2ZY4A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
527
structure length
524
Chain Sequence
b'MSKDYQSLSPFELKDELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-aspartate beta-decarboxylase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
total genus 201
structure length 524
sequence length 527
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy4A01
2JGTA 3DZZA 1ASAA 4MY5A 2AY4A 3QN6A 4GRXA 2Z61A 4F5MA 3NDNA 3VOMA 5K8BA 3MKJA 4HVKA 1MAPA 2FYFA 3TQXA 1RV4A 1JS6A 2C7TA 4NOGA 3WKSA 4EFFA 4AZKA 1LKCA 4JEZA 1JS3A 3HLMA 4K2IA 1ASBA 2VI9A 3AENA 3BWNA 3F6TA 4ZLVA 1LC5A 2ZY2A 1AJSA 3PDXA 2CTZA 1WKHA 2DOUA 3QBOA 3FDBA 4ADDA 2ZY3A 3E9KA 1TASA 3HQTA 5DB5A 4E77A 4ADCA 1H0CA 4GE9A 4Y0DA 1B9HA 2BYLA 4ZAHA 1LS3A 3A9YA 2AATA 3ELEA 2YCPA 1D7UA 3AEJC 4R5ZA 3NUBA 1GBNA 4ZSWA 3NYUA 5M4DA 2D64A 5G4JA 1N8PA 1DJEA 1SFFA 1U08A 4GE7A 1O62A 4XJMA 2VGSA 1D7RA 1CQ7A 5HHYA 2E7UA 3GR9A 4IXOA 1CL1A 2OATA 2W7MA 4A6TA 2R5CA 4KYOA 1P3WA 1XI9A 1IX8A 2VMTA 1GEXA 3ATHA 1QZ9A 4IW7A 1YJSA 2YRIA 1AMRA 2W7DA 3EIBA 4W1XA 3NTJA 1ARTA 1DGDA 1C7NA 4AO9A 1S08A 5HDMA 2GMSA 1LC7A 1VEFA 2RFVA 3MBBA 2OQXA 1EJIA 3L44A 2G6WA 1Z3ZA 4Q76A 3ZZJA 4DQ6A 1WYVB 4W5KA 3KGWA 4E1OA 1KL1A 3BS8A 1BJ4A 5E5IA 3MAFB 4WXGA 1AMQA 3N75A 2W8TA 4IY7A 3JWBA 1CJ0A 4PFFA 3WY7A 3TFUA 2HOYA 2QB3A 4OMAA 2QB2A 1ARSA 2FNUA 4XJLA 3ACZA 5IWQA 3T32A 4RKCA 9AATA 2XBNA 1OHWA 2DKJA 1E5FA 1AX4A 1C7OA 1KKJA 1WYUA 2QBTA 2VIBA 4EU1A 1AY4A 1TOIA 3LVKA 1MLYA 2Z1ZA 2R2NA 3CQ5A 4MKJA 4BQ0A 2CB1A 1DFOA 5C6UA 2BI2A 5EFSA 1W7LA 2HOZA 3GZCA 1ZOBA 2BWPA 4O6ZA 2CJHA 2W7EA 3DYDA 1TATA 2OGAA 3AEJA 1I48A 3A9ZA 3UE8A 2CANA 3FRKA 1FC4A 2VLFA 4W91A 1GD9A 4UHMA 3PGYA 4OTLA 4B98A 3E2YA 3RBFA 4IX8A 2EH6A 3B46A 3NRAA 1T3IA 4Y0IA 1UKJA 1W23A 3BCAA 4LNLA 4Q31A 3DXVA 4Q75A 4BHDA 4U2HA 3FVUA 1B5OA 4WB0A 1IX6A 3M5UA 3E2ZA 2JG2A 2F8JA 3AEOA 3FFRA 1M0QA 2W7IA 4MQQA 3P1TA 5E4ZA 4OYTA 4A6RA 3II0A 4BA4A 2EZ1A 2BKWA 3K7YA 2WKAA 4R8DA 5FT4A 1BQAA 1N31A 2YKVA 4CBSA 1WYTA 2QLRA 2ZSMA 3K28A 4XJPA 3CBFA 5EUDA 1IX7A 2D66A 1M32A 1J32A 1OHYA 2BI9A 2AY7A 1B8GA 4F5IA 3TFTA 3HL2A 2HP2A 4OT8A 5G09A 1ELUA 1OATA 2BI3A 2O1BA 3PD6B 1B4XA 1O4SA 1B9IA 1ZC9A 3AOVA 2W8VA 1EQBA 2YRRA 1MDZA 1W7MA 2CH1A 3B8XA 2HORA 1AIAA 1D7SA 1I29A 3EI6A 3PDBA 5J8QA 2ZUKA 4JEXA 2X5FA 4WXFA 1Z7DA 3BCBA 5G4IA 4EMYA 1M6SA 8AATA 4IXSA 2TPLA 1GEWA 2D7YA 4M2KA 3G7QA 2EO5A 1I41A 3AEMC 3N5MA 1V2DA 4P7YA 3ZZKA 3Q8NA 4P3MA 2YCNA 1AICA 2GSAA 4EB5A 1IBJA 3ECDA 5EUNA 1QGNA 4UHNA 1IAYA 1YNUA 2AY2A 4JEWA 3WX9A 3A2BA 1YAAA 4XQ2A 1ASMA 2C81A 2CSTA 2PB0A 2NMPA 3E2FA 5G0AA 3JW9A 4WYCA 4PIWA 3MAUA 2Z20A 3COGA 4ZASA 2VLHA 2ZY4A 2HOXA 4MSOA 3AOWA 4W1VA 3AENB 1C7GA 1YOOA 5D95A 2E7JA 1LC8A 1AJSB 1ECXA 4LNJA 4A0GA 3ELPA 4AO4A 1ASCA 1OXOA 3LG0A 1V72A 3KGXA 1MDOA 3EIAA 2Z9WA 1KL2A 4IYOA 5EUEA 3B1EA 2GB3A 1M7YA 2D63A 1BQDA 1IUGA 1BT4A 2FNIA 2W7JA 3NU7A 3EI7A 1ZODA 5I92A 3PJ0A 2VGTA 3GBXA 4F5GA 3HDOA 4B9BA 1GC3A 4ATQA 2QMAA 2VGVA 3A8UX 1SPAA 3NNKA 5M4BA 2VMNA 1S06A 1EG5A 2D5YA 4DGTA 4ADBA 2X5DA 1C9CA 1GC2A 1IAXA 2R5CB 2YHKA 4MQRA 1KMKA 2C44A 2Z1YA 3FCRA 2AY9A 5M46A 4TN4A 4CXRA 3NUIA 2FM1A 1M0NA 3D6KA 4F5KA 4N0WA 3EUCA 2D61A 1C0NA 5EIGA 2GQNA 1ASDA 1GC0A 2VMXA 3QM2A 5G2PA 1BJNA 3AEMA 3L8AA 3QHXA 1LK9A 5DJ1A 3UAKA 1QJ3A 4ITXA 2VMVA 4CBRA 1ASNA 4ZWVA 1C4KA 4ZDOA 4UHOA 3BV0A 3R9AA 4WD2A 1LW5A 1BKGA 4ISYA 1D2FA 1AY5A 1CZCA 4GDYA 2CH2A 4A0FA 2VMZA 1JG8A 2E7IA 4W8IA 1M0PA 2AY1A 2FQ6A 2O7CA 2BI5A 3PA9A 3USFA 1G4VA 2BHXA 3ASBA 4U1TA 3VAXA 2HUIA 3EI5A 2BYJA 4MQPA 1S07A 1GC4A 2W7FA 5JAYA 4H51A 3AV7A 4J5UA 2VMRA 5BJ3A 2YKXA 4ITGA 1WYUB 4CVQA 4LNMA 1AKBA 1AHEA 2GMUA 1DJ9A 1B5PA 1SZUA 1J04A 2VI8A 1M0OA 1SZSA 2VMUA 4GE4A 4JEVA 4JF1A 3OKSA 2FN6A 2OGEA 4PFNA 4UOYA 5D5SA 2HUUA 2EGYA 3GZDC 3RQ1A 5F9SA 1CL2A 3F9TA 2JJHA 4BA5A 4A6UA 4AZJA 1YIZA 2BIEA 2W7HA 1QITA 2AY3A 1AY8A 5F8VA 1FG3A 3NU8A 4F5HA 4OCAA 3VK4A 3WGBA 3DR4A 1CZEA 3BC8A 1G7WA 3KKIA 5HXXA 4WB0B 1MLZA 2EPJA 5AX8A 3F0HA 3E2ZB 1BJWA 4UQVA 3WGCA 2Z9VA 3KE3A 1ASEA 2ZY5A 4XEWA 3WLXA 1VP4A 1TARA 1ARHA 1CQ6A 1KKPA 2ORDA 2VIAA 3AEPA 4Y0HA 4WLHA 1IJIA 2AY8A 3BWOA 3EI8A 3I5TA 4IXZA 1WYTB 4A0HA 1RVYA 2WK8A 2XH1A 1DTYA 1ASGA 3DU4A 3EZ1A 4QGRA 4R5FA 1ARIA 3P6KA 1CS1A 4K2MA 3QGUA 4OC9A 1X0MA 2R0TA 3QPGA 2YKYA 3LVLB 3LVJA 1ELQA 3DODA 2VMWA 4WYEA 1M4NA 3HMUA 3B1DA 2ZP7A 3GJUA 4CXQA 1AAMA 2BIAA 1GEYA 4ZDLA 5EAAA 3ISLA 2CFBA 3PDBB 1TOJA 4GSAA 4LC3A 4AH3A 1QJ5A 3FVSA 4XAUA 1JF9A 1E5EA 5DX5A 3FTBA 3FFHA 4JEYA 4RAEA 2W8WA 4ZDPA 2W7KA 2ZSLA 4F4EA 4A72A 1G4XA 3ZRRA 2PO3A 1DJUA 1S0AA 1BJOA 1TOEA 1AMSA 1UU1A 2D65A 3FQ8A 4GEBA 3FKDA 3I4JA 2WK9A 2YKUA 2CY8A 2AY6A 1V2FA 1AHFA 1AAWA 1RV3A 3IHJA 1AIBA 3GZDA 2HP1A 3OP7A 3TCMA 3VK2A 2VMOA 2VMSA 4ZWMA 2DKBA 2EZ2A 1FG7A 1VJOA 2VYCA 3EI9A 4FL0A 3VK3A 2YOBA 3MEBA 2VGUA 5FT5A 2V0YA 1ORDA 2YCTA 1AHYA 2V1PA 3LVMA 4RJYA 1ASLA 1TOGA 2WK7A 2O0RA 4HF8A 4RKDA 1X29A 3TATA 4A00A 5BJ4A 2HZPA 1BJOB 3GSBA 3GETA 4I8AA 4F5FA 4LW2A 1WSTA 3WKRA 4K2BA 3MC6C 1WYVA 1V2EA 4IYOB 2Z9UA 4DBCA 1H1CA 2W8JA 4F5LA 3WZFA 3MAFA 3LV2A 4WLJA 3K40A 4KAMA 3CAIA 3JWAA 1QIRA 3FQ7A 3R4TA 3DC1A 4WYGA 1N2TA 3DXWA 1SF2A 4W1WA 3UWCA 4E3RA 2CJDA 3LWSA 1PFFA 1QISA 3G8MA 5DJ9A 3PPLA 4Q6RA 5E3KA 1SVVA 2D7ZA 4ATPA 1OHVA 1MGVA 3CQ4A 1SZKA 1O61A 1AMAA 3RI6A 1X2AA 3BCXA 1ASFA 3H7FA 3DR7A 2ZC0A 1AKCA 2AY5A 5EQCA 3PIUA 3NYSA 1KMJA 2VGZA 1MAQA 2JJGA 3E6GA 1AKAA 1BW0A 4R2NA 4WYDA 5EAVA 5M49A 4F5JA 5EIGB 3FDDA 4BMKA 2BWOA 4TMRA 3NX3A 4PVFA 4M2JA 1BS0A 2CINA 1YJZA 3BWNC 1G7XA 2DR1A 1GCKA 3EZSA 4M2MA 2VMYA 2ZYJA 2X8UA 1RVUA 4KXKA 2JJEA 1W7NA 2Z9XA 4A0RA 4AOAA 3FSLA 3QI6A 2E54A 3DRDA 4ZM3A 1WKGA 4WBTA 1AHXA 1Y4IA 2C0RA 4LW4A 2VGWA 3RUYA 2BI1A 4WXBA 7AATA 4L0OA 3JTXA 3ZRPA 1MDXA 4FFCA 4ZM4A 1TOKA 4JF0A 4XJOA 1O69A 3RBLA 3ZRQA 3RCHA 4E3QA 3B1CA 1IVRA 3FVXA 1DKAA 3BN1A 1I43A 1YJYA 5FT8A 2W7LA 3N0LA 1GDEA 1YIYA 4WP0A 4ZSYA 3NYTA 1W3UA 4XK1A 3AATA 3BB8A 2R5EA 3E77A 3MC6A 3PD6A 2CJGA 1OXPA 2BWNA 2HUFA 4EB7A 1D7VA 2VMPA 2W7GA 3ASAA 2QA3A 4MKKA 4ADEA 1TPLA 1S09A 3FQAA 1AJRA 1LW4A 4WYAA 5FT6A 5TF5A 3RCHB 3PAAA 4WYFA 3AELA 1PG8A 2JJFA 2BIGA 2ZJGA 1DGEA 2Q7WA 2VMQA 3LY1A 3CQ6A 3MADA 1ARGA 1UU0A 2W8UA 1X28A 1AHGA 3A9XA 1CQ8A 2PB2A 1UU2A 5G2QA
chains in the Genus database with same CATH superfamily
2JGTA 3QN6A 3NDNA 5K8BA 3MGPA 3TQXA 3R45A 3AYWD 1JS6A 3WKSA 4EFFA 3AYWB 3A1IA 5GSUC 3AENA 4ZLVA 1KX3C 2CTZA 3HQTA 5DB5A 4ADCA 5CPID 2BYLA 1P3FA 3UT9D 1M18C 4ZAHA 5AV5D 3NUBA 1GBNA 5CPIB 3UT9B 4X23D 5G4JA 5AV5B 5DNNC 1D7RA 4X23B 5HHYA 3GR9A 1P3WA 3I16A 1GEXA 1QZ9A 5B2ID 1BH9A 3A1KA 2YRIA 3NTJA 5B2IB 1DGDA 1BFMA 1VEFA 2FJ7D 3MBBA 4J8XC 3B6FC 3N4RA 4Q76A 2FJ7B 2G5HC 4W5KA 1KL1A 3BS8A 5E5IA 3N75A 4PFFA 4G91C 1AOID 2FNUA 5IWQA 1AOIB 2YFVB 1WYUA 3RELD 4MKJA 2W8SA 1ZOBA 4O6ZA 2CJHA 2W7EA 5GT3D 2OGAA 3RELB 4B98A 3KWQA 3PGYA 1P3OA 4OTLA 2EH6A 3B46A 5GT3B 1UKJA 1W23A 4LNLA 4J8WD 3M5UA 3E2ZA 5JRGC 4J8WB 3LELD 2F8JA 3AEOA 2W7IA 2EZ1A 3LELB 5FT4A 1N31A 1TAFB 2D66A 5BO0B 3HL2A 2RIQA 2HP2A 5BT1D 2BI3A 3PD6B 1O4SA 3AZMA 3WAAA 3B8XA 1W7MA 1I29A 3EI6A 3PDBA 2ZUKA 2X5FA 4WXFA 1Z7DA 3AFAA 4KGCD 2EO5A 1V2DA 3ZZKA 4KGCB 4R8PA 1ID3A 3MGPD 5EUNA 4UHNA 2F2AC 2CWEA 1IAYA 2AY2A 3MGPB 4JEWA 3WX9A 4HGAC 3P5JB 3W99C 4Z5TC 3JW9A 2Y2GA 5BS7C 2ZY4A 3AENB 3VH5T 1C7GA 5D95A 4Z66A 3WTPA 5DNMA 1ECXA 4A0GA 4AO4A 4G92B 1P3FD 1OXOA 1MDOA 2Z9WA 1KX4A 1P3FB 4IYOA 2Y2OA 2W7JA 3NU7A 5GT0A 1ZLAC 2VQRA 3GBXA 1PMOA 4F5GA 3HDOA 4WU9C 5M4BA 1S06A 1EG5A 2D5YA 1GC2A 2Z1YA 3FCRA 3N4SA 4TN4A 3G0TA 1M0NA 1BH9B 4LD9A 2Y2QA 1GC0A 2OKJA 3AYWC 3QHXA 4ZWVA 1C4KA 1P3MA 3BV0A 4XUJD 1CZCA 2AY1A 4XUJB 2BI5A 3USFA 5CPIC 3UT9C 3VAXA 2HUIA 3EI5A 5AV5C 1S07A 5JAYA 3AV7A 2VMRA 4X23C 1S32A 1WYUB 2GMUA 2VMUA 4PFNA 3KWQD 2FN6A 1P3OD 5D5SA 5F9SA 1CL2A 3F9TA 2AROA 3UTBD 3KUYA 3KWQB 1YIZA 1P3OB 2AY3A 1AY8A 5F8VA 3UTBB 3WGBA 1CZEA 1G7WA 5HXXA 1P3PA 4J8XA 3REKA 3F0HA 3E2ZB 4UQVA 3REIA 3HBXA 3WLXA 2BYMB 2VIAA 1CQ6A 2AY8A 4IXZA 1RVYA 2WB6A 3DU4A 3EZ1A 3MVDC 3AZMD 3WAAD 1AOIC 3QGUA 1X0MA 3LVJA 3AZMB 3B1DA 3WAAB 4ZDLA 3AFAD 3PDBB 1A7WA 3LZ0A 2Y2HA 4GSAA 3RELC 3AFAB 4R8PD 5GT3C 1ID3D 3FTBA 4JEYA 2W8WA 4F4EA 1DJUA 4R8PB 1ID3B 1S0AA 1BJOA 1AMSA 2D65A 1TZYA 3FKDA 2PYOA 5JRGA 4J8WC 1V2FA 3N4XA 1AAWA 2UWXA 3LELC 4Z66D 3WTPD 5DNMD 2Y2JA 2YCTA 1ORDA 4M6BA 4Z66B 3WTPB 5DNMB 1KX4D 2DGMA 3GSBA 3W96A 1WSTA 3WKRA 4K2BA 2FFFB 1KX4B 3KXBA 1WYVA 2DGLA 5GT0D 4IYOB 2Z9UA 4DBCA 3WZFA 3V9RA 3LV2A 5BT1C 3CAIA 5GT0B 4W1WA 4E3RA 1QISA 3G8MA 5DJ9A 3PPLA 3AZHA 4Q6RA 2D7ZA 1MGVA 1O61A 4KUDA 3BCXA 4KGCC 5EQCA 1KMJA 4LD9D 2JJGA 4R2NA 5M49A 4F5JA 5B1LA 4LD9B 1P3KD 4BMKA 1KX5C 1P3MD 1BS0A 4M2MA 1G7XA 1P3KB 2VMYA 5BNXA 2X8UA 4KXKA 4G92C 2JJEA 1BH8A 1P3MB 4AOAA 3C1BD 1P3FC 