2ZY4A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
527
structure length
524
Chain Sequence
MSKDYQSLSPFELKDELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
molecule keywords L-aspartate beta-decarboxylase
total genus 201
structure length 524
sequence length 527
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy4A01
1ELUA 1TOJA 1I43A 3GZDC 4WXFA 4O6ZA 4R5ZA 1Z7DA 2AY4A 5M4DA 3N0LA 2QMAA 3CQ5A 2QBTA 1W7NA 3FRKA 3MC6A 1EQBA 1X0MA 2ZC0A 4ATQA 3BCXA 2ZP7A 1BJWA 1IX7A 1AJRA 5I92A 1BT4A 2HZPA 2Z9XA 4Y0DA 4ISYA 1G7XA 4RAEA 2HP2A 5EIGB 1MDZA 2BWPA 2YKUA 3AOVA 3MADA 3VAXA 1C0NA 3DYDA 2HP1A 3WLXA 4JF1A 5FT5A 4GEBA 1DJEA 3RUYA 1LK9A 4OMAA 1TATA 2W8WA 4R2NA 1YJZA 3FFHA 4K2MA 4QGRA 4MQQA 3LY1A 1AHXA 4LW2A 3LVKA 3MEBA 3AEOA 3QN6A 1W3UA 2EZ1A 2FYFA 4P7YA 2W7LA 5BJ4A 1DJ9A 3RQ1A 4WBTA 4IXZA 1SZKA 2VGWA 5E3KA 1IAXA 4EU1A 4M2MA 1WYUB 3AATA 3WX9A 4AH3A 4XAUA 4ADBA 1VEFA 1M6SA 1QIRA 3AEPA 2AY2A 3FQ8A 4WB0B 3E2ZB 2YKXA 2EZ2A 4PIWA 2R5CB 1OHYA 1KMJA 1SFFA 3BV0A 2D64A 2Z1YA 3FSLA 4ITGA 2ZYJA 1V2EA 2VMTA 2W8VA 2AY1A 3QBOA 5EAVA 1JF9A 3FDDA 3FCRA 1CQ8A 1YIYA 4KXKA 3TFUA 3FVUA 4EFFA 4ZDLA 4LNJA 3COGA 5C6UA 1UU0A 1M0NA 4J5UA 1D7RA 2W7MA 2Q7WA 2TPLA 4RKDA 4KYOA 2Z20A 4GE9A 2DKBA 2DKJA 3DZZA 3DRDA 5EAAA 3LV2A 4FL0A 2VLHA 3AEMC 2W7GA 3ELEA 1AX4A 2ZSLA 1B9HA 4JF0A 3LVLB 2QB2A 1LC5A 3DR7A 3GR9A 3ISLA 1G7WA 3NYSA 1LS3A 2YCTA 2FN6A 1O69A 4BA4A 1ASFA 1ZODA 2GMSA 1Y4IA 2CINA 4GDYA 1LW4A 2YOBA 1AIBA 4LW4A 2DOUA 3A2BA 3NYTA 2D7YA 1QJ3A 2VI8A 1WYVA 4ZM4A 4JEXA 2ZSMA 3M5UA 2C81A 1DTYA 3P1TA 3T32A 3NUIA 2BYJA 2VGZA 4PFNA 2C7TA 1ZOBA 1AHGA 1YOOA 2G6WA 2QB3A 3OP7A 3NX3A 5M4BA 3II0A 2VMNA 3UAKA 4UHOA 5K8BA 1PG8A 4MY5A 5DB5A 1I41A 2VMOA 4ZDPA 1KL1A 3NUBA 1U08A 2PB2A 4TMRA 1TPLA 1AMSA 3LWSA 3FQ7A 4A0HA 3VK2A 3EI9A 1AAMA 1E5FA 4L0OA 3LVMA 2JJEA 1GC4A 4E1OA 1GC2A 3HMUA 1YAAA 3ASBA 2CY8A 1ARGA 1RVUA 1YNUA 2BWOA 2AATA 4F5HA 3DC1A 1OHVA 1LC8A 3I5TA 5IWQA 4ZDOA 2O1BA 2BI2A 3PGYA 1AMQA 4OYTA 4W5KA 3CQ6A 3PDXA 3K28A 1AIAA 5AX8A 3ECDA 3EI6A 4E77A 2PB0A 1WYTB 1FG3A 2VYCA 3G7QA 2YKYA 3F0HA 3DU4A 1X29A 1VJOA 1EJIA 1MLYA 1AY8A 4B9BA 2W7DA 3AV7A 5G2PA 1DGDA 1CL1A 4W8IA 3VK4A 4TN4A 3PA9A 1YJYA 5EUNA 2OQXA 4BA5A 4ZSYA 1SZUA 2X8UA 4A0RA 1GC0A 1SPAA 2PO3A 3ZZKA 3QGUA 2QLRA 4B98A 3B1DA 3AENA 3B1EA 4RKCA 4F5LA 3Q8NA 2EPJA 1SZSA 3EZ1A 3NYUA 5E4ZA 1QZ9A 1D7VA 3EI8A 4R5FA 4OCAA 4IYOA 1H0CA 1W7LA 2W7FA 1IUGA 1CL2A 1FC4A 2HUFA 1BJOA 2CFBA 2Z9VA 2AY7A 3E6GA 4EB7A 4ZWVA 1BQDA 1ASDA 2AY6A 1UU2A 3MAFA 1UU1A 3ZRQA 1S08A 3FQAA 1DJUA 1LC7A 2RFVA 2YKVA 3OKSA 1SF2A 1RV3A 3DXVA 3MBBA 1GBNA 2VMVA 1IVRA 5DJ9A 4CBSA 4DQ6A 1AKBA 3BC8A 4OT8A 1AMRA 5G2QA 1BJOB 2OGAA 2W8JA 4E3RA 4ADCA 4A6TA 8AATA 1S07A 3JTXA 2X5FA 3AELA 3TCMA 3BS8A 1MDOA 5M49A 4F4EA 2DR1A 3F6TA 2ZY5A 2VMYA 4GE7A 5G09A 2E7UA 4BQ0A 3B8XA 1KL2A 2ZJGA 1WYTA 4RJYA 1QGNA 3K7YA 4UOYA 1KKPA 1XI9A 1C7GA 3RBLA 1BJ4A 4P3MA 5HDMA 1TARA 2BI5A 1G4VA 2CJHA 2E54A 5EFSA 4XJPA 4IY7A 4XJOA 2Z1ZA 1C7NA 5HHYA 4I8AA 4XK1A 2Z61A 1ASAA 1ASEA 3AOWA 2YCNA 1GD9A 4WYGA 1IAYA 3BN1A 4GRXA 4EMYA 1WKGA 3EI7A 2Z9WA 4LNMA 4A6UA 3CAIA 2VGUA 1GEWA 2JJGA 2D5YA 3E2ZA 3IHJA 3L44A 1ORDA 1RV4A 1I29A 2R5CA 3GSBA 3EZSA 4XQ2A 1WSTA 2VI9A 1V72A 2R0TA 4Q6RA 2XH1A 1X2AA 4EB5A 1AKAA 1CZCA 3RCHA 3UWCA 2BYLA 3G8MA 2F8JA 3QM2A 3LVJA 5E5IA 1QJ5A 4MSOA 1M0PA 2GB3A 3CBFA 3FVXA 1CZEA 1IX8A 3GBXA 1DFOA 4JEYA 1W23A 2E7IA 1ARTA 3A8UX 1X28A 3MAFB 4MQPA 4F5KA 4ADDA 2NMPA 3NNKA 1TOGA 1O62A 1B5PA 2GSAA 1OXOA 1LKCA 4CXRA 2GMUA 1T3IA 4XJLA 2VGVA 1E5EA 1ASLA 3HQTA 1GEXA 4AZKA 5F8VA 2EGYA 3I4JA 1CS1A 3ATHA 5G0AA 1B8GA 1ASMA 3DR4A 5F9SA 1TOKA 3ASAA 1MAQA 4WXGA 2ORDA 4IYOB 1W7MA 3A9YA 1ASCA 4MKKA 2V0YA 1O61A 3PJ0A 5G4JA 3WKSA 4HVKA 5D95A 3HDOA 1CQ6A 3TFTA 3HL2A 2FQ6A 4MKJA 3RBFA 2W7JA 4ADEA 3VK3A 3BB8A 2FNUA 4DBCA 2CJGA 4AOAA 2W8UA 3BWNC 3FTBA 3GZDA 5J8QA 1WKHA 1ARSA 1JG8A 2ZY4A 3NRAA 4IW7A 2OATA 1AAWA 4Q75A 4WLHA 1ELQA 5FT4A 2BWNA 5DX5A 1ASBA 1O4SA 3VOMA 4A00A 4JEWA 2JGTA 3GZCA 1C7OA 4H51A 4PFFA 4WB0A 4KAMA 4WYDA 2D63A 4IXOA 3TATA 1Z3ZA 3QHXA 2HUUA 2JJHA 1J32A 5EIGA 2XBNA 2D65A 2C44A 3ZRPA 3PD6B 5G4IA 4MQRA 3WGBA 4NOGA 1IJIA 3H7FA 3MC6C 1B9IA 5EQCA 1AHFA 4JEVA 1YJSA 1LW5A 3PDBB 3UE8A 4E3QA 1UKJA 5HXXA 4GSAA 2CSTA 2YRRA 1FG7A 3B1CA 3E2YA 3ZZJA 2FNIA 2HORA 2YHKA 2HUIA 1M0OA 2VIBA 3EI5A 3K40A 1M0QA 3WKRA 1MGVA 2BI1A 2JG2A 2VMRA 3PD6A 2FM1A 4F5IA 4M2KA 1D7UA 5TF5A 1BW0A 2BHXA 3LG0A 2C0RA 1DKAA 2AY5A 1BKGA 2BI3A 3E2FA 1S06A 2EO5A 2VMZA 3PPLA 1EG5A 1YIZA 4LNLA 1ASNA 3TQXA 3FFRA 3FKDA 1WYVB 2AY3A 2VGSA 9AATA 3NU7A 1AJSA 2VGTA 1S09A 4WLJA 4F5GA 3JW9A 3N75A 1B4XA 1BQAA 2VMQA 3NTJA 1M7YA 4A0FA 1IX6A 2OGEA 3D6KA 3EIBA 4LC3A 3BCBA 2X5DA 4ZAHA 4UHNA 1AKCA 1JS6A 1PFFA 2GQNA 1BS0A 1MAPA 1V2DA 2AY8A 4WYCA 3KKIA 3BCAA 3B46A 3NDNA 1MLZA 2WK9A 1OHWA 1GCKA 1ECXA 4IX8A 1GEYA 1WYUA 4WYEA 1MDXA 4IXSA 2VMXA 1D2FA 2D61A 4M2JA 4ZM3A 1AHYA 2VMPA 3NU8A 5M46A 2VMSA 1C9CA 2O7CA 3AEJA 1ARHA 1D7SA 4W1VA 4XEWA 2BIAA 2VIAA 3WZFA 5EUEA 4UQVA 1TASA 2BKWA 1S0AA 1B5OA 1TOEA 1KKJA 2O0RA 4ZLVA 3AEMA 2CH1A 5D5SA 1CJ0A 2CTZA 4ATPA 4WD2A 4N0WA 1DGEA 3AEJC 3DODA 4BMKA 2CB1A 2QA3A 2ZUKA 1AY5A 3N5MA 3USFA 4UHMA 3A9XA 3QPGA 2E7JA 1GC3A 1M4NA 2W7IA 1TOIA 1GDEA 4ZSWA 3R9AA 1V2FA 3ELPA 4FFCA 1CQ7A 2W7KA 4Q76A 1AICA 2YCPA 2YRIA 3ACZA 3PDBA 4K2IA 1AJSB 1JS3A 4Q31A 1P3WA 4AZJA 3QI6A 4A0GA 1AHEA 3BWOA 3BWNA 1ASGA 4AO4A 2W8TA 2ZY2A 3KGXA 1AY4A 3FVSA 4A6RA 1SVVA 3WGCA 3P6KA 3KE3A 1C4KA 3DXWA 1M32A 4DGTA 3PIUA 2AY9A 2V1PA 4ZWMA 4F5JA 1ZC9A 1OXPA 2Z9UA 4XJMA 2BIEA 4JEZA 4W1WA 1H1CA 2WKAA 4CBRA 7AATA 1I48A 2W7EA 1KMKA 1N2TA 1VP4A 2BIGA 3HLMA 4OC9A 4U2HA 4WXBA 5FT6A 1QITA 1BJNA 1J04A 2BI9A 4F5MA 4A72A 2VMUA 3R4TA 3RCHB 3E77A 1IBJA 3KGWA 4Y0HA 2CJDA 2W7HA 5FT8A 5JAYA 4BHDA 4WYAA 2ZY3A 3EUCA 5BJ3A 3WY7A 3ZRRA 4GE4A 4F5FA 2D66A 3MAUA 2HOXA 2WK8A 3AENB 4K2BA 2R2NA 2D7ZA 1OATA 2WK7A 3A9ZA 4CXQA 2VLFA 5DJ1A 3CQ4A 1QISA 4WYFA 3L8AA 2JJFA 3RI6A 3FDBA 3GETA 3GJUA 3JWAA 4U1TA 3PAAA 4R8DA 4CVQA 4PVFA 4ZASA 4HF8A 2HOZA 2CANA 1RVYA 1ARIA 4OTLA 3E9KA 2R5EA 1AMAA 4WP0A 3EIAA 4W91A 2HOYA 2EH6A 3JWBA 5EUDA 4AO9A 4ITXA 1N31A 3F9TA 2CH2A 3MKJA 4Y0IA 1G4XA 4W1XA 1N8PA 2VMWA
chains in the Genus database with same CATH superfamily
1P3BC 3W96D 4R5ZA 3WTPD 3N0LA 1W7NA 1X0MA 1TZYD 3BCXA 2RVQD 4KGCD 4ISYA 1G7XA 1KX5A 4UPKA 3WLXA 5FT5A 4Z5TB 5AVCB 4XZQB 4KUDB 4QGRA 4MQQA 1KU5A 1W3UA 2FYFA 4P7YA 2NZDC 5AV6C 5E5AD 4IXZA 4EU1A 1P3OB 3R45B 3TU4B 4ADBA 1M6SA 2AY2A 3HT4A 2FJ7A 4ITGA 5EAVA 3QBOA 2VMTA 1JF9A 1YIYA 5JA4A 5B2JA 3COGA 5B31B 3AYWB 2AEUA 5B24A 2TPLA 2Z20A 2F2AC 2HIOC 5GXQA 3WA9C 5EAAA 4FL0A 1AX4A 1B9HA 3UTAA 3DR7A 3GWPA 5KDMB 1ASFA 2CINA 4GDYA 1LW4A 2YOBA 1AIBA 2DOUA 1AOIA 3AZEB 2D7YA 3B0DB 3LZ0A 2A1VA 1YOOA 2NQBA 5CP6C 3B6FD 5B0ZB 5M4BA 1M18A 2VMOA 1KL1A 4XUJB 4J8WB 1AMSA 3FQ7A 3VK2A 1AAMA 4L0OA 2YFVB 1GC4A 5AV8C 4E1OA 1YAAA 3REHD 1ARGA 4F5HA 1P3OD 4YM6A 4ZDOA 3PGYA 1AMQA 3ECDA 3W98C 4YM6D 5CP6A 1VJOA 5G2PA 1DGDA 4Z66C 1P3FC 4H9QB 3B6GC 3O62A 3UTBD 2PO3A 3ZZKA 3AENA 3EZ1A 3MGSC 5B1LC 4WU8A 4ZUXC 3C1CB 4IYOA 1PZRA 1IUGA 1CL2A 1FC4A 5B0YC 1BJOA 3E6GA 4EB7A 3AZND 1UU1A 4UUZB 3FQAA 2RFVA 2RIQA 1RV3A 3DXVA 4CBSA 4DQ6A 2VMVA 3A1IA 3BC8A 4A6TA 5B0ZD 3BS8A 3AZKA 1MDOA 5GT3B 2DR1A 4BQ0A 2E7UA 1KL2A 2ZJGA 1WYTA 1B6WA 4UOYA 4J8VD 5CPKC 5EFSA 4XJPA 4IY7A 2Z1ZA 4XK1A 1ASAA 5B40A 3AOWA 3BN1A 1P3IC 5GT0C 3EI7A 2Z9WA 3CAIA 1S32D 5AV5C 5AVCA 1GEWA 2JJGA 4XQ2A 1AOIC 1ORDA 1RV4A 3B0CT 2R5CA 3EZSA 1V72A 3AZLB 4EB5A 3RCHA 3UWCA 3QM2A 1HQ3B 5E5IA 3REIC 2LY8A 3CBFA 3FVXA 3LELD 4JEYA 1KAFA 4F5KA 5AY8A 5CPKD 1BH8B 4XJLA 5AY8D 3HQTA 5F8VA 5G0AA 3A1KA 4YS3C 1MAQA 2ORDA 5F99D 4KGCA 3WKSA 3H0RC 1CQ6A 3RBFA 3NQUA 4AOAA 2W8UA 3BWNC 3REHA 1WKHA 1P3BD 3NRAA 3B0BA 5FT4A 3AZMB 2BWNA 3VOMA 4PFFA 3KXBC 3MVDD 4J8XA 4KAMA 2D63A 3HBXA 3QHXA 4J8VB 1P34B 2C44A 1XEYA 3LZ1C 4MQRA 3H7FA 3MC6C 3REKB 5CPIB 5B31A 3AYWA 4EO5C 3RELC 3UE8A 3W99A 1ID3B 3B1CA 3E2YA 3W97B 3ZZJA 2VIBA 3EI5A 1TAFB 1F66A 4XUJA 3WKJA 3UTAB 5TF5A 1BW0A 3E2FA 1S06A 2CV5B 3TQXA 3LZ0B 1R4VA 2AY3A 1M1AD 3NU7A 1AJSA 2DGLA 3LELB 5FUGB 1P3KA 3WTPC 3O62C 4LD9D 2X3LA 3D6KA 3EIBA 1JS6A 1BS0A 4J8WA 3B46A 2HIOA 2WK9A 5GXQC 3LJAD 3AZFD 1MLZA 1GCKA 4IX8A 1WWSA 3REKC 1AHYA 2VMSA 1C9CA 3MNND 3W1HA 3REJA 3C1BD 1D7SA 4X23C 3MGPB 3WZFA 5EUEA 3N4SA 4UQVA 1TASA 2BKWA 1KKJA 2O0RA 2CH1A 5D5SA 4Z5TA 1ZLAD 5CP6B 2NQBC 2CTZA 4N0WA 3DODA 3WA9D 2CB1A 3B0DC 1GC3A 3MGPD 4ZSWA 4Q76A 3X1UB 3PDBA 4Q31A 5CPJA 1P3WA 1AHEA 3BWNA 1KX3B 5F99A 2JISA 1M32A 3PIUA 1P3LC 5GSUA 5AV6D 4ZBJC 2BG1A 4XJMA 2WKAA 2W7EA 3UTBA 1JFIA 1N2TA 3HLMA 3RCHB 1IBJA 3FZ8A 2CJDA 1P3OC 5BJ3A 2D66A 3MGSA 5BO0B 1OATA 4CXQA 3B6FA 1BH8A 3CQ4A 3GETA 3GJUA 3N4RA 