1VEFA 2BWOA 3WCNA 3E6GA 3NYUA 3N0LA 3HDOA 1M6SA 3TFTA 3CQ4A 1DJ9A 2F8JA 4EFFA 3ISLA 3EI6A 3R9AA 3FD0A 1EQBA 1IVRA 3MAFB 1LK9A 4F5HA 3FVSA 3LG0A 1JS3A 2VMVA 3K28A 1GC2A 4P7YA 4F4EA 4WXBA 2XBNA 3AOWA 4XJPA 4ADDA 2D7YA 1TOKA 3MC6C 2D66A 2WK9A 1GC4A 5E5IA 1V2DA 1W23A 2W7HA 2E7UA 3DR4A 5J8QA 1AAMA 1OXPA 4LNMA 2JJHA 2DR1A 5G2QA 1IBJA 1M0PA 1S06A 1AHXA 3AEPA 1MDZA 1YIZA 3UAKA 2AY2A 3N5MA 4WB0B 4GE7A 3NU7A 4JEVA 2C7TA 2QLRA 1IAYA 1UU2A 2O1BA 2CSTA 2VLHA 3B1EA 3I16A 4W8IA 3ZRQA 4F5GA 1QZ9A 4ITGA 4A0FA 2VGUA 1LKCA 2V0YA 3VAXA 3ASBA 4IXZA 2DGMA 3COGA 3FRKA 3I5TA 4R5ZA 1BQDA 3FFRA 4OYTA 5EUNA 4B9BA 2O0RA 2D61A 1BW0A 1C7GA 3L8AA 2R5CA 2W8WA 2VMXA 2FN6A 4EMYA 3QGUA 1WKGA 3EIAA 5M4BA 3K40A 1BS0A 4MKKA 2AY8A 3A9XA 3QHXA 3M5UA 1MAPA 1SZUA 3AEMC 3F9TA 2YCTA 3KGXA 1RV4A 3MC6A 1S0AA 1GDEA 2YCNA 2ZY5A 4ISYA 5BJ3A 4UOYA 2YKYA 4XQ2A 1Z7DA 1IJIA 3FSLA 1ZC9A 3NYTA 4F5KA 5JAYA 4KYOA 4RAEA 1N2TA 2JJGA 2W7GA 3QBOA 4PFFA 1D2FA 1S08A 3HBXA 1YJZA 1QISA 3AV7A 4IYOB 4W1WA 3QM2A 4HVKA 3HMUA 3DRDA 5G2PA 1QGNA 5DX5A 3WGBA 1M0QA 2JJEA 3DXWA 1BJNA 4RLGA 1SFFA 1U08A 1CZCA 1SPAA 2EO5A 3EUCA 2VMZA 4JEXA 2W7MA 2FYFA 3R4TA 3EI9A 4JE5A 2VMOA 1CZEA 3LY1A 1MDOA 1M4NA 4FL0A 4WD2A 2OGEA 3ECDA 4ADEA 1QIRA 3OKSA 1YJYA 4IX8A 2BWPA 3RUYA 2EZ2A 2HP1A 4UHNA 4J8LA 1MDXA 3LV2A 3DXVA 5G09A 1IX8A 3BWOA 2E54A 3ELEA 4KXKA 1YOOA 1LW5A 1V2FA 2D64A 2OKJA 3NYSA 3NNKA 4CVQA 5E4ZA 1UU0A 4MY5A 1ARGA 3AEMA 4L0OA 3NU8A 4GDYA 3OP7A 4MSOA 4OCAA 5D95A 3TQXA 1AIBA 1FG3A 2VMUA 3NX3A 1FG7A 3PJ0A 2ZJGA 3USFA 1AICA 3FQ7A 3BV0A 1IAXA 2VIAA 3JWAA 4R8DA 1X29A 2CANA 2Z9XA 3A8UX 4B98A 1ASDA 1W7NA 2JISA 3MAUA 4PFNA 4Y0HA 1AMQA 3FVUA 4E1OA 1XI9A 2PB2A 4JF1A 1YIYA 5M49A 4N0WA 2W8VA 5EUDA 1OATA 3JZLA 1D7SA 2YOBA 1M0OA 2FQ6A 1BKGA 2VMSA 4CXRA 3Q8NA 4OBUA 2ORDA 1ASLA 1S07A 2DOUA 2Z61A 3E2FA 2R5CB 2GB3A 3PD6A 4M2MA 4ZM4A 1ASCA 4ATPA 2YCPA 4R2NA 2G6WA 1BJOA 2VGTA 3EZSA 2VLFA 5EFSA 5FT5A 2HUFA 2BKWA 1VJOA 3MBBA 2YRRA 2DKBA 2VMTA 4GSAA 4JE5D 4UQVA 4ZSWA 4JEWA 1LW4A 1S09A 5HXXA 1B5OA 2ZP7A 2V1PA 3FZ7A 1TOGA 3DZZA 2Z20A 2ZY2A 2YHKA 1RVUA 1N8PA 2NMPA 4Y0DA 2OQXA 3FQ8A 3VOMA 4WLHA 3DR7A 1BJ4A 1T3IA 3JWBA 1KMKA 4W91A 1Y4IA 3B1CA 1TOEA 1UU1A 3W1IA 3HQTA
chains in the Genus database with same CATH superfamily
1CS1A 4PVFA 1CQ6A 4AZJA 2BIAA 1D7VA 2GMSA 1YNUA 4WLJA 4DBCA 1DTYA 3BN1A 1MLYA 5EAAA 3BCAA 5TF5A 1AX4A 3QI6A 2ZSMA 1H1CA 3WCOA 2Z1ZA 4Q75A 3N4RA 2X8UA 2Z9WA 3BWNC 4P3MA 3H7FA 3PGYA 4U2HA 3EZ1A 4MQRA 4BMKA 1X2AA 2CH1A 1LC8A 1KKJA 1E5FA 1AIAA 1AKBA 1OHVA 3GETA 1AHYA 4LC3A 2ZYJA 2W7EA 1AAWA 1IX6A 1O61A 3CAIA 2W7LA 2EYQA 1ZOBA 2FNUA 1WSTA 4RITA 4TN4A 3JU7A 2HUIA 5EQCA 4LNLA 4E77A 3K7YA 1TOIA 1J32A 1LC7A 1GC3A 5FT4A 3TFUA 1LS3A 2Q7WA 3FDDA 3HT4A 2VMPA 3AOVA 2EH6A 2GSAA 3IHJA 2PO3A 2YRIA 4WYFA 1ARIA 5I92A 5AX8A 3L44A 2W8JA 3PAAA 2BHXA 4M2JA 2X5FA 1MLZA 3FCRA 2CINA 2D5YA 4WXFA 4E3RA 4ZDPA 4ADCA 3MEBA 2VMQA 1W7LA 3LVKA 2C81A 2X5DA 3GZDC 1O4SA 3HLMA 4ITXA 4DGTA 3N4SA 4DQ6A 2VYCA 4IW7A 2HOYA 1YJSA 1SZSA 2VGSA 1GCKA 2TPLA 3GBXA 3VK4A 3ASAA 4TMRA 1ARHA 1W7MA 2EPJA 2Z1YA 1DGDA 2VGVA 3FVXA 3KE3A 2QB2A 2W7JA 2Z9UA 2W8TA 4CBSA 4F5FA 1IX7A 3BCBA 5LH9A 4ZWMA 2VMRA 3PD6B 3BWNA 3ZRRA 4OTLA 4QGRA 1BJOB 2Z67A 1C9CA 3I4JA 1ASEA 4W1XA 3WY7A 3DC1A 1AMRA 1G7XA 1H0CA 1PFFA 2E7JA 1TASA 3N75A 2W7DA 3PDBA 3PIUA 5G0AA 3EI8A 1QJ3A 2O7CA 1C4KA 3G7QA 3WKSA 2D65A 5EAVA 1MGVA 4IY7A 1KMJA 4GE4A 4F5LA 1WYVA 1E5EA 1WKHA 3F0HA 4A0HA 2VIBA 2FM1A 3AEOA 4GEBA 3CQ5A 2VMWA 3WZFA 3RQ1A 2QBTA 4CBRA 3TATA 9AATA 4TV7A 5E3KA 3VK2A 4ZDLA 2W7KA 3EI5A 1RVYA 1KL2A 1KAFA 2BI2A 2BWNA 3EIBA 3P6KA 1I29A 2FNIA 1EJIA 2AY5A 2QB3A 1VP4A 3BB8A 1EG5A 3GZDA 5DB5A 4XAUA 4F5MA 4OBVA 1DKAA 4EB5A 1BT4A 2VI8A 3A2BA 4BA4A 1B4XA 3GJUA 4WP0A 3FFHA 1B8GA 3PA9A 1IUGA 1TOJA 4XK1A 4K2IA 1X0MA 3A9YA 3ELPA 3FKDA 4RIZA 3WLXA 5F9SA 2CJDA 4NOGA 1SVVA 4UHOA 4RJYA 2CTZA 4OMAA 1OHYA 5BJ4A 2AY1A 1WYTB 3GR9A 1P3WA 3E77A 4IXSA 4ZWVA 1CQ8A 5DJ1A 2HUUA 1M0NA 2JJFA 4LW2A 2BI5A 3E2ZB 4XJLA 1V2EA 2JGTA 3B8XA 1GD9A 1PG8A 2BIGA 4GE9A 4A00A 4A6UA 3AENB 4LNJA 4A72A 1ASNA 2XH1A 5LHAA 1AHFA 3BCXA 4ZASA 4RKCA 2CJGA 1B5PA 3NUBA 4WBTA 4ZDOA 2BIEA 3AATA 2W7FA 4WYCA 5D5SA 1AMAA 2AEVA 3WGCA 1G4XA 1C7OA 2GQNA 4WYAA 4Q31A 3H9XA 1DFOA 1CQ7A 4A6RA 1CJ0A 1AKAA 1C0NA 3G0TA 3LVJA 1JF9A 3ACZA 3LWSA 3QPGA 4GRXA 4AO9A 3BS8A 1CL1A 3LVLB 4K2MA 1TPLA 2JG2A 5C6UA 2QSRA 4KAMA 1QJ5A 2BI1A 2BI3A 4WXGA 3FZ6A 4F5JA 3GWPA 5F8VA 1GEWA 1ELQA 1LC5A 1O62A 1UKJA 4Q76A 3F6TA 3ZZJA 3DYDA 4Q6RA 1TATA 4AOAA 1D7UA 1D7RA 4BQ0A 4ZM3A 4LW4A 4W1VA 3DODA 4OT8A 2G7JA 2CH2A 3B1DA 3PPLA 2QMAA 3E9KA 3GZCA 1CL2A 1JS6A 3PDBB 3RBFA 4BA5A 2ZSLA 3VK3A 1AJSA 3II0A 4J5UA 4MKJA 2CFBA 3E2YA 4ATQA 1OHWA 4E3QA 1WYVB 1WYTA 1M7YA 4H51A 4XJMA 3CQ6A 1Z3ZA 3GSBA 4ZLVA 4BHDA 2W8UA 2YKUA 2C44A 2HOZA 4AO4A 3E2ZA 2D63A 5KTBA 3W1JA 2X3LA 1GEYA 3IF2A 3T32A 3AENA 3KKIA 4M2KA 3CBFA 4W5KA 4JEYA 4Y0IA 1DJUA 1W3UA 4UHMA 5EUEA 1AHEA 2ZUKA 4IXOA 4R5FA 4WYEA 3UWCA 3HVYA 2HOXA 2DGKA 3QN6A 5HHYA 1DGEA 1M32A 4WYDA 3RCHA 3NUIA 5EIGB 3MADA 2R5EA 1ASGA 4WYGA 2WK7A 1WYUB 2CB1A 2OKKA 2ZY3A 4EB7A 3NRAA 4MQPA 3AEJC 4RJ0A 3FDBA 5FT6A 1I48A 3LVMA 4A0RA 1GBNA 2HP2A 1RV3A 2GMUA 1AKCA 4XJOA 5M4DA 2HORA 3ATHA 2CY8A 1PMOA 5HDMA 4K2BA 1G7WA 4RKDA 1ORDA 2AY9A 2WKAA 3MAFA 4PIWA 3RI6A 2ZC0A 1YAAA 2YKXA 1ASBA 3A9ZA 2WK8A 3B46A 4XEWA 3ZRPA 4OC9A 4ZSYA 4AZKA 