3X1TA 4WXBA 5B31D 3C1BB 3X1UA 1S32D 1IVRA 5B31B 1I43A 2F8NG 1S32B 3AATA 2AROD 3KUYD 2BWNA 1D7VA 2AROB 3KUYB 3FQAA 4WV4B 4WYAA 1P3PD 4WYFA 3REKD 2HIOA 3MADA 3REID 1P3PB 3MNNA 3EPKA 2PB2A 3REKB 3REIB 3VH6W 4MY5A 2AY4A 4GRXA 2Z61A 3W1JA 1Q9CA 1B6WA 4XUJC 5CPIA 4NOGA 2JCHA 1LKCA 1ASBA 1LC5A 1AJSA 1WKHA 4ADDA 3UTAA 3LZ0D 2F8NK 3LZ0B 4R5ZA 3H0RC 3NYUA 5B2JA 1P3OC 1TZYD 4GE7A 3UTBC 2PYOD 2VGSA 1CQ7A 4H9PA 5B0YA 1TZYB 2W7MA 2PYOB 4WU8A 3ATHA 4IW7A 1AMRA 4H9QA 3W96D 2GMSA 2HUEB 3MVDA 3KXBD 2OQXA 3W96B 2G6WA 1Z3ZA 3X1SA 3KXBB 1WYVB 3AZMC 3WAAC 1P3GC 3V9RB 2W8TA 3H0LC 3AZHD 3TFUA 3WY7A 4OMAA 3AFAC 4KUDD 4XJLA 3AZHB 1OHWA 2DKJA 3VH6A 4KUDB 1KKJA 4ZBJB 4R8PC 1ID3C 1MLYA 3WCOA 5C6UA 5EFSA 5B1LD 4HGAB 3FD0A 1TATA 3AEJA 3UE8A 3GWPA 2CANA 3LELA 2VLFA 3FZ6A 4W91A 1GD9A 5B1LB 3E2YA 5B1MA 4Q31A 3DXVA 4Z66C 3WTPC 5DNMC 5BO0A 3EPHA 1B5OA 1IX6A 1BH8B 3X1TD 3MGRA 2JG2A 1HTAA 1KX4C 3FFRA 4RIZA 3X1UD 4MQQA 3X1TB 3P1TA 5E4ZA 3II0A 3X1VC 2BKWA 2WKAA 4R8DA 1BQAA 3NQUA 3X1UB 1WYTA 5FUGB 4XJPA 5EUDA 1IX7A 1B8GA 2L5AA 5G09A 1ELUA 2O1BA 1B4XA 1B9IA 2CH1A 1AIAA 4J8UA 2HIOD 4JEXA 5G4IA 4EMYA 4YM6C 1M6SA 4LD9C 3MNND 1KX5A 2HIOB 2TPLA 2D7YA 3G7QA 3MNNB 3LZ1A 1P3KC 4P3MA 1AICA 4Z2MG 4EB5A 1P3MC 2Y2PA 5B33A 4XQ2A 4H9RA 2NMPA 3C1BC 3COGA 4E45A 2HOXA 4MSOA 3UTAD 3AOWA 5B31C 1AJSB 5JA4A 1S32C 3UTAB 2LY8A 3KGXA 3EIAA 5B2JD 1BQDA 2AROC 3KUYC 3FZ8A 5B2JB 1ZODA 5B0YD 2VGTA 4WU8D 1GC3A 3NNKA 4H9PB 5B0YB 1P3PC 4ADBA 3REKC 4WU8B 1KMKA 3REIC 1PMMA 2AY9A 4CXRA 3NUIA 2XD1A 4N0WA 1P3AD 3MVDD 4XUJA 4H9QB 3REHA 3B0DC 2VMXA 3QM2A 1P3AB 3MVDB 3X1SD 3AEMA 4OBUA 1LK9A 2VMVA 4CBRA 3X1SB 4WD2A 1LW5A 1D2FA 3LZ0C 1JG8A 2E7IA 4W8IA 2G5IC 2BHXA 3ASBA 4U1TA 3UTBA 2BYJA 4H51A 4ITGA 4LNMA 1AKBA 1DJ9A 1B5PA 1TZYC 1SZUA 1J04A 2VI8A 2PYOC 1M0OA 1F66A 2HUUA 2F8NA 2EGYA 2BYMA 3RQ1A 3MGSA 4BA5A 5B1MD 4A6UA 4DQYB 5B1MB 3MGRD 3NU8A 4OCAA 3BC8A 2HUEC 3KKIA 4J8LA 1MLZA 5AX8A 3W96C 3MGRB 1BJWA 3KXBC 1P3GA 4XEWA 3B0CW 1TARA 1ARHA 1KKPA 2ORDA 4WLHA 3B0BA 3NQUB 1WYTB 2WK8A 1DTYA 4R5FA 1ARIA 3AZHC 4K2MA 3QPGA 4KUDC 1ELQA 4J8UD 4ZBJC 1M4NA 4CXQA 1AAMA 3REJA 2BIAA 1GEYA 3W98A 4J8UB 1KX5D 2NZDD 1TOJA 4AH3A 1QJ5A 3FVSA 5B1LC 3LZ1D 1KX5B 2NZDB 3VH6T 1JF9A 1E5EA 3LZ1B 4A72A 1G4XA 5G49A 3FQ8A 5B33D 2WK9A 2CY8A 2AY6A 5B33B 3X1TC 2HP1A 3X1VA 4H9RB 4ZWMA 2EZ2A 5CPKB 1FG7A 3EI9A 3X1UC 2KFPA 1AHYA 2AEUA 3LJAA 2WK7A 2O0RA 5JA4B 3TATA 4A00A 5BJ4A 2HZPA 4F5FA 3GETA 1H1CA 3JWAA 3R4TA 3DC1A 4YM6A 1N2TA 1SF2A 1P3LA 2HIOC 5C3IB 1P3KA 1OHVA 3MNNC 3RI6A 1M19A 3DR7A 1AKCA 1MAQA 3E6GA 3REHD 4WYDA 1WWIA 4NE5A 3WKJA 3JZLA 3NQJA 3WA9C 3C1BA 3REHB 3NX3A 5B31A 3N7NA 1YJZA 2ZYJA 3AZJA 3UTAC 2Z9XA 3FSLA 2E54A 3DRDA 4ZM3A 1WKGA 4WBTA 1Y4IA 2C0RA 2VGWA 4QLCA 5B2JC 1DKAA 3BN1A 1YJYA 1F66D 5B0YC 4ZSYA 2F8ND 5E5AD 3MGSD 4WU8C 2NQBA 3E77A 3MC6A 2CJGA 1F66B 2VMPA 2F8NB 3EPJA 5E5AB 2QA3A 3MGSB 4ADEA 1AJRA 4YS3D 5TF5A 3AELA 1P3AC 2Q7WA 4YS3B 1ARGA 1P3GD 2W8UA 1X28A 1CQ8A 3DZZA 1ASAA 3X1SC 1XEYA 1P3GB 4F5MA 3MKJA 4HVKA 1MAPA 2FYFA 1U35A 2JSSA 5KDMA 3H9XA 5AVCA 3W97A 1JS3A 4RLGA 4K2IA 2VI9A 5B40A 3REJD 2ZY2A 3QBOA 3W98D 2ZY3A 1H0CA 4GE9A 4Y0DA 3REJB 1B9HA 3W98B 1Z2CB 3ELEA 2YCPA 1D7UA 3AEJC 4ZSWA 5B24C 5M4DA 1N8PA 1DJEA 1SFFA 1U08A 1O62A 5B1MC 5G49B 1CL1A 3MGRC 3X1VD 2R5CA 4KYOA 1XI9A 2VMTA 3C1CA 1YJSA 3X1VB 3LJAD 3EIBA 4W1XA 3AZGA 1ARTA 3AZLB 1S08A 5HDMA 4J8VA 1LC7A 2RFVA 3LJAB 1EJIA 3L44A 3ZZJA 4DQ6A 4YM6D 4WJ3C 1BJ4A 2JE5A 4J8UC 1P3LD 1AMQA 4IY7A 3JWBA 4YM6B 2HOYA 2QB3A 2QB2A 1P3LB 2NZDC 3ACZA 3T32A 1M19D 4RKCA 2XBNA 3LZ1C 1AX4A 1C7OA 2QBTA 1M19B 3LVKA 3CQ5A 3WKJD 5AV8D 4BQ0A 1N1JA 1DFOA 2OKKA 2BI2A 2HOZA 2BWPA 5B33C 3WKJB 5AV8B 3A9ZA 1I48A 5B32G 3NQJB 5CPKC 3RBFA 3NRAA 5FUGA 1T3IA 4Y0IA 3AZJD 3BCAA 4Q75A 4BHDA 2Y2KA 3FVUA 4WB0A 3AZJB 4QLCD 2RVQD 5AV9A 5KTBA 4WNNA 4A6RA 3AV1D 4QLCB 3K7YA 2QLRA 3CBFA 3AV1B 1J32A 2BI9A 2NQBD 2AY7A 4F5IA 4RM1A 2Y2NA 3TFTA 5C3IC 2NQBB 1ZC9A 3AOVA 2W8VA 2YRRA 1MDZA 3HT4A 5J8QA 2X3LA 4UUZA 3WA9A 3W1HA 8AATA 2F8NH 3O62A 3B0DB 3REHC 2Y2IA 3B0CT 4M2KA 3AEMC 3N5MA 4P7YA 3Q8NA 2YCNA 2Y2MA 1T3UA 1U35D 3ECDA 1QGNA 5AVCD 3A2BA 1U35B 3W97D 1YAAA 2C81A 2CSTA 5KDMB 3E2FA 5G0AA 4CAYA 4WYCA 5B40D 4PIWA 3WTPE 3MAUA 5AVCB 2Z20A 4RJ0A 4ZASA 3W97B 3AV2D 2VLHA 1YOOA 3A6ND 5B40B 2E7JA 1LC8A 4JJNA 3ELPA 3AV2B 3LG0A 3KSYA 5B0ZA 1V72A 3A6NB 1F1EA 1KL2A 1F66C 1M7YA 5E5AC 3MGSC 1IUGA 2FNIA 4OBVA 3AN2A 5I92A 3PJ0A 4B9BA 1P3AA 4YS3C 3A8UX 1SPAA 2VMNA 1JFIA 4DGTA 3C1CD 1C9CA 4AWLB 2R5CB 2YHKA 4MQRA 2C44A 2ZM5A 3C1CB 3AZGD 2YFWB 3D6KA 4J8VD 2D61A 3AZGB 2IO5B 2GQNA 4J8VB 5G2PA 1BJNA 3UAKA 1QJ3A 4ITXA 1ASNA 4ZDOA 2BYKB 1EQZA 1BKGA 3REJC 3W98C 2VMZA 2O7CA 2FQ6A 5B24A 4MQPA 1AHEA 5AVBD 1N1JB 4GE4A 4JEVA 3OKSA 2OGEA 1B67A 2JJHA 5AVBB 2BIEA 1QITA 3AZLC 3VK4A 3DR4A 3LJAC 5AV9D 1M1AA 3KFUG 4WB0B 5GXQD 2Z9VA 3AZEC 3KE3A 5AV9B 1ASEA 4WNNB 2ZY5A 1VP4A 5GXQB 3AEPA 3BWOA 4A0HA 2XH1A 2NZDA 1P3LC 1ASGA 1KU5A 1CS1A 3AL0C 4OC9A 2YKYA 3IP4C 4KHAA 1M19C 3WA9D 3AZKA 5EAAA 3ISLA 2CFBA 3O62D 4H9SC 3WKJC 3AZFA 4UUZB 5AV8C 3WA9B 5CPKA 3O62B 3FFHA 2DF4C 2W7KA 2ZSLA 3ZRRA 2PO3A 1TOEA 1UU1A 3AZJC 2YKUA 1AHFA 3IHJA 1AIBA 3GZDA 3TCMA 2VMOA 4QLCC 2VMSA 2RVQC 4CAYB 4JJND 1VJOA 2YOBA 3MEBA 5FT5A 3AV1C 5B0ZD 4Z2MH 3LVMA 1TOGA 4JJNB 4NFTA 4HF8A 4RKDA 4I8AA 5B0ZB 4LW2A 2JISA 2NQBC 3MC6C 4F5LA 3AN2D 3MAFA 2AEVA 3K40A 4KAMA 4WLJA 4ZUXA 3FQ7A 3AN2B 3UWCA 2CJDA 1PFFA 5E3KA 4RITA 1JFIB 4ATPA 3CQ4A 1SZKA 1AMAA 1X2AA 1ASFA 4NE6A 2ZC0A 2AY5A 1P3BA 2VGZA 1BW0A 5EAVA 1U35C 3AZNC 3FDDA 4H9NA 5AVCC 2BWOA 3W97C 4PVFA 2EYQA 1EQZD 3EPLA 5B40C 2DR1A 5B32A 1ULYA 1RVUA 3AV2C 1W7NA 1EQZB 3A6NC 1H3OA 5B24D 5AV6A 1AHXA 2BI1A 5E5AA 4L0OA 3JTXA 5B24B 1MDXA 4FFCA 4ZM4A 1TOKA 4XJOA 3RBLA 3ZRQA 4E3QA 3B1CA 3FVXA 1HQ3D 4YS3A 2W7LA 1W3UA 1HQ3B 4AWLC 3BB8A 1OXPA 2XD5A 2W7GA 3C1CC 1S09A 3WCNA 1LW4A 3AZGC 1M1AD 2IO5C 5FT6A 3W1IA 3RCHB 4J8VC 2JJFA 1DGEA 2VMQA 3CQ6A 1M1AB 1AHGA 1UU2A 1PZRA 3TU4C 3VOMA 1RV4A 4CSRB 5F99A 2C7TA 4AZKA 4JEZA 3HLMA 3BWNA 3F6TA 1P34A 3AZKD 3PDXA 2DOUA 3FDBA 3E9KA 4KHAB 1TASA 4E77A 3MGQC 3AZFD 3AZKB 3B6GA 5CPKD 2Y2LA 1LS3A 3A9YA 5CPJA 3R45B 2AATA 3AZFB 1P3IA 5AVBC 5CP6A 2CV5A 2D64A 3AZLA 4XJMA 2E7UA 4IXOA 2OATA 4A6TA 3AZEA 5AY8A 5BNVA 5AV9C 1IX8A 4WZSB 4EO5B 5GXQC 2W7DA 4XZQA 1C7NA 4AO9A 4DRBA 3AZIA 4NE3A 4ZUXD 3KGWA 4E1OA 3MAFB 4WXGA 4ZUXB 4H9SA 5AV8A 1CJ0A 3O62C 1ARSA 5GSUA 9AATA 1KX3A 1P3BD 1E5FA 2VIBA 4EU1A 1AY4A 1TOIA 2Z1ZA 2DQNC 2R2NA 4E44A 2CB1A 1P3BB 1W7LA 3GZCA 1M18A 2DGKA 3DYDA 3FRKA 1FC4A 4UHMA 4H9NB 4IX8A 3H0MC 5B32D 3AV1A 5DNNA 4U2HA 4JJNC 5B32B 5AV6D 5B0ZC 1H3OB 1M0QA 5AV6B 4OYTA 4BA4A 2A1VA 2YKVA 3FZ7A 4CBSA 2ZSMA 3K28A 5B2IC 3AN2C 1M32A 1OHYA 4OT8A 3B6FA 1OATA 2FJ7C 1EQBA 2HORA 1D7SA 3AZNA 3BCBA 4IXSA 1GEWA 1I41A 3AV2A 2GSAA 1IBJA 3A6NA 1EQZC 5F99D 1YNUA 1ASMA 2PB0A 5F99B 1P34D 4UPKA 4W1VA 1P34B 4LNJA 3B6GD 1ASCA 5CPJD 1P3ID 1HQ3C 3B6GB 5CP6D 2CV5D 5EUEA 3B1EA 2YFWA 2GB3A 3AZLD 5CPJB 2D63A 1P3IB 1BT4A 3EI7A 5CP6B 2CV5B 1W2EA 4H9OA 3AZED 2QMAA 5AY8D 2VGVA 4ATQA 1M1AC 2X5DA 1IAXA 3AZEB 3TU4A 5AY8B 5BNVB 5M46A 2BYKA 2FM1A 4XZQD 4F5KA 3EUCA 2FKIA 3AZID 1C0NA 5EIGA 4XZQB 1ASDA 3AZIB 5DJ1A 3L8AA 1R4VA 4UHOA 3MGQA 3R9AA 4ISYA 3AZKC 1AY5A 4GDYA 2CH2A 4A0FA 3MGPC 5GSUD 5AVBA 3AZFC 3W99A 4Z5TA 1M0PA 3PA9A 1KX3D 1G4VA 5BS7A 5GSUB 1GC4A 2W7FA 1KX3B 4J5UA 5BJ3A 2YKXA 4CVQA 1M18D 3VP6A 1SZSA 4JF1A 4UOYA 1M18B 4EO5C 3GZDC 5GXQA 5DNND 4AZJA 2W7HA 1ZLAA 1FG3A 4F5HA 5DNNB 4WU9A 2EPJA 3WGCA 2BG1A 4Y0HA 4ZUXC 1IJIA 3EI8A 3I5TA 4J8XD 3B6FD 1KAFA 4QGRA 3AYWA 3P6KA 4J8XB 3B6FB 2R0TA 3LVLB 3DODA 2VMWA 4WYEA 3HMUA 2ZP7A 3EG5B 3AZND 2G7JA 3GJUA 1P3BC 3VH5W 3AZNB 4LC3A 4G91B 4XAUA 3UT9A 5DX5A 5AV5A 4RAEA 4ZDPA 4X23A 5B32C 3HVYA 4GEBA 3I4JA 5AV6C 1RV3A 3OP7A 3VK2A 2DKBA 3KWQC 2VYCA 4FL0A 3VK3A 5B2IA 2VGUA 2V0YA 2V1PA 4RJYA 5JRGD 1ASLA 1X29A 1BJOB 5JRGB 4DRAA 2FJ7A 1V2EA 2W8JA 1QIRA 4WYGA 3DXWA 4H9OB 3LWSA 3TU4D 1SVVA 1AOIA 2YFVA 3TU4B 3H7FA 4H63Q 3PIUA 3NYSA 1AKAA 2J8PA 3RELA 5EIGB 5F99C 5GT3A 4TMRA 4M2JA 3MGQD 2CINA 3BWNC 3EZSA 1GCKA 1P34C 4A0RA 3MGQB 3VH5A 1HQ3A 3W99D 3QI6A 4Z5TD 4J8WA 3B6GC 2QSRA 5B31G 4K05A 4LW4A 3RUYA 5CHLB 5CPJC 1P3IC 3W99B 4Z5TB 7AATA 3ZRPA 5CP6C 4JF0A 1TAFA 2CV5C 1O69A 3RCHA 5FT8A 3N0LA 5BNXB 1GDEA 1YIYA 4WP0A 3NYTA 4XK1A 2R5EA 5AY8C 3PD6A 2HUFA 4EB7A 1ZLAD 3ASAA 4MKKA 1TPLA 4WU9D 4CSRA 5GT0C 1ZLAB 4XZQC 3PAAA 1WWSA 1PG8A 2ZJGA 4WU9B 2BIGA 3AZIC 3LY1A 1UU0A 3A9XA 4KGCA 5G2QA
chains in the Genus database with same CATH topology