4PVFA 4AWLC 3E9KA 2NZDA 3C1BB 4WP0A 5G49B 3AV2A 2CWEA 4E45A 2CH2A 3AZGA 5B1LD 2VMWA 5DNNB 1ELUA 1ZLAB 1I43A 4WXFA 2QBTA 2Y2OA 2AEVA 2ZP7A 1M19A 1AJRA 3AZGC 1AOID 1BT4A 2HZPA 3HVYA 2HP2A 5JRGD 5DNND 2YKUA 4CSRB 4RITA 3AOVA 3VAXA 3X1VC 1C0NA 5BNVA 2HP1A 4JF1A 5AVBC 4GEBA 4JJNB 5AVBD 2Y2NA 5B0YA 1LK9A 2W8WA 5DNMC 1H3OA 1YJZA 3FFHA 3AEOA 2VQRA 5BJ4A 1DJ9A 4WBTA 2KFPA 5E3KA 1IAXA 3MGQA 4J8VA 3UT9D 4AH3A 4XAUA 1VEFA 3W97C 3FQ8A 1P3PC 1KX4D 2EZ2A 1KMJA 4EO5B 3RELB 1W2EA 1V2EA 4KHAB 5C6UA 1UU0A 3FZ6A 5DNNC 4RKDA 4KYOA 2YFWA 4GE9A 4H63Q 2DKJA 3WCNA 5B0ZC 5AV5A 3DZZA 3C1CA 3FD0A 2W7GA 3LJAB 3ELEA 2ZSLA 1O69A 4BA4A 5B40B 5FUGA 4JEXA 3W98D 3M5UA 2C81A 3P1TA 3NUIA 3W1JA 3AV1C 2VGZA 3KUYB 2C7TA 1ZOBA 2G6WA 2HIOB 2VMNA 3UAKA 2G5HC 1PG8A 4MY5A 3TU4A 1I41A 4ZDPA 1U08A 2PB2A 1Q9CA 4A0HA 5B2ID 3VH6A 2JJEA 1GC2A 4JJND 3ASBA 2CY8A 5CHLB 1EQZB 1YNUA 4CAYA 2BYKB 3VH5W 1OHVA 3I5TA 4ZUXA 5IWQA 4OYTA 3CQ6A 5AX8A 3EI6A 3AZLA 5B2IB 2PB0A 3F0HA 3LELC 3EPJA 3REIA 3TU4D 3VK4A 4TN4A 3REJD 3LZ0C 5AY8B 2F8ND 4ZSYA 3AV1B 4XZQC 4KUDC 3AZEA 4A0RA 1KX4A 3KWQC 1P3GA 3AN2B 3W96C 5B33A 3X1VB 4QLCB 3AZHA 4RKCA 3Q8NA 2EPJA 1SZSA 1QZ9A 3MNNC 4OCAA 3AV2C 2Y2JA 2W7FA 2HUFA 2CFBA 3MGPC 4X23B 5GT3D 2Y2HA 3LJAC 4H9SA 1BQDA 1ASDA 1P3MD 1DJUA 3W97A 2YKVA 1GBNA 5DJ9A 4OT8A 1AMRA 4E3RA 3KXBA 5DNNA 4HGAB 3MGSB 4F4EA 5G09A 3F6TA 2ZY5A 2CV5A 2VMYA 4GE7A 1P3PB 4RJYA 4AWLB 1QGNA 4Z66A 1KKPA 3UT9A 5HDMA 5AY8C 2E54A 4XJOA 5HHYA 1ASEA 2YCNA 1GD9A 2CV5C 4DRBA 1IAYA 4H9RB 4GRXA 4EMYA 1WKGA 4A6UA 3W97D 3WA9A 3L44A 3PJ0A 3E2ZA 1EQZD 4J8UB 1I29A 1WSTA 2VI9A 3LZ1D 2XH1A 5AVCD 1AKAA 5AVBB 2F8JA 2CV5D 4MSOA 1M0PA 1CZEA 3GBXA 1DFOA 3N4XA 2E7IA 4MQPA 2BYMA 4UUZA 1M1AB 1LKCA 4AZKA 2EGYA 1CS1A 3G0TA 1ASMA 5GT3A 2PYOD 1W7MA 2V0YA 1Z2CB 5G4JA 2FKIA 4HVKA 5D95A 2HUEB 3HL2A 5AV9A 2YFWB 2FNUA 5CPJB 2CJGA 4DBCA 5J8QA 2AROB 1ARSA 2J8PA 2OATA 3AZIA 1U35A 3REKD 3N7NA 3GZCA 2XD1A 4WYDA 5B40D 4YS3B 5G4IA 3W99D 1JFIB 3WGBA 5B1MD 1B9IA 3X1UA 5AV8A 3PDBB 3KUYD 4GSAA 2Y2GA 1M1AC 2HORA 2YHKA 2HUIA 3K40A 5B1LA 5DNMD 2BI1A 3PD6A 4J8UC 2FM1A 4F5IA 5KTBA 4M2KA 3X1SC 3X1TD 3LG0A 2C0RA 1BKGA 3PPLA 3AZLC 1EG5A 3AZFB 4CAYB 2VGSA 5GT0B 4J8LA 1S09A 4WLJA 2Y2LA 3JW9A 1B4XA 1BQAA 4H9OB 5B1MA 2OGEA 1TZYC 5CPJC 4LC3A 4WU8D 2HUEC 1MAPA 4WYCA 3V9RA 3KKIA 3BCAA 1OHWA 5CPKA 4WYEA 1MDXA 4IXSA 2VMXA 2D61A 2F8NG 1EQZA 2O7CA 3AEJA 2F8NB 1ARHA 4XEWA 5CPIA 2DGKA 4XUJC 3AZMD 2F8NK 5BNVB 4ZLVA 5B2IA 3AEMA 4H9NB 4ATPA 4WD2A 3WKJB 1DGEA 3AEJC 2QA3A 2ZUKA 1AY5A 5GXQB 3USFA 4UHMA 4J8WD 3QPGA 3AZIC 1U35C 1V2FA 3ELPA 3X1TC 3WTPB 2YCPA 2YRIA 3KWQB 3W98A 4K2IA 1AJSB 1JS3A 3QI6A 4A0GA 5B32B 1P3MA 4Z66B 4CSRA 1AY4A 4A6RA 1SVVA 3WGCA 1P3FA 4JJNC 3KE3A 4Z5TD 3X1SB 3LZ0D 2AY9A 4ZWMA 4F5JA 2BIEA 3REJB 3KSYA 1I48A 2BIGA 4A72A 3AZJA 3KGWA 3X1VD 5JAYA 3EUCA 3ZRRA 2DGMA 4J8WC 3MAUA 2WK8A 1PMOA 2R2NA 3IP4C 2WK7A 3MNNB 3A9ZA 5DJ1A 3B6GA 1P3KC 4QLCC 4WYFA 2JJFA 3JWAA 3PAAA 4R8DA 3W96B 4ZASA 4HF8A 1P3BA 1ARIA 4W91A 4AO9A 4ITXA 1N31A 3F9TA 3WKJD 5AVBA 5B0YD 3KFUG 4Y0IA 1KX3A 4E44A 1TOJA 3GZDC 5M4DA 2QMAA 3FRKA 3MC6A 1EQBA 2AROD 1P3AA 2ZC0A 5B31C 3AYWC 3AZED 4ATQA 1BJWA 4XZQA 4KUDA 1EQZC 1P3FD 1MDZA 4WU9A 4WZSB 3REIB 3MADA 3X1TA 1DJEA 3RUYA 1F1EA 4OMAA 4R2NA 3AZNA 3LY1A 4LW2A 1KX4B 3LVKA 2EZ1A 2W7LA 5AV6B 5AVCC 3RQ1A 3WAAD 3UTAC 1WYUB 3AATA 3WX9A 3AEPA 3AZGB 4PIWA 2R5CB 1OHYA 1P3ID 1SFFA 3AV1D 3W1IA 3BV0A 2D64A 5GT3C 2Z1YA 3AZKD 5AV8B 2AY1A 3FCRA 3TFUA 3FVUA 3AV1A 4LNJA 2FJ7D 1M0NA 4J5UA 1D7RA 5BT1C 2DKBA 3MVDA 3DRDA 3H0MC 3WAAA 2Y2KA 2PYOA 3LVLB 3ISLA 1G7WA 3NYSA 2YCTA 1BH9A 2FN6A 1ZODA 5GT0A 2GMSA 4LW4A 2EYQA 1TZYB 2VI8A 1QJ3A 3C1BC 2ZSMA 3T32A 4PFNA 1AHGA 1M18D 5KDMA 1P3PD 1KX4C 3V9RB 3OP7A 3NX3A 4UHOA 5K8BA 3MGRB 1P3PA 5BS7A 4XZQD 4KUDD 3LZ1A 5B2IC 3EI9A 3W98B 3HMUA 4WU9C 5BNXB 4KHAA 2BWOA 1LC8A 2O1BA 2BI2A 4W5KA 3K28A 1AIAA 5AV5B 1S32A 4E77A 5C3IB 3LJAA 3G7QA 2YKYA 3DU4A 1P3IB 1X29A 2OKKA 4R8PC 3AZMA 1EJIA 3A6ND 4B9BA 4W8IA 1CL1A 1HQ3D 3PA9A 4WU9D 1YJYA 2RVQC 2BYMB 1M19C 2X8UA 3I16A 3QGUA 3B1DA 4F5LA 3NYUA 5E4ZA 4R5FA 3B6FC 1W7LA 2Z9VA 4ZWVA 3AN2D 3MAFA 4Z2MG 1S08A 3OKSA 2IO5B 1SF2A 1IVRA 4OBUA 1BJOB 2OGAA 1S07A 3JTXA 3VH6W 3AELA 3H9XA 3VP6A 3AZHD 3K7YA 1XI9A 4J8XD 1BJ4A 2CJHA 1G4VA 1C7NA 2Z61A 3X1TB 3IHJA 3EG5B 2L5AA 5DNMB 5CPKB 2R0TA 4Q6RA 1X2AA 1CZCA 4H9SC 2NQBB 2GB3A 1KX5D 5B24B 1ARTA 3A8UX 3NNKA 1TOGA 4J8UD 1B5PA 2G7JA 2GSAA 4J8XC 4CXRA 2VGVA 1E5EA 1ASLA 1GEXA 1HQ3A 3DR4A 3ASAA 1ZLAC 2NQBD 1P3GD 5E5AA 3TFTA 2W7JA 4ADEA 3AL0C 3BB8A 4R8PA 3AZMC 1ULYA 3GZDA 3AN2C 4RJ0A 1JG8A 2ZY4A 4IW7A 4Q75A 4KGCB 1ELQA 2Y2PA 2PYOB 1O4SA 1P3FB 4JEWA 1T3UA 1C7OA 5GXQD 3AZFC 1BFMA 1B67A 4ZUXD 5G49A 3AFAC 2HUUA 2JJHA 1J32A 5EIGA 1KX5C 2D65A 3X1UD 4WU8C 3B6GD 4NOGA 3WTPA 4JEVA 1P3KD 3A6NA 5B32D 1LW5A 3KWQA 1P3GC 4E3QA 1UKJA 5HXXA 3NQJA 2YRRA 5CPIC 3B6FB 1M0OA 5GT0D 1M0QA 2VMRA 3WAAB 3LZ1B 1MGVA 2JG2A 1P3LB 1D7UA 2AY5A 2BI3A 2NZDB 2EO5A 2VMZA 1KX3C 1PMMA 4LNLA 1ASNA 3FFRA 1TAFA 1F66B 1F66C 9AATA 3KUYC 1H3OB 2AROC 4Z5TC 4F5GA 3X1UC 3NTJA 2VMQA 1IX6A 3B0CW 3BCBA 5AV5D 4UHNA 2DF4C 5B40C 1PFFA 1V2DA 2JE5A 3KXBD 3MVDC 1ECXA 1GEYA 2G5IC 2VMPA 3AV2D 1P3AB 5M46A 4W1VA 3W96A 3AZID 1U35D 1P3BB 5B0YB 3AFAB 3P5JB 3VH5T 2Y2MA 4H9PA 4K05A 3WTPE 3N5MA 3MGQB 1M4NA 2W7IA 1TOIA 3R9AA 1AICA 3AZJD 3ACZA 2XD5A 3REID 3MGSD 1ASGA 4AO4A 2W8TA 2ZY2A 3KGXA 3FVSA 3P6KA 3UT9C 1C4KA 3DXWA 4DGTA 2V1PA 1ZC9A 1WWIA 1OXPA 2Z9UA 4W1WA 1H1CA 4CBRA 7AATA 5AV6A 1VP4A 1QITA 2BI9A 4YM6C 4LD9B 2VMUA 5FT8A 4BHDA 4WYAA 2ZY3A 4H9NA 3WY7A 3KUYA 4K2BA 3AV2B 5JRGC 1P3AD 2D7ZA 3WCOA 3C1CC 2VLFA 4G92C 4Z2MH 3RI6A 4CVQA 3FDBA 4U1TA 2CANA 4WV4B 4OTLA 4WNNA 3EIAA 2HOYA 5EUDA 3EPKA 1P34A 3MKJA 4W1XA 1N8PA 3AZHB 5B31G 3AZKC 1ID3A 4O6ZA 1Z7DA 2AY4A 5BNXA 5B2JB 5AV9D 3CQ5A 3O62D 1IX7A 5I92A 2Z9XA 4Y0DA 3MGRD 4RAEA 5EIGB 4ZBJB 1P3IA 2BWPA 3MGRA 3DYDA 2FJ7C 3X1SD 1M19B 1TATA 4QLCA 4K2MA 1P3KB 5B32G 1AOIB 1AHXA 3MEBA 4G92B 1ID3D 3QN6A 5B24D 5JRGB 4OBVA 1SZKA 2VGWA 4JJNA 4M2MA 2JCHA 1QIRA 4WB0B 3E2ZB 2YKXA 1M18C 2F8NH 3FSLA 2ZYJA 2W8VA 3A6NB 3FDDA 4KXKA 1CQ8A 4EFFA 4ZDLA 4DRAA 2W7MA 2Q7WA 3UT9B 3EPLA 3AZGD 5GSUB 2Y2IA 3LV2A 2VLHA 3AEMC 4KGCC 4JF0A 2QB2A 1LC5A 3GR9A 1LS3A 4RIZA 3AZNC 3AFAA 1Y4IA 4YS3D 3A2BA 3NYTA 3AZNB 3O62B 2UWXA 4ZM4A 1WYVA 3VH6T 5GSUD 1DTYA 2BYJA 5B2JD 5AV9B 3JZLA 4RLGA 4M6BA 2QB3A 2Y2QA 3II0A 5DB5A 1P3LD 3NUBA 1M19D 4TMRA 1TPLA 3LWSA 5E5AC 1E5FA 3LVMA 3A6NC 1RVUA 1ID3C 2AATA 3DC1A 3AZLD 5DNMA 3PDXA 5E5AB 3VH5A 1WYTB 1FG3A 2VYCA 5B33B 4NE5A 1MLYA 1AY8A 5AV8D 2W7DA 3AV7A 3C1BA 5EUNA 3MGQC 5JA4B 2OQXA 4BA5A 1SZUA 1TZYA 3W99C 2QSRA 1GC0A 1SPAA 4B98A 2QLRA 3B1EA 1ZLAA 1D7VA 3EI8A 1HTAA 1H0CA 1P3GB 2AY7A 4G91C 4WNNB 2AY6A 1UU2A 3H0LC 3NQJB 3EPHA 3ZRQA 1LC7A 4QLCD 4G91B 3MBBA 1AKBA 2F8NA 5G2QA 2W8JA 4ADCA 8AATA 3RELA 2HIOD 3AZFA 2X5FA 3TCMA 4NFTA 5M49A 4Z66D 1HQ3C 3B8XA 1M18B 4XUJD 1S32B 3FZ7A 1KX3D 1C7GA 3RBLA 4J8UA 4P3MA 1TARA 2BI5A 3REHB 4I8AA 5CPID 4WYGA 4LNMA 3REHC 2VGUA 2D5YA 3GSBA 2DQNC 3WAAC 1F66D 5B1MC 2BYLA 3G8MA 3LVJA 1QJ5A 4R8PD 1IX8A 5B33D 1W23A 1X28A 4WJ3C 3MAFB 1A7WA 4ADDA 2NMPA 2YFVA 3AZJC 1O62A 1OXOA 2GMUA 1T3IA 3I4JA 3ATHA 2JSSA 1B8GA 2WB6A 5F9SA 1TOKA 4WU8B 5B32C 4WXGA 4IYOB 1KX5B 3A9YA 1ASCA 4MKKA 1N1JA 1O61A 5F99C 2BYKA 2W8SA 4ZUXB 1P3MB 3HDOA 2OKJA 2FQ6A 4MKJA 3AFAD 3VK3A 1P3MC 4X23D 3FTBA 3LELA 5CP6D 3B6GB 4H9QA 4WLHA 1AAWA 3X1SA 3WKJC 5DX5A 1ASBA 4A00A 2JGTA 4H51A 4HGAC 4WB0A 4H9PB 1P3OA 4IXOA 3TATA 1Z3ZA 3R45A 5B33C 5CPJD 2XBNA 3AZJB 3ZRPA 3PD6B 3X1VA 3KWQD 3MGQD 1IJIA 5EQCA 1AHFA 4LD9A 1YJSA 3MGPA 2CSTA 1FG7A 2FFFB 2FNIA 4X23A 3WKRA 4YS3A 5BS7C 1P34D 1P34C 2BHXA 1DKAA 4J8VC 4H9OA 5B1MB 1YIZA 3FKDA 3KXBB 1WYVB 3AN2A 4R8PB 2VGTA 2FJ7B 3UTAD 3N75A 4A0FA 1S32C 1M7YA 5B31D 3AZEC 3AYWD 2X5DA 4ZAHA 1AKCA 2GQNA 2AY8A 5F99B 3NDNA 5B0ZA 1WYUA 4H9RA 4M2JA 1D2FA 4ZM3A 4WU9B 3NU8A 3WA9B 5GSUC 3UTBB 2BIAA 2VIAA 2IO5C 3UTBC 1S0AA 1B5OA 1TOEA 3C1CD 1P3AC 1CJ0A 4NE3A 5BO0A 4DQYB 1P3LA 4BMKA 3MVDB 4RM1A 5B32A 3A9XA 2E7JA 3TU4C 5JRGA 1GDEA 4FFCA 1CQ7A 2W7KA 3REKA 3W99B 3NQUB 4AZJA 5C3IC 3BWOA 4YM6B 4LD9C 4J8XB 1M1AA 3REJC 5B24C 4JEZA 2NZDD 1KMKA 4WXBA 4U2HA 4OC9A 2ZM5A 5FT6A 1BJNA 1J04A 4F5MA 1BH9B 3R4TA 3E77A 4Y0HA 2W7HA 5B2JC 4GE4A 4F5FA 3AZKB 2HOXA 3AZHC 3AENB 3MGRC 2AROA 5B1LB 3RELD 1QISA 3AZIB 1U35B 3L8AA 2PYOC 4NE6A 5AV9C 2HOZA 1RVYA 5BT1D 2R5EA 1AMAA 3JWBA 1N1JB 2EH6A 3MNNA 1G4XA
chains in the Genus database with same CATH topology