2VI9A 2AY6A 2VGWA 3FQAA 4U1TA 3TCMA 2BI9A 2CJHA 4F5IA 5G4JA 1AY4A 1TARA 1ZODA 2OGAA 1AJRA 3BC8A 1DJEA 2PB0A 1I41A 3H14A 4JF0A 3W1HA 2ZY4A 2VMYA 2EZ1A 2AATA 2VGZA 4MQQA 1GC0A 4I8AA 8AATA 1ARSA 3HL2A 1SF2A 1PMMA 3D6KA 4WB0A 2E7IA 3VP6A 1QITA 2Z9VA 1ECXA 1MAQA 5G4IA 3DU4A 2RFVA 5IWQA 4O6ZA 1I43A 3EI7A 1ASFA 3UE8A 1XEYA 5EIGA 2DGLA 3WX9A 1WYUA 2OATA 3AEJA 3P1TA 5DJ9A 3RBLA 1J04A 1OXOA 3JW9A 4RM1A 2W7IA 3JTXA 1V72A 1SZKA 1AJSB 3WKRA 3MKJA 1N31A 2BYJA 3NTJA 1B9HA 3NDNA 1ARTA 2EGYA 2AY3A 3FZ8A 1C7NA 4ZAHA 5K8BA 2A1VA 1BQAA 1JG8A 2QA3A 2R2NA 3G8MA 4MGRA 1AMSA 3KGWA 4A6TA 1FC4A 4A0GA 1GEXA 4HF8A 3ZZKA 1O69A 2AEUA 4AH3A 1KL1A 4EU1A 1AY8A 4FFCA 2C0RA 2R0TA 2AY4A 1ASAA 2HZPA 1ASMA 1ELUA 3AELA 1BJWA 4JEZA 4N0BA 5M46A 4ADBA 2BYLA 5FT8A 2VMNA 2DKJA 1KKPA 3RCHB 3PDXA 4IYOA 7AATA 4CXQA 1X28A 1AY5A 1AHGA 2D7ZA 2AY7A 1B9IA 3FTBA 2YKVA 1G4VA 1VEFA 2BWOA 3WCNA 3E6GA 3NYUA 3N0LA 3HDOA 1M6SA 3TFTA 3CQ4A 1DJ9A 2F8JA 4EFFA 2WB6A 3ISLA 3EI6A 3R9AA 3FD0A 1EQBA 1IVRA 3MAFB 1LK9A 4F5HA 3FVSA 3LG0A 1JS3A 2VMVA 3K28A 1GC2A 4P7YA 4F4EA 4WXBA 2XBNA 3AOWA 4XJPA 4ADDA 2D7YA 1TOKA 3MC6C 2D66A 4H63Q 2WK9A 1GC4A 5E5IA 1V2DA 1W23A 2W7HA 2E7UA 3DR4A 5J8QA 1AAMA 1OXPA 4LNMA 2JJHA 2DR1A 5G2QA 1IBJA 1M0PA 1S06A 1AHXA 3AEPA 1MDZA 1YIZA 3UAKA 2AY2A 3N5MA 4WB0B 4GE7A 3N7NA 3NU7A 4JEVA 2C7TA 2QLRA 1IAYA 1UU2A 2O1BA 2CSTA 2VLHA 3B1EA 3I16A 4W8IA 3ZRQA 4F5GA 1QZ9A 4ITGA 4A0FA 2VGUA 1LKCA 2V0YA 3VAXA 3ASBA 4IXZA 2DGMA 3COGA 3FRKA 3I5TA 4R5ZA 1BQDA 3FFRA 4OYTA 5EUNA 4K05A 4B9BA 2O0RA 2D61A 1BW0A 1C7GA 3L8AA 2R5CA 2W8WA 2VMXA 2FN6A 4EMYA 3QGUA 1WKGA 3EIAA 5M4BA 3K40A 1BS0A 4MKKA 2AY8A 3A9XA 3QHXA 3M5UA 1MAPA 1SZUA 3AEMC 3F9TA 2YCTA 3KGXA 1RV4A 3MC6A 1S0AA 1GDEA 2YCNA 2ZY5A 4ISYA 5BJ3A 4UOYA 2YKYA 4XQ2A 1Z7DA 1IJIA 3FSLA 1ZC9A 3NYTA 4F5KA 5JAYA 4KYOA 4RAEA 1N2TA 2JJGA 2W7GA 3QBOA 4PFFA 1D2FA 1S08A 3HBXA 1YJZA 1QISA 3AV7A 4IYOB 4W1WA 3QM2A 4HVKA 3HMUA 3DRDA 5G2PA 1QGNA 5DX5A 3WGBA 1M0QA 2JJEA 3DXWA 1BJNA 4RLGA 1SFFA 1U08A 1CZCA 1SPAA 2EO5A 3EUCA 2VMZA 4JEXA 2W7MA 2FYFA 3R4TA 3EI9A 4JE5A 2VMOA 1CZEA 3LY1A 1MDOA 1M4NA 4FL0A 4WD2A 2OGEA 3ECDA 4ADEA 1QIRA 3OKSA 1YJYA 4IX8A 2BWPA 3RUYA 2EZ2A 2HP1A 4UHNA 4J8LA 1MDXA 2FKIA 3LV2A 3DXVA 3N4XA 5G09A 1IX8A 3BWOA 2E54A 3ELEA 4KXKA 1YOOA 1LW5A 1V2FA 2D64A 2OKJA 3NYSA 3NNKA 4CVQA 5E4ZA 1UU0A 4MY5A 1ARGA 3AEMA 4L0OA 3NU8A 4GDYA 3OP7A 4MSOA 4OCAA 5D95A 3TQXA 1AIBA 1FG3A 2VMUA 3NX3A 1FG7A 3PJ0A 2ZJGA 3USFA 1AICA 3FQ7A 3BV0A 1IAXA 2VIAA 3JWAA 4R8DA 1X29A 2CANA 2Z9XA 3A8UX 4B98A 1ASDA 1W7NA 2JISA 2KFPA 3MAUA 4PFNA 4Y0HA 1AMQA 3FVUA 4E1OA 1XI9A 2PB2A 4JF1A 1YIYA 5M49A 4N0WA 2W8VA 5EUDA 1OATA 3JZLA 1D7SA 2YOBA 1M0OA 2FQ6A 1BKGA 2VMSA 4CXRA 3Q8NA 4OBUA 2ORDA 1ASLA 1S07A 2DOUA 2Z61A 3E2FA 2R5CB 2GB3A 3PD6A 4M2MA 4ZM4A 1ASCA 4ATPA 2YCPA 4R2NA 2G6WA 1BJOA 2VGTA 3EZSA 2VLFA 5EFSA 5FT5A 2HUFA 2BKWA 1VJOA 3MBBA 2YRRA 2DKBA 2VMTA 4GSAA 4JE5D 4UQVA 4ZSWA 4JEWA 1LW4A 1S09A 5HXXA 1B5OA 2ZP7A 2V1PA 3FZ7A 1TOGA 3DZZA 2Z20A 2ZY2A 2YHKA 1RVUA 1N8PA 2NMPA 4Y0DA 2OQXA 3FQ8A 3VOMA 4WLHA 3DR7A 1BJ4A 1T3IA 3JWBA 1KMKA 4W91A 1Y4IA 3B1CA 1TOEA 1UU1A 3W1IA 3HQTA
chains in the Genus database with same CATH topology
1CS1A 4PVFA 1CQ6A 4AZJA 2BIAA 1D7VA 2GMSA 1YNUA 4WLJA 4DBCA 1DTYA 3BN1A 1MLYA 5EAAA 3BCAA 5TF5A 1AX4A 3QI6A 2ZSMA 1H1CA 3WCOA 2Z1ZA 4Q75A 3N4RA 2X8UA 2Z9WA 3BWNC 4P3MA 3H7FA 3PGYA 4U2HA 3EZ1A 4MQRA 4BMKA 1X2AA 2CH1A 1LC8A 1KKJA 1E5FA 1AIAA 1AKBA 1OHVA 3GETA 1AHYA 4LC3A 2ZYJA 2W7EA 1AAWA 1IX6A 1O61A 3CAIA 2W7LA 2EYQA 1ZOBA 2FNUA 1WSTA 4RITA 4TN4A 3JU7A 2HUIA 5EQCA 4LNLA 4E77A 3K7YA 1TOIA 1J32A 1LC7A 1GC3A 5FT4A 3TFUA 1LS3A 2Q7WA 3FDDA 3HT4A 2VMPA 3AOVA 2EH6A 2GSAA 3IHJA 2PO3A 2YRIA 4WYFA 1ARIA 5I92A 5AX8A 3L44A 2W8JA 3PAAA 2BHXA 4M2JA 2X5FA 1MLZA 3FCRA 2CINA 2D5YA 4WXFA 4E3RA 4ZDPA 4ADCA 3MEBA 2VMQA 1W7LA 3LVKA 2C81A 2X5DA 3GZDC 1O4SA 3HLMA 4ITXA 4DGTA 3N4SA 4DQ6A 2VYCA 4IW7A 2HOYA 1YJSA 1SZSA 2VGSA 1GCKA 2TPLA 3GBXA 3VK4A 3ASAA 4TMRA 1ARHA 1W7MA 2EPJA 2Z1YA 1DGDA 2VGVA 3FVXA 3KE3A 2QB2A 2W7JA 2Z9UA 2W8TA 4CBSA 4F5FA 1IX7A 3BCBA 5LH9A 4ZWMA 2VMRA 3PD6B 3BWNA 3ZRRA 4OTLA 4QGRA 1BJOB 2Z67A 1C9CA 3I4JA 1ASEA 4W1XA 3WY7A 3DC1A 1AMRA 1G7XA 1H0CA 1PFFA 2E7JA 1TASA 3N75A 2W7DA 3PDBA 3PIUA 5G0AA 3EI8A 1QJ3A 2O7CA 1C4KA 3G7QA 3WKSA 2D65A 5EAVA 1MGVA 4IY7A 1KMJA 4GE4A 4F5LA 1WYVA 1E5EA 1WKHA 3F0HA 4A0HA 2VIBA 2FM1A 3AEOA 4GEBA 3CQ5A 2VMWA 3WZFA 3RQ1A 2QBTA 4CBRA 3TATA 9AATA 4TV7A 5E3KA 3VK2A 4ZDLA 2W7KA 3EI5A 1RVYA 1KL2A 2BI2A 2BWNA 3EIBA 3P6KA 1I29A 2FNIA 1EJIA 2AY5A 2QB3A 1VP4A 3BB8A 1EG5A 3GZDA 5DB5A 4XAUA 4F5MA 4OBVA 1DKAA 4EB5A 1BT4A 2VI8A 3A2BA 4BA4A 1B4XA 3GJUA 4WP0A 3FFHA 1B8GA 3PA9A 1IUGA 1TOJA 4XK1A 4K2IA 1X0MA 3A9YA 3ELPA 3FKDA 4RIZA 3WLXA 5F9SA 2CJDA 4NOGA 1SVVA 4UHOA 4RJYA 2CTZA 4OMAA 1OHYA 5BJ4A 2AY1A 1WYTB 3GR9A 1P3WA 3E77A 4IXSA 4ZWVA 1CQ8A 5DJ1A 2HUUA 1M0NA 2JJFA 4LW2A 2BI5A 3E2ZB 4XJLA 1V2EA 2JGTA 3B8XA 1GD9A 1PG8A 2BIGA 4GE9A 4A00A 4A6UA 3AENB 4LNJA 4A72A 1ASNA 2XH1A 5LHAA 1AHFA 3BCXA 4ZASA 4RKCA 2CJGA 1B5PA 3NUBA 4WBTA 4ZDOA 2BIEA 3AATA 2W7FA 4WYCA 5D5SA 1AMAA 2AEVA 3WGCA 1G4XA 1C7OA 2GQNA 4WYAA 4Q31A 3H9XA 1DFOA 1CQ7A 4A6RA 1CJ0A 1AKAA 1C0NA 3G0TA 3LVJA 1JF9A 3ACZA 3LWSA 3QPGA 4GRXA 4AO9A 3BS8A 1CL1A 3LVLB 4K2MA 1TPLA 2JG2A 5C6UA 2QSRA 4KAMA 1QJ5A 2BI1A 2BI3A 4WXGA 3FZ6A 4F5JA 3GWPA 5F8VA 1GEWA 