2JGTA 3QN6A 3NDNA 5K8BA 3MGPA 3TQXA 3R45A 3AYWD 1JS6A 3WKSA 4EFFA 3AYWB 3A1IA 5GSUC 3AENA 4ZLVA 1KX3C 2CTZA 3HQTA 5DB5A 4ADCA 5CPID 2BYLA 1P3FA 3UT9D 1M18C 4ZAHA 5AV5D 3NUBA 1GBNA 5CPIB 3UT9B 4X23D 5G4JA 5AV5B 5DNNC 1D7RA 4X23B 5HHYA 3GR9A 1P3WA 3I16A 1GEXA 1QZ9A 5B2ID 1BH9A 3A1KA 2YRIA 3NTJA 5B2IB 1DGDA 1BFMA 1VEFA 2FJ7D 3MBBA 4J8XC 3B6FC 3N4RA 4Q76A 2FJ7B 2G5HC 4W5KA 1KL1A 3BS8A 5E5IA 3N75A 4PFFA 4G91C 1AOID 2FNUA 5IWQA 1AOIB 2YFVB 1WYUA 3RELD 4MKJA 2W8SA 1ZOBA 4O6ZA 2CJHA 2W7EA 5GT3D 2OGAA 3RELB 4B98A 3KWQA 3PGYA 1P3OA 4OTLA 2EH6A 3B46A 5GT3B 1UKJA 1W23A 4LNLA 4J8WD 3M5UA 3E2ZA 5JRGC 4J8WB 3LELD 2F8JA 3AEOA 2W7IA 2EZ1A 3LELB 5FT4A 1N31A 1TAFB 2D66A 5BO0B 3HL2A 2RIQA 2HP2A 5BT1D 2BI3A 3PD6B 1O4SA 3AZMA 3WAAA 3B8XA 1W7MA 1I29A 3EI6A 3PDBA 2ZUKA 2X5FA 4WXFA 1Z7DA 3AFAA 4KGCD 2EO5A 1V2DA 3ZZKA 4KGCB 4R8PA 1ID3A 3MGPD 5EUNA 4UHNA 2F2AC 2CWEA 1IAYA 2AY2A 3MGPB 4JEWA 3WX9A 4HGAC 3P5JB 3W99C 4Z5TC 3JW9A 2Y2GA 5BS7C 2ZY4A 3AENB 3VH5T 1C7GA 5D95A 4Z66A 3WTPA 5DNMA 1ECXA 4A0GA 4AO4A 4G92B 1P3FD 1OXOA 1MDOA 2Z9WA 1KX4A 1P3FB 4IYOA 2Y2OA 2W7JA 3NU7A 5GT0A 1ZLAC 2VQRA 3GBXA 1PMOA 4F5GA 3HDOA 4WU9C 5M4BA 1S06A 1EG5A 2D5YA 1GC2A 2Z1YA 3FCRA 3N4SA 4TN4A 3G0TA 1M0NA 1BH9B 4LD9A 2Y2QA 1GC0A 2OKJA 3AYWC 3QHXA 4ZWVA 1C4KA 1P3MA 3BV0A 4XUJD 1CZCA 2AY1A 4XUJB 2BI5A 3USFA 5CPIC 3UT9C 3VAXA 2HUIA 3EI5A 5AV5C 1S07A 5JAYA 3AV7A 2VMRA 4X23C 1S32A 1WYUB 2GMUA 2VMUA 4PFNA 3KWQD 2FN6A 1P3OD 5D5SA 5F9SA 1CL2A 3F9TA 2AROA 3UTBD 3KUYA 3KWQB 1YIZA 1P3OB 2AY3A 1AY8A 5F8VA 3UTBB 3WGBA 1CZEA 1G7WA 5HXXA 1P3PA 4J8XA 3REKA 3F0HA 3E2ZB 4UQVA 3REIA 3HBXA 3WLXA 2BYMB 2VIAA 1CQ6A 2AY8A 4IXZA 1RVYA 2WB6A 3DU4A 3EZ1A 3MVDC 3AZMD 3WAAD 1AOIC 3QGUA 1X0MA 3LVJA 3AZMB 3B1DA 3WAAB 4ZDLA 3AFAD 3PDBB 1A7WA 3LZ0A 2Y2HA 4GSAA 3RELC 3AFAB 4R8PD 5GT3C 1ID3D 3FTBA 4JEYA 2W8WA 4F4EA 1DJUA 4R8PB 1ID3B 1S0AA 1BJOA 1AMSA 2D65A 1TZYA 3FKDA 2PYOA 5JRGA 4J8WC 1V2FA 3N4XA 1AAWA 2UWXA 3LELC 4Z66D 3WTPD 5DNMD 2Y2JA 2YCTA 1ORDA 4M6BA 4Z66B 3WTPB 5DNMB 1KX4D 2DGMA 3GSBA 3W96A 1WSTA 3WKRA 4K2BA 2FFFB 1KX4B 3KXBA 1WYVA 2DGLA 5GT0D 4IYOB 2Z9UA 4DBCA 3WZFA 3V9RA 3LV2A 5BT1C 3CAIA 5GT0B 4W1WA 4E3RA 1QISA 3G8MA 5DJ9A 3PPLA 3AZHA 4Q6RA 2D7ZA 1MGVA 1O61A 4KUDA 3BCXA 4KGCC 5EQCA 1KMJA 4LD9D 2JJGA 4R2NA 5M49A 4F5JA 5B1LA 4LD9B 1P3KD 4BMKA 1KX5C 1P3MD 1BS0A 4M2MA 1G7XA 1P3KB 2VMYA 5BNXA 2X8UA 4KXKA 4G92C 2JJEA 1BH8A 1P3MB 4AOAA 3C1BD 1P3FC 3X1TA 4WXBA 5B31D 3C1BB 3X1UA 1S32D 1IVRA 5B31B 1I43A 2F8NG 1S32B 3AATA 2AROD 3KUYD 2BWNA 1D7VA 2AROB 3KUYB 3FQAA 4WV4B 4WYAA 1P3PD 4WYFA 3REKD 2HIOA 3MADA 3REID 1P3PB 3MNNA 3EPKA 2PB2A 3REKB 3REIB 3VH6W 4MY5A 2AY4A 4GRXA 2Z61A 3W1JA 1Q9CA 1B6WA 4XUJC 5CPIA 4NOGA 2JCHA 1LKCA 1ASBA 1LC5A 1AJSA 1WKHA 4ADDA 3UTAA 3LZ0D 2F8NK 3LZ0B 4R5ZA 3H0RC 3NYUA 5B2JA 1P3OC 1TZYD 4GE7A 3UTBC 2PYOD 2VGSA 1CQ7A 4H9PA 5B0YA 1TZYB 2W7MA 2PYOB 4WU8A 3ATHA 4IW7A 1AMRA 4H9QA 3W96D 2GMSA 2HUEB 3MVDA 3KXBD 2OQXA 3W96B 2G6WA 1Z3ZA 3X1SA 3KXBB 1WYVB 3AZMC 3WAAC 1P3GC 3V9RB 2W8TA 3H0LC 3AZHD 3TFUA 3WY7A 4OMAA 3AFAC 4KUDD 4XJLA 3AZHB 1OHWA 2DKJA 3VH6A 4KUDB 1KKJA 4ZBJB 4R8PC 1ID3C 1MLYA 3WCOA 5C6UA 5EFSA 5B1LD 4HGAB 3FD0A 1TATA 3AEJA 3UE8A 3GWPA 2CANA 3LELA 2VLFA 3FZ6A 4W91A 1GD9A 5B1LB 3E2YA 5B1MA 4Q31A 3DXVA 4Z66C 3WTPC 5DNMC 5BO0A 3EPHA 1B5OA 1IX6A 1BH8B 3X1TD 3MGRA 2JG2A 1HTAA 1KX4C 3FFRA 4RIZA 3X1UD 4MQQA 3X1TB 3P1TA 5E4ZA 3II0A 3X1VC 2BKWA 2WKAA 4R8DA 1BQAA 3NQUA 3X1UB 1WYTA 5FUGB 4XJPA 5EUDA 1IX7A 1B8GA 2L5AA 5G09A 1ELUA 2O1BA 1B4XA 1B9IA 2CH1A 1AIAA 4J8UA 2HIOD 4JEXA 5G4IA 4EMYA 4YM6C 1M6SA 4LD9C 3MNND 1KX5A 2HIOB 2TPLA 2D7YA 3G7QA 3MNNB 3LZ1A 1P3KC 4P3MA 1AICA 4Z2MG 4EB5A 1P3MC 2Y2PA 5B33A 4XQ2A 4H9RA 2NMPA 3C1BC 3COGA 4E45A 2HOXA 4MSOA 3UTAD 3AOWA 5B31C 1AJSB 5JA4A 1S32C 3UTAB 2LY8A 3KGXA 3EIAA 5B2JD 1BQDA 2AROC 3KUYC 3FZ8A 5B2JB 1ZODA 5B0YD 2VGTA 4WU8D 1GC3A 3NNKA 4H9PB 5B0YB 1P3PC 4ADBA 3REKC 4WU8B 1KMKA 3REIC 1PMMA 2AY9A 4CXRA 3NUIA 2XD1A 4N0WA 1P3AD 3MVDD 4XUJA 4H9QB 3REHA 3B0DC 2VMXA 3QM2A 1P3AB 3MVDB 3X1SD 3AEMA 4OBUA 1LK9A 2VMVA 4CBRA 3X1SB 4WD2A 1LW5A 1D2FA 3LZ0C 1JG8A 2E7IA 4W8IA 2G5IC 2BHXA 3ASBA 4U1TA 3UTBA 2BYJA 4H51A 4ITGA 4LNMA 1AKBA 1DJ9A 1B5PA 1TZYC 1SZUA 1J04A 2VI8A 2PYOC 1M0OA 1F66A 2HUUA 2F8NA 2EGYA 2BYMA 3RQ1A 3MGSA 4BA5A 5B1MD 4A6UA 4DQYB 5B1MB 3MGRD 3NU8A 4OCAA 3BC8A 2HUEC 3KKIA 4J8LA 1MLZA 5AX8A 3W96C 3MGRB 1BJWA 3KXBC 1P3GA 4XEWA 3B0CW 1TARA 1ARHA 1KKPA 2ORDA 4WLHA 3B0BA 3NQUB 1WYTB 2WK8A 1DTYA 4R5FA 1ARIA 3AZHC 4K2MA 3QPGA 4KUDC 1ELQA 4J8UD 4ZBJC 1M4NA 4CXQA 1AAMA 3REJA 2BIAA 1GEYA 3W98A 4J8UB 1KX5D 2NZDD 1TOJA 4AH3A 1QJ5A 3FVSA 5B1LC 3LZ1D 1KX5B 2NZDB 3VH6T 1JF9A 1E5EA 3LZ1B 4A72A 1G4XA 5G49A 3FQ8A 5B33D 2WK9A 2CY8A 2AY6A 5B33B 3X1TC 2HP1A 3X1VA 4H9RB 4ZWMA 2EZ2A 5CPKB 1FG7A 3EI9A 3X1UC 2KFPA 1AHYA 2AEUA 3LJAA 2WK7A 2O0RA 5JA4B 3TATA 4A00A 5BJ4A 2HZPA 4F5FA 3GETA 1H1CA 3JWAA 3R4TA 3DC1A 4YM6A 1N2TA 1SF2A 1P3LA 2HIOC 5C3IB 1P3KA 1OHVA 3MNNC 3RI6A 1M19A 3DR7A 1AKCA 1MAQA 3E6GA 3REHD 4WYDA 1WWIA 4NE5A 3WKJA 3JZLA 3NQJA 3WA9C 3C1BA 3REHB 3NX3A 5B31A 3N7NA 1YJZA 2ZYJA 3AZJA 3UTAC 2Z9XA 3FSLA 2E54A 3DRDA 4ZM3A 1WKGA 4WBTA 1Y4IA 2C0RA 2VGWA 4QLCA 5B2JC 1DKAA 3BN1A 1YJYA 1F66D 5B0YC 4ZSYA 2F8ND 5E5AD 3MGSD 4WU8C 2NQBA 3E77A 3MC6A 2CJGA 1F66B 2VMPA 2F8NB 3EPJA 5E5AB 2QA3A 3MGSB 4ADEA 1AJRA 4YS3D 5TF5A 3AELA 1P3AC 2Q7WA 4YS3B 1ARGA 1P3GD 2W8UA 1X28A 1CQ8A 3DZZA 1ASAA 3X1SC 1XEYA 1P3GB 4F5MA 3MKJA 4HVKA 1MAPA 2FYFA 1U35A 2JSSA 5KDMA 3H9XA 5AVCA 3W97A 1JS3A 4RLGA 4K2IA 2VI9A 5B40A 3REJD 2ZY2A 3QBOA 3W98D 2ZY3A 1H0CA 4GE9A 4Y0DA 3REJB 1B9HA 3W98B 1Z2CB 3ELEA 2YCPA 1D7UA 3AEJC 4ZSWA 5B24C 5M4DA 1N8PA 1DJEA 1SFFA 1U08A 1O62A 5B1MC 5G49B 1CL1A 3MGRC 3X1VD 2R5CA 4KYOA 1XI9A 2VMTA 3C1CA 1YJSA 3X1VB 3LJAD 3EIBA 4W1XA 3AZGA 1ARTA 3AZLB 1S08A 5HDMA 4J8VA 1LC7A 2RFVA 3LJAB 1EJIA 3L44A 3ZZJA 4DQ6A 4YM6D 4WJ3C 1BJ4A 2JE5A 4J8UC 1P3LD 1AMQA 4IY7A 3JWBA 4YM6B 2HOYA 2QB3A 2QB2A 1P3LB 2NZDC 3ACZA 3T32A 1M19D 4RKCA 2XBNA 3LZ1C 1AX4A 1C7OA 2QBTA 1M19B 3LVKA 3CQ5A 3WKJD 5AV8D 4BQ0A 1N1JA 1DFOA 2OKKA 2BI2A 2HOZA 2BWPA 5B33C 3WKJB 5AV8B 3A9ZA 1I48A 5B32G 3NQJB 5CPKC 3RBFA 3NRAA 5FUGA 1T3IA 4Y0IA 3AZJD 3BCAA 4Q75A 4BHDA 2Y2KA 3FVUA 4WB0A 3AZJB 4QLCD 2RVQD 5AV9A 5KTBA 4WNNA 4A6RA 3AV1D 4QLCB 3K7YA 2QLRA 3CBFA 3AV1B 1J32A 2BI9A 2NQBD 2AY7A 4F5IA 4RM1A 2Y2NA 3TFTA 5C3IC 2NQBB 1ZC9A 3AOVA 2W8VA 2YRRA 1MDZA 3HT4A 5J8QA 2X3LA 4UUZA 3WA9A 3W1HA 8AATA 2F8NH 3O62A 3B0DB 3REHC 2Y2IA 3B0CT 4M2KA 3AEMC 3N5MA 4P7YA 3Q8NA 2YCNA 2Y2MA 1T3UA 1U35D 3ECDA 1QGNA 5AVCD 3A2BA 1U35B 3W97D 1YAAA 2C81A 2CSTA 5KDMB 3E2FA 5G0AA 4CAYA 4WYCA 5B40D 4PIWA 3WTPE 3MAUA 5AVCB 2Z20A 4RJ0A 4ZASA 3W97B 3AV2D 2VLHA 1YOOA 3A6ND 5B40B 2E7JA 1LC8A 4JJNA 3ELPA 3AV2B 3LG0A 3KSYA 5B0ZA 1V72A 3A6NB 1F1EA 1KL2A 1F66C 1M7YA 5E5AC 3MGSC 1IUGA 2FNIA 4OBVA 3AN2A 5I92A 3PJ0A 4B9BA 1P3AA 4YS3C 3A8UX 1SPAA 2VMNA 1JFIA 4DGTA 3C1CD 1C9CA 4AWLB 2R5CB 2YHKA 4MQRA 2C44A 2ZM5A 3C1CB 3AZGD 2YFWB 3D6KA 4J8VD 2D61A 3AZGB 2IO5B 2GQNA 4J8VB 5G2PA 1BJNA 3UAKA 1QJ3A 4ITXA 1ASNA 4ZDOA 2BYKB 1EQZA 1BKGA 3REJC 3W98C 2VMZA 2O7CA 2FQ6A 5B24A 4MQPA 1AHEA 5AVBD 1N1JB 4GE4A 4JEVA 3OKSA 2OGEA 1B67A 2JJHA 5AVBB 2BIEA 1QITA 3AZLC 3VK4A 3DR4A 3LJAC 5AV9D 1M1AA 3KFUG 4WB0B 5GXQD 2Z9VA 3AZEC 3KE3A 5AV9B 1ASEA 4WNNB 2ZY5A 1VP4A 5GXQB 3AEPA 3BWOA 4A0HA 2XH1A 2NZDA 1P3LC 1ASGA 1KU5A 1CS1A 3AL0C 4OC9A 2YKYA 3IP4C 4KHAA 1M19C 3WA9D 3AZKA 5EAAA 3ISLA 2CFBA 3O62D 4H9SC 3WKJC 3AZFA 4UUZB 5AV8C 3WA9B 5CPKA 3O62B 3FFHA 2DF4C 2W7KA 2ZSLA 3ZRRA 2PO3A 1TOEA 1UU1A 3AZJC 2YKUA 1AHFA 3IHJA 1AIBA 3GZDA 3TCMA 2VMOA 4QLCC 2VMSA 2RVQC 4CAYB 4JJND 1VJOA 2YOBA 3MEBA 5FT5A 3AV1C 5B0ZD 4Z2MH 3LVMA 1TOGA 4JJNB 4NFTA 4HF8A 4RKDA 4I8AA 5B0ZB 4LW2A 2JISA 2NQBC 3MC6C 4F5LA 3AN2D 3MAFA 2AEVA 3K40A 4KAMA 4WLJA 4ZUXA 3FQ7A 3AN2B 3UWCA 2CJDA 1PFFA 5E3KA 4RITA 1JFIB 4ATPA 3CQ4A 1SZKA 1AMAA 1X2AA 1ASFA 4NE6A 2ZC0A 2AY5A 1P3BA 2VGZA 1BW0A 5EAVA 1U35C 3AZNC 3FDDA 4H9NA 5AVCC 2BWOA 3W97C 4PVFA 2EYQA 1EQZD 3EPLA 5B40C 2DR1A 5B32A 1ULYA 1RVUA 3AV2C 1W7NA 1EQZB 3A6NC 1H3OA 5B24D 5AV6A 1AHXA 2BI1A 5E5AA 4L0OA 3JTXA 5B24B 1MDXA 4FFCA 4ZM4A 1TOKA 4XJOA 3RBLA 3ZRQA 4E3QA 3B1CA 3FVXA 1HQ3D 4YS3A 2W7LA 1W3UA 1HQ3B 4AWLC 3BB8A 1OXPA 2XD5A 2W7GA 3C1CC 1S09A 3WCNA 1LW4A 3AZGC 1M1AD 2IO5C 5FT6A 3W1IA 3RCHB 4J8VC 2JJFA 1DGEA 2VMQA 3CQ6A 1M1AB 1AHGA 1UU2A 1PZRA 3TU4C 3VOMA 1RV4A 4CSRB 5F99A 2C7TA 4AZKA 4JEZA 3HLMA 3BWNA 3F6TA 1P34A 3AZKD 3PDXA 2DOUA 3FDBA 3E9KA 4KHAB 1TASA 4E77A 3MGQC 3AZFD 3AZKB 3B6GA 5CPKD 2Y2LA 1LS3A 3A9YA 5CPJA 3R45B 2AATA 3AZFB 1P3IA 5AVBC 5CP6A 2CV5A 2D64A 3AZLA 4XJMA 2E7UA 4IXOA 2OATA 4A6TA 3AZEA 5AY8A 5BNVA 5AV9C 1IX8A 4WZSB 4EO5B 5GXQC 2W7DA 4XZQA 1C7NA 4AO9A 4DRBA 3AZIA 4NE3A 4ZUXD 3KGWA 4E1OA 3MAFB 4WXGA 4ZUXB 4H9SA 5AV8A 1CJ0A 3O62C 1ARSA 5GSUA 9AATA 1KX3A 1P3BD 1E5FA 2VIBA 4EU1A 1AY4A 1TOIA 2Z1ZA 2DQNC 2R2NA 4E44A 2CB1A 1P3BB 1W7LA 3GZCA 