1P3BC 3W96D 4R5ZA 3WTPD 3N0LA 1W7NA 1X0MA 1TZYD 3BCXA 2RVQD 4KGCD 4ISYA 1G7XA 1KX5A 4UPKA 3WLXA 5FT5A 4Z5TB 5AVCB 4XZQB 4KUDB 4QGRA 4MQQA 1KU5A 1W3UA 2FYFA 4P7YA 2NZDC 5AV6C 5E5AD 4IXZA 4EU1A 1P3OB 3R45B 3TU4B 4ADBA 1M6SA 2AY2A 3HT4A 2FJ7A 4ITGA 5EAVA 3QBOA 2VMTA 1JF9A 1YIYA 5JA4A 5B2JA 3COGA 5B31B 3AYWB 2AEUA 5B24A 2TPLA 2Z20A 2F2AC 2HIOC 5GXQA 3WA9C 5EAAA 4FL0A 1AX4A 1B9HA 3UTAA 3DR7A 3GWPA 5KDMB 1ASFA 2CINA 4GDYA 1LW4A 2YOBA 1AIBA 2DOUA 1AOIA 3AZEB 2D7YA 3B0DB 3LZ0A 2A1VA 1YOOA 2NQBA 5CP6C 3B6FD 5B0ZB 5M4BA 1M18A 2VMOA 1KL1A 4XUJB 4J8WB 1AMSA 3FQ7A 3VK2A 1AAMA 4L0OA 2YFVB 1GC4A 5AV8C 4E1OA 1YAAA 3REHD 1ARGA 4F5HA 1P3OD 4YM6A 4ZDOA 3PGYA 1AMQA 3ECDA 3W98C 4YM6D 5CP6A 1VJOA 5G2PA 1DGDA 4Z66C 1P3FC 4H9QB 3B6GC 3O62A 3UTBD 2PO3A 3ZZKA 3AENA 3EZ1A 3MGSC 5B1LC 4WU8A 4ZUXC 3C1CB 4IYOA 1PZRA 1IUGA 1CL2A 1FC4A 5B0YC 1BJOA 3E6GA 4EB7A 3AZND 1UU1A 4UUZB 3FQAA 2RFVA 2RIQA 1RV3A 3DXVA 4CBSA 4DQ6A 2VMVA 3A1IA 3BC8A 4A6TA 5B0ZD 3BS8A 3AZKA 1MDOA 5GT3B 2DR1A 4BQ0A 2E7UA 1KL2A 2ZJGA 1WYTA 1B6WA 4UOYA 4J8VD 5CPKC 5EFSA 4XJPA 4IY7A 2Z1ZA 4XK1A 1ASAA 5B40A 3AOWA 3BN1A 1P3IC 5GT0C 3EI7A 2Z9WA 3CAIA 1S32D 5AV5C 5AVCA 1GEWA 2JJGA 4XQ2A 1AOIC 1ORDA 1RV4A 3B0CT 2R5CA 3EZSA 1V72A 3AZLB 4EB5A 3RCHA 3UWCA 3QM2A 1HQ3B 5E5IA 3REIC 2LY8A 3CBFA 3FVXA 3LELD 4JEYA 4F5KA 5AY8A 5CPKD 1BH8B 4XJLA 5AY8D 3HQTA 5F8VA 5G0AA 3A1KA 4YS3C 1MAQA 2ORDA 5F99D 4KGCA 3WKSA 3H0RC 1CQ6A 3RBFA 3NQUA 4AOAA 2W8UA 3BWNC 3REHA 1WKHA 1P3BD 3NRAA 3B0BA 5FT4A 3AZMB 2BWNA 3VOMA 4PFFA 3KXBC 3MVDD 4J8XA 4KAMA 2D63A 3HBXA 3QHXA 4J8VB 1P34B 2C44A 1XEYA 3LZ1C 4MQRA 3H7FA 3MC6C 3REKB 5CPIB 5B31A 3AYWA 4EO5C 3RELC 3UE8A 3W99A 1ID3B 3B1CA 3E2YA 3W97B 3ZZJA 2VIBA 3EI5A 1TAFB 1F66A 4XUJA 3WKJA 3UTAB 5TF5A 1BW0A 3E2FA 1S06A 2CV5B 3TQXA 3LZ0B 1R4VA 2AY3A 1M1AD 3NU7A 1AJSA 2DGLA 3LELB 5FUGB 1P3KA 3WTPC 3O62C 4LD9D 2X3LA 3D6KA 3EIBA 1JS6A 1BS0A 4J8WA 3B46A 2HIOA 2WK9A 5GXQC 3LJAD 3AZFD 1MLZA 1GCKA 4IX8A 1WWSA 3REKC 1AHYA 2VMSA 1C9CA 3MNND 3W1HA 3REJA 3C1BD 1D7SA 4X23C 3MGPB 3WZFA 5EUEA 3N4SA 4UQVA 1TASA 2BKWA 1KKJA 2O0RA 2CH1A 5D5SA 4Z5TA 1ZLAD 5CP6B 2NQBC 2CTZA 4N0WA 3DODA 3WA9D 2CB1A 3B0DC 1GC3A 3MGPD 4ZSWA 4Q76A 3X1UB 3PDBA 4Q31A 5CPJA 1P3WA 1AHEA 3BWNA 1KX3B 5F99A 2JISA 1M32A 3PIUA 1P3LC 5GSUA 5AV6D 4ZBJC 2BG1A 4XJMA 2WKAA 2W7EA 3UTBA 1JFIA 1N2TA 3HLMA 3RCHB 1IBJA 3FZ8A 2CJDA 1P3OC 5BJ3A 2D66A 3MGSA 5BO0B 1OATA 4CXQA 3B6FA 1BH8A 3CQ4A 3GETA 3GJUA 3N4RA 4PVFA 4AWLC 3E9KA 2NZDA 3C1BB 4WP0A 5G49B 3AV2A 2CWEA 4E45A 2CH2A 3AZGA 5B1LD 2VMWA 5DNNB 1ELUA 1ZLAB 1I43A 4WXFA 2QBTA 2Y2OA 2AEVA 2ZP7A 1M19A 1AJRA 3AZGC 1AOID 1BT4A 2HZPA 3HVYA 2HP2A 5JRGD 5DNND 2YKUA 4CSRB 4RITA 3AOVA 3VAXA 3X1VC 1C0NA 5BNVA 2HP1A 4JF1A 5AVBC 4GEBA 4JJNB 5AVBD 2Y2NA 5B0YA 1LK9A 2W8WA 5DNMC 1H3OA 1YJZA 3FFHA 3AEOA 2VQRA 5BJ4A 1DJ9A 4WBTA 2KFPA 5E3KA 1IAXA 3MGQA 4J8VA 3UT9D 4AH3A 4XAUA 1VEFA 3W97C 3FQ8A 1P3PC 1KX4D 2EZ2A 1KMJA 4EO5B 3RELB 1W2EA 1V2EA 4KHAB 5C6UA 1UU0A 3FZ6A 5DNNC 4RKDA 4KYOA 2YFWA 4GE9A 4H63Q 2DKJA 3WCNA 5B0ZC 5AV5A 3DZZA 3C1CA 3FD0A 2W7GA 3LJAB 3ELEA 2ZSLA 1O69A 4BA4A 5B40B 5FUGA 4JEXA 3W98D 3M5UA 2C81A 3P1TA 3NUIA 3W1JA 3AV1C 2VGZA 3KUYB 2C7TA 1ZOBA 2G6WA 2HIOB 2VMNA 3UAKA 2G5HC 1PG8A 4MY5A 3TU4A 1I41A 4ZDPA 1U08A 2PB2A 1Q9CA 4A0HA 5B2ID 3VH6A 2JJEA 1GC2A 4JJND 3ASBA 2CY8A 5CHLB 1EQZB 1YNUA 4CAYA 2BYKB 3VH5W 1OHVA 3I5TA 4ZUXA 5IWQA 4OYTA 3CQ6A 5AX8A 3EI6A 3AZLA 5B2IB 2PB0A 3F0HA 3LELC 3EPJA 3REIA 3TU4D 3VK4A 4TN4A 3REJD 3LZ0C 5AY8B 2F8ND 4ZSYA 3AV1B 4XZQC 4KUDC 3AZEA 4A0RA 1KX4A 3KWQC 1P3GA 3AN2B 3W96C 5B33A 3X1VB 4QLCB 3AZHA 4RKCA 3Q8NA 2EPJA 1SZSA 1QZ9A 3MNNC 4OCAA 3AV2C 2Y2JA 2W7FA 2HUFA 2CFBA 3MGPC 4X23B 5GT3D 2Y2HA 3LJAC 4H9SA 1BQDA 1ASDA 1P3MD 1DJUA 3W97A 2YKVA 1GBNA 5DJ9A 4OT8A 1AMRA 4E3RA 3KXBA 5DNNA 4HGAB 3MGSB 4F4EA 5G09A 3F6TA 2ZY5A 2CV5A 2VMYA 4GE7A 1P3PB 4RJYA 4AWLB 1QGNA 4Z66A 1KKPA 3UT9A 5HDMA 5AY8C 2E54A 4XJOA 5HHYA 1ASEA 2YCNA 1GD9A 2CV5C 4DRBA 1IAYA 4H9RB 4GRXA 4EMYA 1WKGA 4A6UA 3W97D 3WA9A 3L44A 3PJ0A 3E2ZA 1EQZD 4J8UB 1I29A 1WSTA 2VI9A 3LZ1D 2XH1A 5AVCD 1AKAA 5AVBB 2F8JA 2CV5D 4MSOA 1M0PA 1CZEA 3GBXA 1DFOA 3N4XA 2E7IA 4MQPA 2BYMA 4UUZA 1M1AB 1LKCA 4AZKA 2EGYA 1CS1A 3G0TA 1ASMA 5GT3A 2PYOD 1W7MA 2V0YA 1Z2CB 5G4JA 2FKIA 4HVKA 5D95A 2HUEB 3HL2A 5AV9A 2YFWB 2FNUA 5CPJB 2CJGA 4DBCA 5J8QA 2AROB 1ARSA 2J8PA 2OATA 3AZIA 1U35A 3REKD 3N7NA 3GZCA 2XD1A 4WYDA 5B40D 4YS3B 5G4IA 3W99D 1JFIB 3WGBA 5B1MD 1B9IA 3X1UA 5AV8A 3PDBB 3KUYD 4GSAA 2Y2GA 1M1AC 2HORA 2YHKA 2HUIA 3K40A 5B1LA 5DNMD 2BI1A 3PD6A 4J8UC 2FM1A 4F5IA 5KTBA 4M2KA 3X1SC 3X1TD 3LG0A 2C0RA 1BKGA 3PPLA 3AZLC 1EG5A 3AZFB 4CAYB 2VGSA 5GT0B 4J8LA 1S09A 4WLJA 2Y2LA 3JW9A 1B4XA 1BQAA 4H9OB 5B1MA 2OGEA 1TZYC 5CPJC 4LC3A 4WU8D 2HUEC 1MAPA 4WYCA 3V9RA 3KKIA 3BCAA 1OHWA 5CPKA 4WYEA 1MDXA 4IXSA 2VMXA 2D61A 2F8NG 1EQZA 2O7CA 3AEJA 2F8NB 1ARHA 4XEWA 5CPIA 2DGKA 4XUJC 3AZMD 2F8NK 5BNVB 4ZLVA 5B2IA 3AEMA 4H9NB 4ATPA 4WD2A 3WKJB 1DGEA 3AEJC 2QA3A 2ZUKA 1AY5A 5GXQB 3USFA 4UHMA 4J8WD 3QPGA 3AZIC 1U35C 1V2FA 3ELPA 3X1TC 3WTPB 2YCPA 2YRIA 3KWQB 3W98A 4K2IA 1AJSB 1JS3A 3QI6A 4A0GA 5B32B 1P3MA 4Z66B 4CSRA 1AY4A 4A6RA 1SVVA 3WGCA 1P3FA 4JJNC 3KE3A 4Z5TD 3X1SB 3LZ0D 2AY9A 4ZWMA 4F5JA 2BIEA 3REJB 3KSYA 1I48A 2BIGA 4A72A 3AZJA 3KGWA 3X1VD 5JAYA 3EUCA 3ZRRA 2DGMA 4J8WC 3MAUA 2WK8A 1PMOA 2R2NA 3IP4C 2WK7A 3MNNB 3A9ZA 5DJ1A 3B6GA 1P3KC 4QLCC 4WYFA 2JJFA 3JWAA 3PAAA 4R8DA 3W96B 4ZASA 4HF8A 1P3BA 1ARIA 4W91A 4AO9A 4ITXA 1N31A 3F9TA 3WKJD 5AVBA 5B0YD 3KFUG 4Y0IA 1KX3A 4E44A 1TOJA 3GZDC 5M4DA 2QMAA 3FRKA 3MC6A 1EQBA 2AROD 1P3AA 2ZC0A 5B31C 3AYWC 3AZED 4ATQA 1BJWA 4XZQA 4KUDA 1EQZC 1P3FD 1MDZA 4WU9A 4WZSB 3REIB 3MADA 3X1TA 1DJEA 3RUYA 1F1EA 4OMAA 4R2NA 3AZNA 3LY1A 4LW2A 1KX4B 3LVKA 2EZ1A 2W7LA 5AV6B 5AVCC 3RQ1A 3WAAD 3UTAC 1WYUB 3AATA 3WX9A 3AEPA 3AZGB 4PIWA 2R5CB 1OHYA 1P3ID 1SFFA 3AV1D 3W1IA 3BV0A 2D64A 5GT3C 2Z1YA 3AZKD 5AV8B 2AY1A 3FCRA 3TFUA 3FVUA 3AV1A 4LNJA 2FJ7D 1M0NA 4J5UA 1D7RA 5BT1C 2DKBA 3MVDA 3DRDA 3H0MC 3WAAA 2Y2KA 2PYOA 3LVLB 3ISLA 1G7WA 3NYSA 2YCTA 1BH9A 2FN6A 1ZODA 5GT0A 2GMSA 4LW4A 2EYQA 1TZYB 2VI8A 1QJ3A 3C1BC 2ZSMA 3T32A 4PFNA 1AHGA 1M18D 5KDMA 1P3PD 1KX4C 3V9RB 3OP7A 3NX3A 4UHOA 5K8BA 3MGRB 1P3PA 5BS7A 4XZQD 4KUDD 3LZ1A 5B2IC 3EI9A 3W98B 3HMUA 4WU9C 5BNXB 4KHAA 2BWOA 1LC8A 2O1BA 2BI2A 4W5KA 3K28A 1AIAA 5AV5B 1S32A 4E77A 5C3IB 3LJAA 3G7QA 2YKYA 3DU4A 1P3IB 1X29A 2OKKA 4R8PC 3AZMA 1EJIA 3A6ND 4B9BA 4W8IA 1CL1A 1HQ3D 3PA9A 4WU9D 1YJYA 2RVQC 2BYMB 1M19C 2X8UA 3I16A 3QGUA 3B1DA 4F5LA 3NYUA 5E4ZA 4R5FA 3B6FC 1W7LA 2Z9VA 4ZWVA 3AN2D 3MAFA 4Z2MG 1S08A 3OKSA 2IO5B 1SF2A 1IVRA 4OBUA 1BJOB 2OGAA 1S07A 3JTXA 3VH6W 3AELA 3H9XA 3VP6A 3AZHD 3K7YA 1XI9A 4J8XD 1BJ4A 2CJHA 1G4VA 1C7NA 2Z61A 3X1TB 3IHJA 3EG5B 2L5AA 5DNMB 5CPKB 2R0TA 4Q6RA 1X2AA 1CZCA 4H9SC 2NQBB 2GB3A 1KX5D 5B24B 1ARTA 3A8UX 3NNKA 1TOGA 4J8UD 1B5PA 2G7JA 2GSAA 4J8XC 4CXRA 2VGVA 1E5EA 1ASLA 1GEXA 1HQ3A 3DR4A 3ASAA 1ZLAC 2NQBD 1P3GD 5E5AA 3TFTA 2W7JA 4ADEA 3AL0C 3BB8A 4R8PA 3AZMC 1ULYA 3GZDA 3AN2C 4RJ0A 1JG8A 2ZY4A 4IW7A 4Q75A 4KGCB 1ELQA 2Y2PA 2PYOB 1O4SA 1P3FB 4JEWA 1T3UA 1C7OA 5GXQD 3AZFC 1BFMA 1B67A 4ZUXD 5G49A 3AFAC 2HUUA 2JJHA 1J32A 5EIGA 1KX5C 2D65A 3X1UD 4WU8C 3B6GD 4NOGA 3WTPA 4JEVA 1P3KD 3A6NA 5B32D 1LW5A 3KWQA 1P3GC 4E3QA 1UKJA 5HXXA 3NQJA 2YRRA 5CPIC 3B6FB 1M0OA 5GT0D 1M0QA 2VMRA 3WAAB 3LZ1B 1MGVA 2JG2A 1P3LB 1D7UA 2AY5A 2BI3A 2NZDB 2EO5A 2VMZA 1KX3C 1PMMA 4LNLA 1ASNA 3FFRA 1TAFA 1F66B 1F66C 9AATA 3KUYC 1H3OB 2AROC 4Z5TC 4F5GA 3X1UC 3NTJA 2VMQA 1IX6A 3B0CW 3BCBA 5AV5D 4UHNA 2DF4C 5B40C 1PFFA 1V2DA 2JE5A 3KXBD 3MVDC 1ECXA 1GEYA 2G5IC 2VMPA 3AV2D 1P3AB 5M46A 4W1VA 3W96A 3AZID 1U35D 1P3BB 5B0YB 3AFAB 3P5JB 3VH5T 2Y2MA 4H9PA 4K05A 3WTPE 3N5MA 3MGQB 1M4NA 2W7IA 1TOIA 3R9AA 1AICA 3AZJD 3ACZA 2XD5A 3REID 3MGSD 1ASGA 4AO4A 2W8TA 2ZY2A 3KGXA 3FVSA 3P6KA 3UT9C 1C4KA 3DXWA 4DGTA 2V1PA 1ZC9A 1WWIA 1OXPA 2Z9UA 4W1WA 1H1CA 4CBRA 7AATA 5AV6A 1VP4A 1QITA 2BI9A 4YM6C 4LD9B 2VMUA 5FT8A 4BHDA 4WYAA 2ZY3A 4H9NA 3WY7A 3KUYA 4K2BA 3AV2B 5JRGC 1P3AD 2D7ZA 3WCOA 3C1CC 2VLFA 4G92C 4Z2MH 3RI6A 4CVQA 3FDBA 4U1TA 2CANA 4WV4B 4OTLA 4WNNA 3EIAA 2HOYA 5EUDA 3EPKA 1P34A 3MKJA 4W1XA 1N8PA 3AZHB 5B31G 3AZKC 1ID3A 4O6ZA 1Z7DA 2AY4A 5BNXA 5B2JB 5AV9D 3CQ5A 3O62D 1IX7A 5I92A 2Z9XA 4Y0DA 3MGRD 4RAEA 5EIGB 4ZBJB 1P3IA 2BWPA 3MGRA 3DYDA 2FJ7C 3X1SD 1M19B 1TATA 4QLCA 4K2MA 1P3KB 5B32G 1AOIB 1AHXA 3MEBA 4G92B 1ID3D 3QN6A 5B24D 5JRGB 4OBVA 1SZKA 2VGWA 4JJNA 4M2MA 2JCHA 1QIRA 4WB0B 3E2ZB 2YKXA 1M18C 2F8NH 3FSLA 2ZYJA 2W8VA 3A6NB 3FDDA 4KXKA 1CQ8A 4EFFA 4ZDLA 4DRAA 2W7MA 2Q7WA 3UT9B 3EPLA 3AZGD 5GSUB 2Y2IA 3LV2A 2VLHA 3AEMC 4KGCC 4JF0A 2QB2A 1LC5A 3GR9A 1LS3A 4RIZA 3AZNC 3AFAA 1Y4IA 4YS3D 3A2BA 3NYTA 3AZNB 3O62B 2UWXA 4ZM4A 1WYVA 3VH6T 5GSUD 1DTYA 2BYJA 5B2JD 5AV9B 3JZLA 4RLGA 4M6BA 2QB3A 2Y2QA 3II0A 5DB5A 1P3LD 3NUBA 1M19D 4TMRA 1TPLA 3LWSA 5E5AC 1E5FA 3LVMA 3A6NC 1RVUA 1ID3C 2AATA 3DC1A 3AZLD 5DNMA 