1ELQA 1LC5A 1O62A 1UKJA 4Q76A 3F6TA 3ZZJA 3DYDA 4Q6RA 1TATA 4AOAA 1D7UA 1D7RA 4BQ0A 4ZM3A 4LW4A 4W1VA 3DODA 4OT8A 2G7JA 2CH2A 3B1DA 3PPLA 2QMAA 3E9KA 3GZCA 1CL2A 1JS6A 3PDBB 3RBFA 4BA5A 2ZSLA 3VK3A 1AJSA 3II0A 4J5UA 4MKJA 2CFBA 3E2YA 4ATQA 1OHWA 4E3QA 1WYVB 1WYTA 1M7YA 4H51A 4XJMA 3CQ6A 1Z3ZA 3GSBA 4ZLVA 4BHDA 2W8UA 2YKUA 2C44A 2HOZA 4AO4A 3E2ZA 2D63A 5KTBA 3W1JA 2X3LA 1GEYA 3IF2A 3T32A 3AENA 3KKIA 4M2KA 3CBFA 4W5KA 4JEYA 4Y0IA 1DJUA 1W3UA 4UHMA 5EUEA 1AHEA 2ZUKA 4IXOA 4R5FA 4WYEA 3UWCA 3HVYA 2HOXA 2DGKA 3QN6A 5HHYA 1DGEA 1M32A 4WYDA 3RCHA 3NUIA 5EIGB 3MADA 2R5EA 1ASGA 4WYGA 2WK7A 1WYUB 2CB1A 2OKKA 2ZY3A 4EB7A 3NRAA 4MQPA 3AEJC 4RJ0A 3FDBA 5FT6A 1I48A 3LVMA 4A0RA 1GBNA 2HP2A 1RV3A 2GMUA 1AKCA 4XJOA 5M4DA 2HORA 3ATHA 2CY8A 1PMOA 5HDMA 4K2BA 1G7WA 4RKDA 1ORDA 2AY9A 2WKAA 3MAFA 4PIWA 3RI6A 2ZC0A 1YAAA 2YKXA 1ASBA 3A9ZA 2WK8A 3B46A 4XEWA 3ZRPA 4OC9A 4ZSYA 4AZKA 2VI9A 2AY6A 2VGWA 3FQAA 4U1TA 3TCMA 2BI9A 2CJHA 4F5IA 5G4JA 1AY4A 1TARA 1ZODA 2OGAA 1AJRA 3BC8A 1DJEA 2PB0A 1I41A 3H14A 4JF0A 3W1HA 2ZY4A 2VMYA 2EZ1A 2AATA 2VGZA 4MQQA 1GC0A 4I8AA 8AATA 1ARSA 3HL2A 1SF2A 1PMMA 3D6KA 4WB0A 2E7IA 3VP6A 1QITA 2Z9VA 1ECXA 1MAQA 5G4IA 3DU4A 2RFVA 5IWQA 4O6ZA 1I43A 3EI7A 1ASFA 3UE8A 1XEYA 5EIGA 2DGLA 3WX9A 1WYUA 2OATA 3AEJA 3P1TA 5DJ9A 3RBLA 1J04A 1OXOA 3JW9A 4RM1A 2W7IA 3JTXA 1V72A 1SZKA 1AJSB 3WKRA 3MKJA 1N31A 2BYJA 3NTJA 1B9HA 3NDNA 1ARTA 2EGYA 2AY3A 3FZ8A 1C7NA 4ZAHA 5K8BA 2A1VA 1BQAA 1JG8A 2QA3A 2R2NA 3G8MA 4MGRA 1AMSA 3KGWA 4A6TA 1FC4A 4A0GA 1GEXA 4HF8A 3ZZKA 1O69A 2AEUA 4AH3A 1KL1A 4EU1A 1AY8A 4FFCA 2C0RA 2R0TA 2AY4A 1ASAA 2HZPA 1ASMA 1ELUA 3AELA 1BJWA 4JEZA 4N0BA 5M46A 4ADBA 2BYLA 5FT8A 2VMNA 2DKJA 1KKPA 3RCHB 3PDXA 4IYOA 7AATA 4CXQA 1X28A 1AY5A 1AHGA 2D7ZA 2AY7A 1B9IA 3FTBA 2YKVA 1G4VA 1VEFA 2BWOA 3WCNA 3E6GA 3NYUA 3N0LA 3HDOA 1M6SA 3TFTA 3CQ4A 1DJ9A 2F8JA 4EFFA 2WB6A 3ISLA 3EI6A 3R9AA 3FD0A 1EQBA 1IVRA 3MAFB 1LK9A 4F5HA 3FVSA 3LG0A 1JS3A 2VMVA 3K28A 1GC2A 4P7YA 4F4EA 4WXBA 2XBNA 3AOWA 4XJPA 4ADDA 2D7YA 1TOKA 3MC6C 2D66A 4H63Q 2WK9A 1GC4A 5E5IA 1V2DA 1W23A 2W7HA 2E7UA 3DR4A 5J8QA 1AAMA 1OXPA 4LNMA 2JJHA 2DR1A 5G2QA 1IBJA 1M0PA 1S06A 1AHXA 3AEPA 1MDZA 1YIZA 3UAKA 2AY2A 3N5MA 4WB0B 4GE7A 3N7NA 3NU7A 4JEVA 2C7TA 2QLRA 1IAYA 1UU2A 2O1BA 2CSTA 2VLHA 3B1EA 3I16A 4W8IA 3ZRQA 4F5GA 1QZ9A 4ITGA 4A0FA 2VGUA 1LKCA 2V0YA 3VAXA 3ASBA 4IXZA 2DGMA 3COGA 3FRKA 3I5TA 4R5ZA 1BQDA 3FFRA 4OYTA 5EUNA 4K05A 4B9BA 2O0RA 2D61A 1BW0A 1C7GA 3L8AA 2R5CA 2W8WA 2VMXA 2FN6A 4EMYA 3QGUA 1WKGA 3EIAA 5M4BA 3K40A 1BS0A 4MKKA 2AY8A 3A9XA 3QHXA 3M5UA 1MAPA 1SZUA 3AEMC 3F9TA 2YCTA 3KGXA 1RV4A 3MC6A 1S0AA 1GDEA 2YCNA 2ZY5A 4ISYA 5BJ3A 4UOYA 2YKYA 4XQ2A 1Z7DA 1IJIA 3FSLA 1ZC9A 3NYTA 4F5KA 5JAYA 4KYOA 4RAEA 1N2TA 2JJGA 2W7GA 3QBOA 4PFFA 1D2FA 1S08A 3HBXA 1YJZA 1QISA 3AV7A 4IYOB 4W1WA 3QM2A 4HVKA 3HMUA 3DRDA 5G2PA 1QGNA 5DX5A 3WGBA 1M0QA 2JJEA 3DXWA 1BJNA 4RLGA 1SFFA 1U08A 1CZCA 1SPAA 2EO5A 3EUCA 2VMZA 4JEXA 2W7MA 2FYFA 3R4TA 3EI9A 4JE5A 2VMOA 1CZEA 3LY1A 1MDOA 1M4NA 4FL0A 4WD2A 2OGEA 3ECDA 4ADEA 1QIRA 3OKSA 1YJYA 4IX8A 2BWPA 3RUYA 2EZ2A 2HP1A 4UHNA 4J8LA 1MDXA 2FKIA 3LV2A 3DXVA 3N4XA 5G09A 1IX8A 3BWOA 2E54A 3ELEA 4KXKA 1YOOA 1LW5A 1V2FA 2D64A 2OKJA 3NYSA 3NNKA 4CVQA 5E4ZA 1UU0A 4MY5A 1ARGA 3AEMA 4L0OA 3NU8A 4GDYA 3OP7A 4MSOA 4OCAA 5D95A 3TQXA 1AIBA 1FG3A 2VMUA 3NX3A 1FG7A 3PJ0A 2ZJGA 3USFA 1AICA 3FQ7A 3BV0A 1IAXA 2VIAA 3JWAA 4R8DA 1X29A 2CANA 2Z9XA 3A8UX 4B98A 1ASDA 1W7NA 2JISA 2KFPA 3MAUA 4PFNA 4Y0HA 1AMQA 3FVUA 4E1OA 1XI9A 2PB2A 4JF1A 1YIYA 5M49A 4N0WA 2W8VA 5EUDA 1OATA 3JZLA 1D7SA 2YOBA 1M0OA 2FQ6A 1BKGA 2VMSA 4CXRA 3Q8NA 4OBUA 2ORDA 1ASLA 1S07A 2DOUA 2Z61A 3E2FA 2R5CB 2GB3A 3PD6A 4M2MA 4ZM4A 1ASCA 4ATPA 2YCPA 4R2NA 2G6WA 1BJOA 2VGTA 3EZSA 2VLFA 5EFSA 5FT5A 2HUFA 2BKWA 1VJOA 3MBBA 2YRRA 2DKBA 2VMTA 4GSAA 4JE5D 4UQVA 4ZSWA 4JEWA 1LW4A 1S09A 5HXXA 1B5OA 2ZP7A 2V1PA 3FZ7A 1TOGA 3DZZA 2Z20A 2ZY2A 2YHKA 1RVUA 1N8PA 2NMPA 4Y0DA 2OQXA 3FQ8A 3VOMA 4WLHA 3DR7A 1BJ4A 1T3IA 3JWBA 1KMKA 4W91A 1Y4IA 3B1CA 1TOEA 1UU1A 3W1IA 3HQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CS1 A;  4PVF A;  1CQ6 A;  4AZJ A;  2BIA A;  1D7V A;  2GMS A;  1YNU A;  4WLJ A;  4DBC A;  1DTY A;  3BN1 A;  1MLY A;  5EAA A;  3BCA A;  5TF5 A;  1AX4 A;  3QI6 A;  2ZSM A;  1H1C A;  3WCO A;  2Z1Z A;  4Q75 A;  2X8U A;  2Z9W A;  3BWN C;  4P3M A;  3H7F A;  3PGY A;  4U2H A;  3EZ1 A;  4MQR A;  4BMK A;  1X2A A;  2CH1 A;  1LC8 A;  1KKJ A;  1E5F A;  1AIA A;  1AKB A;  1OHV A;  3GET A;  1AHY A;  4LC3 A;  2ZYJ A;  2W7E A;  1AAW A;  1IX6 A;  1O61 A;  3CAI A;  2W7L A;  1ZOB A;  2FNU A;  1WST A;  4RIT A;  4TN4 A;  3JU7 A;  2HUI A;  5EQC A;  4LNL A;  4E77 A;  3K7Y A;  1TOI A;  1J32 A;  1LC7 A;  1GC3 A;  5FT4 A;  3TFU A;  1LS3 A;  2Q7W A;  3FDD A;  3HT4 A;  2VMP A;  3AOV A;  2EH6 A;  2GSA A;  3IHJ A;  2PO3 A;  2YRI A;  4WYF A;  1ARI A;  5I92 A;  5AX8 A;  3L44 A;  2W8J A;  3PAA A;  2BHX A;  4M2J A;  2X5F A;  1MLZ A;  3FCR A;  2CIN A;  2D5Y A;  4WXF A;  4E3R A;  4ZDP A;  4ADC A;  3MEB A;  2VMQ A;  1W7L A;  3LVK A;  2C81 A;  2X5D A;  3GZD C;  1O4S A;  3HLM A;  4ITX A;  4DGT A;  4DQ6 A;  2VYC A;  4IW7 A;  2HOY A;  1YJS A;  1SZS A;  2VGS A;  1GCK A;  2TPL A;  3GBX A;  3VK4 A;  3ASA A;  4TMR A;  1ARH A;  1W7M A;  2EPJ A;  2Z1Y A;  1DGD A;  2VGV A;  3FVX A;  3KE3 A;  2QB2 A;  2W7J