1M18A 2DGKA 3DYDA 3FRKA 1FC4A 4UHMA 4H9NB 4IX8A 3H0MC 5B32D 3AV1A 5DNNA 4U2HA 4JJNC 5B32B 5AV6D 5B0ZC 1H3OB 1M0QA 5AV6B 4OYTA 4BA4A 2A1VA 2YKVA 3FZ7A 4CBSA 2ZSMA 3K28A 5B2IC 3AN2C 1M32A 1OHYA 4OT8A 3B6FA 1OATA 2FJ7C 1EQBA 2HORA 1D7SA 3AZNA 3BCBA 4IXSA 1GEWA 1I41A 3AV2A 2GSAA 1IBJA 3A6NA 1EQZC 5F99D 1YNUA 1ASMA 2PB0A 5F99B 1P34D 4UPKA 4W1VA 1P34B 4LNJA 3B6GD 1ASCA 5CPJD 1P3ID 1HQ3C 3B6GB 5CP6D 2CV5D 5EUEA 3B1EA 2YFWA 2GB3A 3AZLD 5CPJB 2D63A 1P3IB 1BT4A 3EI7A 5CP6B 2CV5B 1W2EA 4H9OA 3AZED 2QMAA 5AY8D 2VGVA 4ATQA 1M1AC 2X5DA 1IAXA 3AZEB 3TU4A 5AY8B 5BNVB 5M46A 2BYKA 2FM1A 4XZQD 4F5KA 3EUCA 2FKIA 3AZID 1C0NA 5EIGA 4XZQB 1ASDA 3AZIB 5DJ1A 3L8AA 1R4VA 4UHOA 3MGQA 3R9AA 4ISYA 3AZKC 1AY5A 4GDYA 2CH2A 4A0FA 3MGPC 5GSUD 5AVBA 3AZFC 3W99A 4Z5TA 1M0PA 3PA9A 1KX3D 1G4VA 5BS7A 5GSUB 1GC4A 2W7FA 1KX3B 4J5UA 5BJ3A 2YKXA 4CVQA 1M18D 3VP6A 1SZSA 4JF1A 4UOYA 1M18B 4EO5C 3GZDC 5GXQA 5DNND 4AZJA 2W7HA 1ZLAA 1FG3A 4F5HA 5DNNB 4WU9A 2EPJA 3WGCA 2BG1A 4Y0HA 4ZUXC 1IJIA 3EI8A 3I5TA 4J8XD 3B6FD 4QGRA 3AYWA 3P6KA 4J8XB 3B6FB 2R0TA 3LVLB 3DODA 2VMWA 4WYEA 3HMUA 2ZP7A 3EG5B 3AZND 2G7JA 3GJUA 1P3BC 3VH5W 3AZNB 4LC3A 4G91B 4XAUA 3UT9A 5DX5A 5AV5A 4RAEA 4ZDPA 4X23A 5B32C 3HVYA 4GEBA 3I4JA 5AV6C 1RV3A 3OP7A 3VK2A 2DKBA 3KWQC 2VYCA 4FL0A 3VK3A 5B2IA 2VGUA 2V0YA 2V1PA 4RJYA 5JRGD 1ASLA 1X29A 1BJOB 5JRGB 4DRAA 2FJ7A 1V2EA 2W8JA 1QIRA 4WYGA 3DXWA 4H9OB 3LWSA 3TU4D 1SVVA 1AOIA 2YFVA 3TU4B 3H7FA 4H63Q 3PIUA 3NYSA 1AKAA 2J8PA 3RELA 5EIGB 5F99C 5GT3A 4TMRA 4M2JA 3MGQD 2CINA 3BWNC 3EZSA 1GCKA 1P34C 4A0RA 3MGQB 3VH5A 1HQ3A 3W99D 3QI6A 4Z5TD 4J8WA 3B6GC 2QSRA 5B31G 4K05A 4LW4A 3RUYA 5CHLB 5CPJC 1P3IC 3W99B 4Z5TB 7AATA 3ZRPA 5CP6C 4JF0A 1TAFA 2CV5C 1O69A 3RCHA 5FT8A 3N0LA 5BNXB 1GDEA 1YIYA 4WP0A 3NYTA 4XK1A 2R5EA 5AY8C 3PD6A 2HUFA 4EB7A 1ZLAD 3ASAA 4MKKA 1TPLA 4WU9D 4CSRA 5GT0C 1ZLAB 4XZQC 3PAAA 1WWSA 1PG8A 2ZJGA 4WU9B 2BIGA 3AZIC 3LY1A 1UU0A 3A9XA 4KGCA 5G2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JGT A;  3DZZ A;  1ASA A;  4MY5 A;  2AY4 A;  3QN6 A;  4GRX A;  2Z61 A;  4F5M A;  3NDN A;  3VOM A;  5K8B A;  3MKJ A;  4HVK A;  1MAP A;  2FYF A;  3TQX A;  1RV4 A;  1JS6 A;  2C7T A;  4NOG A;  3WKS A;  4EFF A;  4AZK A;  1LKC A;  4JEZ A;  1JS3 A;  3HLM A;  4K2I A;  1ASB A;  2VI9 A;  3AEN A;  3BWN A;  3F6T A;  4ZLV A;  1LC5 A;  2ZY2 A;  1AJS A;  3PDX A;  2CTZ A;  1WKH A;  2DOU A;  3QBO A;  3FDB A;  4ADD A;  2ZY3 A;  3E9K A;  1TAS A;  3HQT A;  5DB5 A;  4E77 A;  4ADC A;  1H0C A;  4GE9 A;  4Y0D A;  1B9H A;  2BYL A;  4ZAH A;  1LS3 A;  3A9Y A;  2AAT A;  3ELE A;  2YCP A;  1D7U A;  3AEJ C;  4R5Z A;  3NUB A;  1GBN A;  4ZSW A;  3NYU A;  5M4D A;  2D64 A;  5G4J A;  1N8P A;  1DJE A;  1SFF A;  1U08 A;  4GE7 A;  1O62 A;  4XJM A;  2VGS A;  1D7R A;  1CQ7 A;  5HHY A;  2E7U A;  3GR9 A;  4IXO A;  1CL1 A;  2OAT A;  2W7M A;  4A6T A;  2R5C A;  4KYO A;  1P3W A;  1XI9 A;  1IX8 A;  2VMT A;  1GEX A;  3ATH A;  1QZ9 A;  4IW7 A;  1YJS A;  2YRI A;  1AMR A;  2W7D A;  3EIB A;  4W1X A;  3NTJ A;  1ART A;  1DGD A;  1C7N A;  4AO9 A;  1S08 A;  5HDM A;  2GMS A;  1LC7 A;  1VEF A;  2RFV A;  3MBB A;  2OQX A;  1EJI A;  3L44 A;  2G6W A;  1Z3Z A;  4Q76 A;  3ZZJ A;  4DQ6 A;  1WYV B;  4W5K A;  3KGW A;  4E1O A;  1KL1 A;  3BS8 A;  1BJ4 A;  5E5I A;  3MAF B;  4WXG A;  1AMQ A;  3N75 A;  2W8T A;  4IY7 A;  3JWB A;  1CJ0 A;  4PFF A;  3WY7 A;  3TFU A;  2HOY A;  2QB3 A;  4OMA A;  2QB2 A;  1ARS A;  2FNU A;  4XJL A;  3ACZ A;  5IWQ A;  3T32 A;  4RKC A;  9AAT A;  2XBN A;  1OHW A;  2DKJ A;  1E5F A;  1AX4 A;  1C7O A;  1KKJ A;  1WYU A;  2QBT A;  2VIB A;  4EU1 A;  1AY4 A;  1TOI A;  3LVK A;  1MLY A;  2Z1Z A;  2R2N A;  3CQ5 A;  4MKJ A;  4BQ0 A;  2CB1 A;  1DFO A;  5C6U A;  2BI2 A;  5EFS A;  1W7L A;  2HOZ A;  3GZC A;  1ZOB A;  2BWP A;  4O6Z A;  2CJH A;  2W7E A;  3DYD A;  1TAT A;  2OGA A;  3AEJ A;  1I48 A;  3A9Z A;  3UE8 A;  2CAN A;  3FRK A;  1FC4 A;  2VLF A;  4W91 A;  1GD9 A;  4UHM A;  3PGY A;  4OTL A;  4B98 A;  3E2Y A;  3RBF A;  4IX8 A;  2EH6 A;  3B46 A;  3NRA A;  1T3I A;  4Y0I A;  1UKJ A;  1W23 A;  3BCA A;  4LNL A;  4Q31 A;  3DXV A;  4Q75 A;  4BHD A;  4U2H A;  3FVU A;  1B5O A;  4WB0 A;  1IX6 A;  3M5U A;  3E2Z A;  2JG2 A;  2F8J A;  3AEO A;  3FFR A;  1M0Q A;  2W7I A;  4MQQ A;  3P1T A;  5E4Z A;  4OYT A;  4A6R A;  3II0 A;  4BA4 A;  2EZ1 A;  2BKW A;  3K7Y A;  2WKA A;  4R8D A;  5FT4 A;  1BQA A;  1N31 A;  2YKV A;  4CBS A;  1WYT A;  2QLR A;  2ZSM A;  3K28 A;  4XJP A;  3CBF A;  5EUD A;  1IX7 A;  2D66 A;  1M32 A;  1J32 A;  1OHY A;  2BI9 A;  2AY7 A;  1B8G A;  4F5I A;  3TFT A;  3HL2 A;  2HP2 A;  4OT8 A;  5G09 A;  1ELU A;  1OAT A;  2BI3 A;  2O1B A;  3PD6 B;  1B4X A;  1O4S A;  1B9I A;  1ZC9 A;  3AOV A;  2W8V A;  1EQB A;  2YRR A;  1MDZ A;  1W7M A;  2CH1 A;  3B8X A;  2HOR A;  1AIA A;  1D7S A;  1I29 A;  3EI6 A;  3PDB A;  5J8Q A;  2ZUK A;  4JEX A;  2X5F A;  4WXF A;  1Z7D A;  3BCB A;  5G4I A;  4EMY A;  1M6S A;  8AAT A;  4IXS A;  2TPL A;  1GEW A;  2D7Y A;  4M2K A;  3G7Q A;  2EO5 A;  1I41 A;  3AEM C;  3N5M A;  1V2D A;  4P7Y A;  3ZZK A;  3Q8N A;  4P3M A;  2YCN A;  1AIC A;  2GSA A;  4EB5 A;  1IBJ A;  3ECD A;  5EUN A;  1QGN A;  4UHN A;  1IAY A;  1YNU A;  2AY2 A;  4JEW A;  3WX9 A;  3A2B A;  1YAA A;  4XQ2 A;  1ASM A;  2C81 A;  2CST A;  2PB0 A;  2NMP A;  3E2F A;  5G0A A;  3JW9 A;  4WYC A;  4PIW A;  3MAU A;  2Z20 A;  3COG A;  4ZAS A;  2VLH A;  2ZY4 A;  2HOX A;  4MSO A;  3AOW A;  4W1V A;  3AEN B;  1C7G A;  1YOO A;  5D95 A;  2E7J A;  1LC8 A;  1AJS B;  1ECX A;  4LNJ A;  4A0G A;  3ELP A;  4AO4 A;  1ASC A;  1OXO A;  3LG0 A;  1V72 A;  3KGX A;  1MDO A;  3EIA A;  2Z9W A;  1KL2 A;  4IYO A;  5EUE A;  3B1E A;  2GB3 A;  1M7Y A;  2D63 A;  1BQD A;  1IUG A;  1BT4 A;  2FNI A;  2W7J A;  3NU7 A;  3EI7 A;  1ZOD A;  5I92 A;  3PJ0 A;  2VGT A;  3GBX A;  4F5G A;  3HDO A;  4B9B A;  1GC3 A;  4ATQ A;  2QMA A;  2VGV A;  3A8U X;  1SPA A;  3NNK A;  5M4B A;  2VMN A;  1S06 A;  1EG5 A;  2D5Y A;  4DGT A;  4ADB A;  2X5D A;  1C9C A;  1GC2 A;  1IAX A;  2R5C B;  2YHK A;  4MQR A;  1KMK A;  2C44 A;  2Z1Y A;  3FCR A;  2AY9 A;  5M46 A;  4TN4 A;  4CXR A;  3NUI A;  2FM1 A;  1M0N A;  3D6K A;  4F5K A;  4N0W A;  3EUC A;  2D61 A;  1C0N A;  5EIG A;  2GQN A;  1ASD A;  1GC0 A;  2VMX A;  3QM2 A;  5G2P A;  1BJN A;  3AEM A;  3L8A A;  3QHX A;  1LK9 A;  5DJ1 A;  3UAK A;  1QJ3 A;  4ITX A;  2VMV A;  4CBR A;  1ASN A;  4ZWV A;  1C4K A;  4ZDO A;  4UHO A;  3BV0 A;  3R9A A;  4WD2 A;  1LW5 A;  1BKG A;  4ISY A;  1D2F A;  1AY5 A;  1CZC A;  4GDY A;  2CH2 A;  4A0F A;  2VMZ A;  1JG8 A;  2E7I A;  4W8I A;  1M0P A;  2AY1 A;  2FQ6 A;  2O7C A;  2BI5 A;  3PA9 A;  3USF A;  1G4V A;  2BHX A;  3ASB A;  4U1T A;  3VAX A;  2HUI A;  3EI5 A;  2BYJ A;  4MQP A;  1S07 A;  1GC4 A;  2W7F A;  5JAY A;  4H51 A;  3AV7 A;  4J5U A;  2VMR A;  5BJ3 A;  2YKX A;  4ITG A;  1WYU B;  4CVQ A;  4LNM A;  1AKB A;  1AHE A;  2GMU A;  1DJ9 A;  1B5P A;  1SZU A;  1J04 A;  2VI8 A;  1M0O A;  1SZS A;  2VMU A;  4GE4 A;  4JEV A;  4JF1 A;  3OKS A;  2FN6 A;  2OGE A;  4PFN A;  4UOY A;  5D5S A;  2HUU A;  2EGY A;  3GZD C;  3RQ1 A;  5F9S A;  1CL2 A;  3F9T A;  2JJH A;  4BA5 A;  4A6U A;  4AZJ A;  1YIZ A;  2BIE A;  2W7H A;  1QIT A;  2AY3 A;  1AY8 A;  5F8V A;  1FG3 A;  3NU8 A;  4F5H A;  4OCA A;  3VK4 A;  3WGB A;  3DR4 A;  1CZE A;  3BC8 A;  1G7W A;  3KKI A;  5HXX A;  4WB0 B;  1MLZ A;  2EPJ A;  5AX8 A;  3F0H A;  3E2Z B;  1BJW A;  4UQV A;  3WGC A;  2Z9V A;  3KE3 A;  1ASE A;  2ZY5 A;  4XEW A;  3WLX A;  1VP4 A;  1TAR A;  1ARH A;  1CQ6 A;  1KKP A;  2ORD A;  2VIA A;  3AEP A;  4Y0H A;  4WLH A;  1IJI A;  2AY8 A;  3BWO A;  3EI8 A;  3I5T A;  4IXZ A;  1WYT B;  4A0H A;  1RVY A;  2WK8 A;  2XH1 A;  1DTY A;  1ASG A;  3DU4 A;  3EZ1 A;  4QGR A;  4R5F A;  1ARI A;  3P6K A;  1CS1 A;  4K2M A;  3QGU A;  4OC9 A;  1X0M A;  2R0T A;  3QPG A;  2YKY A;  3LVL B;  3LVJ A;  1ELQ A;  3DOD A;  2VMW A;  4WYE A;  1M4N A;  3HMU A;  3B1D A;  2ZP7 A;  3GJU A;  4CXQ A;  1AAM A;  2BIA A;  1GEY A;  4ZDL A;  5EAA A;  3ISL A;  2CFB A;  3PDB B;  1TOJ A;  4GSA A;  4LC3 A;  4AH3 A;  1QJ5 A;  3FVS A;  4XAU A;  1JF9 A;  1E5E A;  5DX5 A;  3FTB A;  3FFH A;  4JEY A;  4RAE A;  2W8W A;  4ZDP A;  2W7K A;  2ZSL A;  4F4E A;  4A72 A;  1G4X A;  3ZRR A;  2PO3 A;  1DJU A;  1S0A A;  1BJO A;  1TOE A;  1AMS A;  1UU1 A;  2D65 A;  3FQ8 A;  4GEB A;  3FKD A;  3I4J A;  2WK9 A;  2YKU A;  2CY8 A;  2AY6 A;  1V2F A;  1AHF A;  1AAW A;  1RV3 A;  3IHJ A;  1AIB A;  3GZD A;  2HP1 A;  3OP7 A;  3TCM A;  3VK2 A;  2VMO A;  2VMS A;  4ZWM A;  2DKB A;  2EZ2 A;  1FG7 A;  1VJO A;  2VYC A;  3EI9 A;  4FL0 A;  3VK3 A;  2YOB A;  3MEB A;  2VGU A;  5FT5 A;  2V0Y A;  1ORD A;  2YCT A;  1AHY A;  2V1P A;  3LVM A;  4RJY A;  1ASL