3PDXA 5E5AB 3VH5A 1WYTB 1FG3A 2VYCA 5B33B 4NE5A 1MLYA 1AY8A 5AV8D 2W7DA 3AV7A 3C1BA 5EUNA 3MGQC 5JA4B 2OQXA 4BA5A 1SZUA 1TZYA 3W99C 2QSRA 1GC0A 1SPAA 4B98A 2QLRA 3B1EA 1ZLAA 1D7VA 3EI8A 1HTAA 1H0CA 1P3GB 2AY7A 4G91C 4WNNB 2AY6A 1UU2A 3H0LC 3NQJB 3EPHA 3ZRQA 1LC7A 4QLCD 4G91B 3MBBA 1AKBA 2F8NA 5G2QA 2W8JA 4ADCA 8AATA 3RELA 2HIOD 3AZFA 2X5FA 3TCMA 4NFTA 5M49A 4Z66D 1HQ3C 3B8XA 1M18B 4XUJD 1S32B 3FZ7A 1KX3D 1C7GA 3RBLA 4J8UA 4P3MA 1TARA 2BI5A 3REHB 4I8AA 5CPID 4WYGA 4LNMA 3REHC 2VGUA 2D5YA 3GSBA 2DQNC 3WAAC 1F66D 5B1MC 2BYLA 3G8MA 3LVJA 1QJ5A 4R8PD 1IX8A 5B33D 1W23A 1X28A 4WJ3C 3MAFB 1A7WA 4ADDA 2NMPA 2YFVA 3AZJC 1O62A 1OXOA 2GMUA 1T3IA 3I4JA 3ATHA 2JSSA 1B8GA 2WB6A 5F9SA 1TOKA 4WU8B 5B32C 4WXGA 4IYOB 1KX5B 3A9YA 1ASCA 4MKKA 1N1JA 1O61A 5F99C 2BYKA 2W8SA 4ZUXB 1P3MB 3HDOA 2OKJA 2FQ6A 4MKJA 3AFAD 3VK3A 1P3MC 4X23D 3FTBA 3LELA 5CP6D 3B6GB 4H9QA 4WLHA 1AAWA 3X1SA 3WKJC 5DX5A 1ASBA 4A00A 2JGTA 4H51A 4HGAC 4WB0A 4H9PB 1P3OA 4IXOA 3TATA 1Z3ZA 3R45A 5B33C 5CPJD 2XBNA 3AZJB 3ZRPA 3PD6B 3X1VA 3KWQD 3MGQD 1IJIA 5EQCA 1AHFA 4LD9A 1YJSA 3MGPA 2CSTA 1FG7A 2FFFB 2FNIA 4X23A 3WKRA 4YS3A 5BS7C 1P34D 1P34C 2BHXA 1DKAA 4J8VC 4H9OA 5B1MB 1YIZA 3FKDA 3KXBB 1WYVB 3AN2A 4R8PB 2VGTA 2FJ7B 3UTAD 3N75A 4A0FA 1S32C 1M7YA 5B31D 3AZEC 3AYWD 2X5DA 4ZAHA 1AKCA 2GQNA 2AY8A 5F99B 3NDNA 5B0ZA 1WYUA 4H9RA 4M2JA 1D2FA 4ZM3A 4WU9B 3NU8A 3WA9B 5GSUC 3UTBB 2BIAA 2VIAA 2IO5C 3UTBC 1S0AA 1B5OA 1TOEA 3C1CD 1P3AC 1CJ0A 4NE3A 5BO0A 4DQYB 1P3LA 4BMKA 3MVDB 4RM1A 5B32A 3A9XA 2E7JA 3TU4C 5JRGA 1GDEA 4FFCA 1CQ7A 2W7KA 3REKA 3W99B 3NQUB 4AZJA 5C3IC 3BWOA 4YM6B 4LD9C 4J8XB 1M1AA 3REJC 5B24C 4JEZA 2NZDD 1KMKA 4WXBA 4U2HA 4OC9A 2ZM5A 5FT6A 1BJNA 1J04A 4F5MA 1BH9B 3R4TA 3E77A 4Y0HA 2W7HA 5B2JC 4GE4A 4F5FA 3AZKB 2HOXA 3AZHC 3AENB 3MGRC 2AROA 5B1LB 3RELD 1QISA 3AZIB 1U35B 3L8AA 2PYOC 4NE6A 5AV9C 2HOZA 1RVYA 5BT1D 2R5EA 1AMAA 3JWBA 1N1JB 2EH6A 3MNNA 1G4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELU A;  1TOJ A;  1I43 A;  3GZD C;  4WXF A;  4O6Z A;  4R5Z A;  1Z7D A;  2AY4 A;  5M4D A;  3N0L A;  2QMA A;  3CQ5 A;  2QBT A;  1W7N A;  3FRK A;  3MC6 A;  1EQB A;  1X0M A;  2ZC0 A;  4ATQ A;  3BCX A;  2ZP7 A;  1BJW A;  1IX7 A;  1AJR A;  5I92 A;  1BT4 A;  2HZP A;  2Z9X A;  4Y0D A;  4ISY A;  1G7X A;  4RAE A;  2HP2 A;  5EIG B;  1MDZ A;  2BWP A;  2YKU A;  3AOV A;  3MAD A;  3VAX A;  1C0N A;  3DYD A;  2HP1 A;  3WLX A;  4JF1 A;  5FT5 A;  4GEB A;  1DJE A;  3RUY A;  1LK9 A;  4OMA A;  1TAT A;  2W8W A;  4R2N A;  1YJZ A;  3FFH A;  4K2M A;  4QGR A;  4MQQ A;  3LY1 A;  1AHX A;  4LW2 A;  3LVK A;  3MEB A;  3AEO A;  3QN6 A;  1W3U A;  2EZ1 A;  2FYF A;  4P7Y A;  2W7L A;  5BJ4 A;  1DJ9 A;  3RQ1 A;  4WBT A;  4IXZ A;  1SZK A;  2VGW A;  5E3K A;  1IAX A;  4EU1 A;  4M2M A;  1WYU B;  3AAT A;  3WX9 A;  4AH3 A;  4XAU A;  4ADB A;  1VEF A;  1M6S A;  1QIR A;  3AEP A;  2AY2 A;  3FQ8 A;  4WB0 B;  3E2Z B;  2YKX A;  2EZ2 A;  4PIW A;  2R5C B;  1OHY A;  1KMJ A;  1SFF A;  3BV0 A;  2D64 A;  2Z1Y A;  3FSL A;  4ITG A;  2ZYJ A;  1V2E A;  2VMT A;  2W8V A;  2AY1 A;  3QBO A;  5EAV A;  1JF9 A;  3FDD A;  3FCR A;  1CQ8 A;  1YIY A;  4KXK A;  3TFU A;  3FVU A;  4EFF A;  4ZDL A;  4LNJ A;  3COG A;  5C6U A;  1UU0 A;  1M0N A;  4J5U A;  1D7R A;  2W7M A;  2Q7W A;  2TPL A;  4RKD A;  4KYO A;  2Z20 A;  4GE9 A;  2DKB A;  2DKJ A;  3DZZ A;  3DRD A;  5EAA A;  3LV2 A;  4FL0 A;  2VLH A;  3AEM C;  2W7G A;  3ELE A;  1AX4 A;  2ZSL A;  1B9H A;  4JF0 A;  3LVL B;  2QB2 A;  1LC5 A;  3DR7 A;  3GR9 A;  3ISL A;  1G7W A;  3NYS A;  1LS3 A;  2YCT A;  2FN6 A;  1O69 A;  4BA4 A;  1ASF A;  1ZOD A;  2GMS A;  1Y4I A;  2CIN A;  4GDY A;  1LW4 A;  2YOB A;  1AIB A;  4LW4 A;  2DOU A;  3A2B A;  3NYT A;  2D7Y A;  1QJ3 A;  2VI8 A;  1WYV A;  4ZM4 A;  4JEX A;  2ZSM A;  3M5U A;  2C81 A;  1DTY A;  3P1T A;  3T32 A;  3NUI A;  2BYJ A;  2VGZ A;  4PFN A;  2C7T A;  1ZOB A;  1AHG A;  1YOO A;  2G6W A;  2QB3 A;  3OP7 A;  3NX3 A;  5M4B A;  3II0 A;  2VMN A;  3UAK A;  4UHO A;  5K8B A;  1PG8 A;  4MY5 A;  5DB5 A;  1I41 A;  2VMO A;  4ZDP A;  1KL1 A;  3NUB A;  1U08 A;  2PB2 A;  4TMR A;  1TPL A;  1AMS A;  3LWS A;  3FQ7 A;  4A0H A;  3VK2 A;  3EI9 A;  1AAM A;  1E5F A;  4L0O A;  3LVM A;  2JJE A;  1GC4 A;  4E1O A;  1GC2 A;  3HMU A;  1YAA A;  3ASB A;  2CY8 A;  1ARG A;  1RVU A;  1YNU A;  2BWO A;  2AAT A;  4F5H A;  3DC1 A;  1OHV A;  1LC8 A;  3I5T A;  5IWQ A;  4ZDO A;  2O1B A;  2BI2 A;  3PGY A;  1AMQ A;  4OYT A;  4W5K A;  3CQ6 A;  3PDX A;  3K28 A;  1AIA A;  5AX8 A;  3ECD A;  3EI6 A;  4E77 A;  2PB0 A;  1WYT B;  1FG3 A;  2VYC A;  3G7Q A;  2YKY A;  3F0H A;  3DU4 A;  1X29 A;  1VJO A;  1EJI A;  1MLY A;  1AY8 A;  4B9B A;  2W7D A;  3AV7 A;  5G2P A;  1DGD A;  1CL1 A;  4W8I A;  3VK4 A;  4TN4 A;  3PA9 A;  1YJY A;  5EUN A;  2OQX A;  4BA5 A;  4ZSY A;  1SZU A;  2X8U A;  4A0R A;  1GC0 A;  1SPA A;  2PO3 A;  3ZZK A;  3QGU A;  2QLR A;  4B98 A;  3B1D A;  3AEN A;  3B1E A;  4RKC A;  4F5L A;  3Q8N A;  2EPJ A;  1SZS A;  3EZ1 A;  3NYU A;  5E4Z A;  1QZ9 A;  1D7V A;  3EI8 A;  4R5F A;  4OCA A;  4IYO A;  1H0C A;  1W7L A;  2W7F A;  1IUG A;  1CL2 A;  1FC4 A;  2HUF A;  1BJO A;  2CFB A;  2Z9V A;  2AY7 A;  3E6G A;  4EB7 A;  4ZWV A;  1BQD A;  1ASD A;  2AY6 A;  1UU2 A;  3MAF A;  1UU1 A;  3ZRQ A;  1S08 A;  3FQA A;  1DJU A;  1LC7 A;  2RFV A;  2YKV A;  3OKS A;  1SF2 A;  1RV3 A;  3DXV A;  3MBB A;  1GBN A;  2VMV A;  1IVR A;  5DJ9 A;  4CBS A;  4DQ6 A;  1AKB A;  3BC8 A;  4OT8 A;  1AMR A;  5G2Q A;  1BJO B;  2OGA A;  2W8J A;  4E3R A;  4ADC A;  4A6T A;  8AAT A;  1S07 A;  3JTX A;  2X5F A;  3AEL A;  3TCM A;  3BS8 A;  1MDO A;  5M49 A;  4F4E A;  2DR1 A;  3F6T A;  2ZY5 A;  2VMY A;  4GE7 A;  5G09 A;  2E7U A;  4BQ0 A;  3B8X A;  1KL2 A;  2ZJG A;  1WYT A;  4RJY A;  1QGN A;  3K7Y A;  4UOY A;  1KKP A;  1XI9 A;  1C7G A;  3RBL A;  1BJ4 A;  4P3M A;  5HDM A;  1TAR A;  2BI5 A;  1G4V A;  2CJH A;  2E54 A;  5EFS A;  4XJP A;  4IY7 A;  4XJO A;  2Z1Z A;  1C7N A;  5HHY A;  4I8A A;  4XK1 A;  2Z61 A;  1ASA A;  1ASE A;  3AOW A;  2YCN A;  1GD9 A;  4WYG A;  1IAY A;  3BN1 A;  4GRX A;  4EMY A;  1WKG A;  3EI7 A;  2Z9W A;  4LNM A;  4A6U A;  3CAI A;  2VGU A;  1GEW A;  2JJG A;  2D5Y A;  3E2Z A;  3IHJ A;  3L44 A;  1ORD A;  1RV4 A;  1I29 A;  2R5C A;  3GSB A;  3EZS A;  4XQ2 A;  1WST A;  2VI9 A;  1V72 A;  2R0T A;  4Q6R A;  2XH1 A;  1X2A A;  4EB5 A;  1AKA A;  1CZC A;  3RCH A;  3UWC A;  2BYL A;  3G8M A;  2F8J A;  3QM2 A;  3LVJ A;  5E5I A;  1QJ5 A;  4MSO A;  1M0P A;  2GB3 A;  3CBF A;  3FVX A;  1CZE A;  1IX8 A;  3GBX A;  1DFO A;  4JEY A;  1W23 A;  2E7I A;  1ART A;  3A8U X;  1X28 A;  3MAF B;  4MQP A;  4F5K A;  4ADD A;  2NMP A;  3NNK A;  1TOG A;  1O62 A;  1B5P A;  2GSA A;  1OXO A;  1LKC A;  4CXR A;  2GMU A;  1T3I A;  4XJL A;  2VGV A;  1E5E A;  1ASL A;  3HQT A;  1GEX A;  4AZK A;  5F8V A;  2EGY A;  3I4J A;  1CS1 A;  3ATH A;  5G0A A;  1B8G A;  1ASM A;  3DR4 A;  5F9S A;  1TOK A;  3ASA A;  1MAQ A;  4WXG A;  2ORD A;  4IYO B;  1W7M A;  3A9Y A;  1ASC A;  4MKK A;  2V0Y A;  1O61 A;  3PJ0 A;  5G4J A;  3WKS A;  4HVK A;  5D95 A;  3HDO A;  1CQ6 A;  3TFT A;  3HL2 A;  2FQ6 A;  4MKJ A;  3RBF A;  2W7J A;  4ADE A;  3VK3 A;  3BB8 A;  2FNU A;  4DBC A;  2CJG A;  4AOA A;  2W8U A;  3BWN C;  3FTB A;  3GZD A;  5J8Q A;  1WKH A;  1ARS A;  1JG8 A;  2ZY4 A;  3NRA A;  4IW7 A;  2OAT A;  1AAW A;  4Q75 A;  4WLH A;  1ELQ A;  5FT4 A;  2BWN A;  5DX5 A;  1ASB A;  1O4S A;  3VOM A;  4A00 A;  4JEW A;  2JGT A;  3GZC A;  1C7O A;  4H51 A;  4PFF A;  4WB0 A;  4KAM A;  4WYD A;  2D63 A;  4IXO A;  3TAT A;  1Z3Z A;  3QHX A;  2HUU A;  2JJH A;  1J32 A;  5EIG A;  2XBN A;  2D65 A;  2C44 A;  3ZRP A;  3PD6 B;  5G4I A;  4MQR A;  3WGB A;  4NOG A;  1IJI A;  3H7F A;  3MC6 C;  1B9I A;  5EQC A;  1AHF A;  4JEV A;  1YJS A;  1LW5 A;  3PDB B;  3UE8 A;  4E3Q A;  1UKJ A;  5HXX A;  4GSA A;  2CST A;  2YRR A;  1FG7 A;  3B1C A;  3E2Y A;  3ZZJ A;  2FNI A;  2HOR A;  2YHK A;  2HUI A;  1M0O A;  2VIB A;  3EI5 A;  3K40 A;  1M0Q A;  3WKR A;  1MGV A;  2BI1 A;  2JG2 A;  2VMR A;  3PD6 A;  2FM1 A;  4F5I A;  4M2K A;  1D7U A;  5TF5 A;  1BW0 A;  2BHX A;  3LG0 A;  2C0R A;  1DKA A;  2AY5 A;  1BKG A;  2BI3 A;  3E2F A;  1S06 A;  2EO5 A;  2VMZ A;  3PPL A;  1EG5 A;  1YIZ A;  4LNL A;  1ASN A;  3TQX A;  3FFR A;  3FKD A;  1WYV B;  2AY3 A;  2VGS A;  9AAT A;  3NU7 A;  1AJS A;  2VGT A;  1S09 A;  4WLJ A;  4F5G A;  3JW9 A;  3N75 A;  1B4X A;  1BQA A;  2VMQ A;  3NTJ A;  1M7Y A;  4A0F A;  1IX6 A;  2OGE A;  3D6K A;  3EIB A;  4LC3 A;  3BCB A;  2X5D A;  4ZAH A;  4UHN A;  1AKC A;  1JS6 A;  1PFF A;  2GQN A;  1BS0 A;  1MAP A;  1V2D A;  2AY8 A;  4WYC A;  3KKI A;  3BCA A;  3B46 A;  3NDN A;  1MLZ A;  2WK9 A;  1OHW A;  1GCK A;  1ECX A;  4IX8 A;  1GEY