A;  2Z9U A;  2W8T A;  4CBS A;  4F5F A;  1IX7 A;  3BCB A;  5LH9 A;  4ZWM A;  2VMR A;  3PD6 B;  3BWN A;  3ZRR A;  4OTL A;  4QGR A;  1BJO B;  2Z67 A;  1C9C A;  3I4J A;  1ASE A;  4W1X A;  3WY7 A;  3DC1 A;  1AMR A;  1G7X A;  1H0C A;  1PFF A;  2E7J A;  1TAS A;  3N75 A;  2W7D A;  3PDB A;  3PIU A;  5G0A A;  3EI8 A;  1QJ3 A;  2O7C A;  1C4K A;  3G7Q A;  3WKS A;  2D65 A;  5EAV A;  1MGV A;  4IY7 A;  1KMJ A;  4GE4 A;  4F5L A;  1WYV A;  1E5E A;  1WKH A;  3F0H A;  4A0H A;  2VIB A;  2FM1 A;  3AEO A;  4GEB A;  3CQ5 A;  2VMW A;  3WZF A;  3RQ1 A;  2QBT A;  4CBR A;  3TAT A;  9AAT A;  4TV7 A;  5E3K A;  3VK2 A;  4ZDL A;  2W7K A;  3EI5 A;  1RVY A;  1KL2 A;  2BI2 A;  2BWN A;  3EIB A;  3P6K A;  1I29 A;  2FNI A;  1EJI A;  2AY5 A;  2QB3 A;  1VP4 A;  3BB8 A;  1EG5 A;  3GZD A;  5DB5 A;  4XAU A;  4F5M A;  4OBV A;  1DKA A;  4EB5 A;  1BT4 A;  2VI8 A;  3A2B A;  4BA4 A;  1B4X A;  3GJU A;  4WP0 A;  3FFH A;  1B8G A;  3PA9 A;  1IUG A;  1TOJ A;  4XK1 A;  4K2I A;  1X0M A;  3A9Y A;  3ELP A;  3FKD A;  4RIZ A;  3WLX A;  5F9S A;  2CJD A;  4NOG A;  1SVV A;  4UHO A;  4RJY A;  2CTZ A;  4OMA A;  1OHY A;  5BJ4 A;  2AY1 A;  1WYT B;  3GR9 A;  1P3W A;  3E77 A;  4IXS A;  4ZWV A;  1CQ8 A;  5DJ1 A;  2HUU A;  1M0N A;  2JJF A;  4LW2 A;  2BI5 A;  3E2Z B;  4XJL A;  1V2E A;  2JGT A;  3B8X A;  1GD9 A;  1PG8 A;  2BIG A;  4GE9 A;  4A00 A;  4A6U A;  3AEN B;  4LNJ A;  4A72 A;  1ASN A;  2XH1 A;  5LHA A;  1AHF A;  3BCX A;  4ZAS A;  4RKC A;  2CJG A;  1B5P A;  3NUB A;  4WBT A;  4ZDO A;  2BIE A;  3AAT A;  2W7F A;  4WYC A;  5D5S A;  1AMA A;  2AEV A;  3WGC A;  1G4X A;  1C7O A;  2GQN A;  4WYA A;  4Q31 A;  1DFO A;  1CQ7 A;  4A6R A;  1CJ0 A;  1AKA A;  1C0N A;  3G0T A;  3LVJ A;  1JF9 A;  3ACZ A;  3LWS A;  3QPG A;  4GRX A;  4AO9 A;  3BS8 A;  1CL1 A;  3LVL B;  4K2M A;  1TPL A;  2JG2 A;  5C6U A;  4KAM A;  1QJ5 A;  2BI1 A;  2BI3 A;  4WXG A;  3FZ6 A;  4F5J A;  3GWP A;  5F8V A;  1GEW A;  1ELQ A;  1LC5 A;  1O62 A;  1UKJ A;  4Q76 A;  3F6T A;  3ZZJ A;  3DYD A;  4Q6R A;  1TAT A;  4AOA A;  1D7U A;  1D7R A;  4BQ0 A;  4ZM3 A;  4LW4 A;  4W1V A;  3DOD A;  4OT8 A;  2CH2 A;  3B1D A;  3PPL A;  2QMA A;  3E9K A;  3GZC A;  1CL2 A;  1JS6 A;  3PDB B;  3RBF A;  4BA5 A;  2ZSL A;  3VK3 A;  1AJS A;  3II0 A;  4J5U A;  4MKJ A;  2CFB A;  3E2Y A;  4ATQ A;  1OHW A;  4E3Q A;  1WYV B;  1WYT A;  1M7Y A;  4H51 A;  4XJM A;  3CQ6 A;  1Z3Z A;  3GSB A;  4ZLV A;  4BHD A;  2W8U A;  2YKU A;  2C44 A;  2HOZ A;  4AO4 A;  3E2Z A;  2D63 A;  3W1J A;  2X3L A;  1GEY A;  3IF2 A;  3T32 A;  3AEN A;  3KKI A;  4M2K A;  3CBF A;  4W5K A;  4JEY A;  4Y0I A;  1DJU A;  1W3U A;  4UHM A;  5EUE A;  1AHE A;  2ZUK A;  4IXO A;  4R5F A;  4WYE A;  3UWC A;  3HVY A;  2HOX A;  2DGK A;  3QN6 A;  5HHY A;  1DGE A;  1M32 A;  4WYD A;  3RCH A;  3NUI A;  5EIG B;  3MAD A;  2R5E A;  1ASG A;  4WYG A;  2WK7 A;  1WYU B;  2CB1 A;  2OKK A;  2ZY3 A;  4EB7 A;  3NRA A;  4MQP A;  3AEJ C;  4RJ0 A;  3FDB A;  5FT6 A;  1I48 A;  3LVM A;  4A0R A;  1GBN A;  2HP2 A;  1RV3 A;  2GMU A;  1AKC A;  4XJO A;  5M4D A;  2HOR A;  3ATH A;  2CY8 A;  1PMO A;  5HDM A;  4K2B A;  1G7W A;  4RKD A;  1ORD A;  2AY9 A;  2WKA A;  3MAF A;  4PIW A;  3RI6 A;  2ZC0 A;  1YAA A;  2YKX A;  1ASB A;  3A9Z A;  2WK8 A;  3B46 A;  4XEW A;  3ZRP A;  4OC9 A;  4ZSY A;  4AZK A;  2VI9 A;  2AY6 A;  2VGW A;  3FQA A;  4U1T A;  3TCM A;  2BI9 A;  2CJH A;  4F5I A;  5G4J A;  1AY4 A;  1TAR A;  1ZOD A;  2OGA A;  1AJR A;  3BC8 A;  1DJE A;  2PB0 A;  1I41 A;  3H14 A;  4JF0 A;  3W1H A;  2ZY4 A;  2VMY A;  2EZ1 A;  2AAT A;  2VGZ A;  4MQQ A;  1GC0 A;  4I8A A;  8AAT A;  1ARS A;  3HL2 A;  1SF2 A;  1PMM A;  3D6K A;  4WB0 A;  2E7I A;  3VP6 A;  1QIT A;  2Z9V A;  1ECX A;  1MAQ A;  5G4I A;  3DU4 A;  2RFV A;  5IWQ A;  4O6Z A;  1I43 A;  3EI7 A;  1ASF A;  3UE8 A;  1XEY A;  5EIG A;  2DGL A;  3WX9 A;  1WYU A;  2OAT A;  3AEJ A;  3P1T A;  5DJ9 A;  3RBL A;  1J04 A;  1OXO A;  3JW9 A;  4RM1 A;  2W7I A;  3JTX A;  1V72 A;  1SZK A;  1AJS B;  3WKR A;  3MKJ A;  1N31 A;  2BYJ A;  3NTJ A;  1B9H A;  3NDN A;  1ART A;  2EGY A;  2AY3 A;  3FZ8 A;  1C7N A;  4ZAH A;  5K8B A;  1BQA A;  1JG8 A;  2QA3 A;  2R2N A;  3G8M A;  4MGR A;  1AMS A;  3KGW A;  4A6T A;  1FC4 A;  4A0G A;  1GEX A;  4HF8 A;  3ZZK A;  1O69 A;  2AEU A;  4AH3 A;  1KL1 A;  4EU1 A;  1AY8 A;  4FFC A;  2C0R A;  2R0T A;  2AY4 A;  1ASA A;  2HZP A;  1ASM A;  1ELU A;  3AEL A;  1BJW A;  4JEZ A;  4N0B A;  5M46 A;  4ADB A;  2BYL A;  5FT8 A;  2VMN A;  2DKJ A;  1KKP A;  3RCH B;  3PDX A;  4IYO A;  7AAT A;  4CXQ A;  1X28 A;  1AY5 A;  1AHG A;  2D7Z A;  2AY7 A;  1B9I A;  3FTB A;  2YKV A;  1G4V A;  1VEF A;  2BWO A;  3WCN A;  3E6G A;  3NYU A;  3N0L A;  3HDO A;  1M6S A;  3TFT A;  3CQ4 A;  1DJ9 A;  2F8J A;  4EFF A;  3ISL A;  3EI6 A;  3R9A A;  3FD0 A;  1EQB A;  1IVR A;  3MAF B;  1LK9 A;  4F5H A;  3FVS A;  3LG0 A;  1JS3 A;  2VMV A;  3K28 A;  1GC2 A;  4P7Y A;  4F4E A;  4WXB A;  2XBN A;  3AOW A;  4XJP A;  4ADD A;  2D7Y A;  1TOK A;  3MC6 C;  2D66 A;  2WK9 A;  1GC4 A;  5E5I A;  1V2D A;  1W23 A;  2W7H A;  2E7U A;  3DR4 A;  5J8Q A;  1AAM A;  1OXP A;  4LNM A;  2JJH A;  2DR1 A;  5G2Q A;  1IBJ A;  1M0P A;  1S06 A;  1AHX A;  3AEP A;  1MDZ A;  1YIZ A;  3UAK A;  2AY2 A;  3N5M A;  4WB0 B;  4GE7 A;  3NU7 A;  4JEV A;  2C7T A;  2QLR A;  1IAY A;  1UU2 A;  2O1B A;  2CST A;  2VLH A;  3B1E A;  3I16 A;  