2ZY4A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
527
structure length
524
Chain Sequence
MSKDYQSLSPFELKDELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-aspartate beta-decarboxylase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
total genus 201
structure length 524
sequence length 527
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy4A01
3OKSA 4A72A 2W7EA 2OATA 4OMAA 5G2QA 4ZLVA 3RUYA 2VMPA 2HORA 1BW0A 4LW4A 3B1EA 5E5IA 1V72A 4F5HA 4MKJA 1PG8A 3EIBA 3TQXA 3ZZJA 4WYEA 4MQQA 1I48A 4IXZA 4IYOB 4WXBA 5G09A 3FVSA 2YKYA 1RVUA 3T32A 2ZY5A 4W8IA 2W7MA 4A0RA 1V2FA 2WK9A 4GDYA 2VIAA 3ASBA 4F4EA 1SZUA 5EAVA 4OCAA 1ASAA 1ECXA 2HOXA 2R5CA 1GC4A 3F9TA 3I5TA 1MLYA 1D7RA 1UU1A 3PA9A 4JF1A 4M2MA 4P7YA 4JEZA 4F5MA 1SPAA 3PJ0A 4LNLA 2W7IA 5EUEA 3A9ZA 5E4ZA 1GCKA 2DKJA 2BI2A 4R5FA 3FDBA 2ZUKA 2VMUA 1TOGA 5K8BA 1X2AA 2W7FA 3LVKA 2VMXA 1KKJA 1N31A 2YCNA 3ACZA 1IAXA 2VMOA 1QJ5A 3LVMA 2YRIA 4IXSA 4P3MA 2D66A 1LW5A 3OP7A 1DTYA 3KE3A 4K2IA 3NU7A 3K7YA 3KKIA 3AEMA 1I41A 2HUIA 3AELA 1P3WA 4CXRA 1ASEA 1WYTA 1Y4IA 3RBLA 3LV2A 1IX8A 1H1CA 2OGEA 3EI8A 5IWQA 2QB2A 2VGUA 1KMKA 4BA4A 3BWOA 1KL2A 2CJHA 2FNUA 2VLFA 2E54A 3FRKA 2PO3A 3G8MA 2W7HA 1AMQA 1AJRA 3ECDA 3NYTA 3BS8A 5D95A 4EU1A 1DJUA 1AY8A 2JJGA 1BQDA 3R9AA 4F5GA 1IBJA 4A0HA 4HF8A 4W1XA 2VI9A 2YOBA 1T3IA 3PIUA 1B5PA 3HQTA 4ADCA 1C0NA 1FG3A 2D7ZA 3P6KA 4XQ2A 1WYVA 2NMPA 1AY4A 1G4XA 2CJGA 1D7SA 3K28A 4RJYA 3LG0A 2VIBA 1OXOA 3ZRRA 3GZDC 2PB0A 3GETA 1BKGA 4EB7A 3NDNA 2C44A 4GRXA 3EIAA 1CQ8A 4WLHA 2GMSA 1UKJA 1O4SA 1ASBA 2YKXA 5HXXA 4H51A 2R5EA 1N2TA 2BI9A 2ZSLA 4MQPA 5G0AA 3NX3A 2W7DA 3P1TA 2BHXA 2DKBA 2CY8A 1CL1A 4WYGA 4WXFA 5M4DA 2AY2A 1OHWA 3FVUA 2ZY4A 4IX8A 1O69A 4GSAA 2BYJA 2W8WA 4ITGA 1KKPA 2ZY3A 4A6RA 2ZJGA 1VP4A 1B9IA 4ADEA 2YCPA 2VI8A 4J5UA 3FVXA 3EI7A 1CZEA 3DR4A 3FFRA 4XJPA 4F5KA 3N5MA 3JTXA 3ASAA 5G2PA 2BWOA 3Q8NA 4E77A 2D63A 4DQ6A 1E5FA 3A2BA 3DYDA 1ASMA 4FFCA 4PFFA 3AATA 4ZSYA 1LS3A 1CS1A 3DU4A 2GSAA 3FFHA 2HUFA 