A;  1WYU A;  4WYE A;  1MDX A;  4IXS A;  2VMX A;  1D2F A;  2D61 A;  4M2J A;  4ZM3 A;  1AHY A;  2VMP A;  3NU8 A;  5M46 A;  2VMS A;  1C9C A;  2O7C A;  3AEJ A;  1ARH A;  1D7S A;  4W1V A;  4XEW A;  2BIA A;  2VIA A;  3WZF A;  5EUE A;  4UQV A;  1TAS A;  2BKW A;  1S0A A;  1B5O A;  1TOE A;  1KKJ A;  2O0R A;  4ZLV A;  3AEM A;  2CH1 A;  5D5S A;  1CJ0 A;  2CTZ A;  4ATP A;  4WD2 A;  4N0W A;  1DGE A;  3AEJ C;  3DOD A;  4BMK A;  2CB1 A;  2QA3 A;  2ZUK A;  1AY5 A;  3N5M A;  3USF A;  4UHM A;  3A9X A;  3QPG A;  2E7J A;  1GC3 A;  1M4N A;  2W7I A;  1TOI A;  1GDE A;  4ZSW A;  3R9A A;  1V2F A;  3ELP A;  4FFC A;  1CQ7 A;  2W7K A;  4Q76 A;  1AIC A;  2YCP A;  2YRI A;  3ACZ A;  3PDB A;  4K2I A;  1AJS B;  1JS3 A;  4Q31 A;  1P3W A;  4AZJ A;  3QI6 A;  4A0G A;  1AHE A;  3BWO A;  3BWN A;  1ASG A;  4AO4 A;  2W8T A;  2ZY2 A;  3KGX A;  1AY4 A;  3FVS A;  4A6R A;  1SVV A;  3WGC A;  3P6K A;  3KE3 A;  1C4K A;  3DXW A;  1M32 A;  4DGT A;  3PIU A;  2AY9 A;  2V1P A;  4ZWM A;  4F5J A;  1ZC9 A;  1OXP A;  2Z9U A;  4XJM A;  2BIE A;  4JEZ A;  4W1W A;  1H1C A;  2WKA A;  4CBR A;  7AAT A;  1I48 A;  2W7E A;  1KMK A;  1N2T A;  1VP4 A;  2BIG A;  3HLM A;  4OC9 A;  4U2H A;  4WXB A;  5FT6 A;  1QIT A;  1BJN A;  1J04 A;  2BI9 A;  4F5M A;  4A72 A;  2VMU A;  3R4T A;  3RCH B;  3E77 A;  1IBJ A;  3KGW A;  4Y0H A;  2CJD A;  2W7H A;  5FT8 A;  5JAY A;  4BHD A;  4WYA A;  2ZY3 A;  3EUC A;  5BJ3 A;  3WY7 A;  3ZRR A;  4GE4 A;  4F5F A;  2D66 A;  3MAU A;  2HOX A;  2WK8 A;  3AEN B;  4K2B A;  2R2N A;  2D7Z A;  1OAT A;  2WK7 A;  3A9Z A;  4CXQ A;  2VLF A;  5DJ1 A;  3CQ4 A;  1QIS A;  4WYF A;  3L8A A;  2JJF A;  3RI6 A;  3FDB A;  3GET A;  3GJU A;  3JWA A;  4U1T A;  3PAA A;  4R8D A;  4CVQ A;  4PVF A;  4ZAS A;  4HF8 A;  2HOZ A;  2CAN A;  1RVY A;  1ARI A;  4OTL A;  3E9K A;  2R5E A;  1AMA A;  4WP0 A;  3EIA A;  4W91 A;  2HOY A;  2EH6 A;  3JWB A;  5EUD A;  4AO9 A;  4ITX A;  1N31 A;  3F9T A;  2CH2 A;  3MKJ A;  4Y0I A;  1G4X A;  4W1X A;  1N8P A;  2VMW A; 
#chains in the Genus database with same CATH topology
 1P3B C;  3W96 D;  4R5Z A;  3WTP D;  3N0L A;  1W7N A;  1X0M A;  1TZY D;  3BCX A;  2RVQ D;  4KGC D;  4ISY A;  1G7X A;  1KX5 A;  4UPK A;  3WLX A;  5FT5 A;  4Z5T B;  5AVC B;  4XZQ B;  4KUD B;  4QGR A;  4MQQ A;  1KU5 A;  1W3U A;  2FYF A;  4P7Y A;  2NZD C;  5AV6 C;  5E5A D;  4IXZ A;  4EU1 A;  1P3O B;  3R45 B;  3TU4 B;  4ADB A;  1M6S A;  2AY2 A;  3HT4 A;  2FJ7 A;  4ITG A;  5EAV A;  3QBO A;  2VMT A;  1JF9 A;  1YIY A;  5JA4 A;  5B2J A;  3COG A;  5B31 B;  3AYW B;  2AEU A;  5B24 A;  2TPL A;  2Z20 A;  2F2A C;  2HIO C;  5GXQ A;  3WA9 C;  5EAA A;  4FL0 A;  1AX4 A;  1B9H A;  3UTA A;  3DR7 A;  3GWP A;  5KDM B;  1ASF A;  2CIN A;  4GDY A;  1LW4 A;  2YOB A;  1AIB A;  2DOU A;  1AOI A;  3AZE B;  2D7Y A;  3B0D B;  3LZ0 A;  2A1V A;  1YOO A;  2NQB A;  5CP6 C;  3B6F D;  5B0Z B;  5M4B A;  1M18 A;  2VMO A;  1KL1 A;  4XUJ B;  4J8W B;  1AMS A;  3FQ7 A;  3VK2 A;  1AAM A;  4L0O A;  2YFV B;  1GC4 A;  5AV8 C;  4E1O A;  1YAA A;  3REH D;  1ARG A;  4F5H A;  1P3O D;  4YM6 A;  4ZDO A;  3PGY A;  1AMQ A;  3ECD A;  3W98 C;  4YM6 D;  5CP6 A;  1VJO A;  5G2P A;  1DGD A;  4Z66 C;  1P3F C;  4H9Q B;  3B6G C;  3O62 A;  3UTB D;  2PO3 A;  3ZZK A;  3AEN A;  3EZ1 A;  3MGS C;  5B1L C;  4WU8 A;  4ZUX C;  3C1C B;  4IYO A;  1PZR A;  1IUG A;  1CL2 A;  1FC4 A;  5B0Y C;  1BJO A;  3E6G A;  4EB7 A;  3AZN D;  1UU1 A;  4UUZ B;  3FQA A;  2RFV A;  2RIQ A;  1RV3 A;  3DXV A;  4CBS A;  4DQ6 A;  2VMV A;  3A1I A;  3BC8 A;  4A6T A;  5B0Z D;  3BS8 A;  3AZK A;  1MDO A;  5GT3 B;  2DR1 A;  4BQ0 A;  2E7U A;  1KL2 A;  2ZJG A;  1WYT A;  1B6W A;  4UOY A;  4J8V D;  5CPK C;  5EFS A;  4XJP A;  4IY7 A;  2Z1Z A;  4XK1 A;  1ASA A;  5B40 A;  3AOW A;  3BN1 A;  1P3I C;  5GT0 C;  3EI7 A;  2Z9W A;  3CAI A;  1S32 D;  5AV5 C;  5AVC A;  1GEW A;  2JJG A;  4XQ2 A;  1AOI C;  1ORD A;  1RV4 A;  3B0C T;  2R5C A;  3EZS A;  1V72 A;  3AZL B;  4EB5 A;  3RCH A;  3UWC A;  3QM2 A;  1HQ3 B;  5E5I A;  3REI C;  2LY8 A;  3CBF A;  3FVX A;  3LEL D;  4JEY A;  1KAF A;  4F5K A;  5AY8 A;  5CPK D;  1BH8 B;  4XJL A;  5AY8 D;  3HQT A;  5F8V A;  5G0A A;  3A1K A;  4YS3 C;  1MAQ A;  2ORD A;  5F99 D;  4KGC A;  3WKS A;  3H0R C;  1CQ6 A;  3RBF A;  3NQU A;  4AOA A;  2W8U A;  3BWN C;  3REH A;  1WKH A;  1P3B D;  3NRA A;  3B0B A;  5FT4 A;  3AZM B;  2BWN A;  3VOM A;  4PFF A;  3KXB C;  3MVD D;  4J8X A;  4KAM A;  2D63 A;  3HBX A;  3QHX A;  4J8V B;  1P34 B;  2C44 A;  1XEY A;  3LZ1 C;  4MQR A;  3H7F A;  3MC6 C;  3REK B;  5CPI B;  5B31 A;  3AYW A;  4EO5 C;  3REL C;  3UE8 A;  3W99 A;  1ID3 B;  3B1C A;  3E2Y A;  3W97 B;  3ZZJ A;  2VIB A;  3EI5 A;  1TAF B;  1F66 A;  4XUJ A;  3WKJ A;  3UTA B;  5TF5 A;  1BW0 A;  3E2F A;  1S06 A;  2CV5 B;  3TQX A;  3LZ0 B;  1R4V A;  2AY3 A;  1M1A D;  3NU7 A;  1AJS A;  2DGL A;  3LEL B;  5FUG B;  1P3K A;  3WTP C;  3O62 C;  4LD9 D;  2X3L A;  3D6K A;  3EIB A;  1JS6 A;  1BS0 A;  4J8W A;  3B46 A;  2HIO A;  2WK9 A;  5GXQ C;  3LJA D;  3AZF D;  1MLZ A;  1GCK A;  4IX8 A;  1WWS A;  3REK C;  1AHY A;  2VMS A;  1C9C A;  3MNN D;  3W1H A;  3REJ A;  3C1B D;  1D7S A;  4X23 C;  3MGP B;  3WZF A;  5EUE A;  3N4S A;  4UQV A;  1TAS A;  2BKW A;  1KKJ A;  2O0R A;  2CH1 A;  5D5S A;  4Z5T A;  1ZLA D;  5CP6 B;  2NQB C;  2CTZ A;  4N0W A;  3DOD A;  3WA9 D;  2CB1 A;  3B0D C;  1GC3 A;  3MGP D;  4ZSW A;  4Q76 A;  3X1U B;  3PDB A;  4Q31 A;  5CPJ A;  1P3W A;  1AHE A;  3BWN A;  1KX3 B;  5F99 A;  2JIS A;  1M32 A;  3PIU A;  1P3L C;  5GSU A;  5AV6 D;  4ZBJ C;  2BG1 A;  4XJM A;  2WKA A;  2W7E A;  3UTB A;  1JFI A;  1N2T A;  3HLM A;  3RCH B;  1IBJ A;  3FZ8 A;  2CJD A;  1P3O C;  5BJ3 A;  2D66 A;  3MGS A;  5BO0 B;  1OAT A;  4CXQ A;  3B6F A;  1BH8 A;  3CQ4 A;  3GET A;  3GJU A;  3N4R A;  4PVF A;  4AWL C;  3E9K A;  2NZD A;  3C1B B;  4WP0 A;  5G49 B;  3AV2 A;  2CWE A;  4E45 A;  2CH2 A;  3AZG A;  5B1L D;  2VMW A;  5DNN B;  1ELU A;  1ZLA B;  1I43 A;  4WXF A;  2QBT A;  2Y2O A;  2AEV A;  2ZP7 A;  1M19 A;  1AJR A;  3AZG C;  1AOI D;  1BT4 A;  2HZP A;  3HVY A;  2HP2 A;  5JRG D;  5DNN D;  2YKU A;  4CSR B;  4RIT A;  3AOV A;  3VAX A;  3X1V C;  1C0N A;  5BNV A;  2HP1 A;  4JF1 A;  5AVB C;  4GEB A;  4JJN B;  5AVB D;  2Y2N A;  5B0Y A;  1LK9 A;  2W8W A;  5DNM C;  1H3O A;  1YJZ A;  3FFH A;  3AEO A;  2VQR A;  5BJ4 A;  1DJ9 A;  4WBT A;  2KFP A;  5E3K A;  1IAX A;  3MGQ A;  4J8V A;  3UT9 D;  4AH3 A;  4XAU A;  1VEF A;  3W97 C;  3FQ8 A;  1P3P C;  1KX4 D;  2EZ2 A;  1KMJ A;  4EO5 B;  3REL B;  1W2E A;  1V2E A;  4KHA B;  5C6U A;  1UU0 A;  3FZ6 A;  5DNN C;  4RKD A;  4KYO A;  2YFW A;  4GE9 A;  4H63 Q;  2DKJ A;  3WCN A;  5B0Z C;  5AV5 A;  3DZZ A;  3C1C A;  3FD0 A;  2W7G A;  3LJA B;  3ELE A;  2ZSL A;  1O69 A;  4BA4 A;  5B40 B;  5FUG A;  4JEX A;  3W98 D;  3M5U A;  2C81 A;  3P1T A;  3NUI A;  3W1J A;  3AV1 C;  2VGZ A;  3KUY B;  2C7T A;  1ZOB A;  2G6W A;  2HIO B;  2VMN A;  3UAK A;  2G5H C;  1PG8 A;  4MY5 A;  3TU4 A;  1I41 A;  4ZDP A;  1U08 A;  2PB2 A;  1Q9C A;  4A0H A;  5B2I D;  3VH6 A;  2JJE A;  1GC2 A;  4JJN D;  3ASB A;  2CY8 A;  5CHL B;  1EQZ B;  1YNU A;  4CAY A;  2BYK B;  3VH5 W;  1OHV A;  3I5T A;  4ZUX A;  5IWQ A;  4OYT A;  3CQ6 A;  5AX8 A;  3EI6 A;  3AZL A;  5B2I B;  2PB0 A;  3F0H A;  3LEL C;  3EPJ A;  3REI A;  3TU4 D;  3VK4 A;  4TN4 A;  3REJ D;  3LZ0 C;  5AY8 B;  2F8N D;  4ZSY A;  3AV1 B;  4XZQ C;  4KUD C;  3AZE A;  4A0R A;  1KX4 A;  3KWQ C;  1P3G A;  3AN2 B;  3W96 C;  5B33 A;  3X1V B;  4QLC B;  3AZH A;  4RKC A;  3Q8N A;  2EPJ A;  1SZS A;  1QZ9 A;  3MNN C;  4OCA A;  3AV2 C;  2Y2J A;  2W7F A;  2HUF A;  2CFB A;  3MGP C;  4X23 B;  5GT3 D;  2Y2H A;  3LJA C;  4H9S A;  1BQD A;  1ASD A;  1P3M D;  1DJU A;  3W97 A;  2YKV A;  1GBN A;  5DJ9 A;  4OT8 A;  1AMR A;  4E3R A;  3KXB A;  5DNN A;  4HGA B;  3MGS B;  4F4E A;  5G09 A;  3F6T A;  2ZY5 A;  2CV5 A;  2VMY A;  4GE7 A;  1P3P B;  4RJY A;  4AWL B;  1QGN A;  4Z66 A;  1KKP A;  3UT9 A;  5HDM A;  5AY8 C;  2E54 A;  4XJO A;  5HHY A;  1ASE A;  2YCN A;  1GD9 A;  2CV5 C;  4DRB A;  1IAY A;  4H9R B;  4GRX A;  4EMY A;  1WKG A;  4A6U A;  3W97 D;  3WA9 A;  3L44 A;  3PJ0 A;  3E2Z A;  1EQZ D;  4J8U B;  1I29 A;  1WST A;  2VI9 A;  3LZ1 D;  2XH1 A;  5AVC D;  1AKA A;  5AVB B;  2F8J A;  2CV5 D;  4MSO A;  1M0P A;  1CZE A;  3GBX A;  1DFO A;  3N4X A;  2E7I A;  4MQP A;  2BYM A;  4UUZ A;  1M1A B;  1LKC A;  4AZK A;  2EGY A;  1CS1 A;  3G0T A;  1ASM A;  5GT3 A;  2PYO D;  1W7M A;  2V0Y A;  1Z2C B;  5G4J A;  2FKI A;  4HVK A;  5D95 A;  2HUE B;  3HL2 A;  5AV9 A;  2YFW B;  2FNU A;  5CPJ B;  2CJG A;  4DBC A;  5J8Q A;  2ARO B;  1ARS A;  2J8P A;  2OAT A;  3AZI A;  1U35 A;  3REK D;  3N7N A;  3GZC A;  2XD1 A;  4WYD A;  5B40 D;  4YS3 