4W8I A;  3ZRQ A;  4F5G A;  1QZ9 A;  4ITG A;  4A0F A;  2VGU A;  1LKC A;  2V0Y A;  3VAX A;  3ASB A;  4IXZ A;  2DGM A;  3COG A;  3FRK A;  3I5T A;  4R5Z A;  1BQD A;  3FFR A;  4OYT A;  5EUN A;  4B9B A;  2O0R A;  2D61 A;  1BW0 A;  1C7G A;  3L8A A;  2R5C A;  2W8W A;  2VMX A;  2FN6 A;  4EMY A;  3QGU A;  1WKG A;  3EIA A;  5M4B A;  3K40 A;  1BS0 A;  4MKK A;  2AY8 A;  3A9X A;  3QHX A;  3M5U A;  1MAP A;  1SZU A;  3AEM C;  3F9T A;  2YCT A;  3KGX A;  1RV4 A;  3MC6 A;  1S0A A;  1GDE A;  2YCN A;  2ZY5 A;  4ISY A;  5BJ3 A;  4UOY A;  2YKY A;  4XQ2 A;  1Z7D A;  1IJI A;  3FSL A;  1ZC9 A;  3NYT A;  4F5K A;  5JAY A;  4KYO A;  4RAE A;  1N2T A;  2JJG A;  2W7G A;  3QBO A;  4PFF A;  1D2F A;  1S08 A;  3HBX A;  1YJZ A;  1QIS A;  3AV7 A;  4IYO B;  4W1W A;  3QM2 A;  4HVK A;  3HMU A;  3DRD A;  5G2P A;  1QGN A;  5DX5 A;  3WGB A;  1M0Q A;  2JJE A;  3DXW A;  1BJN A;  4RLG A;  1SFF A;  1U08 A;  1CZC A;  1SPA A;  2EO5 A;  3EUC A;  2VMZ A;  4JEX A;  2W7M A;  2FYF A;  3R4T A;  3EI9 A;  4JE5 A;  2VMO A;  1CZE A;  3LY1 A;  1MDO A;  1M4N A;  4FL0 A;  4WD2 A;  2OGE A;  3ECD A;  4ADE A;  1QIR A;  3OKS A;  1YJY A;  4IX8 A;  2BWP A;  3RUY A;  2EZ2 A;  2HP1 A;  4UHN A;  4J8L A;  1MDX A;  3LV2 A;  3DXV A;  5G09 A;  1IX8 A;  3BWO A;  2E54 A;  3ELE A;  4KXK A;  1YOO A;  1LW5 A;  1V2F A;  2D64 A;  2OKJ A;  3NYS A;  3NNK A;  4CVQ A;  5E4Z A;  1UU0 A;  4MY5 A;  1ARG A;  3AEM A;  4L0O A;  3NU8 A;  4GDY A;  3OP7 A;  4MSO A;  4OCA A;  5D95 A;  3TQX A;  1AIB A;  1FG3 A;  2VMU A;  3NX3 A;  1FG7 A;  3PJ0 A;  2ZJG A;  3USF A;  1AIC A;  3FQ7 A;  3BV0 A;  1IAX A;  2VIA A;  3JWA A;  4R8D A;  1X29 A;  2CAN A;  2Z9X A;  3A8U X;  4B98 A;  1ASD A;  1W7N A;  2JIS A;  3MAU A;  4PFN A;  4Y0H A;  1AMQ A;  3FVU A;  4E1O A;  1XI9 A;  2PB2 A;  4JF1 A;  1YIY A;  5M49 A;  4N0W A;  2W8V A;  5EUD A;  1OAT A;  3JZL A;  1D7S A;  2YOB A;  1M0O A;  2FQ6 A;  1BKG A;  2VMS A;  4CXR A;  3Q8N A;  4OBU A;  2ORD A;  1ASL A;  1S07 A;  2DOU A;  2Z61 A;  3E2F A;  2R5C B;  2GB3 A;  3PD6 A;  4M2M A;  4ZM4 A;  1ASC A;  4ATP A;  2YCP A;  4R2N A;  2G6W A;  1BJO A;  2VGT A;  3EZS A;  2VLF A;  5EFS A;  5FT5 A;  2HUF A;  2BKW A;  1VJO A;  3MBB A;  2YRR A;  2DKB A;  2VMT A;  4GSA A;  4JE5 D;  4UQV A;  4ZSW A;  4JEW A;  1LW4 A;  1S09 A;  5HXX A;  1B5O A;  2ZP7 A;  2V1P A;  3FZ7 A;  1TOG A;  3DZZ A;  2Z20 A;  2ZY2 A;  2YHK A;  1RVU A;  1N8P A;  2NMP A;  4Y0D A;  2OQX A;  3FQ8 A;  3VOM A;  4WLH A;  3DR7 A;  1BJ4 A;  1T3I A;  3JWB A;  1KMK A;  4W91 A;  1Y4I A;  3B1C A;  1TOE A;  1UU1 A;  3W1I A;  3HQT A; 
#chains in the Genus database with same CATH topology
 1CS1 A;  4PVF A;  1CQ6 A;  4AZJ A;  2BIA A;  1D7V A;  2GMS A;  1YNU A;  4WLJ A;  4DBC A;  1DTY A;  3BN1 A;  1MLY A;  5EAA A;  3BCA A;  5TF5 A;  1AX4 A;  3QI6 A;  2ZSM A;  1H1C A;  3WCO A;  2Z1Z A;  4Q75 A;  3N4R A;  2X8U A;  2Z9W A;  3BWN C;  4P3M A;  3H7F A;  3PGY A;  4U2H A;  3EZ1 A;  4MQR A;  4BMK A;  1X2A A;  2CH1 A;  1LC8 A;  1KKJ A;  1E5F A;  1AIA A;  1AKB A;  1OHV A;  3GET A;  1AHY A;  4LC3 A;  2ZYJ A;  2W7E A;  1AAW A;  1IX6 A;  1O61 A;  3CAI A;  2W7L A;  2EYQ A;  1ZOB A;  2FNU A;  1WST A;  4RIT A;  4TN4 A;  3JU7 A;  2HUI A;  5EQC A;  4LNL A;  4E77 A;  3K7Y A;  1TOI A;  1J32 A;  1LC7 A;  1GC3 A;  5FT4 A;  3TFU A;  1LS3 A;  2Q7W A;  3FDD A;  3HT4 A;  2VMP A;  3AOV A;  2EH6 A;  2GSA A;  3IHJ A;  2PO3 A;  2YRI A;  4WYF A;  1ARI A;  5I92 A;  5AX8 A;  3L44 A;  2W8J A;  3PAA A;  2BHX A;  4M2J A;  2X5F A;  1MLZ A;  3FCR A;  2CIN A;  2D5Y A;  4WXF A;  4E3R A;  4ZDP A;  4ADC A;  3MEB A;  2VMQ A;  1W7L A;  3LVK A;  2C81 A;  2X5D A;  3GZD C;  1O4S A;  3HLM A;  4ITX A;  4DGT A;  3N4S A;  4DQ6 A;  2VYC A;  4IW7 A;  2HOY A;  1YJS A;  1SZS A;  2VGS A;  1GCK A;  2TPL A;  3GBX A;  3VK4 A;  3ASA A;  4TMR A;  1ARH A;  1W7M A;  2EPJ A;  2Z1Y A;  1DGD A;  2VGV A;  3FVX A;  3KE3 A;  2QB2 A;  2W7J A;  2Z9U A;  2W8T A;  4CBS A;  4F5F A;  1IX7 A;  3BCB A;  5LH9 A;  4ZWM A;  2VMR A;  3PD6 B;  3BWN A;  3ZRR A;  4OTL A;  4QGR A;  1BJO B;  2Z67 A;  1C9C A;  3I4J A;  1ASE A;  4W1X A;  3WY7 A;  3DC1 A;  1AMR A;  1G7X A;  1H0C A;  1PFF A;  2E7J A;  1TAS A;  3N75 A;  2W7D A;  3PDB A;  3PIU A;  5G0A A;  3EI8 A;  1QJ3 A;  2O7C A;  1C4K A;  3G7Q A;  3WKS A;  2D65 A;  5EAV A;  1MGV A;  4IY7 A;  1KMJ A;  4GE4 A;  4F5L A;  1WYV A;  1E5E A;  1WKH A;  3F0H A;  4A0H A;  2VIB A;  2FM1 A;  3AEO A;  4GEB A;  3CQ5 A;  2VMW A;  3WZF A;  3RQ1 A;  2QBT A;  4CBR A;  3TAT A;  9AAT A;  4TV7 A;  5E3K A;  3VK2 A;  4ZDL A;  2W7K A;  3EI5 A;  1RVY A;  1KL2 A;  1KAF A;  2BI2 A;  2BWN A;  3EIB A;  3P6K A;  1I29 A;  2FNI A;  1EJI A;  2AY5 A;  2QB3 A;  1VP4 A;  3BB8 A;  1EG5 A;  3GZD A;  5DB5 A;  4XAU A;  4F5M A;  4OBV A;  1DKA A;  4EB5 A;  1BT4 A;  2VI8 A;  3A2B A;  4BA4 A;  1B4X A;  3GJU A;  4WP0 A;  3FFH A;  1B8G A;  3PA9 A;  1IUG A;  1TOJ A;  4XK1 A;  4K2I A;  1X0M A;  3A9Y A;  3ELP A;  3FKD A;  4RIZ A;  3WLX A;  5F9S A;  2CJD A;  4NOG A;  1SVV A;  4UHO A;  4RJY A;  2CTZ A;  4OMA A;  1OHY A;  5BJ4 A;  2AY1 A;  1WYT B;  3GR9 A;  1P3W A;  3E77 A;  4IXS A;  4ZWV A;  1CQ8 A;  5DJ1 A;  2HUU A;  1M0N A;  2JJF A;  4LW2 A;  2BI5 A;  3E2Z B;  4XJL A;  1V2E A;  2JGT A;  3B8X A;  1GD9 A;  1PG8 A;  2BIG A;  4GE9 A;  4A00 A;  4A6U A;  3AEN B;  4LNJ A;  4A72 A;  1ASN A;  2XH1 