3AENA 1QIRA 4WBTA 3ZRQA 1AICA 1S0AA 5EUDA 5J8QA 4WP0A 4PVFA 2ZP7A 8AATA 5M49A 1ARTA 1YAAA 3ISLA 3F6TA 1OXPA 3ATHA 1ZC9A 4ZWMA 2D61A 1M0OA 1V2DA 2CINA 4QGRA 2R5CB 4K2MA 1KL1A 3B8XA 1TOKA 4U2HA 1JG8A 2E7JA 2X5FA 2VLHA 4RKCA 3LVLB 2VGWA 3RCHA 3COGA 1RV4A 2CH2A 3QN6A 4ATQA 3HMUA 5JAYA 1ELUA 3DRDA 1S08A 1M7YA 2CB1A 2AY4A 1LW4A 2Z20A 5DJ9A 3MC6A 1AY5A 4ISYA 1C7GA 4UHNA 1OHVA 9AATA 4JEVA 4LC3A 2C81A 4W1WA 3E9KA 1MAQA 1DJEA 3FSLA 3WLXA 1CZCA 4Q6RA 4ITXA 4B9BA 2VMQA 1WYTB 7AATA 4R5ZA 3MAUA 2AY9A 1AHYA 1EJIA 3TCMA 1AX4A 2HUUA 4Y0IA 2AY8A 1DGDA 2AY6A 4E3QA 3DR7A 1JS3A 1WSTA 5EIGA 1DFOA 2HP2A 1ASFA 1BS0A 2Z9VA 1MLZA 3E2FA 3PDXA 4IW7A 1AKBA 2CFBA 2C7TA 2FN6A 1W7MA 4BMKA 3WGBA 2BIEA 2Z1YA 3AEMC 1ELQA 1GBNA 1GEWA 3KGXA 2O1BA 1VEFA 3R4TA 1WYVB 2HOYA 2Z9WA 3TFUA 4EB5A 3GSBA 2YCTA 1MAPA 2VMZA 3E2YA 1LC8A 1SZKA 4ADDA 3EZ1A 4ZDPA 1ZOBA 3EUCA 2W8UA 3RQ1A 1B4XA 3L8AA 5EUNA 2BYLA 2BWPA 2EPJA 2FYFA 4PFNA 1QGNA 1AMAA 3FQ7A 1UU0A 1W7NA 3AEOA 4AO4A 4OC9A 2AY5A 4A0FA 3PD6A 2QLRA 3ELPA 3MAFA 2CJDA 3H7FA 4BA5A 1CJ0A 3FQ8A 4FL0A 4AH3A 4ZSWA 4CXQA 1AAWA 1RVYA 3GZCA 2EZ1A 3GBXA 1IJIA 4ZWVA 1UU2A 4TMRA 3TFTA 2QMAA 1GC2A 1YJYA 4GE9A 4JEYA 5D5SA 1TOIA 2W7KA 1M32A 3EI6A 1MDOA 2ZC0A 1S07A 1GEXA 3N75A 3USFA 4WYAA 1BJOA 1G7WA 2E7UA 4CBSA 3CQ4A 3VAXA 1M6SA 4B98A 1AHEA 1WYUA 2AY3A 4ZAHA 3AEPA 3MKJA 2W7GA 4CVQA 5C6UA 1AKCA 5G4IA 3NYSA 4ZASA 4GE7A 1TPLA 1MGVA 3NRAA 3L44A 2HZPA 2QA3A 1B9HA 4UHMA 5AX8A 4LW2A 3LVJA 3AENB 5HDMA 2VGVA 1G4VA 3VK4A 3QGUA 2XH1A 1QZ9A 4WD2A 2ZY2A 1OHYA 2VMTA 4AOAA 3DODA 2JJHA 4E1OA 3B1DA 2X8UA 3EI9A 1SFFA 1GD9A 3NU8A 3WX9A 3NNKA 4AZJA 1YIZA 4GEBA 5BJ4A 5F9SA 1QJ3A 4OT8A 1PFFA 2EO5A 2G6WA 3UAKA 4E3RA 3PGYA 1S06A 3AOVA 2VMSA 1LC7A 2C0RA 4ADBA 4ZM3A 3RCHB 3BN1A 2VMRA 3JW9A 2GB3A 5EFSA 3AV7A 1ARSA 1ARGA 4WYDA 4K2BA 3BWNA 3IHJA 3ZZKA 3QI6A 1MDXA 1WKGA 4M2KA 4O6ZA 4TN4A 4EFFA 1MDZA 4ZDOA 2F8JA 4W1VA 2JJEA 2X5DA 1E5EA 2W8TA 2D65A 2EZ2A 1SZSA 1AJSA 2Q7WA 1AIBA 3BCXA 1SVVA 1X29A 3BCBA 2FQ6A 3G7QA 2GMUA 