B;  5G4I A;  3W99 D;  1JFI B;  3WGB A;  5B1M D;  1B9I A;  3X1U A;  5AV8 A;  3PDB B;  3KUY D;  4GSA A;  2Y2G A;  1M1A C;  2HOR A;  2YHK A;  2HUI A;  3K40 A;  5B1L A;  5DNM D;  2BI1 A;  3PD6 A;  4J8U C;  2FM1 A;  4F5I A;  5KTB A;  4M2K A;  3X1S C;  3X1T D;  3LG0 A;  2C0R A;  1BKG A;  3PPL A;  3AZL C;  1EG5 A;  3AZF B;  4CAY B;  2VGS A;  5GT0 B;  4J8L A;  1S09 A;  4WLJ A;  2Y2L A;  3JW9 A;  1B4X A;  1BQA A;  4H9O B;  5B1M A;  2OGE A;  1TZY C;  5CPJ C;  4LC3 A;  4WU8 D;  2HUE C;  1MAP A;  4WYC A;  3V9R A;  3KKI A;  3BCA A;  1OHW A;  5CPK A;  4WYE A;  1MDX A;  4IXS A;  2VMX A;  2D61 A;  2F8N G;  1EQZ A;  2O7C A;  3AEJ A;  2F8N B;  1ARH A;  4XEW A;  5CPI A;  2DGK A;  4XUJ C;  3AZM D;  2F8N K;  5BNV B;  4ZLV A;  5B2I A;  3AEM A;  4H9N B;  4ATP A;  4WD2 A;  3WKJ B;  1DGE A;  3AEJ C;  2QA3 A;  2ZUK A;  1AY5 A;  5GXQ B;  3USF A;  4UHM A;  4J8W D;  3QPG A;  3AZI C;  1U35 C;  1V2F A;  3ELP A;  3X1T C;  3WTP B;  2YCP A;  2YRI A;  3KWQ B;  3W98 A;  4K2I A;  1AJS B;  1JS3 A;  3QI6 A;  4A0G A;  5B32 B;  1P3M A;  4Z66 B;  4CSR A;  1AY4 A;  4A6R A;  1SVV A;  3WGC A;  1P3F A;  4JJN C;  3KE3 A;  4Z5T D;  3X1S B;  3LZ0 D;  2AY9 A;  4ZWM A;  4F5J A;  2BIE A;  3REJ B;  3KSY A;  1I48 A;  2BIG A;  4A72 A;  3AZJ A;  3KGW A;  3X1V D;  5JAY A;  3EUC A;  3ZRR A;  2DGM A;  4J8W C;  3MAU A;  2WK8 A;  1PMO A;  2R2N A;  3IP4 C;  2WK7 A;  3MNN B;  3A9Z A;  5DJ1 A;  3B6G A;  1P3K C;  4QLC C;  4WYF A;  2JJF A;  3JWA A;  3PAA A;  4R8D A;  3W96 B;  4ZAS A;  4HF8 A;  1P3B A;  1ARI A;  4W91 A;  4AO9 A;  4ITX A;  1N31 A;  3F9T A;  3WKJ D;  5AVB A;  5B0Y D;  3KFU G;  4Y0I A;  1KX3 A;  4E44 A;  1TOJ A;  3GZD C;  5M4D A;  2QMA A;  3FRK A;  3MC6 A;  1EQB A;  2ARO D;  1P3A A;  2ZC0 A;  5B31 C;  3AYW C;  3AZE D;  4ATQ A;  1BJW A;  4XZQ A;  4KUD A;  1EQZ C;  1P3F D;  1MDZ A;  4WU9 A;  4WZS B;  3REI B;  3MAD A;  3X1T A;  1DJE A;  3RUY A;  1F1E A;  4OMA A;  4R2N A;  3AZN A;  3LY1 A;  4LW2 A;  1KX4 B;  3LVK A;  2EZ1 A;  2W7L A;  5AV6 B;  5AVC C;  3RQ1 A;  3WAA D;  3UTA C;  1WYU B;  3AAT A;  3WX9 A;  3AEP A;  3AZG B;  4PIW A;  2R5C B;  1OHY A;  1P3I D;  1SFF A;  3AV1 D;  3W1I A;  3BV0 A;  2D64 A;  5GT3 C;  2Z1Y A;  3AZK D;  5AV8 B;  2AY1 A;  3FCR A;  3TFU A;  3FVU A;  3AV1 A;  4LNJ A;  2FJ7 D;  1M0N A;  4J5U A;  1D7R A;  5BT1 C;  2DKB A;  3MVD A;  3DRD A;  3H0M C;  3WAA A;  2Y2K A;  2PYO A;  3LVL B;  3ISL A;  1G7W A;  3NYS A;  2YCT A;  1BH9 A;  2FN6 A;  1ZOD A;  5GT0 A;  2GMS A;  4LW4 A;  2EYQ A;  1TZY B;  2VI8 A;  1QJ3 A;  3C1B C;  2ZSM A;  3T32 A;  4PFN A;  1AHG A;  1M18 D;  5KDM A;  1P3P D;  1KX4 C;  3V9R B;  3OP7 A;  3NX3 A;  4UHO A;  5K8B A;  3MGR B;  1P3P A;  5BS7 A;  4XZQ D;  4KUD D;  3LZ1 A;  5B2I C;  3EI9 A;  3W98 B;  3HMU A;  4WU9 C;  5BNX B;  4KHA A;  2BWO A;  1LC8 A;  2O1B A;  2BI2 A;  4W5K A;  3K28 A;  1AIA A;  5AV5 B;  1S32 A;  4E77 A;  5C3I B;  3LJA A;  3G7Q A;  2YKY A;  3DU4 A;  1P3I B;  1X29 A;  2OKK A;  4R8P C;  3AZM A;  1EJI A;  3A6N D;  4B9B A;  4W8I A;  1CL1 A;  1HQ3 D;  3PA9 A;  4WU9 D;  1YJY A;  2RVQ C;  2BYM B;  1M19 C;  2X8U A;  3I16 A;  3QGU A;  3B1D A;  4F5L A;  3NYU A;  5E4Z A;  4R5F A;  3B6F C;  1W7L A;  2Z9V A;  4ZWV A;  3AN2 D;  3MAF A;  4Z2M G;  1S08 A;  3OKS A;  2IO5 B;  1SF2 A;  1IVR A;  4OBU A;  1BJO B;  2OGA A;  1S07 A;  3JTX A;  3VH6 W;  3AEL A;  3H9X A;  3VP6 A;  3AZH D;  3K7Y A;  1XI9 A;  4J8X D;  1BJ4 A;  2CJH A;  1G4V A;  1C7N A;  2Z61 A;  3X1T B;  3IHJ A;  3EG5 B;  2L5A A;  5DNM B;  5CPK B;  2R0T A;  4Q6R A;  1X2A A;  1CZC A;  4H9S C;  2NQB B;  2GB3 A;  1KX5 D;  5B24 B;  1ART A;  3A8U X;  3NNK A;  1TOG A;  4J8U D;  1B5P A;  2G7J A;  2GSA A;  4J8X C;  4CXR A;  2VGV A;  1E5E A;  1ASL A;  1GEX A;  1HQ3 A;  3DR4 A;  3ASA A;  1ZLA C;  2NQB D;  1P3G D;  5E5A A;  3TFT A;  2W7J A;  4ADE A;  3AL0 C;  3BB8 A;  4R8P A;  3AZM C;  1ULY A;  3GZD A;  3AN2 C;  4RJ0 A;  1JG8 A;  2ZY4 A;  4IW7 A;  4Q75 A;  4KGC B;  1ELQ A;  2Y2P A;  2PYO B;  1O4S A;  1P3F B;  4JEW A;  1T3U A;  1C7O A;  5GXQ D;  3AZF C;  1BFM A;  1B67 A;  4ZUX D;  5G49 A;  3AFA C;  2HUU A;  2JJH A;  1J32 A;  5EIG A;  1KX5 C;  2D65 A;  3X1U D;  4WU8 C;  3B6G D;  4NOG A;  3WTP A;  4JEV A;  1P3K D;  3A6N A;  5B32 D;  1LW5 A;  3KWQ A;  1P3G C;  4E3Q A;  1UKJ A;  5HXX A;  3NQJ A;  2YRR A;  5CPI C;  3B6F B;  1M0O A;  5GT0 D;  1M0Q A;  2VMR A;  3WAA B;  3LZ1 B;  1MGV A;  2JG2 A;  1P3L B;  1D7U A;  2AY5 A;  2BI3 A;  2NZD B;  2EO5 A;  2VMZ A;  1KX3 C;  1PMM A;  4LNL A;  1ASN A;  3FFR A;  1TAF A;  1F66 B;  1F66 C;  9AAT A;  3KUY C;  1H3O B;  2ARO C;  4Z5T C;  4F5G A;  3X1U C;  3NTJ A;  2VMQ A;  1IX6 A;  3B0C W;  3BCB A;  5AV5 D;  4UHN A;  2DF4 C;  5B40 C;  1PFF A;  1V2D A;  2JE5 A;  3KXB D;  3MVD C;  1ECX A;  1GEY A;  2G5I C;  2VMP A;  3AV2 D;  1P3A B;  5M46 A;  4W1V A;  3W96 A;  3AZI D;  1U35 D;  1P3B B;  5B0Y B;  3AFA B;  3P5J B;  3VH5 T;  2Y2M A;  4H9P A;  4K05 A;  3WTP E;  3N5M A;  3MGQ B;  1M4N A;  2W7I A;  1TOI A;  3R9A A;  1AIC A;  3AZJ D;  3ACZ A;  2XD5 A;  3REI D;  3MGS D;  1ASG A;  4AO4 A;  2W8T A;  2ZY2 A;  3KGX A;  3FVS A;  3P6K A;  3UT9 C;  1C4K A;  3DXW A;  4DGT A;  2V1P A;  1ZC9 A;  1WWI A;  1OXP A;  2Z9U A;  4W1W A;  1H1C A;  4CBR A;  7AAT A;  5AV6 A;  1VP4 A;  1QIT A;  2BI9 A;  4YM6 C;  4LD9 B;  2VMU A;  5FT8 A;  4BHD A;  4WYA A;  2ZY3 A;  4H9N A;  3WY7 A;  3KUY A;  4K2B A;  3AV2 B;  5JRG C;  1P3A D;  2D7Z A;  3WCO A;  3C1C C;  2VLF A;  4G92 C;  4Z2M H;  3RI6 A;  4CVQ A;  3FDB A;  4U1T A;  2CAN A;  4WV4 B;  4OTL A;  4WNN A;  3EIA A;  2HOY A;  5EUD A;  3EPK A;  1P34 A;  3MKJ A;  4W1X A;  1N8P A;  3AZH B;  5B31 G;  3AZK C;  1ID3 A;  4O6Z A;  1Z7D A;  2AY4 A;  5BNX A;  5B2J B;  5AV9 D;  3CQ5 A;  3O62 D;  1IX7 A;  5I92 A;  2Z9X A;  4Y0D A;  3MGR D;  4RAE A;  5EIG B;  4ZBJ B;  1P3I A;  2BWP A;  3MGR A;  3DYD A;  2FJ7 C;  3X1S D;  1M19 B;  1TAT A;  4QLC A;  4K2M A;  1P3K B;  5B32 G;  1AOI B;  1AHX A;  3MEB A;  4G92 B;  1ID3 D;  3QN6 A;  5B24 D;  5JRG B;  4OBV A;  1SZK A;  2VGW A;  4JJN A;  4M2M A;  2JCH A;  1QIR A;  4WB0 B;  3E2Z B;  2YKX A;  1M18 C;  2F8N H;  3FSL A;  2ZYJ A;  2W8V A;  3A6N B;  3FDD A;  4KXK A;  1CQ8 A;  4EFF A;  4ZDL A;  4DRA A;  2W7M A;  2Q7W A;  3UT9 B;  3EPL A;  3AZG D;  5GSU B;  2Y2I A;  3LV2 A;  2VLH A;  3AEM C;  4KGC C;  4JF0 A;  2QB2 A;  1LC5 A;  3GR9 A;  1LS3 A;  4RIZ A;  3AZN C;  3AFA A;  1Y4I A;  4YS3 D;  3A2B A;  3NYT A;  3AZN B;  3O62 B;  2UWX A;  4ZM4 A;  1WYV A;  3VH6 T;  5GSU D;  1DTY A;  2BYJ A;  5B2J D;  5AV9 B;  3JZL A;  4RLG A;  4M6B A;  2QB3 A;  2Y2Q A;  3II0 A;  5DB5 A;  1P3L D;  3NUB A;  1M19 D;  4TMR A;  1TPL A;  3LWS A;  5E5A C;  1E5F A;  3LVM A;  3A6N C;  1RVU A;  1ID3 C;  2AAT A;  3DC1 A;  3AZL D;  5DNM A;  3PDX A;  5E5A B;  3VH5 A;  1WYT B;  1FG3 A;  2VYC A;  5B33 B;  4NE5 A;  1MLY A;  1AY8 A;  5AV8 D;  2W7D A;  3AV7 A;  3C1B A;  5EUN A;  3MGQ C;  5JA4 B;  2OQX A;  4BA5 A;  1SZU A;  1TZY A;  3W99 C;  2QSR A;  1GC0 A;  1SPA A;  4B98 A;  2QLR A;  3B1E A;  1ZLA A;  1D7V A;  3EI8 A;  1HTA A;  1H0C A;  1P3G B;  2AY7 A;  4G91 C;  4WNN B;  2AY6 A;  1UU2 A;  3H0L C;  3NQJ B;  3EPH A;  3ZRQ A;  1LC7 A;  4QLC D;  4G91 B;  3MBB A;  1AKB A;  2F8N A;  5G2Q A;  2W8J A;  4ADC A;  8AAT A;  3REL A;  2HIO D;  3AZF A;  2X5F A;  3TCM A;  4NFT A;  5M49 A;  4Z66 D;  1HQ3 C;  3B8X A;  1M18 B;  4XUJ D;  1S32 B;  3FZ7 A;  1KX3 D;  1C7G A;  3RBL A;  4J8U A;  4P3M A;  1TAR A;  2BI5 A;  3REH B;  4I8A A;  5CPI D;  4WYG A;  4LNM A;  3REH C;  2VGU A;  2D5Y A;  3GSB A;  2DQN C;  3WAA C;  1F66 D;  5B1M C;  2BYL A;  3G8M A;  3LVJ A;  1QJ5 A;  4R8P D;  1IX8 A;  5B33 D;  1W23 A;  1X28 A;  4WJ3 C;  3MAF B;  1A7W A;  4ADD A;  2NMP A;  2YFV A;  3AZJ C;  1O62 A;  1OXO A;  2GMU A;  1T3I A;  3I4J A;  3ATH A;  2JSS A;  1B8G A;  2WB6 A;  5F9S A;  1TOK A;  4WU8 B;  5B32 C;  4WXG A;  4IYO B;  1KX5 B;  3A9Y A;  1ASC A;  4MKK A;  1N1J A;  1O61 A;  5F99 C;  2BYK A;  2W8S A;  4ZUX B;  1P3M B;  3HDO A;  2OKJ A;  2FQ6 A;  4MKJ A;  3AFA D;  3VK3 A;  1P3M C;  4X23 D;  3FTB A;  3LEL A;  5CP6 D;  3B6G B;  4H9Q A;  4WLH A;  1AAW A;  3X1S A;  3WKJ C;  5DX5 A;  1ASB A;  4A00 A;  2JGT A;  4H51 A;  4HGA C;  4WB0 A;  4H9P B;  1P3O A;  4IXO A;  3TAT A;  1Z3Z A;  3R45 A;  5B33 C;  5CPJ D;  2XBN A;  3AZJ B;  3ZRP A;  3PD6 B;  3X1V A;  3KWQ D;  3MGQ D;  1IJI A;  5EQC A;  1AHF A;  4LD9 A;  1YJS A;  3MGP A;  2CST A;  1FG7 A;  2FFF B;  2FNI A;  4X23 A;  3WKR A;  4YS3 A;  5BS7 C;  1P34 D;  1P34 C;  2BHX A;  1DKA A;  4J8V C;  4H9O A;  5B1M B;  1YIZ A;  3FKD A;  3KXB B;  1WYV B;  3AN2 A;  4R8P B;  2VGT A;  2FJ7 B;  3UTA D;  3N75 A;  4A0F A;  1S32 C;  1M7Y A;  5B31 D;  3AZE C;  3AYW D;  2X5D A;  4ZAH A;  1AKC A;  2GQN A;  2AY8 A;  5F99 B;  3NDN A;  5B0Z A;  1WYU A;  4H9R A;  4M2J A;  1D2F A;  4ZM3 A;  4WU9 B;  3NU8 A;  3WA9 B;  5GSU C;  3UTB B;  2BIA A;  2VIA A;  2IO5 C;  3UTB C;  1S0A A;  1B5O A;  1TOE A;  3C1C D;  1P3A C;  1CJ0 A;  4NE3 A;  5BO0 A;  4DQY B;  1P3L A;  4BMK A;  3MVD B;  4RM1 A;  5B32 A;  3A9X A;  2E7J A;  3TU4 C;  5JRG A;  1GDE A;  4FFC A;  1CQ7 A;  2W7K A;  3REK A;  3W99 B;  3NQU B;  4AZJ A;  5C3I C;  3BWO A;  4YM6 B;  4LD9 C;  4J8X B;  1M1A A;  3REJ C;  5B24 C;  4JEZ A;  2NZD D;  1KMK A;  4WXB A;  4U2H A;  4OC9 A;  2ZM5 A;  5FT6 A;  1BJN A;  1J04 A;  4F5M A;  1BH9 B;  3R4T A;  3E77 A;  4Y0H A;  2W7H A;  5B2J C;  4GE4 A;  4F5F A;  3AZK B;  2HOX A;  3AZH C;  3AEN B;  3MGR C;  2ARO A;  5B1L B;  3REL D;  1QIS A;  3AZI B;  1U35 B;  3L8A A;  2PYO C;  4NE6 A;  5AV9 C;  2HOZ A;  1RVY A;  5BT1 D;  2R5E A;  1AMA A;  3JWB A;  1N1J B;  2EH6 A;  3MNN A;  1G4X A; 