A;  1TOG A;  2WK7 A;  2O0R A;  4HF8 A;  4RKD A;  1X29 A;  3TAT A;  4A00 A;  5BJ4 A;  2HZP A;  1BJO B;  3GSB A;  3GET A;  4I8A A;  4F5F A;  4LW2 A;  1WST A;  3WKR A;  4K2B A;  3MC6 C;  1WYV A;  1V2E A;  4IYO B;  2Z9U A;  4DBC A;  1H1C A;  2W8J A;  4F5L A;  3WZF A;  3MAF A;  3LV2 A;  4WLJ A;  3K40 A;  4KAM A;  3CAI A;  3JWA A;  1QIR A;  3FQ7 A;  3R4T A;  3DC1 A;  4WYG A;  1N2T A;  3DXW A;  1SF2 A;  4W1W A;  3UWC A;  4E3R A;  2CJD A;  3LWS A;  1PFF A;  1QIS A;  3G8M A;  5DJ9 A;  3PPL A;  4Q6R A;  5E3K A;  1SVV A;  2D7Z A;  4ATP A;  1OHV A;  1MGV A;  3CQ4 A;  1SZK A;  1O61 A;  1AMA A;  3RI6 A;  1X2A A;  3BCX A;  1ASF A;  3H7F A;  3DR7 A;  2ZC0 A;  1AKC A;  2AY5 A;  5EQC A;  3PIU A;  3NYS A;  1KMJ A;  2VGZ A;  1MAQ A;  2JJG A;  3E6G A;  1AKA A;  1BW0 A;  4R2N A;  4WYD A;  5EAV A;  5M49 A;  4F5J A;  5EIG B;  3FDD A;  4BMK A;  2BWO A;  4TMR A;  3NX3 A;  4PVF A;  4M2J A;  1BS0 A;  2CIN A;  1YJZ A;  3BWN C;  1G7X A;  2DR1 A;  1GCK A;  3EZS A;  4M2M A;  2VMY A;  2ZYJ A;  2X8U A;  1RVU A;  4KXK A;  2JJE A;  1W7N A;  2Z9X A;  4A0R A;  4AOA A;  3FSL A;  3QI6 A;  2E54 A;  3DRD A;  4ZM3 A;  1WKG A;  4WBT A;  1AHX A;  1Y4I A;  2C0R A;  4LW4 A;  2VGW A;  3RUY A;  2BI1 A;  4WXB A;  7AAT A;  4L0O A;  3JTX A;  3ZRP A;  1MDX A;  4FFC A;  4ZM4 A;  1TOK A;  4JF0 A;  4XJO A;  1O69 A;  3RBL A;  3ZRQ A;  3RCH A;  4E3Q A;  3B1C A;  1IVR A;  3FVX A;  1DKA A;  3BN1 A;  1I43 A;  1YJY A;  5FT8 A;  2W7L A;  3N0L A;  1GDE A;  1YIY A;  4WP0 A;  4ZSY A;  3NYT A;  1W3U A;  4XK1 A;  3AAT A;  3BB8 A;  2R5E A;  3E77 A;  3MC6 A;  3PD6 A;  2CJG A;  1OXP A;  2BWN A;  2HUF A;  4EB7 A;  1D7V A;  2VMP A;  2W7G A;  3ASA A;  2QA3 A;  4MKK A;  4ADE A;  1TPL A;  1S09 A;  3FQA A;  1AJR A;  1LW4 A;  4WYA A;  5FT6 A;  5TF5 A;  3RCH B;  3PAA A;  4WYF A;  3AEL A;  1PG8 A;  2JJF A;  2BIG A;  2ZJG A;  1DGE A;  2Q7W A;  2VMQ A;  3LY1 A;  3CQ6 A;  3MAD A;  1ARG A;  1UU0 A;  2W8U A;  1X28 A;  1AHG A;  3A9X A;  1CQ8 A;  2PB2 A;  1UU2 A;  5G2Q A; 
#chains in the Genus database with same CATH topology
 2JGT A;  3QN6 A;  3NDN A;  5K8B A;  3MGP A;  3TQX A;  3R45 A;  3AYW D;  1JS6 A;  3WKS A;  4EFF A;  3AYW B;  3A1I A;  5GSU C;  3AEN A;  4ZLV A;  1KX3 C;  2CTZ A;  3HQT A;  5DB5 A;  4ADC A;  5CPI D;  2BYL A;  1P3F A;  3UT9 D;  1M18 C;  4ZAH A;  5AV5 D;  3NUB A;  1GBN A;  5CPI B;  3UT9 B;  4X23 D;  5G4J A;  5AV5 B;  5DNN C;  1D7R A;  4X23 B;  5HHY A;  3GR9 A;  1P3W A;  3I16 A;  1GEX A;  1QZ9 A;  5B2I D;  1BH9 A;  3A1K A;  2YRI A;  3NTJ A;  5B2I B;  1DGD A;  1BFM A;  1VEF A;  2FJ7 D;  3MBB A;  4J8X C;  3B6F C;  3N4R A;  4Q76 A;  2FJ7 B;  2G5H C;  4W5K A;  1KL1 A;  3BS8 A;  5E5I A;  3N75 A;  4PFF A;  4G91 C;  1AOI D;  2FNU A;  5IWQ A;  1AOI B;  2YFV B;  1WYU A;  3REL D;  4MKJ A;  2W8S A;  1ZOB A;  4O6Z A;  2CJH A;  2W7E A;  5GT3 D;  2OGA A;  3REL B;  4B98 A;  3KWQ A;  3PGY A;  1P3O A;  4OTL A;  2EH6 A;  3B46 A;  5GT3 B;  1UKJ A;  1W23 A;  4LNL A;  4J8W D;  3M5U A;  3E2Z A;  5JRG C;  4J8W B;  3LEL D;  2F8J A;  3AEO A;  2W7I A;  2EZ1 A;  3LEL B;  5FT4 A;  1N31 A;  1TAF B;  2D66 A;  5BO0 B;  3HL2 A;  2RIQ A;  2HP2 A;  5BT1 D;  2BI3 A;  3PD6 B;  1O4S A;  3AZM A;  3WAA A;  3B8X A;  1W7M A;  1I29 A;  3EI6 A;  3PDB A;  2ZUK A;  2X5F A;  4WXF A;  1Z7D A;  3AFA A;  4KGC D;  2EO5 A;  1V2D A;  3ZZK A;  4KGC B;  4R8P A;  1ID3 A;  3MGP D;  5EUN A;  4UHN A;  2F2A C;  2CWE A;  1IAY A;  2AY2 A;  3MGP B;  4JEW A;  3WX9 A;  4HGA C;  3P5J B;  3W99 C;  4Z5T C;  3JW9 A;  2Y2G A;  5BS7 C;  2ZY4 A;  3AEN B;  3VH5 T;  1C7G A;  5D95 A;  4Z66 A;  3WTP A;  5DNM A;  1ECX A;  4A0G A;  4AO4 A;  4G92 B;  1P3F D;  1OXO A;  1MDO A;  2Z9W A;  1KX4 A;  1P3F B;  4IYO A;  2Y2O A;  2W7J A;  3NU7 A;  5GT0 A;  1ZLA C;  2VQR A;  3GBX A;  1PMO A;  4F5G A;  3HDO A;  4WU9 C;  5M4B A;  1S06 A;  1EG5 A;  2D5Y A;  1GC2 A;  2Z1Y A;  3FCR A;  3N4S A;  4TN4 A;  3G0T A;  1M0N A;  1BH9 B;  4LD9 A;  2Y2Q A;  1GC0 A;  2OKJ A;  3AYW C;  3QHX A;  4ZWV A;  1C4K A;  1P3M A;  3BV0 A;  4XUJ D;  1CZC A;  2AY1 A;  4XUJ B;  2BI5 A;  3USF A;  5CPI C;  3UT9 C;  3VAX A;  2HUI A;  3EI5 A;  5AV5 C;  1S07 A;  5JAY A;  3AV7 A;  2VMR A;  4X23 C;  1S32 A;  1WYU B;  2GMU A;  2VMU A;  4PFN A;  3KWQ D;  2FN6 A;  1P3O D;  5D5S A;  5F9S A;  1CL2 A;  3F9T A;  2ARO A;  3UTB D;  3KUY A;  3KWQ B;  1YIZ A;  1P3O B;  2AY3 A;  1AY8 A;  5F8V A;  3UTB B;  3WGB A;  1CZE A;  1G7W A;  5HXX A;  1P3P A;  4J8X A;  3REK A;  3F0H A;  3E2Z B;  4UQV A;  3REI A;  3HBX A;  3WLX A;  2BYM B;  2VIA A;  1CQ6 A;  2AY8 A;  4IXZ A;  1RVY A;  2WB6 A;  3DU4 A;  3EZ1 A;  3MVD C;  3AZM D;  3WAA D;  1AOI C;  3QGU A;  1X0M A;  3LVJ A;  3AZM B;  3B1D A;  3WAA B;  4ZDL A;  3AFA D;  3PDB B;  1A7W A;  3LZ0 A;  2Y2H A;  4GSA A;  3REL C;  3AFA B;  4R8P D;  5GT3 C;  1ID3 D;  3FTB A;  4JEY A;  2W8W A;  4F4E A;  1DJU A;  4R8P B;  1ID3 B;  1S0A A;  1BJO A;  1AMS A;  2D65 A;  1TZY A;  3FKD A;  2PYO A;  5JRG A;  4J8W C;  1V2F A;  3N4X A;  1AAW A;  2UWX A;  3LEL C;  4Z66 D;  3WTP D;  5DNM D;  2Y2J A;  2YCT A;  1ORD A;  4M6B A;  4Z66 B;  3WTP B;  5DNM B;  1KX4 D;  2DGM A;  3GSB A;  3W96 A;  1WST A;  3WKR A;  4K2B A;  2FFF B;  1KX4 B;  3KXB A;  1WYV A;  2DGL A;  5GT0 D;  4IYO B;  2Z9U A;  4DBC A;  3WZF A;  3V9R A;  3LV2 A;  5BT1 C;  3CAI A;  5GT0 B;  4W1W A;  4E3R A;  1QIS A;  3G8M A;  5DJ9 A;  3PPL A;  3AZH A;  4Q6R A;  2D7Z A;  1MGV A;  1O61 A;  4KUD A;  3BCX A;  4KGC C;  5EQC A;  1KMJ A;  4LD9 D;  2JJG A;  4R2N A;  5M49 A;  4F5J A;  5B1L A;  4LD9 B;  1P3K D;  4BMK A;  1KX5 C;  1P3M D;  1BS0 A;  4M2M A;  1G7X A;  1P3K B;  2VMY A;  5BNX A;  2X8U A;  4KXK A;  4G92 C;  2JJE A;  1BH8 A;  1P3M B;  4AOA A;  3C1B D;  1P3F C;  3X1T A;  4WXB A;  5B31 D;  3C1B B;  3X1U A;  1S32 D;  1IVR A;  5B31 B;  1I43 A;  2F8N G;  1S32 B;  3AAT A;  2ARO D;  3KUY D;  2BWN A;  1D7V A;  2ARO B;  3KUY B;  3FQA A;  4WV4 B;  4WYA A;  1P3P D;  4WYF A;  3REK D;  2HIO A;  3MAD A;  3REI D;  1P3P B;  3MNN A;  3EPK A;  2PB2 A;  3REK B;  3REI B;  3VH6 W;  4MY5 A;  2AY4 A;  4GRX A;  2Z61 A;  3W1J A;  1Q9C A;  1B6W A;  4XUJ C;  5CPI A;  4NOG A;  2JCH A;  1LKC A;  1ASB A;  1LC5 A;  1AJS A;  1WKH A;  4ADD A;  3UTA A;  3LZ0 D;  2F8N K;  3LZ0 B;  4R5Z A;  3H0R C;  3NYU A;  5B2J A;  1P3O C;  1TZY D;  4GE7 A;  3UTB C;  2PYO D;  2VGS A;  1CQ7 A;  4H9P A;  5B0Y A;  1TZY B;  2W7M A;  2PYO B;  4WU8 A;  3ATH A;  4IW7 A;  1AMR A;  4H9Q A;  3W96 D;  2GMS A;  2HUE B;  3MVD A;  3KXB D;  2OQX A;  3W96 B;  2G6W A;  1Z3Z A;  3X1S A;  3KXB B;  1WYV B;  3AZM C;  3WAA C;  1P3G C;  3V9R B;  2W8T A;  3H0L C;  3AZH D;  3TFU A;  3WY7 A;  4OMA A;  3AFA C;  4KUD D;  4XJL A;  3AZH B;  1OHW A;  2DKJ A;  3VH6 A;  4KUD B;  1KKJ A;  4ZBJ B;  4R8P C;  1ID3 C;  1MLY A;  3WCO A;  5C6U A;  5EFS A;  5B1L D;  4HGA B;  3FD0 A;  1TAT A;  3AEJ A;  3UE8 A;  3GWP A;  2CAN A;  3LEL A;  2VLF A;  3FZ6 A;  4W91 A;  1GD9 A;  5B1L B;  3E2Y A;  5B1M A;  4Q31 A;  3DXV A;  4Z66 C;  3WTP C;  5DNM C;  5BO0 A;  3EPH A;  1B5O A;  1IX6 A;  1BH8 B;  3X1T D;  3MGR A;  2JG2 A;  1HTA A;  1KX4 C;  3FFR A;  4RIZ A;  3X1U D;  4MQQ A;  3X1T B;  3P1T A;  5E4Z A;  3II0 A;  3X1V C;  2BKW A;  2WKA A;  4R8D A;  1BQA A;  3NQU A;  3X1U B;  1WYT A;  5FUG B;  4XJP A;  5EUD A;  1IX7 A;  1B8G A;  2L5A A;  5G09 A;  1ELU A;  2O1B A;  1B4X A;  1B9I A;  2CH1 A;  1AIA A;  4J8U A;  2HIO D;  4JEX A;  5G4I A;  4EMY A;  4YM6 C;  1M6S A;  4LD9 C;  3MNN D;  1KX5 A;  2HIO B;  2TPL A;  2D7Y A;  3G7Q A;  3MNN B;  3LZ1 A;  1P3K C;  4P3M A;  1AIC A;  4Z2M G;  4EB5 A;  1P3M C;  2Y2P A;  5B33 A;  4XQ2 A;  4H9R A;  2NMP A;  3C1B C;  3COG A;  4E45 A;  2HOX A;  4MSO A;  3UTA D;  3AOW A;  5B31 C;  1AJS B;  5JA4 A;  1S32 C;  3UTA B;  2LY8 A;  3KGX A;  3EIA A;  5B2J D;  1BQD A;  2ARO C;  3KUY C;  3FZ8 A;  5B2J B;  1ZOD A;  5B0Y D;  2VGT A;  4WU8 D;  1GC3 A;  3NNK A;  4H9P B;  5B0Y B;  1P3P C;  4ADB A;  3REK C;  4WU8 B;  1KMK A;  3REI C;  1PMM A;  2AY9 A;  4CXR A;  3NUI A;  2XD1 A;  4N0W A;  1P3A D;  3MVD D;  4XUJ A;  4H9Q B;  3REH A;  3B0D C;  2VMX A;  3QM2 A;  1P3A B;  3MVD B;  3X1S D;  3AEM A;  4OBU A;  1LK9 A;  2VMV A;  4CBR A;  3X1S B;  4WD2 A;  1LW5 A;  1D2F A;  3LZ0 C;  1JG8 A;  2E7I A;  4W8I A;  2G5I C;  2BHX A;  3ASB A;  4U1T A;  3UTB A;  2BYJ A;  4H51 A;  4ITG A;  4LNM A;  1AKB A;  1DJ9 A;  1B5P A;  1TZY C;  1SZU A;  1J04 A;  2VI8 A;  2PYO C;  1M0O A;  1F66 A;  2HUU A;  2F8N A;  2EGY A;  2BYM A;  3RQ1 A;  3MGS A;  4BA5 A;  5B1M D;  4A6U A;  4DQY B;  5B1M B;  3MGR D;  3NU8 A;  4OCA A;  3BC8 A;  2HUE C;  3KKI A;  4J8L A;  1MLZ A;  5AX8 A;  3W96 C;  3MGR B;  1BJW A;  3KXB C;  1P3G A;  4XEW A;  