3VOMA 3QPGA 2WK8A 4AO9A 1JF9A 1ARHA 1H0CA 4A00A 1TASA 4R2NA 3DC1A 1N8PA 1FG7A 2XBNA 5M46A 3AOWA 2Z1ZA 3AEJA 3TATA 5BJ3A 2ORDA 1ARIA 4OTLA 2RFVA 3MADA 3A8UX 1IAYA 5F8VA 4XJLA 1LC5A 5EIGB 1M4NA 3MC6C 3E6GA 5HHYA 1LKCA 1YIYA 2EH6A 3NUIA 3NTJA 3QBOA 3WKSA 3BCAA 2JGTA 1YOOA 2BIAA 1X0MA 1FC4A 2EGYA 2WKAA 4RAEA 1VJOA 2Z61A 4XEWA 3E2ZB 1AAMA 2VMWA 2HOZA 2Z9XA 3A9YA 1TARA 2VGSA 3KGWA 3QM2A 3ZRPA 1O61A 4EMYA 4F5JA 2E7IA 4R8DA 3PDBA 4MSOA 2VYCA 4CBRA 1C7OA 1Z3ZA 4M2JA 5I92A 4Q76A 3RI6A 1V2EA 4BHDA 1O62A 1J04A 2CSTA 3I4JA 3VK3A 2BWNA 4DGTA 2BI1A 4KYOA 5DX5A 1BT4A 1GC3A 4MKKA 3RBFA 2AY7A 1ASLA 3PD6B 2VGTA 2VMYA 1AHFA 3JWAA 3MAFB 4WB0A 1YNUA 1AHXA 3WKRA 4A0GA 3E77A 1D2FA 3FQAA 4PIWA 2AY1A 3BV0A 3E2ZA 1OATA 5EAAA 3ELEA 1I29A 2W8JA 4UQVA 1TOEA 2YKUA 4JEXA 1D7VA 2DOUA 1QISA 4MY5A 1YJSA 1W3UA 4WYCA 2BKWA 1TOJA 2D5YA 1CQ6A 1QITA 2VMNA 3GJUA 3CAIA 2R0TA 1ASGA 3MEBA 1YJZA 1BJOB 2FNIA 4Y0DA 2R2NA 4MQRA 1IX6A 3PPLA 3JWBA 1B8GA 2TPLA 3DZZA 2W8VA 4U1TA 3BC8A 1WYUB 4GE4A 4IYOA 4WLJA 1XI9A 1DKAA 2YHKA 3B1CA 1ORDA 3BB8A 4LNMA 3HL2A 3EZSA 3D6KA 4NOGA 2W7JA 2CTZA 2ZSMA 3WZFA 1W23A 5DJ1A 3HDOA 2D7YA 3N0LA 1AHGA 5EQCA 1AMSA 2D64A 2OGAA 3M5UA 4KAMA 2BI5A 2HP1A 4XK1A 1ASNA 3LY1A 3B46A 2CANA 3CQ6A 1C9CA 2CH1A 5DB5A 1G7XA 4A6TA 1I43A 1EG5A 1GC0A 2QBTA 4IXOA 2BI3A 4ATPA 5M4BA 2JG2A 2BIGA 3UWCA 4AZKA 4N0WA 1B5OA 3QHXA 2V0YA 2PB2A 4OYTA 1M0NA 4KXKA 4DBCA 1DJ9A 1IX7A 3F0HA 4ZM4A 3UE8A 2O7CA 3GZDA 2YRRA 1AJSB 1S09A 1TATA 1RV3A 2ZYJA 1U08A 3FTBA 1M0PA 3NYUA 4I8AA 5G4JA 4JEWA 4WXGA 5TF5A 1BJNA 2AATA 1W7LA 2GQNA 1JS6A 3DXVA 3GR9A 3K40A 4UHOA 2DR1A 3LWSA 3II0A 3NUBA 2FM1A 4L0OA 1CL2A 1ZODA 3VK2A 5E3KA 1C4KA 4XJOA 3BWNC 4Y0HA 4XJMA 5FT6A 4HVKA 1SF2A 4F5IA 4Q31A 3WY7A 4Q75A 3HLMA 1GEYA 2QB3A 1GDEA 1BJWA 2VMVA 3DXWA 4ZDLA 3WGCA 1LK9A 1Z7DA 3FCRA 4A6UA 3FDDA 5FT8A 1IUGA 4IY7A 1BQAA 1D7UA 3MBBA 1J32A 3PDBB 1M0QA 1CQ7A 1ASCA 1AIAA 2JJFA 2Z9UA 3PAAA 3AEJC 3A9XA 2OQXA 1KMJA 4RKDA 2O0RA 2WK7A 1IVRA 3CBFA 2YKVA 4W91A 2V1PA 2VGZA 4F5LA 4JF0A 1AMRA 3EI5A 1EQBA 1C7NA 1ASDA 4XAUA 2W7LA 4F5FA 1BJ4A 1X28A 4WB0B 3FKDA 4LNJA 1AKAA 5FT5A 4BQ0A 3CQ5A 4W5KA 1DGEA 4UOYA 5FT4A 1WKHA 4WYFA