A;  5LHA A;  1AHF A;  3BCX A;  4ZAS A;  4RKC A;  2CJG A;  1B5P A;  3NUB A;  4WBT A;  4ZDO A;  2BIE A;  3AAT A;  2W7F A;  4WYC A;  5D5S A;  1AMA A;  2AEV A;  3WGC A;  1G4X A;  1C7O A;  2GQN A;  4WYA A;  4Q31 A;  3H9X A;  1DFO A;  1CQ7 A;  4A6R A;  1CJ0 A;  1AKA A;  1C0N A;  3G0T A;  3LVJ A;  1JF9 A;  3ACZ A;  3LWS A;  3QPG A;  4GRX A;  4AO9 A;  3BS8 A;  1CL1 A;  3LVL B;  4K2M A;  1TPL A;  2JG2 A;  5C6U A;  2QSR A;  4KAM A;  1QJ5 A;  2BI1 A;  2BI3 A;  4WXG A;  3FZ6 A;  4F5J A;  3GWP A;  5F8V A;  1GEW A;  1ELQ A;  1LC5 A;  1O62 A;  1UKJ A;  4Q76 A;  3F6T A;  3ZZJ A;  3DYD A;  4Q6R A;  1TAT A;  4AOA A;  1D7U A;  1D7R A;  4BQ0 A;  4ZM3 A;  4LW4 A;  4W1V A;  3DOD A;  4OT8 A;  2G7J A;  2CH2 A;  3B1D A;  3PPL A;  2QMA A;  3E9K A;  3GZC A;  1CL2 A;  1JS6 A;  3PDB B;  3RBF A;  4BA5 A;  2ZSL A;  3VK3 A;  1AJS A;  3II0 A;  4J5U A;  4MKJ A;  2CFB A;  3E2Y A;  4ATQ A;  1OHW A;  4E3Q A;  1WYV B;  1WYT A;  1M7Y A;  4H51 A;  4XJM A;  3CQ6 A;  1Z3Z A;  3GSB A;  4ZLV A;  4BHD A;  2W8U A;  2YKU A;  2C44 A;  2HOZ A;  4AO4 A;  3E2Z A;  2D63 A;  5KTB A;  3W1J A;  2X3L A;  1GEY A;  3IF2 A;  3T32 A;  3AEN A;  3KKI A;  4M2K A;  3CBF A;  4W5K A;  4JEY A;  4Y0I A;  1DJU A;  1W3U A;  4UHM A;  5EUE A;  1AHE A;  2ZUK A;  4IXO A;  4R5F A;  4WYE A;  3UWC A;  3HVY A;  2HOX A;  2DGK A;  3QN6 A;  5HHY A;  1DGE A;  1M32 A;  4WYD A;  3RCH A;  3NUI A;  5EIG B;  3MAD A;  2R5E A;  1ASG A;  4WYG A;  2WK7 A;  1WYU B;  2CB1 A;  2OKK A;  2ZY3 A;  4EB7 A;  3NRA A;  4MQP A;  3AEJ C;  4RJ0 A;  3FDB A;  5FT6 A;  1I48 A;  3LVM A;  4A0R A;  1GBN A;  2HP2 A;  1RV3 A;  2GMU A;  1AKC A;  4XJO A;  5M4D A;  2HOR A;  3ATH A;  2CY8 A;  1PMO A;  5HDM A;  4K2B A;  1G7W A;  4RKD A;  1ORD A;  2AY9 A;  2WKA A;  3MAF A;  4PIW A;  3RI6 A;  2ZC0 A;  1YAA A;  2YKX A;  1ASB A;  3A9Z A;  2WK8 A;  3B46 A;  4XEW A;  3ZRP A;  4OC9 A;  4ZSY A;  4AZK A;  2VI9 A;  2AY6 A;  2VGW A;  3FQA A;  4U1T A;  3TCM A;  2BI9 A;  2CJH A;  4F5I A;  5G4J A;  1AY4 A;  1TAR A;  1ZOD A;  2OGA A;  1AJR A;  3BC8 A;  1DJE A;  2PB0 A;  1I41 A;  3H14 A;  4JF0 A;  3W1H A;  2ZY4 A;  2VMY A;  2EZ1 A;  2AAT A;  2VGZ A;  4MQQ A;  1GC0 A;  4I8A A;  8AAT A;  1ARS A;  3HL2 A;  1SF2 A;  1PMM A;  3D6K A;  4WB0 A;  2E7I A;  3VP6 A;  1QIT A;  2Z9V A;  1ECX A;  1MAQ A;  5G4I A;  3DU4 A;  2RFV A;  5IWQ A;  4O6Z A;  1I43 A;  3EI7 A;  1ASF A;  3UE8 A;  1XEY A;  5EIG A;  2DGL A;  3WX9 A;  1WYU A;  2OAT A;  3AEJ A;  3P1T A;  5DJ9 A;  3RBL A;  1J04 A;  1OXO A;  3JW9 A;  4RM1 A;  2W7I A;  3JTX A;  1V72 A;  1SZK A;  1AJS B;  3WKR A;  3MKJ A;  1N31 A;  2BYJ A;  3NTJ A;  1B9H A;  3NDN A;  1ART A;  2EGY A;  2AY3 A;  3FZ8 A;  1C7N A;  4ZAH A;  5K8B A;  2A1V A;  1BQA A;  1JG8 A;  2QA3 A;  2R2N A;  3G8M A;  4MGR A;  1AMS A;  3KGW A;  4A6T A;  1FC4 A;  4A0G A;  1GEX A;  4HF8 A;  3ZZK A;  1O69 A;  2AEU A;  4AH3 A;  1KL1 A;  4EU1 A;  1AY8 A;  4FFC A;  2C0R A;  2R0T A;  2AY4 A;  1ASA A;  2HZP A;  1ASM A;  1ELU A;  3AEL A;  1BJW A;  4JEZ A;  4N0B A;  5M46 A;  4ADB A;  2BYL A;  5FT8 A;  2VMN A;  2DKJ A;  1KKP A;  3RCH B;  3PDX A;  4IYO A;  7AAT A;  4CXQ A;  1X28 A;  1AY5 A;  1AHG A;  2D7Z A;  2AY7 A;  1B9I A;  3FTB A;  2YKV A;  1G4V A;  1VEF A;  2BWO A;  3WCN A;  3E6G A;  3NYU A;  3N0L A;  3HDO A;  1M6S A;  3TFT A;  3CQ4 A;  1DJ9 A;  2F8J A;  4EFF A;  2WB6 A;  3ISL A;  3EI6 A;  3R9A A;  3FD0 A;  1EQB A;  1IVR A;  3MAF B;  1LK9 A;  4F5H A;  3FVS A;  3LG0 A;  1JS3 A;  2VMV A;  3K28 A;  1GC2 A;  4P7Y A;  4F4E A;  4WXB A;  2XBN A;  3AOW A;  4XJP A;  4ADD A;  2D7Y A;  1TOK A;  3MC6 C;  2D66 A;  4H63 Q;  2WK9 A;  1GC4 A;  5E5I A;  1V2D A;  1W23 A;  2W7H A;  2E7U A;  3DR4 A;  5J8Q A;  1AAM A;  1OXP A;  4LNM A;  2JJH A;  2DR1 A;  5G2Q A;  1IBJ A;  1M0P A;  1S06 A;  1AHX A;  3AEP A;  1MDZ A;  1YIZ A;  3UAK A;  2AY2 A;  3N5M A;  4WB0 B;  4GE7 A;  3N7N A;  3NU7 A;  4JEV A;  2C7T A;  2QLR A;  1IAY A;  1UU2 A;  2O1B A;  2CST A;  2VLH A;  3B1E A;  3I16 A;  4W8I A;  3ZRQ A;  4F5G A;  1QZ9 A;  4ITG A;  4A0F A;  2VGU A;  1LKC A;  2V0Y A;  3VAX A;  3ASB A;  4IXZ A;  2DGM A;  3COG A;  3FRK A;  3I5T A;  4R5Z A;  1BQD A;  3FFR A;  4OYT A;  5EUN A;  4K05 A;  4B9B A;  2O0R A;  2D61 A;  1BW0 A;  1C7G A;  3L8A A;  2R5C A;  2W8W A;  2VMX A;  2FN6 A;  4EMY A;  3QGU A;  1WKG A;  3EIA A;  5M4B A;  3K40 A;  1BS0 A;  4MKK A;  2AY8 A;  3A9X A;  3QHX A;  3M5U A;  1MAP A;  1SZU A;  3AEM C;  3F9T A;  2YCT A;  3KGX A;  1RV4 A;  3MC6 A;  1S0A A;  1GDE A;  2YCN A;  2ZY5 A;  4ISY A;  5BJ3 A;  4UOY A;  2YKY A;  4XQ2 A;  1Z7D A;  1IJI A;  3FSL A;  1ZC9 A;  3NYT A;  4F5K A;  5JAY A;  4KYO A;  4RAE A;  1N2T A;  2JJG A;  2W7G A;  3QBO A;  4PFF A;  1D2F A;  1S08 A;  3HBX A;  1YJZ A;  1QIS A;  3AV7 A;  4IYO B;  4W1W A;  3QM2 A;  4HVK A;  3HMU A;  3DRD A;  5G2P A;  1QGN A;  5DX5 A;  3WGB A;  1M0Q A;  2JJE A;  3DXW A;  1BJN A;  4RLG A;  1SFF A;  1U08 A;  1CZC A;  1SPA A;  2EO5 A;  3EUC A;  2VMZ A;  4JEX A;  2W7M A;  2FYF A;  3R4T A;  3EI9 A;  4JE5 A;  2VMO A;  1CZE A;  3LY1 A;  1MDO A;  1M4N A;  4FL0 A;  4WD2 A;  2OGE A;  3ECD A;  4ADE A;  1QIR A;  3OKS A;  1YJY A;  4IX8 A;  2BWP A;  3RUY A;  2EZ2 A;  2HP1 A;  4UHN A;  4J8L A;  1MDX A;  2FKI A;  3LV2 A;  3DXV A;  3N4X A;  5G09 A;  1IX8 A;  3BWO A;  2E54 A;  3ELE A;  4KXK A;  1YOO A;  1LW5 A;  1V2F