3B0C W;  1TAR A;  1ARH A;  1KKP A;  2ORD A;  4WLH A;  3B0B A;  3NQU B;  1WYT B;  2WK8 A;  1DTY A;  4R5F A;  1ARI A;  3AZH C;  4K2M A;  3QPG A;  4KUD C;  1ELQ A;  4J8U D;  4ZBJ C;  1M4N A;  4CXQ A;  1AAM A;  3REJ A;  2BIA A;  1GEY A;  3W98 A;  4J8U B;  1KX5 D;  2NZD D;  1TOJ A;  4AH3 A;  1QJ5 A;  3FVS A;  5B1L C;  3LZ1 D;  1KX5 B;  2NZD B;  3VH6 T;  1JF9 A;  1E5E A;  3LZ1 B;  4A72 A;  1G4X A;  5G49 A;  3FQ8 A;  5B33 D;  2WK9 A;  2CY8 A;  2AY6 A;  5B33 B;  3X1T C;  2HP1 A;  3X1V A;  4H9R B;  4ZWM A;  2EZ2 A;  5CPK B;  1FG7 A;  3EI9 A;  3X1U C;  2KFP A;  1AHY A;  2AEU A;  3LJA A;  2WK7 A;  2O0R A;  5JA4 B;  3TAT A;  4A00 A;  5BJ4 A;  2HZP A;  4F5F A;  3GET A;  1H1C A;  3JWA A;  3R4T A;  3DC1 A;  4YM6 A;  1N2T A;  1SF2 A;  1P3L A;  2HIO C;  5C3I B;  1P3K A;  1OHV A;  3MNN C;  3RI6 A;  1M19 A;  3DR7 A;  1AKC A;  1MAQ A;  3E6G A;  3REH D;  4WYD A;  1WWI A;  4NE5 A;  3WKJ A;  3JZL A;  3NQJ A;  3WA9 C;  3C1B A;  3REH B;  3NX3 A;  5B31 A;  3N7N A;  1YJZ A;  2ZYJ A;  3AZJ A;  3UTA C;  2Z9X A;  3FSL A;  2E54 A;  3DRD A;  4ZM3 A;  1WKG A;  4WBT A;  1Y4I A;  2C0R A;  2VGW A;  4QLC A;  5B2J C;  1DKA A;  3BN1 A;  1YJY A;  1F66 D;  5B0Y C;  4ZSY A;  2F8N D;  5E5A D;  3MGS D;  4WU8 C;  2NQB A;  3E77 A;  3MC6 A;  2CJG A;  1F66 B;  2VMP A;  2F8N B;  3EPJ A;  5E5A B;  2QA3 A;  3MGS B;  4ADE A;  1AJR A;  4YS3 D;  5TF5 A;  3AEL A;  1P3A C;  2Q7W A;  4YS3 B;  1ARG A;  1P3G D;  2W8U A;  1X28 A;  1CQ8 A;  3DZZ A;  1ASA A;  3X1S C;  1XEY A;  1P3G B;  4F5M A;  3MKJ A;  4HVK A;  1MAP A;  2FYF A;  1U35 A;  2JSS A;  5KDM A;  3H9X A;  5AVC A;  3W97 A;  1JS3 A;  4RLG A;  4K2I A;  2VI9 A;  5B40 A;  3REJ D;  2ZY2 A;  3QBO A;  3W98 D;  2ZY3 A;  1H0C A;  4GE9 A;  4Y0D A;  3REJ B;  1B9H A;  3W98 B;  1Z2C B;  3ELE A;  2YCP A;  1D7U A;  3AEJ C;  4ZSW A;  5B24 C;  5M4D A;  1N8P A;  1DJE A;  1SFF A;  1U08 A;  1O62 A;  5B1M C;  5G49 B;  1CL1 A;  3MGR C;  3X1V D;  2R5C A;  4KYO A;  1XI9 A;  2VMT A;  3C1C A;  1YJS A;  3X1V B;  3LJA D;  3EIB A;  4W1X A;  3AZG A;  1ART A;  3AZL B;  1S08 A;  5HDM A;  4J8V A;  1LC7 A;  2RFV A;  3LJA B;  1EJI A;  3L44 A;  3ZZJ A;  4DQ6 A;  4YM6 D;  4WJ3 C;  1BJ4 A;  2JE5 A;  4J8U C;  1P3L D;  1AMQ A;  4IY7 A;  3JWB A;  4YM6 B;  2HOY A;  2QB3 A;  2QB2 A;  1P3L B;  2NZD C;  3ACZ A;  3T32 A;  1M19 D;  4RKC A;  2XBN A;  3LZ1 C;  1AX4 A;  1C7O A;  2QBT A;  1M19 B;  3LVK A;  3CQ5 A;  3WKJ D;  5AV8 D;  4BQ0 A;  1N1J A;  1DFO A;  2OKK A;  2BI2 A;  2HOZ A;  2BWP A;  5B33 C;  3WKJ B;  5AV8 B;  3A9Z A;  1I48 A;  5B32 G;  3NQJ B;  5CPK C;  3RBF A;  3NRA A;  5FUG A;  1T3I A;  4Y0I A;  3AZJ D;  3BCA A;  4Q75 A;  4BHD A;  2Y2K A;  3FVU A;  4WB0 A;  3AZJ B;  4QLC D;  2RVQ D;  5AV9 A;  5KTB A;  4WNN A;  4A6R A;  3AV1 D;  4QLC B;  3K7Y A;  2QLR A;  3CBF A;  3AV1 B;  1J32 A;  2BI9 A;  2NQB D;  2AY7 A;  4F5I A;  4RM1 A;  2Y2N A;  3TFT A;  5C3I C;  2NQB B;  1ZC9 A;  3AOV A;  2W8V A;  2YRR A;  1MDZ A;  3HT4 A;  5J8Q A;  2X3L A;  4UUZ A;  3WA9 A;  3W1H A;  8AAT A;  2F8N H;  3O62 A;  3B0D B;  3REH C;  2Y2I A;  3B0C T;  4M2K A;  3AEM C;  3N5M A;  4P7Y A;  3Q8N A;  2YCN A;  2Y2M A;  1T3U A;  1U35 D;  3ECD A;  1QGN A;  5AVC D;  3A2B A;  1U35 B;  3W97 D;  1YAA A;  2C81 A;  2CST A;  5KDM B;  3E2F A;  5G0A A;  4CAY A;  4WYC A;  5B40 D;  4PIW A;  3WTP E;  3MAU A;  5AVC B;  2Z20 A;  4RJ0 A;  4ZAS A;  3W97 B;  3AV2 D;  2VLH A;  1YOO A;  3A6N D;  5B40 B;  2E7J A;  1LC8 A;  4JJN A;  3ELP A;  3AV2 B;  3LG0 A;  3KSY A;  5B0Z A;  1V72 A;  3A6N B;  1F1E A;  1KL2 A;  1F66 C;  1M7Y A;  5E5A C;  3MGS C;  1IUG A;  2FNI A;  4OBV A;  3AN2 A;  5I92 A;  3PJ0 A;  4B9B A;  1P3A A;  4YS3 C;  3A8U X;  1SPA A;  2VMN A;  1JFI A;  4DGT A;  3C1C D;  1C9C A;  4AWL B;  2R5C B;  2YHK A;  4MQR A;  2C44 A;  2ZM5 A;  3C1C B;  3AZG D;  2YFW B;  3D6K A;  4J8V D;  2D61 A;  3AZG B;  2IO5 B;  2GQN A;  4J8V B;  5G2P A;  1BJN A;  3UAK A;  1QJ3 A;  4ITX A;  1ASN A;  4ZDO A;  2BYK B;  1EQZ A;  1BKG A;  3REJ C;  3W98 C;  2VMZ A;  2O7C A;  2FQ6 A;  5B24 A;  4MQP A;  1AHE A;  5AVB D;  1N1J B;  4GE4 A;  4JEV A;  3OKS A;  2OGE A;  1B67 A;  2JJH A;  5AVB B;  2BIE A;  1QIT A;  3AZL C;  3VK4 A;  3DR4 A;  3LJA C;  5AV9 D;  1M1A A;  3KFU G;  4WB0 B;  5GXQ D;  2Z9V A;  3AZE C;  3KE3 A;  5AV9 B;  1ASE A;  4WNN B;  2ZY5 A;  1VP4 A;  5GXQ B;  3AEP A;  3BWO A;  4A0H A;  2XH1 A;  2NZD A;  1P3L C;  1ASG A;  1KU5 A;  1CS1 A;  3AL0 C;  4OC9 A;  2YKY A;  3IP4 C;  4KHA A;  1M19 C;  3WA9 D;  3AZK A;  5EAA A;  3ISL A;  2CFB A;  3O62 D;  4H9S C;  3WKJ C;  3AZF A;  4UUZ B;  5AV8 C;  3WA9 B;  5CPK A;  3O62 B;  3FFH A;  2DF4 C;  2W7K A;  2ZSL A;  3ZRR A;  2PO3 A;  1TOE A;  1UU1 A;  3AZJ C;  2YKU A;  1AHF A;  3IHJ A;  1AIB A;  3GZD A;  3TCM A;  2VMO A;  4QLC C;  2VMS A;  2RVQ C;  4CAY B;  4JJN D;  1VJO A;  2YOB A;  3MEB A;  5FT5 A;  3AV1 C;  5B0Z D;  4Z2M H;  3LVM A;  1TOG A;  4JJN B;  4NFT A;  4HF8 A;  4RKD A;  4I8A A;  5B0Z B;  4LW2 A;  2JIS A;  2NQB C;  3MC6 C;  4F5L A;  3AN2 D;  3MAF A;  2AEV A;  3K40 A;  4KAM A;  4WLJ A;  4ZUX A;  3FQ7 A;  3AN2 B;  3UWC A;  2CJD A;  1PFF A;  5E3K A;  4RIT A;  1JFI B;  4ATP A;  3CQ4 A;  1SZK A;  1AMA A;  1X2A A;  1ASF A;  4NE6 A;  2ZC0 A;  2AY5 A;  1P3B A;  2VGZ A;  1BW0 A;  5EAV A;  1U35 C;  3AZN C;  3FDD A;  4H9N A;  5AVC C;  2BWO A;  3W97 C;  4PVF A;  2EYQ A;  1EQZ D;  3EPL A;  5B40 C;  2DR1 A;  5B32 A;  1ULY A;  1RVU A;  3AV2 C;  1W7N A;  1EQZ B;  3A6N C;  1H3O A;  5B24 D;  5AV6 A;  1AHX A;  2BI1 A;  5E5A A;  4L0O A;  3JTX A;  5B24 B;  1MDX A;  4FFC A;  4ZM4 A;  1TOK A;  4XJO A;  3RBL A;  3ZRQ A;  4E3Q A;  3B1C A;  3FVX A;  1HQ3 D;  4YS3 A;  2W7L A;  1W3U A;  1HQ3 B;  4AWL C;  3BB8 A;  1OXP A;  2XD5 A;  2W7G A;  3C1C C;  1S09 A;  3WCN A;  1LW4 A;  3AZG C;  1M1A D;  2IO5 C;  5FT6 A;  3W1I A;  3RCH B;  4J8V C;  2JJF A;  1DGE A;  2VMQ A;  3CQ6 A;  1M1A B;  1AHG A;  1UU2 A;  1PZR A;  3TU4 C;  3VOM A;  1RV4 A;  4CSR B;  5F99 A;  2C7T A;  4AZK A;  4JEZ A;  3HLM A;  3BWN A;  3F6T A;  1P34 A;  3AZK D;  3PDX A;  2DOU A;  3FDB A;  3E9K A;  4KHA B;  1TAS A;  4E77 A;  3MGQ C;  3AZF D;  3AZK B;  3B6G A;  5CPK D;  2Y2L A;  1LS3 A;  3A9Y A;  5CPJ A;  3R45 B;  2AAT A;  3AZF B;  1P3I A;  5AVB C;  5CP6 A;  2CV5 A;  2D64 A;  3AZL A;  4XJM A;  2E7U A;  4IXO A;  2OAT A;  4A6T A;  3AZE A;  5AY8 A;  5BNV A;  5AV9 C;  1IX8 A;  4WZS B;  4EO5 B;  5GXQ C;  2W7D A;  4XZQ A;  1C7N A;  4AO9 A;  4DRB A;  3AZI A;  4NE3 A;  4ZUX D;  3KGW A;  4E1O A;  3MAF B;  4WXG A;  4ZUX B;  4H9S A;  5AV8 A;  1CJ0 A;  3O62 C;  1ARS A;  5GSU A;  9AAT A;  1KX3 A;  1P3B D;  1E5F A;  2VIB A;  4EU1 A;  1AY4 A;  1TOI A;  2Z1Z A;  2DQN C;  2R2N A;  4E44 A;  2CB1 A;  1P3B B;  1W7L A;  3GZC A;  1M18 A;  2DGK A;  3DYD A;  3FRK A;  1FC4 A;  4UHM A;  4H9N B;  4IX8 A;  3H0M C;  5B32 D;  3AV1 A;  5DNN A;  4U2H A;  4JJN C;  5B32 B;  5AV6 D;  5B0Z C;  1H3O B;  1M0Q A;  5AV6 B;  4OYT A;  4BA4 A;  2A1V A;  2YKV A;  3FZ7 A;  4CBS A;  2ZSM A;  3K28 A;  5B2I C;  3AN2 C;  1M32 A;  1OHY A;  4OT8 A;  3B6F A;  1OAT A;  2FJ7 C;  1EQB A;  2HOR A;  1D7S A;  3AZN A;  3BCB A;  4IXS A;  1GEW A;  1I41 A;  3AV2 A;  2GSA A;  1IBJ A;  3A6N A;  1EQZ C;  5F99 D;  1YNU A;  1ASM A;  2PB0 A;  5F99 B;  1P34 D;  4UPK A;  4W1V A;  1P34 B;  4LNJ A;  3B6G D;  1ASC A;  5CPJ D;  1P3I D;  1HQ3 C;  3B6G B;  5CP6 D;  2CV5 D;  5EUE A;  3B1E A;  2YFW A;  2GB3 A;  3AZL D;  5CPJ B;  2D63 A;  1P3I B;  1BT4 A;  3EI7 A;  5CP6 B;  2CV5 B;  1W2E A;  4H9O A;  3AZE D;  2QMA A;  5AY8 D;  2VGV A;  4ATQ A;  1M1A C;  2X5D A;  1IAX A;  3AZE B;  3TU4 A;  5AY8 B;  5BNV B;  5M46 A;  2BYK A;  2FM1 A;  4XZQ D;  4F5K A;  3EUC A;  2FKI A;  3AZI D;  1C0N A;  5EIG A;  4XZQ B;  1ASD A;  3AZI B;  5DJ1 A;  3L8A A;  1R4V A;  4UHO A;  3MGQ A;  3R9A A;  4ISY A;  3AZK C;  1AY5 A;  4GDY A;  2CH2 A;  4A0F A;  3MGP C;  5GSU D;  5AVB A;  3AZF C;  3W99 A;  4Z5T A;  1M0P A;  3PA9 A;  1KX3 D;  1G4V A;  5BS7 A;  5GSU B;  1GC4 A;  2W7F A;  1KX3 B;  4J5U A;  5BJ3 A;  2YKX A;  4CVQ A;  1M18 D;  3VP6 A;  1SZS A;  4JF1 A;  4UOY A;  1M18 B;  4EO5 C;  3GZD C;  5GXQ A;  5DNN D;  4AZJ A;  2W7H A;  1ZLA A;  1FG3 A;  4F5H A;  5DNN B;  4WU9 A;  2EPJ A;  3WGC A;  2BG1 A;  4Y0H A;  4ZUX C;  1IJI A;  3EI8 A;  3I5T A;  4J8X D;  3B6F D;  1KAF A;  4QGR A;  3AYW A;  3P6K A;  4J8X B;  3B6F B;  2R0T A;  3LVL B;  3DOD A;  2VMW A;  4WYE A;  3HMU A;  2ZP7 A;  3EG5 B;  3AZN D;  2G7J A;  3GJU A;  1P3B C;  3VH5 W;  3AZN B;  4LC3 A;  4G91 B;  4XAU A;  3UT9 A;  5DX5 A;  5AV5 A;  4RAE A;  4ZDP A;  4X23 A;  5B32 C;  3HVY A;  4GEB A;  3I4J A;  5AV6 C;  1RV3 A;  3OP7 A;  3VK2 A;  2DKB A;  3KWQ C;  2VYC A;  4FL0 A;  3VK3 A;  5B2I A;  2VGU A;  2V0Y A;  2V1P A;  4RJY A;  5JRG D;  1ASL A;  1X29 A;  1BJO B;  5JRG B;  4DRA A;  2FJ7 A;  1V2E A;  2W8J A;  1QIR A;  4WYG A;  3DXW A;  4H9O B;  3LWS A;  3TU4 D;  1SVV A;  1AOI A;  2YFV A;  3TU4 B;  3H7F A;  4H63 Q;  3PIU A;  3NYS A;  1AKA A;  2J8P A;  3REL A;  5EIG B;  5F99 C;  5GT3 A;  4TMR A;  4M2J A;  3MGQ D;  2CIN A;  3BWN C;  3EZS A;  1GCK A;  1P34 C;  4A0R A;  3MGQ B;  3VH5 A;  1HQ3 A;  3W99 D;  3QI6 A;  4Z5T D;  4J8W A;  3B6G C;  2QSR A;  5B31 G;  4K05 A;  4LW4 A;  3RUY A;  5CHL B;  5CPJ C;  1P3I C;  3W99 B;  4Z5T B;  7AAT A;  3ZRP A;  5CP6 C;  4JF0 A;  1TAF A;  2CV5 C;  1O69 A;  3RCH A;  5FT8 A;  3N0L A;  5BNX B;  1GDE A;  1YIY A;  4WP0 A;  3NYT A;  4XK1 A;  2R5E A;  5AY8 C;  3PD6 A;  2HUF A;  4EB7 A;  1ZLA D;  3ASA A;  4MKK A;  1TPL A;  4WU9 D;  4CSR A;  5GT0 C;  1ZLA B;  4XZQ C;  3PAA A;  1WWS A;  1PG8 A;  2ZJG A;  4WU9 B;  2BIG A;  3AZI C;  3LY1 A;  1UU0 A;  3A9X A;  4KGC A;  5G2Q A; 