#chains in the Genus database with same CATH homology
 1P3B C;  3W96 D;  4R5Z A;  3WTP D;  3N0L A;  1W7N A;  1X0M A;  1TZY D;  3BCX A;  2RVQ D;  4KGC D;  4ISY A;  1G7X A;  1KX5 A;  4UPK A;  3WLX A;  5FT5 A;  4Z5T B;  5AVC B;  4XZQ B;  4KUD B;  4QGR A;  4MQQ A;  1KU5 A;  1W3U A;  2FYF A;  4P7Y A;  2NZD C;  5AV6 C;  5E5A D;  4IXZ A;  4EU1 A;  1P3O B;  3R45 B;  3TU4 B;  4ADB A;  1M6S A;  2AY2 A;  3HT4 A;  2FJ7 A;  4ITG A;  5EAV A;  3QBO A;  2VMT A;  1JF9 A;  1YIY A;  5JA4 A;  5B2J A;  3COG A;  5B31 B;  3AYW B;  2AEU A;  5B24 A;  2TPL A;  2Z20 A;  2F2A C;  2HIO C;  5GXQ A;  3WA9 C;  5EAA A;  4FL0 A;  1AX4 A;  1B9H A;  3UTA A;  3DR7 A;  3GWP A;  5KDM B;  1ASF A;  2CIN A;  4GDY A;  1LW4 A;  2YOB A;  1AIB A;  2DOU A;  1AOI A;  3AZE B;  2D7Y A;  3B0D B;  3LZ0 A;  2A1V A;  1YOO A;  2NQB A;  5CP6 C;  3B6F D;  5B0Z B;  5M4B A;  1M18 A;  2VMO A;  1KL1 A;  4XUJ B;  4J8W B;  1AMS A;  3FQ7 A;  3VK2 A;  1AAM A;  4L0O A;  2YFV B;  1GC4 A;  5AV8 C;  4E1O A;  1YAA A;  3REH D;  1ARG A;  4F5H A;  1P3O D;  4YM6 A;  4ZDO A;  3PGY A;  1AMQ A;  3ECD A;  3W98 C;  4YM6 D;  5CP6 A;  1VJO A;  5G2P A;  1DGD A;  4Z66 C;  1P3F C;  4H9Q B;  3B6G C;  3O62 A;  3UTB D;  2PO3 A;  3ZZK A;  3AEN A;  3EZ1 A;  3MGS C;  5B1L C;  4WU8 A;  4ZUX C;  3C1C B;  4IYO A;  1PZR A;  1IUG A;  1CL2 A;  1FC4 A;  5B0Y C;  1BJO A;  3E6G A;  4EB7 A;  3AZN D;  1UU1 A;  4UUZ B;  3FQA A;  2RFV A;  2RIQ A;  1RV3 A;  3DXV A;  4CBS A;  4DQ6 A;  2VMV A;  3A1I A;  3BC8 A;  4A6T A;  5B0Z D;  3BS8 A;  3AZK A;  1MDO A;  5GT3 B;  2DR1 A;  4BQ0 A;  2E7U A;  1KL2 A;  2ZJG A;  1WYT A;  1B6W A;  4UOY A;  4J8V D;  5CPK C;  5EFS A;  4XJP A;  4IY7 A;  2Z1Z A;  4XK1 A;  1ASA A;  5B40 A;  3AOW A;  3BN1 A;  1P3I C;  5GT0 C;  3EI7 A;  2Z9W A;  3CAI A;  1S32 D;  5AV5 C;  5AVC A;  1GEW A;  2JJG A;  4XQ2 A;  1AOI C;  1ORD A;  1RV4 A;  3B0C T;  2R5C A;  3EZS A;  1V72 A;  3AZL B;  4EB5 A;  3RCH A;  3UWC A;  3QM2 A;  1HQ3 B;  5E5I A;  3REI C;  2LY8 A;  3CBF A;  3FVX A;  3LEL D;  4JEY A;  4F5K A;  5AY8 A;  5CPK D;  1BH8 B;  4XJL A;  5AY8 D;  3HQT A;  5F8V A;  5G0A A;  3A1K A;  4YS3 C;  1MAQ A;  2ORD A;  5F99 D;  4KGC A;  3WKS A;  3H0R C;  1CQ6 A;  3RBF A;  3NQU A;  4AOA A;  2W8U A;  3BWN C;  3REH A;  1WKH A;  1P3B D;  3NRA A;  3B0B A;  5FT4 A;  3AZM B;  2BWN A;  3VOM A;  4PFF A;  3KXB C;  3MVD D;  4J8X A;  4KAM A;  2D63 A;  3HBX A;  3QHX A;  4J8V B;  1P34 B;  2C44 A;  1XEY A;  3LZ1 C;  4MQR A;  3H7F A;  3MC6 C;  3REK B;  5CPI B;  5B31 A;  3AYW A;  4EO5 C;  3REL C;  3UE8 A;  3W99 A;  1ID3 B;  3B1C A;  3E2Y A;  3W97 B;  3ZZJ A;  2VIB A;  3EI5 A;  1TAF B;  1F66 A;  4XUJ A;  3WKJ A;  3UTA B;  5TF5 A;  1BW0 A;  3E2F A;  1S06 A;  2CV5 B;  3TQX A;  3LZ0 B;  1R4V A;  2AY3 A;  1M1A D;  3NU7 A;  1AJS A;  2DGL A;  3LEL B;  5FUG B;  1P3K A;  3WTP C;  3O62 C;  4LD9 D;  2X3L A;  3D6K A;  3EIB A;  1JS6 A;  1BS0 A;  4J8W A;  3B46 A;  2HIO A;  2WK9 A;  5GXQ C;  3LJA D;  3AZF D;  1MLZ A;  1GCK A;  4IX8 A;  1WWS A;  3REK C;  1AHY A;  2VMS A;  1C9C A;  3MNN D;  3W1H A;  3REJ A;  3C1B D;  1D7S A;  4X23 C;  3MGP B;  3WZF A;  5EUE A;  3N4S A;  4UQV A;  1TAS A;  2BKW A;  1KKJ A;  2O0R A;  2CH1 A;  5D5S A;  4Z5T A;  1ZLA D;  5CP6 B;  2NQB C;  2CTZ A;  4N0W A;  3DOD A;  3WA9 D;  2CB1 A;  3B0D C;  1GC3 A;  3MGP D;  4ZSW A;  4Q76 A;  3X1U B;  3PDB A;  4Q31 A;  5CPJ A;  1P3W A;  1AHE A;  3BWN A;  1KX3 B;  5F99 A;  2JIS A;  1M32 A;  3PIU A;  1P3L C;  5GSU A;  5AV6 D;  4ZBJ C;  2BG1 A;  4XJM A;  2WKA A;  2W7E A;  3UTB A;  1JFI A;  1N2T A;  3HLM A;  3RCH B;  1IBJ A;  3FZ8 A;  2CJD A;  1P3O C;  5BJ3 A;  2D66 A;  3MGS A;  5BO0 B;  1OAT A;  4CXQ A;  3B6F A;  1BH8 A;  3CQ4 A;  3GET A;  3GJU A;  3N4R A;  4PVF A;  4AWL C;  3E9K A;  2NZD A;  3C1B B;  4WP0 A;  5G49 B;  3AV2 A;  2CWE A;  4E45 A;  2CH2 A;  3AZG A;  5B1L D;  2VMW A;  5DNN B;  1ELU A;  1ZLA B;  1I43 A;  4WXF A;  2QBT A;  2Y2O A;  2AEV A;  2ZP7 A;  1M19 A;  1AJR A;  3AZG C;  1AOI D;  1BT4 A;  2HZP A;  3HVY A;  2HP2 A;  5JRG D;  5DNN D;  2YKU A;  4CSR B;  4RIT A;  3AOV A;  3VAX A;  3X1V C;  1C0N A;  5BNV A;  2HP1 A;  4JF1 A;  5AVB C;  4GEB A;  4JJN B;  5AVB D;  2Y2N A;  5B0Y A;  1LK9 A;  2W8W A;  5DNM C;  1H3O A;  1YJZ A;  3FFH A;  3AEO A;  2VQR A;  5BJ4 A;  1DJ9 A;  4WBT A;  2KFP A;  5E3K A;  1IAX A;  3MGQ A;  4J8V A;  3UT9 D;  4AH3 A;  4XAU A;  1VEF A;  3W97 C;  3FQ8 A;  1P3P C;  1KX4 D;  2EZ2 A;  1KMJ A;  4EO5 B;  3REL B;  1W2E A;  1V2E A;  4KHA B;  5C6U A;  1UU0 A;  3FZ6 A;  5DNN C;  4RKD A;  4KYO A;  2YFW A;  4GE9 A;  4H63 Q;  2DKJ A;  3WCN A;  5B0Z C;  5AV5 A;  3DZZ A;  3C1C A;  3FD0 A;  2W7G A;  3LJA B;  3ELE A;  2ZSL A;  1O69 A;  4BA4 A;  5B40 B;  5FUG A;  4JEX A;  3W98 D;  3M5U A;  2C81 A;  3P1T A;  3NUI A;  3W1J A;  3AV1 C;  2VGZ A;  3KUY B;  2C7T A;  1ZOB A;  2G6W A;  2HIO B;  2VMN A;  3UAK A;  2G5H C;  1PG8 A;  4MY5 A;  3TU4 A;  1I41 A;  4ZDP A;  1U08 A;  2PB2 A;  1Q9C A;  4A0H A;  5B2I D;  3VH6 A;  2JJE A;  1GC2 A;  4JJN D;  3ASB A;  2CY8 A;  5CHL B;  1EQZ B;  1YNU A;  4CAY A;  2BYK B;  3VH5 W;  1OHV A;  3I5T A;  4ZUX A;  5IWQ A;  4OYT A;  3CQ6 A;  5AX8 A;  3EI6 A;  3AZL A;  5B2I B;  2PB0 A;  3F0H A;  3LEL C;  3EPJ A;  3REI A;  3TU4 D;  3VK4 A;  4TN4 A;  3REJ D;  3LZ0 C;  5AY8 B;  2F8N D;  4ZSY A;  3AV1 B;  4XZQ C;  4KUD C;  3AZE A;  4A0R A;  1KX4 A;  3KWQ C;  1P3G A;  3AN2 B;  3W96 C;  5B33 A;  3X1V B;  4QLC B;  3AZH A;  4RKC A;  3Q8N A;  2EPJ A;  1SZS A;  1QZ9 A;  3MNN C;  4OCA A;  3AV2 C;  2Y2J A;  2W7F A;  2HUF A;  2CFB A;  3MGP C;  4X23 B;  5GT3 D;  2Y2H A;  3LJA C;  4H9S A;  1BQD A;  1ASD A;  1P3M D;  1DJU A;  3W97 A;  2YKV A;  1GBN A;  5DJ9 A;  4OT8 A;  1AMR A;  4E3R A;  3KXB A;  5DNN A;  4HGA B;  3MGS B;  4F4E A;  5G09 A;  3F6T A;  2ZY5 A;  2CV5 A;  2VMY A;  4GE7 A;  1P3P B;  4RJY A;  4AWL B;  1QGN A;  4Z66 A;  1KKP A;  3UT9 A;  5HDM A;  5AY8 C;  2E54 A;  4XJO A;  5HHY A;  1ASE A;  2YCN A;  1GD9 A;  2CV5 C;  4DRB A;  1IAY A;  4H9R B;  4GRX A;  4EMY A;  1WKG A;  4A6U A;  3W97 D;  3WA9 A;  3L44 A;  3PJ0 A;  3E2Z A;  1EQZ D;  4J8U B;  1I29 A;  1WST A;  2VI9 A;  3LZ1 D;  2XH1 A;  5AVC D;  1AKA A;  5AVB B;  2F8J A;  2CV5 D;  4MSO A;  1M0P A;  1CZE A;  3GBX A;  1DFO A;  3N4X A;  2E7I A;  4MQP A;  2BYM A;  4UUZ A;  1M1A B;  1LKC A;  4AZK A;  2EGY A;  1CS1 A;  3G0T A;  1ASM A;  5GT3 A;  2PYO D;  1W7M A;  2V0Y A;  1Z2C B;  5G4J A;  2FKI A;  4HVK A;  5D95 A;  2HUE B;  3HL2 A;  5AV9 A;  2YFW B;  2FNU A;  5CPJ B;  2CJG A;  4DBC A;  5J8Q A;  2ARO B;  1ARS A;  2J8P A;  2OAT A;  3AZI A;  1U35 A;  3REK D;  3N7N A;  3GZC A;  2XD1 A;  4WYD A;  5B40 D;  4YS3 B;  5G4I A;  3W99 D;  1JFI B;  3WGB A;  5B1M D;  1B9I A;  3X1U A;  5AV8 A;  3PDB B;  3KUY D;  4GSA A;  2Y2G A;  1M1A C;  2HOR A;  2YHK A;  2HUI A;  3K40 A;  5B1L A;  5DNM D;  2BI1 A;  3PD6 A;  4J8U C;  2FM1 A;  4F5I A;  5KTB A;  4M2K A;  3X1S C;  3X1T D;  3LG0 A;  2C0R A;  1BKG A;  3PPL A;  3AZL C;  1EG5 A;  3AZF B;  4CAY B;  2VGS A;  5GT0 B;  4J8L A;  1S09 A;  4WLJ A;  2Y2L A;  3JW9 A;  1B4X A;  1BQA A;  4H9O B;  5B1M A;  2OGE A;  1TZY C;  5CPJ C;  4LC3 A;  4WU8 D;  2HUE C;  1MAP A;  4WYC A;  3V9R A;  3KKI A;  3BCA A;  1OHW A;  5CPK A;  4WYE A;  1MDX A;  4IXS A;  2VMX A;  2D61 A;  2F8N G;  1EQZ A;  2O7C A;  3AEJ A;  2F8N B;  1ARH A;  4XEW A;  5CPI A;  2DGK A;  4XUJ C;  3AZM D;  2F8N K;  5BNV B;  4ZLV A;  5B2I A;  3AEM A;  4H9N B;  4ATP A;  4WD2 A;  3WKJ B;  1DGE A;  3AEJ C;  2QA3 A;  2ZUK A;  1AY5 A;  5GXQ B;  3USF A;  4UHM A;  4J8W D;  3QPG A;  3AZI C;  1U35 C;  1V2F A;  3ELP A;  3X1T C;  3WTP B;  2YCP A;  2YRI A;  3KWQ B;  3W98 A;  4K2I A;  1AJS B;  1JS3 A;  3QI6 