A;  2D64 A;  2OKJ A;  3NYS A;  3NNK A;  4CVQ A;  5E4Z A;  1UU0 A;  4MY5 A;  1ARG A;  3AEM A;  4L0O A;  3NU8 A;  4GDY A;  3OP7 A;  4MSO A;  4OCA A;  5D95 A;  3TQX A;  1AIB A;  1FG3 A;  2VMU A;  3NX3 A;  1FG7 A;  3PJ0 A;  2ZJG A;  3USF A;  1AIC A;  3FQ7 A;  3BV0 A;  1IAX A;  2VIA A;  3JWA A;  4R8D A;  1X29 A;  2CAN A;  2Z9X A;  3A8U X;  4B98 A;  1ASD A;  1W7N A;  2JIS A;  2KFP A;  3MAU A;  4PFN A;  4Y0H A;  1AMQ A;  3FVU A;  4E1O A;  1XI9 A;  2PB2 A;  4JF1 A;  1YIY A;  5M49 A;  4N0W A;  2W8V A;  5EUD A;  1OAT A;  3JZL A;  1D7S A;  2YOB A;  1M0O A;  2FQ6 A;  1BKG A;  2VMS A;  4CXR A;  3Q8N A;  4OBU A;  2ORD A;  1ASL A;  1S07 A;  2DOU A;  2Z61 A;  3E2F A;  2R5C B;  2GB3 A;  3PD6 A;  4M2M A;  4ZM4 A;  1ASC A;  4ATP A;  2YCP A;  4R2N A;  2G6W A;  1BJO A;  2VGT A;  3EZS A;  2VLF A;  5EFS A;  5FT5 A;  2HUF A;  2BKW A;  1VJO A;  3MBB A;  2YRR A;  2DKB A;  2VMT A;  4GSA A;  4JE5 D;  4UQV A;  4ZSW A;  4JEW A;  1LW4 A;  1S09 A;  5HXX A;  1B5O A;  2ZP7 A;  2V1P A;  3FZ7 A;  1TOG A;  3DZZ A;  2Z20 A;  2ZY2 A;  2YHK A;  1RVU A;  1N8P A;  2NMP A;  4Y0D A;  2OQX A;  3FQ8 A;  3VOM A;  4WLH A;  3DR7 A;  1BJ4 A;  1T3I A;  3JWB A;  1KMK A;  4W91 A;  1Y4I A;  3B1C A;  1TOE A;  1UU1 A;  3W1I A;  3HQT A; 
#chains in the Genus database with same CATH homology
 1CS1 A;  4PVF A;  1CQ6 A;  4AZJ A;  2BIA A;  1D7V A;  2GMS A;  1YNU A;  4WLJ A;  4DBC A;  1DTY A;  3BN1 A;  1MLY A;  5EAA A;  3BCA A;  5TF5 A;  1AX4 A;  3QI6 A;  2ZSM A;  1H1C A;  3WCO A;  2Z1Z A;  4Q75 A;  3N4R A;  2X8U A;  2Z9W A;  3BWN C;  4P3M A;  3H7F A;  3PGY A;  4U2H A;  3EZ1 A;  4MQR A;  4BMK A;  1X2A A;  2CH1 A;  1LC8 A;  1KKJ A;  1E5F A;  1AIA A;  1AKB A;  1OHV A;  3GET A;  1AHY A;  4LC3 A;  2ZYJ A;  2W7E A;  1AAW A;  1IX6 A;  1O61 A;  3CAI A;  2W7L A;  2EYQ A;  1ZOB A;  2FNU A;  1WST A;  4RIT A;  4TN4 A;  3JU7 A;  2HUI A;  5EQC A;  4LNL A;  4E77 A;  3K7Y A;  1TOI A;  1J32 A;  1LC7 A;  1GC3 A;  5FT4 A;  3TFU A;  1LS3 A;  2Q7W A;  3FDD A;  3HT4 A;  2VMP A;  3AOV A;  2EH6 A;  2GSA A;  3IHJ A;  2PO3 A;  2YRI A;  4WYF A;  1ARI A;  5I92 A;  5AX8 A;  3L44 A;  2W8J A;  3PAA A;  2BHX A;  4M2J A;  2X5F A;  1MLZ A;  3FCR A;  2CIN A;  2D5Y A;  4WXF A;  4E3R A;  4ZDP A;  4ADC A;  3MEB A;  2VMQ A;  1W7L A;  3LVK A;  2C81 A;  2X5D A;  3GZD C;  1O4S A;  3HLM A;  4ITX A;  4DGT A;  3N4S A;  4DQ6 A;  2VYC A;  4IW7 A;  2HOY A;  1YJS A;  1SZS A;  2VGS A;  1GCK A;  2TPL A;  3GBX A;  3VK4 A;  3ASA A;  4TMR A;  1ARH A;  1W7M A;  2EPJ A;  2Z1Y A;  1DGD A;  2VGV A;  3FVX A;  3KE3 A;  2QB2 A;  2W7J A;  2Z9U A;  2W8T A;  4CBS A;  4F5F A;  1IX7 A;  3BCB A;  5LH9 A;  4ZWM A;  2VMR A;  3PD6 B;  3BWN A;  3ZRR A;  4OTL A;  4QGR A;  1BJO B;  2Z67 A;  1C9C A;  3I4J A;  1ASE A;  4W1X A;  3WY7 A;  3DC1 A;  1AMR A;  1G7X A;  1H0C A;  1PFF A;  2E7J A;  1TAS A;  3N75 A;  2W7D A;  3PDB A;  3PIU A;  5G0A A;  3EI8 A;  1QJ3 A;  2O7C A;  1C4K A;  3G7Q A;  3WKS A;  2D65 A;  5EAV A;  1MGV A;  4IY7 A;  1KMJ A;  4GE4 A;  4F5L A;  1WYV A;  1E5E A;  1WKH A;  3F0H A;  4A0H A;  2VIB A;  2FM1 A;  3AEO A;  4GEB A;  3CQ5 A;  2VMW A;  3WZF A;  3RQ1 A;  2QBT A;  4CBR A;  3TAT A;  9AAT A;  4TV7 A;  5E3K A;  3VK2 A;  4ZDL A;  2W7K A;  3EI5 A;  1RVY A;  1KL2 A;  2BI2 A;  2BWN A;  3EIB A;  3P6K A;  1I29 A;  2FNI A;  1EJI A;  2AY5 A;  2QB3 A;  1VP4 A;  3BB8 A;  1EG5 A;  3GZD A;  5DB5 A;  4XAU A;  4F5M A;  4OBV A;  1DKA A;  4EB5 A;  1BT4 A;  2VI8 A;  3A2B A;  4BA4 A;  1B4X A;  3GJU A;  4WP0 A;  3FFH A;  1B8G A;  3PA9 A;  1IUG A;  1TOJ A;  4XK1 A;  4K2I A;  1X0M A;  3A9Y A;  3ELP A;  3FKD A;  4RIZ A;  3WLX A;  5F9S A;  2CJD A;  4NOG A;  1SVV A;  4UHO A;  4RJY A;  2CTZ A;  4OMA A;  1OHY A;  5BJ4 A;  2AY1 A;  1WYT B;  3GR9 A;  1P3W A;  3E77 A;  4IXS A;  4ZWV A;  1CQ8 A;  5DJ1 A;  2HUU A;  1M0N A;  2JJF A;  4LW2 A;  2BI5 A;  3E2Z B;  4XJL A;  1V2E A;  2JGT A;  3B8X A;  1GD9 A;  1PG8 A;  2BIG A;  4GE9 A;  4A00 A;  4A6U A;  3AEN B;  4LNJ A;  4A72 A;  1ASN A;  2XH1 A;  5LHA A;  1AHF A;  3BCX A;  4ZAS A;  4RKC A;  2CJG A;  1B5P A;  3NUB A;  4WBT A;  4ZDO A;  2BIE A;  3AAT A;  2W7F A;  4WYC A;  5D5S A;  1AMA A;  2AEV A;  3WGC A;  1G4X A;  1C7O A;  2GQN A;  4WYA A;  4Q31 A;  3H9X A;  1DFO A;  1CQ7 A;  4A6R A;  1CJ0 A;  1AKA A;  1C0N A;  3G0T A;  3LVJ A;  1JF9 A;  3ACZ A;  3LWS A;  3QPG A;  4GRX A;  4AO9 A;  3BS8 A;  1CL1 A;  3LVL B;  4K2M A;  1TPL A;  2JG2 A;  5C6U A;  2QSR A;  4KAM A;  1QJ5 A;  2BI1 A;  2BI3 A;  4WXG A;  3FZ6 A;  4F5J A;  3GWP A;  5F8V A;  1GEW A;  1ELQ A;  1LC5 A;  1O62 A;  1UKJ A;  4Q76 A;  3F6T A;  3ZZJ A;  3DYD A;  4Q6R A;  1TAT A;  4AOA A;  1D7U A;  1D7R A;  4BQ0 A;  4ZM3 A;  4LW4 A;  4W1V A;  3DOD A;  4OT8 A;  2G7J A;  2CH2 A;  3B1D A;  3PPL A;  2QMA A;  3E9K A;  3GZC A;  1CL2 A;  1JS6 A;  3PDB B;  3RBF A;  4BA5 A;  2ZSL A;  3VK3 A;  1AJS A;  3II0 A;  4J5U A;  4MKJ A;  2CFB A;  3E2Y A;  4ATQ A;  1OHW A;  4E3Q A;  1WYV B;  1WYT A;  1M7Y A;  4H51 A;  4XJM A;  3CQ6 A;  1Z3Z A;  3GSB A;  4ZLV A;  4BHD A;  2W8U A;  2YKU A;  2C44 A;  2HOZ A;  4AO4 A;  3E2Z A;  2D63 A;  5KTB A;  3W1J A;  2X3L A;  1GEY A;  3IF2 A;  3T32 A;  3AEN A;  3KKI A;  4M2K A;  3CBF A;  4W5K A;  4JEY A;  4Y0I A;  1DJU A;  1W3U A;  4UHM A;  5EUE A;  1AHE A;  2ZUK A;  4IXO A;  4R5F A;  4WYE A;  3UWC A;  3HVY A;  