#chains in the Genus database with same CATH homology
 2JGT A;  3QN6 A;  3NDN A;  5K8B A;  3MGP A;  3TQX A;  3R45 A;  3AYW D;  1JS6 A;  3WKS A;  4EFF A;  3AYW B;  3A1I A;  5GSU C;  3AEN A;  4ZLV A;  1KX3 C;  2CTZ A;  3HQT A;  5DB5 A;  4ADC A;  5CPI D;  2BYL A;  1P3F A;  3UT9 D;  1M18 C;  4ZAH A;  5AV5 D;  3NUB A;  1GBN A;  5CPI B;  3UT9 B;  4X23 D;  5G4J A;  5AV5 B;  5DNN C;  1D7R A;  4X23 B;  5HHY A;  3GR9 A;  1P3W A;  3I16 A;  1GEX A;  1QZ9 A;  5B2I D;  1BH9 A;  3A1K A;  2YRI A;  3NTJ A;  5B2I B;  1DGD A;  1BFM A;  1VEF A;  2FJ7 D;  3MBB A;  4J8X C;  3B6F C;  3N4R A;  4Q76 A;  2FJ7 B;  2G5H C;  4W5K A;  1KL1 A;  3BS8 A;  5E5I A;  3N75 A;  4PFF A;  4G91 C;  1AOI D;  2FNU A;  5IWQ A;  1AOI B;  2YFV B;  1WYU A;  3REL D;  4MKJ A;  2W8S A;  1ZOB A;  4O6Z A;  2CJH A;  2W7E A;  5GT3 D;  2OGA A;  3REL B;  4B98 A;  3KWQ A;  3PGY A;  1P3O A;  4OTL A;  2EH6 A;  3B46 A;  5GT3 B;  1UKJ A;  1W23 A;  4LNL A;  4J8W D;  3M5U A;  3E2Z A;  5JRG C;  4J8W B;  3LEL D;  2F8J A;  3AEO A;  2W7I A;  2EZ1 A;  3LEL B;  5FT4 A;  1N31 A;  1TAF B;  2D66 A;  5BO0 B;  3HL2 A;  2RIQ A;  2HP2 A;  5BT1 D;  2BI3 A;  3PD6 B;  1O4S A;  3AZM A;  3WAA A;  3B8X A;  1W7M A;  1I29 A;  3EI6 A;  3PDB A;  2ZUK A;  2X5F A;  4WXF A;  1Z7D A;  3AFA A;  4KGC D;  2EO5 A;  1V2D A;  3ZZK A;  4KGC B;  4R8P A;  1ID3 A;  3MGP D;  5EUN A;  4UHN A;  2F2A C;  2CWE A;  1IAY A;  2AY2 A;  3MGP B;  4JEW A;  3WX9 A;  4HGA C;  3P5J B;  3W99 C;  4Z5T C;  3JW9 A;  2Y2G A;  5BS7 C;  2ZY4 A;  3AEN B;  3VH5 T;  1C7G A;  5D95 A;  4Z66 A;  3WTP A;  5DNM A;  1ECX A;  4A0G A;  4AO4 A;  4G92 B;  1P3F D;  1OXO A;  1MDO A;  2Z9W A;  1KX4 A;  1P3F B;  4IYO A;  2Y2O A;  2W7J A;  3NU7 A;  5GT0 A;  1ZLA C;  2VQR A;  3GBX A;  1PMO A;  4F5G A;  3HDO A;  4WU9 C;  5M4B A;  1S06 A;  1EG5 A;  2D5Y A;  1GC2 A;  2Z1Y A;  3FCR A;  3N4S A;  4TN4 A;  3G0T A;  1M0N A;  1BH9 B;  4LD9 A;  2Y2Q A;  1GC0 A;  2OKJ A;  3AYW C;  3QHX A;  4ZWV A;  1C4K A;  1P3M A;  3BV0 A;  4XUJ D;  1CZC A;  2AY1 A;  4XUJ B;  2BI5 A;  3USF A;  5CPI C;  3UT9 C;  3VAX A;  2HUI A;  3EI5 A;  5AV5 C;  1S07 A;  5JAY A;  3AV7 A;  2VMR A;  4X23 C;  1S32 A;  1WYU B;  2GMU A;  2VMU A;  4PFN A;  3KWQ D;  2FN6 A;  1P3O D;  5D5S A;  5F9S A;  1CL2 A;  3F9T A;  2ARO A;  3UTB D;  3KUY A;  3KWQ B;  1YIZ A;  1P3O B;  2AY3 A;  1AY8 A;  5F8V A;  3UTB B;  3WGB A;  1CZE A;  1G7W A;  5HXX A;  1P3P A;  4J8X A;  3REK A;  3F0H A;  3E2Z B;  4UQV A;  3REI A;  3HBX A;  3WLX A;  2BYM B;  2VIA A;  1CQ6 A;  2AY8 A;  4IXZ A;  1RVY A;  2WB6 A;  3DU4 A;  3EZ1 A;  3MVD C;  3AZM D;  3WAA D;  1AOI C;  3QGU A;  1X0M A;  3LVJ A;  3AZM B;  3B1D A;  3WAA B;  4ZDL A;  3AFA D;  3PDB B;  1A7W A;  3LZ0 A;  2Y2H A;  4GSA A;  3REL C;  3AFA B;  4R8P D;  5GT3 C;  1ID3 D;  3FTB A;  4JEY A;  2W8W A;  4F4E A;  1DJU A;  4R8P B;  1ID3 B;  1S0A A;  1BJO A;  1AMS A;  2D65 A;  1TZY A;  3FKD A;  2PYO A;  5JRG A;  4J8W C;  1V2F A;  3N4X A;  1AAW A;  2UWX A;  3LEL C;  4Z66 D;  3WTP D;  5DNM D;  2Y2J A;  2YCT A;  1ORD A;  4M6B A;  4Z66 B;  3WTP B;  5DNM B;  1KX4 D;  2DGM A;  3GSB A;  3W96 A;  1WST A;  3WKR A;  4K2B A;  2FFF B;  1KX4 B;  3KXB A;  1WYV A;  2DGL A;  5GT0 D;  4IYO B;  2Z9U A;  4DBC A;  3WZF A;  3V9R A;  3LV2 A;  5BT1 C;  3CAI A;  5GT0 B;  4W1W A;  4E3R A;  1QIS A;  3G8M A;  5DJ9 A;  3PPL A;  3AZH A;  4Q6R A;  2D7Z A;  1MGV A;  1O61 A;  4KUD A;  3BCX A;  4KGC C;  5EQC A;  1KMJ A;  4LD9 D;  2JJG A;  4R2N A;  5M49 A;  4F5J A;  5B1L A;  4LD9 B;  1P3K D;  4BMK A;  1KX5 C;  1P3M D;  1BS0 A;  4M2M A;  1G7X A;  1P3K B;  2VMY A;  5BNX A;  2X8U A;  4KXK A;  4G92 C;  2JJE A;  1BH8 A;  1P3M B;  4AOA A;  3C1B D;  1P3F C;  3X1T A;  4WXB A;  5B31 D;  3C1B B;  3X1U A;  1S32 D;  1IVR A;  5B31 B;  1I43 A;  2F8N G;  1S32 B;  3AAT A;  2ARO D;  3KUY D;  2BWN A;  1D7V A;  2ARO B;  3KUY B;  3FQA A;  4WV4 B;  4WYA A;  1P3P D;  4WYF A;  3REK D;  2HIO A;  3MAD A;  3REI D;  1P3P B;  3MNN A;  3EPK A;  2PB2 A;  3REK B;  3REI B;  3VH6 W;  4MY5 A;  2AY4 A;  4GRX A;  2Z61 A;  3W1J A;  1Q9C A;  1B6W A;  4XUJ C;  5CPI A;  4NOG A;  2JCH A;  1LKC A;  1ASB A;  1LC5 A;  1AJS A;  1WKH A;  4ADD A;  3UTA A;  3LZ0 D;  2F8N K;  3LZ0 B;  4R5Z A;  3H0R C;  3NYU A;  5B2J A;  1P3O C;  1TZY D;  4GE7 A;  3UTB C;  2PYO D;  2VGS A;  1CQ7 A;  4H9P A;  5B0Y A;  1TZY B;  2W7M A;  2PYO B;  4WU8 A;  3ATH A;  4IW7 A;  1AMR A;  4H9Q A;  3W96 D;  2GMS A;  2HUE B;  3MVD A;  3KXB D;  2OQX A;  3W96 B;  2G6W A;  1Z3Z A;  3X1S A;  3KXB B;  1WYV B;  3AZM C;  3WAA C;  1P3G C;  3V9R B;  2W8T A;  3H0L C;  3AZH D;  3TFU A;  3WY7 A;  4OMA A;  3AFA C;  4KUD D;  4XJL A;  3AZH B;  1OHW A;  2DKJ A;  3VH6 A;  4KUD B;  1KKJ A;  4ZBJ B;  4R8P C;  1ID3 C;  1MLY A;  3WCO A;  5C6U A;  5EFS A;  5B1L D;  4HGA B;  3FD0 A;  1TAT A;  3AEJ A;  3UE8 A;  3GWP A;  2CAN A;  3LEL A;  2VLF A;  3FZ6 A;  4W91 A;  1GD9 A;  5B1L B;  3E2Y A;  5B1M A;  4Q31 A;  3DXV A;  4Z66 C;  3WTP C;  5DNM C;  5BO0 A;  3EPH A;  1B5O A;  1IX6 A;  1BH8 B;  3X1T D;  3MGR A;  2JG2 A;  1HTA A;  1KX4 C;  3FFR A;  4RIZ A;  3X1U D;  4MQQ A;  3X1T B;  3P1T A;  5E4Z A;  3II0 A;  3X1V C;  2BKW A;  2WKA A;  4R8D A;  1BQA A;  3NQU A;  3X1U B;  1WYT A;  5FUG B;  4XJP A;  5EUD A;  1IX7 A;  1B8G A;  2L5A A;  5G09 A;  1ELU A;  2O1B A;  1B4X A;  1B9I A;  2CH1 A;  1AIA A;  4J8U A;  2HIO D;  4JEX A;  5G4I A;  4EMY A;  4YM6 C;  1M6S A;  4LD9 C;  3MNN D;  1KX5 A;  2HIO B;  2TPL A;  2D7Y A;  3G7Q A;  3MNN B;  3LZ1 A;  1P3K C;  4P3M A;  1AIC A;  4Z2M G;  4EB5 A;  1P3M C;  2Y2P A;  5B33 A;  4XQ2 A;  4H9R A;  2NMP A;  3C1B C;  3COG A;  4E45 A;  2HOX A;  4MSO A;  3UTA D;  3AOW A;  5B31 C;  1AJS B;  5JA4 A;  1S32 C;  3UTA B;  2LY8 A;  3KGX A;  3EIA A;  5B2J D;  1BQD A;  2ARO C;  3KUY C;  3FZ8 A;  5B2J B;  1ZOD A;  5B0Y D;  2VGT A;  4WU8 D;  1GC3 A;  3NNK A;  4H9P B;  5B0Y B;  1P3P C;  4ADB A;  3REK C;  4WU8 B;  1KMK A;  3REI C;  1PMM A;  2AY9 A;  4CXR A;  3NUI A;  2XD1 A;  4N0W A;  1P3A D;  3MVD D;  4XUJ A;  4H9Q B;  3REH A;  3B0D C;  2VMX A;  3QM2 A;  1P3A B;  3MVD B;  3X1S D;  3AEM A;  4OBU A;  1LK9 A;  2VMV A;  4CBR A;  3X1S B;  4WD2 A;  1LW5 A;  1D2F A;  3LZ0 C;  1JG8 A;  2E7I A;  4W8I A;  2G5I C;  2BHX A;  3ASB A;  4U1T A;  3UTB A;  2BYJ A;  4H51 A;  4ITG A;  4LNM A;  1AKB A;  1DJ9 A;  1B5P A;  1TZY C;  1SZU A;  1J04 A;  2VI8 A;  2PYO C;  1M0O A;  1F66 A;  2HUU A;  2F8N A;  2EGY A;  2BYM A;  3RQ1 A;  3MGS A;  4BA5 A;  5B1M D;  4A6U A;  4DQY B;  5B1M B;  3MGR D;  3NU8 A;  4OCA A;  3BC8 A;  2HUE C;  3KKI A;  4J8L A;  1MLZ A;  5AX8 A;  3W96 C;  3MGR B;  1BJW A;  3KXB C;  1P3G A;  4XEW A;  3B0C W;  1TAR A;  1ARH A;  1KKP A;  2ORD A;  4WLH A;  3B0B A;  3NQU B;  1WYT B;  2WK8 A;  1DTY A;  4R5F A;  1ARI A;  3AZH C;  4K2M A;  3QPG A;  4KUD C;  1ELQ A;  4J8U D;  4ZBJ C;  1M4N A;  4CXQ A;  1AAM A;  3REJ A;  2BIA A;  1GEY A;  3W98 A;  4J8U B;  1KX5 D;  2NZD D;  1TOJ A;  4AH3 A;  1QJ5 A;  3FVS A;  5B1L C;  3LZ1 D;  1KX5 B;  2NZD B;  3VH6 T;  1JF9 A;  1E5E A;  3LZ1 B;  4A72 A;  1G4X A;  5G49 A;  3FQ8 A;  5B33 D;  2WK9 A;  2CY8 A;  2AY6 A;  5B33 B;  3X1T C;  2HP1 A;  3X1V A;  4H9R B;  4ZWM A;  2EZ2 A;  5CPK B;  1FG7 A;  3EI9 A;  3X1U C;  2KFP A;  1AHY A;  2AEU A;  3LJA A;  2WK7 A;  2O0R A;  5JA4 B;  3TAT A;  4A00 A;  5BJ4 A;  2HZP A;  4F5F A;  3GET A;  1H1C A;  3JWA A;  3R4T A;  3DC1 A;  4YM6 A;  1N2T A;  1SF2 A;  1P3L A;  2HIO C;  5C3I B;  1P3K A;  1OHV A;  3MNN C;  3RI6 A;  1M19 A;  3DR7 A;  1AKC A;  1MAQ A;  3E6G A;  3REH D;  4WYD A;  1WWI A;  4NE5 A;  3WKJ A;  3JZL A;  3NQJ A;  3WA9 C;  3C1B A;  3REH B;  3NX3 A;  5B31 A;  3N7N A;  1YJZ A;  2ZYJ A;  3AZJ A;  