A;  4A0G A;  5B32 B;  1P3M A;  4Z66 B;  4CSR A;  1AY4 A;  4A6R A;  1SVV A;  3WGC A;  1P3F A;  4JJN C;  3KE3 A;  4Z5T D;  3X1S B;  3LZ0 D;  2AY9 A;  4ZWM A;  4F5J A;  2BIE A;  3REJ B;  3KSY A;  1I48 A;  2BIG A;  4A72 A;  3AZJ A;  3KGW A;  3X1V D;  5JAY A;  3EUC A;  3ZRR A;  2DGM A;  4J8W C;  3MAU A;  2WK8 A;  1PMO A;  2R2N A;  3IP4 C;  2WK7 A;  3MNN B;  3A9Z A;  5DJ1 A;  3B6G A;  1P3K C;  4QLC C;  4WYF A;  2JJF A;  3JWA A;  3PAA A;  4R8D A;  3W96 B;  4ZAS A;  4HF8 A;  1P3B A;  1ARI A;  4W91 A;  4AO9 A;  4ITX A;  1N31 A;  3F9T A;  3WKJ D;  5AVB A;  5B0Y D;  3KFU G;  4Y0I A;  1KX3 A;  4E44 A;  1TOJ A;  3GZD C;  5M4D A;  2QMA A;  3FRK A;  3MC6 A;  1EQB A;  2ARO D;  1P3A A;  2ZC0 A;  5B31 C;  3AYW C;  3AZE D;  4ATQ A;  1BJW A;  4XZQ A;  4KUD A;  1EQZ C;  1P3F D;  1MDZ A;  4WU9 A;  4WZS B;  3REI B;  3MAD A;  3X1T A;  1DJE A;  3RUY A;  1F1E A;  4OMA A;  4R2N A;  3AZN A;  3LY1 A;  4LW2 A;  1KX4 B;  3LVK A;  2EZ1 A;  2W7L A;  5AV6 B;  5AVC C;  3RQ1 A;  3WAA D;  3UTA C;  1WYU B;  3AAT A;  3WX9 A;  3AEP A;  3AZG B;  4PIW A;  2R5C B;  1OHY A;  1P3I D;  1SFF A;  3AV1 D;  3W1I A;  3BV0 A;  2D64 A;  5GT3 C;  2Z1Y A;  3AZK D;  5AV8 B;  2AY1 A;  3FCR A;  3TFU A;  3FVU A;  3AV1 A;  4LNJ A;  2FJ7 D;  1M0N A;  4J5U A;  1D7R A;  5BT1 C;  2DKB A;  3MVD A;  3DRD A;  3H0M C;  3WAA A;  2Y2K A;  2PYO A;  3LVL B;  3ISL A;  1G7W A;  3NYS A;  2YCT A;  1BH9 A;  2FN6 A;  1ZOD A;  5GT0 A;  2GMS A;  4LW4 A;  2EYQ A;  1TZY B;  2VI8 A;  1QJ3 A;  3C1B C;  2ZSM A;  3T32 A;  4PFN A;  1AHG A;  1M18 D;  5KDM A;  1P3P D;  1KX4 C;  3V9R B;  3OP7 A;  3NX3 A;  4UHO A;  5K8B A;  3MGR B;  1P3P A;  5BS7 A;  4XZQ D;  4KUD D;  3LZ1 A;  5B2I C;  3EI9 A;  3W98 B;  3HMU A;  4WU9 C;  5BNX B;  4KHA A;  2BWO A;  1LC8 A;  2O1B A;  2BI2 A;  4W5K A;  3K28 A;  1AIA A;  5AV5 B;  1S32 A;  4E77 A;  5C3I B;  3LJA A;  3G7Q A;  2YKY A;  3DU4 A;  1P3I B;  1X29 A;  2OKK A;  4R8P C;  3AZM A;  1EJI A;  3A6N D;  4B9B A;  4W8I A;  1CL1 A;  1HQ3 D;  3PA9 A;  4WU9 D;  1YJY A;  2RVQ C;  2BYM B;  1M19 C;  2X8U A;  3I16 A;  3QGU A;  3B1D A;  4F5L A;  3NYU A;  5E4Z A;  4R5F A;  3B6F C;  1W7L A;  2Z9V A;  4ZWV A;  3AN2 D;  3MAF A;  4Z2M G;  1S08 A;  3OKS A;  2IO5 B;  1SF2 A;  1IVR A;  4OBU A;  1BJO B;  2OGA A;  1S07 A;  3JTX A;  3VH6 W;  3AEL A;  3H9X A;  3VP6 A;  3AZH D;  3K7Y A;  1XI9 A;  4J8X D;  1BJ4 A;  2CJH A;  1G4V A;  1C7N A;  2Z61 A;  3X1T B;  3IHJ A;  3EG5 B;  2L5A A;  5DNM B;  5CPK B;  2R0T A;  4Q6R A;  1X2A A;  1CZC A;  4H9S C;  2NQB B;  2GB3 A;  1KX5 D;  5B24 B;  1ART A;  3A8U X;  3NNK A;  1TOG A;  4J8U D;  1B5P A;  2G7J A;  2GSA A;  4J8X C;  4CXR A;  2VGV A;  1E5E A;  1ASL A;  1GEX A;  1HQ3 A;  3DR4 A;  3ASA A;  1ZLA C;  2NQB D;  1P3G D;  5E5A A;  3TFT A;  2W7J A;  4ADE A;  3AL0 C;  3BB8 A;  4R8P A;  3AZM C;  1ULY A;  3GZD A;  3AN2 C;  4RJ0 A;  1JG8 A;  2ZY4 A;  4IW7 A;  4Q75 A;  4KGC B;  1ELQ A;  2Y2P A;  2PYO B;  1O4S A;  1P3F B;  4JEW A;  1T3U A;  1C7O A;  5GXQ D;  3AZF C;  1BFM A;  1B67 A;  4ZUX D;  5G49 A;  3AFA C;  2HUU A;  2JJH A;  1J32 A;  5EIG A;  1KX5 C;  2D65 A;  3X1U D;  4WU8 C;  3B6G D;  4NOG A;  3WTP A;  4JEV A;  1P3K D;  3A6N A;  5B32 D;  1LW5 A;  3KWQ A;  1P3G C;  4E3Q A;  1UKJ A;  5HXX A;  3NQJ A;  2YRR A;  5CPI C;  3B6F B;  1M0O A;  5GT0 D;  1M0Q A;  2VMR A;  3WAA B;  3LZ1 B;  1MGV A;  2JG2 A;  1P3L B;  1D7U A;  2AY5 A;  2BI3 A;  2NZD B;  2EO5 A;  2VMZ A;  1KX3 C;  1PMM A;  4LNL A;  1ASN A;  3FFR A;  1TAF A;  1F66 B;  1F66 C;  9AAT A;  3KUY C;  1H3O B;  2ARO C;  4Z5T C;  4F5G A;  3X1U C;  3NTJ A;  2VMQ A;  1IX6 A;  3B0C W;  3BCB A;  5AV5 D;  4UHN A;  2DF4 C;  5B40 C;  1PFF A;  1V2D A;  2JE5 A;  3KXB D;  3MVD C;  1ECX A;  1GEY A;  2G5I C;  2VMP A;  3AV2 D;  1P3A B;  5M46 A;  4W1V A;  3W96 A;  3AZI D;  1U35 D;  1P3B B;  5B0Y B;  3AFA B;  3P5J B;  3VH5 T;  2Y2M A;  4H9P A;  4K05 A;  3WTP E;  3N5M A;  3MGQ B;  1M4N A;  2W7I A;  1TOI A;  3R9A A;  1AIC A;  3AZJ D;  3ACZ A;  2XD5 A;  3REI D;  3MGS D;  1ASG A;  4AO4 A;  2W8T A;  2ZY2 A;  3KGX A;  3FVS A;  3P6K A;  3UT9 C;  1C4K A;  3DXW A;  4DGT A;  2V1P A;  1ZC9 A;  1WWI A;  1OXP A;  2Z9U A;  4W1W A;  1H1C A;  4CBR A;  7AAT A;  5AV6 A;  1VP4 A;  1QIT A;  2BI9 A;  4YM6 C;  4LD9 B;  2VMU A;  5FT8 A;  4BHD A;  4WYA A;  2ZY3 A;  4H9N A;  3WY7 A;  3KUY A;  4K2B A;  3AV2 B;  5JRG C;  1P3A D;  2D7Z A;  3WCO A;  3C1C C;  2VLF A;  4G92 C;  4Z2M H;  3RI6 A;  4CVQ A;  3FDB A;  4U1T A;  2CAN A;  4WV4 B;  4OTL A;  4WNN A;  3EIA A;  2HOY A;  5EUD A;  3EPK A;  1P34 A;  3MKJ A;  4W1X A;  1N8P A;  3AZH B;  5B31 G;  3AZK C;  1ID3 A;  4O6Z A;  1Z7D A;  2AY4 A;  5BNX A;  5B2J B;  5AV9 D;  3CQ5 A;  3O62 D;  1IX7 A;  5I92 A;  2Z9X A;  4Y0D A;  3MGR D;  4RAE A;  5EIG B;  4ZBJ B;  1P3I A;  2BWP A;  3MGR A;  3DYD A;  2FJ7 C;  3X1S D;  1M19 B;  1TAT A;  4QLC A;  4K2M A;  1P3K B;  5B32 G;  1AOI B;  1AHX A;  3MEB A;  4G92 B;  1ID3 D;  3QN6 A;  5B24 D;  5JRG B;  4OBV A;  1SZK A;  2VGW A;  4JJN A;  4M2M A;  2JCH A;  1QIR A;  4WB0 B;  3E2Z B;  2YKX A;  1M18 C;  2F8N H;  3FSL A;  2ZYJ A;  2W8V A;  3A6N B;  3FDD A;  4KXK A;  1CQ8 A;  4EFF A;  4ZDL A;  4DRA A;  2W7M A;  2Q7W A;  3UT9 B;  3EPL A;  3AZG D;  5GSU B;  2Y2I A;  3LV2 A;  2VLH A;  3AEM C;  4KGC C;  4JF0 A;  2QB2 A;  1LC5 A;  3GR9 A;  1LS3 A;  4RIZ A;  3AZN C;  3AFA A;  1Y4I A;  4YS3 D;  3A2B A;  3NYT A;  3AZN B;  3O62 B;  2UWX A;  4ZM4 A;  1WYV A;  3VH6 T;  5GSU D;  1DTY A;  2BYJ A;  5B2J D;  5AV9 B;  3JZL A;  4RLG A;  4M6B A;  2QB3 A;  2Y2Q A;  3II0 A;  5DB5 A;  1P3L D;  3NUB A;  1M19 D;  4TMR A;  1TPL A;  3LWS A;  5E5A C;  1E5F A;  3LVM A;  3A6N C;  1RVU A;  1ID3 C;  2AAT A;  3DC1 A;  3AZL D;  5DNM A;  3PDX A;  5E5A B;  3VH5 A;  1WYT B;  1FG3 A;  2VYC A;  5B33 B;  4NE5 A;  1MLY A;  1AY8 A;  5AV8 D;  2W7D A;  3AV7 A;  3C1B A;  5EUN A;  3MGQ C;  5JA4 B;  2OQX A;  4BA5 A;  1SZU A;  1TZY A;  3W99 C;  2QSR A;  1GC0 A;  1SPA A;  4B98 A;  2QLR A;  3B1E A;  1ZLA A;  1D7V A;  3EI8 A;  1HTA A;  1H0C A;  1P3G B;  2AY7 A;  4G91 C;  4WNN B;  2AY6 A;  1UU2 A;  3H0L C;  3NQJ B;  3EPH A;  3ZRQ A;  1LC7 A;  4QLC D;  4G91 B;  3MBB A;  1AKB A;  2F8N A;  5G2Q A;  2W8J A;  4ADC A;  8AAT A;  3REL A;  2HIO D;  3AZF A;  2X5F A;  3TCM A;  4NFT A;  5M49 A;  4Z66 D;  1HQ3 C;  3B8X A;  1M18 B;  4XUJ D;  1S32 B;  3FZ7 A;  1KX3 D;  1C7G A;  3RBL A;  4J8U A;  4P3M A;  1TAR A;  2BI5 A;  3REH B;  4I8A A;  5CPI D;  4WYG A;  4LNM A;  3REH C;  2VGU A;  2D5Y A;  3GSB A;  2DQN C;  3WAA C;  1F66 D;  5B1M C;  2BYL A;  3G8M A;  3LVJ A;  1QJ5 A;  4R8P D;  1IX8 A;  5B33 D;  1W23 A;  1X28 A;  4WJ3 C;  3MAF B;  1A7W A;  4ADD A;  2NMP A;  2YFV A;  3AZJ C;  1O62 A;  1OXO A;  2GMU A;  1T3I A;  3I4J A;  3ATH A;  2JSS A;  1B8G A;  2WB6 A;  5F9S A;  1TOK A;  4WU8 B;  5B32 C;  4WXG A;  4IYO B;  1KX5 B;  3A9Y A;  1ASC A;  4MKK A;  1N1J A;  1O61 A;  5F99 C;  2BYK A;  2W8S A;  4ZUX B;  1P3M B;  3HDO A;  2OKJ A;  2FQ6 A;  4MKJ A;  3AFA D;  3VK3 A;  1P3M C;  4X23 D;  3FTB A;  3LEL A;  5CP6 D;  3B6G B;  4H9Q A;  4WLH A;  1AAW A;  3X1S A;  3WKJ C;  5DX5 A;  1ASB A;  4A00 A;  2JGT A;  4H51 A;  4HGA C;  4WB0 A;  4H9P B;  1P3O A;  4IXO A;  3TAT A;  1Z3Z A;  3R45 A;  5B33 C;  5CPJ D;  2XBN A;  3AZJ B;  3ZRP A;  3PD6 B;  3X1V A;  3KWQ D;  3MGQ D;  1IJI A;  5EQC A;  1AHF A;  4LD9 A;  1YJS A;  3MGP A;  2CST A;  1FG7 A;  2FFF B;  2FNI A;  4X23 A;  3WKR A;  4YS3 A;  5BS7 C;  1P34 D;  1P34 C;  2BHX A;  1DKA A;  4J8V C;  4H9O A;  5B1M B;  1YIZ A;  3FKD A;  3KXB B;  1WYV B;  3AN2 A;  4R8P B;  2VGT A;  2FJ7 B;  3UTA D;  3N75 A;  4A0F A;  1S32 C;  1M7Y A;  5B31 D;  3AZE C;  3AYW D;  2X5D A;  4ZAH A;  1AKC A;  2GQN A;  2AY8 A;  5F99 B;  3NDN A;  5B0Z A;  1WYU A;  4H9R A;  4M2J A;  1D2F A;  4ZM3 A;  4WU9 B;  3NU8 A;  3WA9 B;  5GSU C;  3UTB B;  2BIA A;  2VIA A;  2IO5 C;  3UTB C;  1S0A A;  1B5O A;  1TOE A;  3C1C D;  1P3A C;  1CJ0 A;  4NE3 A;  5BO0 A;  4DQY B;  1P3L A;  4BMK A;  3MVD B;  4RM1 A;  5B32 A;  3A9X A;  2E7J A;  3TU4 C;  5JRG A;  1GDE A;  4FFC A;  1CQ7 A;  2W7K A;  3REK A;  3W99 B;  3NQU B;  4AZJ A;  5C3I C;  3BWO A;  4YM6 B;  4LD9 C;  4J8X B;  1M1A A;  3REJ C;  5B24 C;  4JEZ A;  2NZD D;  1KMK A;  4WXB A;  4U2H A;  4OC9 A;  2ZM5 A;  5FT6 A;  1BJN A;  1J04 A;  4F5M A;  1BH9 B;  3R4T A;  3E77 A;  4Y0H A;  2W7H A;  5B2J C;  4GE4 A;  4F5F A;  3AZK B;  2HOX A;  3AZH C;  3AEN B;  3MGR C;  2ARO A;  5B1L B;  3REL D;  1QIS A;  3AZI B;  1U35 B;  3L8A A;  2PYO C;  4NE6 A;  5AV9 C;  2HOZ A;  1RVY A;  5BT1 D;  2R5E A;  1AMA A;  3JWB A;  1N1J B;  2EH6 A;  3MNN A;  1G4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...