2HOX A;  2DGK A;  3QN6 A;  5HHY A;  1DGE A;  1M32 A;  4WYD A;  3RCH A;  3NUI A;  5EIG B;  3MAD A;  2R5E A;  1ASG A;  4WYG A;  2WK7 A;  1WYU B;  2CB1 A;  2OKK A;  2ZY3 A;  4EB7 A;  3NRA A;  4MQP A;  3AEJ C;  4RJ0 A;  3FDB A;  5FT6 A;  1I48 A;  3LVM A;  4A0R A;  1GBN A;  2HP2 A;  1RV3 A;  2GMU A;  1AKC A;  4XJO A;  5M4D A;  2HOR A;  3ATH A;  2CY8 A;  1PMO A;  5HDM A;  4K2B A;  1G7W A;  4RKD A;  1ORD A;  2AY9 A;  2WKA A;  3MAF A;  4PIW A;  3RI6 A;  2ZC0 A;  1YAA A;  2YKX A;  1ASB A;  3A9Z A;  2WK8 A;  3B46 A;  4XEW A;  3ZRP A;  4OC9 A;  4ZSY A;  4AZK A;  2VI9 A;  2AY6 A;  2VGW A;  3FQA A;  4U1T A;  3TCM A;  2BI9 A;  2CJH A;  4F5I A;  5G4J A;  1AY4 A;  1TAR A;  1ZOD A;  2OGA A;  1AJR A;  3BC8 A;  1DJE A;  2PB0 A;  1I41 A;  3H14 A;  4JF0 A;  3W1H A;  2ZY4 A;  2VMY A;  2EZ1 A;  2AAT A;  2VGZ A;  4MQQ A;  1GC0 A;  4I8A A;  8AAT A;  1ARS A;  3HL2 A;  1SF2 A;  1PMM A;  3D6K A;  4WB0 A;  2E7I A;  3VP6 A;  1QIT A;  2Z9V A;  1ECX A;  1MAQ A;  5G4I A;  3DU4 A;  2RFV A;  5IWQ A;  4O6Z A;  1I43 A;  3EI7 A;  1ASF A;  3UE8 A;  1XEY A;  5EIG A;  2DGL A;  3WX9 A;  1WYU A;  2OAT A;  3AEJ A;  3P1T A;  5DJ9 A;  3RBL A;  1J04 A;  1OXO A;  3JW9 A;  4RM1 A;  2W7I A;  3JTX A;  1V72 A;  1SZK A;  1AJS B;  3WKR A;  3MKJ A;  1N31 A;  2BYJ A;  3NTJ A;  1B9H A;  3NDN A;  1ART A;  2EGY A;  2AY3 A;  3FZ8 A;  1C7N A;  4ZAH A;  5K8B A;  2A1V A;  1BQA A;  1JG8 A;  2QA3 A;  2R2N A;  3G8M A;  4MGR A;  1AMS A;  3KGW A;  4A6T A;  1FC4 A;  4A0G A;  1GEX A;  4HF8 A;  3ZZK A;  1O69 A;  2AEU A;  4AH3 A;  1KL1 A;  4EU1 A;  1AY8 A;  4FFC A;  2C0R A;  2R0T A;  2AY4 A;  1ASA A;  2HZP A;  1ASM A;  1ELU A;  3AEL A;  1BJW A;  4JEZ A;  4N0B A;  5M46 A;  4ADB A;  2BYL A;  5FT8 A;  2VMN A;  2DKJ A;  1KKP A;  3RCH B;  3PDX A;  4IYO A;  7AAT A;  4CXQ A;  1X28 A;  1AY5 A;  1AHG A;  2D7Z A;  2AY7 A;  1B9I A;  3FTB A;  2YKV A;  1G4V A;  1VEF A;  2BWO A;  3WCN A;  3E6G A;  3NYU A;  3N0L A;  3HDO A;  1M6S A;  3TFT A;  3CQ4 A;  1DJ9 A;  2F8J A;  4EFF A;  2WB6 A;  3ISL A;  3EI6 A;  3R9A A;  3FD0 A;  1EQB A;  1IVR A;  3MAF B;  1LK9 A;  4F5H A;  3FVS A;  3LG0 A;  1JS3 A;  2VMV A;  3K28 A;  1GC2 A;  4P7Y A;  4F4E A;  4WXB A;  2XBN A;  3AOW A;  4XJP A;  4ADD A;  2D7Y A;  1TOK A;  3MC6 C;  2D66 A;  4H63 Q;  2WK9 A;  1GC4 A;  5E5I A;  1V2D A;  1W23 A;  2W7H A;  2E7U A;  3DR4 A;  5J8Q A;  1AAM A;  1OXP A;  4LNM A;  2JJH A;  2DR1 A;  5G2Q A;  1IBJ A;  1M0P A;  1S06 A;  1AHX A;  3AEP A;  1MDZ A;  1YIZ A;  3UAK A;  2AY2 A;  3N5M A;  4WB0 B;  4GE7 A;  3N7N A;  3NU7 A;  4JEV A;  2C7T A;  2QLR A;  1IAY A;  1UU2 A;  2O1B A;  2CST A;  2VLH A;  3B1E A;  3I16 A;  4W8I A;  3ZRQ A;  4F5G A;  1QZ9 A;  4ITG A;  4A0F A;  2VGU A;  1LKC A;  2V0Y A;  3VAX A;  3ASB A;  4IXZ A;  2DGM A;  3COG A;  3FRK A;  3I5T A;  4R5Z A;  1BQD A;  3FFR A;  4OYT A;  5EUN A;  4K05 A;  4B9B A;  2O0R A;  2D61 A;  1BW0 A;  1C7G A;  3L8A A;  2R5C A;  2W8W A;  2VMX A;  2FN6 A;  4EMY A;  3QGU A;  1WKG A;  3EIA A;  5M4B A;  3K40 A;  1BS0 A;  4MKK A;  2AY8 A;  3A9X A;  3QHX A;  3M5U A;  1MAP A;  1SZU A;  3AEM C;  3F9T A;  2YCT A;  3KGX A;  1RV4 A;  3MC6 A;  1S0A A;  1GDE A;  2YCN A;  2ZY5 A;  4ISY A;  5BJ3 A;  4UOY A;  2YKY A;  4XQ2 A;  1Z7D A;  1IJI A;  3FSL A;  1ZC9 A;  3NYT A;  4F5K A;  5JAY A;  4KYO A;  4RAE A;  1N2T A;  2JJG A;  2W7G A;  3QBO A;  4PFF A;  1D2F A;  1S08 A;  3HBX A;  1YJZ A;  1QIS A;  3AV7 A;  4IYO B;  4W1W A;  3QM2 A;  4HVK A;  3HMU A;  3DRD A;  5G2P A;  1QGN A;  5DX5 A;  3WGB A;  1M0Q A;  2JJE A;  3DXW A;  1BJN A;  4RLG A;  1SFF A;  1U08 A;  1CZC A;  1SPA A;  2EO5 A;  3EUC A;  2VMZ A;  4JEX A;  2W7M A;  2FYF A;  3R4T A;  3EI9 A;  4JE5 A;  2VMO A;  1CZE A;  3LY1 A;  1MDO A;  1M4N A;  4FL0 A;  4WD2 A;  2OGE A;  3ECD A;  4ADE A;  1QIR A;  3OKS A;  1YJY A;  4IX8 A;  2BWP A;  3RUY A;  2EZ2 A;  2HP1 A;  4UHN A;  4J8L A;  1MDX A;  2FKI A;  3LV2 A;  3DXV A;  3N4X A;  5G09 A;  1IX8 A;  3BWO A;  2E54 A;  3ELE A;  4KXK A;  1YOO A;  1LW5 A;  1V2F A;  2D64 A;  2OKJ A;  3NYS A;  3NNK A;  4CVQ A;  5E4Z A;  1UU0 A;  4MY5 A;  1ARG A;  3AEM A;  4L0O A;  3NU8 A;  4GDY A;  3OP7 A;  4MSO A;  4OCA A;  5D95 A;  3TQX A;  1AIB A;  1FG3 A;  2VMU A;  3NX3 A;  1FG7 A;  3PJ0 A;  2ZJG A;  3USF A;  1AIC A;  3FQ7 A;  3BV0 A;  1IAX A;  2VIA A;  3JWA A;  4R8D A;  1X29 A;  2CAN A;  2Z9X A;  3A8U X;  4B98 A;  1ASD A;  1W7N A;  2JIS A;  2KFP A;  3MAU A;  4PFN A;  4Y0H A;  1AMQ A;  3FVU A;  4E1O A;  1XI9 A;  2PB2 A;  4JF1 A;  1YIY A;  5M49 A;  4N0W A;  2W8V A;  5EUD A;  1OAT A;  3JZL A;  1D7S A;  2YOB A;  1M0O A;  2FQ6 A;  1BKG A;  2VMS A;  4CXR A;  3Q8N A;  4OBU A;  2ORD A;  1ASL A;  1S07 A;  2DOU A;  2Z61 A;  3E2F A;  2R5C B;  2GB3 A;  3PD6 A;  4M2M A;  4ZM4 A;  1ASC A;  4ATP A;  2YCP A;  4R2N A;  2G6W A;  1BJO A;  2VGT A;  3EZS A;  2VLF A;  5EFS A;  5FT5 A;  2HUF A;  2BKW A;  1VJO A;  3MBB A;  2YRR A;  2DKB A;  2VMT A;  4GSA A;  4JE5 D;  4UQV A;  4ZSW A;  4JEW A;  1LW4 A;  1S09 A;  5HXX A;  1B5O A;  2ZP7 A;  2V1P A;  3FZ7 A;  1TOG A;  3DZZ A;  2Z20 A;  2ZY2 A;  2YHK A;  1RVU A;  1N8P A;  2NMP A;  4Y0D A;  2OQX A;  3FQ8 A;  3VOM A;  4WLH A;  3DR7 A;  1BJ4 A;  1T3I A;  3JWB A;  1KMK A;  4W91 A;  1Y4I A;  3B1C A;  1TOE A;  1UU1 A;  3W1I A;  3HQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...