3UTA C;  2Z9X A;  3FSL A;  2E54 A;  3DRD A;  4ZM3 A;  1WKG A;  4WBT A;  1Y4I A;  2C0R A;  2VGW A;  4QLC A;  5B2J C;  1DKA A;  3BN1 A;  1YJY A;  1F66 D;  5B0Y C;  4ZSY A;  2F8N D;  5E5A D;  3MGS D;  4WU8 C;  2NQB A;  3E77 A;  3MC6 A;  2CJG A;  1F66 B;  2VMP A;  2F8N B;  3EPJ A;  5E5A B;  2QA3 A;  3MGS B;  4ADE A;  1AJR A;  4YS3 D;  5TF5 A;  3AEL A;  1P3A C;  2Q7W A;  4YS3 B;  1ARG A;  1P3G D;  2W8U A;  1X28 A;  1CQ8 A;  3DZZ A;  1ASA A;  3X1S C;  1XEY A;  1P3G B;  4F5M A;  3MKJ A;  4HVK A;  1MAP A;  2FYF A;  1U35 A;  2JSS A;  5KDM A;  3H9X A;  5AVC A;  3W97 A;  1JS3 A;  4RLG A;  4K2I A;  2VI9 A;  5B40 A;  3REJ D;  2ZY2 A;  3QBO A;  3W98 D;  2ZY3 A;  1H0C A;  4GE9 A;  4Y0D A;  3REJ B;  1B9H A;  3W98 B;  1Z2C B;  3ELE A;  2YCP A;  1D7U A;  3AEJ C;  4ZSW A;  5B24 C;  5M4D A;  1N8P A;  1DJE A;  1SFF A;  1U08 A;  1O62 A;  5B1M C;  5G49 B;  1CL1 A;  3MGR C;  3X1V D;  2R5C A;  4KYO A;  1XI9 A;  2VMT A;  3C1C A;  1YJS A;  3X1V B;  3LJA D;  3EIB A;  4W1X A;  3AZG A;  1ART A;  3AZL B;  1S08 A;  5HDM A;  4J8V A;  1LC7 A;  2RFV A;  3LJA B;  1EJI A;  3L44 A;  3ZZJ A;  4DQ6 A;  4YM6 D;  4WJ3 C;  1BJ4 A;  2JE5 A;  4J8U C;  1P3L D;  1AMQ A;  4IY7 A;  3JWB A;  4YM6 B;  2HOY A;  2QB3 A;  2QB2 A;  1P3L B;  2NZD C;  3ACZ A;  3T32 A;  1M19 D;  4RKC A;  2XBN A;  3LZ1 C;  1AX4 A;  1C7O A;  2QBT A;  1M19 B;  3LVK A;  3CQ5 A;  3WKJ D;  5AV8 D;  4BQ0 A;  1N1J A;  1DFO A;  2OKK A;  2BI2 A;  2HOZ A;  2BWP A;  5B33 C;  3WKJ B;  5AV8 B;  3A9Z A;  1I48 A;  5B32 G;  3NQJ B;  5CPK C;  3RBF A;  3NRA A;  5FUG A;  1T3I A;  4Y0I A;  3AZJ D;  3BCA A;  4Q75 A;  4BHD A;  2Y2K A;  3FVU A;  4WB0 A;  3AZJ B;  4QLC D;  2RVQ D;  5AV9 A;  5KTB A;  4WNN A;  4A6R A;  3AV1 D;  4QLC B;  3K7Y A;  2QLR A;  3CBF A;  3AV1 B;  1J32 A;  2BI9 A;  2NQB D;  2AY7 A;  4F5I A;  4RM1 A;  2Y2N A;  3TFT A;  5C3I C;  2NQB B;  1ZC9 A;  3AOV A;  2W8V A;  2YRR A;  1MDZ A;  3HT4 A;  5J8Q A;  2X3L A;  4UUZ A;  3WA9 A;  3W1H A;  8AAT A;  2F8N H;  3O62 A;  3B0D B;  3REH C;  2Y2I A;  3B0C T;  4M2K A;  3AEM C;  3N5M A;  4P7Y A;  3Q8N A;  2YCN A;  2Y2M A;  1T3U A;  1U35 D;  3ECD A;  1QGN A;  5AVC D;  3A2B A;  1U35 B;  3W97 D;  1YAA A;  2C81 A;  2CST A;  5KDM B;  3E2F A;  5G0A A;  4CAY A;  4WYC A;  5B40 D;  4PIW A;  3WTP E;  3MAU A;  5AVC B;  2Z20 A;  4RJ0 A;  4ZAS A;  3W97 B;  3AV2 D;  2VLH A;  1YOO A;  3A6N D;  5B40 B;  2E7J A;  1LC8 A;  4JJN A;  3ELP A;  3AV2 B;  3LG0 A;  3KSY A;  5B0Z A;  1V72 A;  3A6N B;  1F1E A;  1KL2 A;  1F66 C;  1M7Y A;  5E5A C;  3MGS C;  1IUG A;  2FNI A;  4OBV A;  3AN2 A;  5I92 A;  3PJ0 A;  4B9B A;  1P3A A;  4YS3 C;  3A8U X;  1SPA A;  2VMN A;  1JFI A;  4DGT A;  3C1C D;  1C9C A;  4AWL B;  2R5C B;  2YHK A;  4MQR A;  2C44 A;  2ZM5 A;  3C1C B;  3AZG D;  2YFW B;  3D6K A;  4J8V D;  2D61 A;  3AZG B;  2IO5 B;  2GQN A;  4J8V B;  5G2P A;  1BJN A;  3UAK A;  1QJ3 A;  4ITX A;  1ASN A;  4ZDO A;  2BYK B;  1EQZ A;  1BKG A;  3REJ C;  3W98 C;  2VMZ A;  2O7C A;  2FQ6 A;  5B24 A;  4MQP A;  1AHE A;  5AVB D;  1N1J B;  4GE4 A;  4JEV A;  3OKS A;  2OGE A;  1B67 A;  2JJH A;  5AVB B;  2BIE A;  1QIT A;  3AZL C;  3VK4 A;  3DR4 A;  3LJA C;  5AV9 D;  1M1A A;  3KFU G;  4WB0 B;  5GXQ D;  2Z9V A;  3AZE C;  3KE3 A;  5AV9 B;  1ASE A;  4WNN B;  2ZY5 A;  1VP4 A;  5GXQ B;  3AEP A;  3BWO A;  4A0H A;  2XH1 A;  2NZD A;  1P3L C;  1ASG A;  1KU5 A;  1CS1 A;  3AL0 C;  4OC9 A;  2YKY A;  3IP4 C;  4KHA A;  1M19 C;  3WA9 D;  3AZK A;  5EAA A;  3ISL A;  2CFB A;  3O62 D;  4H9S C;  3WKJ C;  3AZF A;  4UUZ B;  5AV8 C;  3WA9 B;  5CPK A;  3O62 B;  3FFH A;  2DF4 C;  2W7K A;  2ZSL A;  3ZRR A;  2PO3 A;  1TOE A;  1UU1 A;  3AZJ C;  2YKU A;  1AHF A;  3IHJ A;  1AIB A;  3GZD A;  3TCM A;  2VMO A;  4QLC C;  2VMS A;  2RVQ C;  4CAY B;  4JJN D;  1VJO A;  2YOB A;  3MEB A;  5FT5 A;  3AV1 C;  5B0Z D;  4Z2M H;  3LVM A;  1TOG A;  4JJN B;  4NFT A;  4HF8 A;  4RKD A;  4I8A A;  5B0Z B;  4LW2 A;  2JIS A;  2NQB C;  3MC6 C;  4F5L A;  3AN2 D;  3MAF A;  2AEV A;  3K40 A;  4KAM A;  4WLJ A;  4ZUX A;  3FQ7 A;  3AN2 B;  3UWC A;  2CJD A;  1PFF A;  5E3K A;  4RIT A;  1JFI B;  4ATP A;  3CQ4 A;  1SZK A;  1AMA A;  1X2A A;  1ASF A;  4NE6 A;  2ZC0 A;  2AY5 A;  1P3B A;  2VGZ A;  1BW0 A;  5EAV A;  1U35 C;  3AZN C;  3FDD A;  4H9N A;  5AVC C;  2BWO A;  3W97 C;  4PVF A;  2EYQ A;  1EQZ D;  3EPL A;  5B40 C;  2DR1 A;  5B32 A;  1ULY A;  1RVU A;  3AV2 C;  1W7N A;  1EQZ B;  3A6N C;  1H3O A;  5B24 D;  5AV6 A;  1AHX A;  2BI1 A;  5E5A A;  4L0O A;  3JTX A;  5B24 B;  1MDX A;  4FFC A;  4ZM4 A;  1TOK A;  4XJO A;  3RBL A;  3ZRQ A;  4E3Q A;  3B1C A;  3FVX A;  1HQ3 D;  4YS3 A;  2W7L A;  1W3U A;  1HQ3 B;  4AWL C;  3BB8 A;  1OXP A;  2XD5 A;  2W7G A;  3C1C C;  1S09 A;  3WCN A;  1LW4 A;  3AZG C;  1M1A D;  2IO5 C;  5FT6 A;  3W1I A;  3RCH B;  4J8V C;  2JJF A;  1DGE A;  2VMQ A;  3CQ6 A;  1M1A B;  1AHG A;  1UU2 A;  1PZR A;  3TU4 C;  3VOM A;  1RV4 A;  4CSR B;  5F99 A;  2C7T A;  4AZK A;  4JEZ A;  3HLM A;  3BWN A;  3F6T A;  1P34 A;  3AZK D;  3PDX A;  2DOU A;  3FDB A;  3E9K A;  4KHA B;  1TAS A;  4E77 A;  3MGQ C;  3AZF D;  3AZK B;  3B6G A;  5CPK D;  2Y2L A;  1LS3 A;  3A9Y A;  5CPJ A;  3R45 B;  2AAT A;  3AZF B;  1P3I A;  5AVB C;  5CP6 A;  2CV5 A;  2D64 A;  3AZL A;  4XJM A;  2E7U A;  4IXO A;  2OAT A;  4A6T A;  3AZE A;  5AY8 A;  5BNV A;  5AV9 C;  1IX8 A;  4WZS B;  4EO5 B;  5GXQ C;  2W7D A;  4XZQ A;  1C7N A;  4AO9 A;  4DRB A;  3AZI A;  4NE3 A;  4ZUX D;  3KGW A;  4E1O A;  3MAF B;  4WXG A;  4ZUX B;  4H9S A;  5AV8 A;  1CJ0 A;  3O62 C;  1ARS A;  5GSU A;  9AAT A;  1KX3 A;  1P3B D;  1E5F A;  2VIB A;  4EU1 A;  1AY4 A;  1TOI A;  2Z1Z A;  2DQN C;  2R2N A;  4E44 A;  2CB1 A;  1P3B B;  1W7L A;  3GZC A;  1M18 A;  2DGK A;  3DYD A;  3FRK A;  1FC4 A;  4UHM A;  4H9N B;  4IX8 A;  3H0M C;  5B32 D;  3AV1 A;  5DNN A;  4U2H A;  4JJN C;  5B32 B;  5AV6 D;  5B0Z C;  1H3O B;  1M0Q A;  5AV6 B;  4OYT A;  4BA4 A;  2A1V A;  2YKV A;  3FZ7 A;  4CBS A;  2ZSM A;  3K28 A;  5B2I C;  3AN2 C;  1M32 A;  1OHY A;  4OT8 A;  3B6F A;  1OAT A;  2FJ7 C;  1EQB A;  2HOR A;  1D7S A;  3AZN A;  3BCB A;  4IXS A;  1GEW A;  1I41 A;  3AV2 A;  2GSA A;  1IBJ A;  3A6N A;  1EQZ C;  5F99 D;  1YNU A;  1ASM A;  2PB0 A;  5F99 B;  1P34 D;  4UPK A;  4W1V A;  1P34 B;  4LNJ A;  3B6G D;  1ASC A;  5CPJ D;  1P3I D;  1HQ3 C;  3B6G B;  5CP6 D;  2CV5 D;  5EUE A;  3B1E A;  2YFW A;  2GB3 A;  3AZL D;  5CPJ B;  2D63 A;  1P3I B;  1BT4 A;  3EI7 A;  5CP6 B;  2CV5 B;  1W2E A;  4H9O A;  3AZE D;  2QMA A;  5AY8 D;  2VGV A;  4ATQ A;  1M1A C;  2X5D A;  1IAX A;  3AZE B;  3TU4 A;  5AY8 B;  5BNV B;  5M46 A;  2BYK A;  2FM1 A;  4XZQ D;  4F5K A;  3EUC A;  2FKI A;  3AZI D;  1C0N A;  5EIG A;  4XZQ B;  1ASD A;  3AZI B;  5DJ1 A;  3L8A A;  1R4V A;  4UHO A;  3MGQ A;  3R9A A;  4ISY A;  3AZK C;  1AY5 A;  4GDY A;  2CH2 A;  4A0F A;  3MGP C;  5GSU D;  5AVB A;  3AZF C;  3W99 A;  4Z5T A;  1M0P A;  3PA9 A;  1KX3 D;  1G4V A;  5BS7 A;  5GSU B;  1GC4 A;  2W7F A;  1KX3 B;  4J5U A;  5BJ3 A;  2YKX A;  4CVQ A;  1M18 D;  3VP6 A;  1SZS A;  4JF1 A;  4UOY A;  1M18 B;  4EO5 C;  3GZD C;  5GXQ A;  5DNN D;  4AZJ A;  2W7H A;  1ZLA A;  1FG3 A;  4F5H A;  5DNN B;  4WU9 A;  2EPJ A;  3WGC A;  2BG1 A;  4Y0H A;  4ZUX C;  1IJI A;  3EI8 A;  3I5T A;  4J8X D;  3B6F D;  4QGR A;  3AYW A;  3P6K A;  4J8X B;  3B6F B;  2R0T A;  3LVL B;  3DOD A;  2VMW A;  4WYE A;  3HMU A;  2ZP7 A;  3EG5 B;  3AZN D;  2G7J A;  3GJU A;  1P3B C;  3VH5 W;  3AZN B;  4LC3 A;  4G91 B;  4XAU A;  3UT9 A;  5DX5 A;  5AV5 A;  4RAE A;  4ZDP A;  4X23 A;  5B32 C;  3HVY A;  4GEB A;  3I4J A;  5AV6 C;  1RV3 A;  3OP7 A;  3VK2 A;  2DKB A;  3KWQ C;  2VYC A;  4FL0 A;  3VK3 A;  5B2I A;  2VGU A;  2V0Y A;  2V1P A;  4RJY A;  5JRG D;  1ASL A;  1X29 A;  1BJO B;  5JRG B;  4DRA A;  2FJ7 A;  1V2E A;  2W8J A;  1QIR A;  4WYG A;  3DXW A;  4H9O B;  3LWS A;  3TU4 D;  1SVV A;  1AOI A;  2YFV A;  3TU4 B;  3H7F A;  4H63 Q;  3PIU A;  3NYS A;  1AKA A;  2J8P A;  3REL A;  5EIG B;  5F99 C;  5GT3 A;  4TMR A;  4M2J A;  3MGQ D;  2CIN A;  3BWN C;  3EZS A;  1GCK A;  1P34 C;  4A0R A;  3MGQ B;  3VH5 A;  1HQ3 A;  3W99 D;  3QI6 A;  4Z5T D;  4J8W A;  3B6G C;  2QSR A;  5B31 G;  4K05 A;  4LW4 A;  3RUY A;  5CHL B;  5CPJ C;  1P3I C;  3W99 B;  4Z5T B;  7AAT A;  3ZRP A;  5CP6 C;  4JF0 A;  1TAF A;  2CV5 C;  1O69 A;  3RCH A;  5FT8 A;  3N0L A;  5BNX B;  1GDE A;  1YIY A;  4WP0 A;  3NYT A;  4XK1 A;  2R5E A;  5AY8 C;  3PD6 A;  2HUF A;  4EB7 A;  1ZLA D;  3ASA A;  4MKK A;  1TPL A;  4WU9 D;  4CSR A;  5GT0 C;  1ZLA B;  4XZQ C;  3PAA A;  1WWS A;  1PG8 A;  2ZJG A;  4WU9 B;  2BIG A;  3AZI C;  3LY1 A;  1UU0 A;  3A9X A;  4KGC A;  5G2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...