chains in the Genus database with same CATH superfamily
4OMAA 3R45A 5G2QA 4ZLVA 2Y2JA 1BW0A 3B6FD 4LW4A 1P34D 5E5IA 1V72A 1EQZA 3EIBA 3TQXA 1I48A 1KX3A 3FZ6A 5G09A 1R4VA 4H9PB 3T32A 4W8IA 2W7MA 1P3BC 3MGPC 1V2FA 2VIAA 4F4EA 1KX5B 2AROC 1UU1A 3KWQC 2NQBC 5CP6C 5EUEA 4J8VC 1AOIC 3VH5T 5K8BA 4P3MA 5CPKA 3REHD 3TU4D 2PYOB 3KE3A 4K2IA 3K7YA 1Y4IA 3RBLA 3LV2A 5B0YA 1KMKA 4BA4A 1P3IC 1KL2A 3W98D 2VLFA 1AMQA 3NYTA 5B1MA 1AY8A 4A0HA 3REJA 4ADCA 5AV8A 3MGSB 4X23C 1D7SA 3ZRRA 3WTPE 2PB0A 1WWIA 3GETA 3UTAC 1KX4B 5C3IB 3C1CB 1UKJA 3X1TD 3AYWB 3AN2B 4Z5TA 2YKXA 4H51A 2R5EA 1N2TA 3A1KA 2BI9A 3NX3A 2W7DA 4YS3C 2DKBA 1CL1A 2AY2A 3WTPC 2ZY4A 2IO5C 1M18B 4GSAA 2ZY3A 5GT3A 1VP4A 2RVQC 5F99B 4J5UA 4K05A 1ID3A 4WU9C 2BWOA 5B0ZC 2D63A 3W99B 1E5FA 3A2BA 4PFFA 3AATA 4XUJD 1LS3A 2HUFA 3AENA 3ZRQA 1AICA 5EUDA 4H9RA 3AZHB 3F6TA 2JSSA 5AVCD 1ZC9A 4ZWMA 2D61A 1M0OA 5BNVA 2CINA 4QGRA 1KL1A 2QSRA 3B8XA 1JG8A 2VLHA 5B31A 3RCHA 1RV4A 1EQZC 3AZGA 3RELB 1KX3C 3X1SB 2AY4A 5BT1C 1HTAA 4ISYA 2C81A 1MAQA 3NQJB 1DJEA 1CZCA 2VMQA 5DNMA 1Z2CB 4R5ZA 2AY9A 5B1LA 1AX4A 5GT0B 1JS3A 1BS0A 3E2FA 2CFBA 5CPKC 2FN6A 5AY8B 5B33A 4LD9B 1GEWA 3GSBA 4Z66B 5B0YC 2YCTA 4KHAA 1ZOBA 3AV1A 5CPJA 3L8AA 2BYLA 2EPJA 5B1MC 3FQ7A 1W7NA 4OC9A 3REJC 2CJDA 4BA5A 3AZLA 1P3AB 5JRGB 5AV8C 2YFWB 2W8SA 3AV2D 4JEYA 5D5SA 1M32A 2Y2LA 5AV9A 4Z5TC 4CBSA 3G0TA 1M6SA 4B98A 1AHEA 4ZAHA 4ZBJB 2FJ7B 5KDMA 3NYSA 1M1AB 4ZASA 4GE7A 4UHMA 3NRAA 3L44A 3LVJA 3B6GA 2VGVA 3VK4A 3WAAB 4HGAB 4WD2A 5GT3C 3DODA 2HUEB 1TZYD 3MGRB 1SFFA 1ID3C 5BJ4A 5F9SA 5DNNB 4OT8A 4E3RA 5B32G 4R8PD 3KUYD 3UT9B 3AOVA 1P3GA 4ZM3A 3JW9A 5EFSA 3AV7A 1ARGA 4WYDA 2F8NG 3BWNA 3IHJA 1MDZA 4W1VA 2JJEA 2EZ2A 1SZSA 5JA4B 4J8XD 2Q7WA 1X29A 3BCBA 5B31C 1P3OB 1JF9A 3W96D 1P3PA 1FG7A 2XBNA 3AOWA 1P3FA 3AZGC 3TATA 4YM6B 3AZJD 4OBUA 3X1VD 1LC5A 1M4NA 5HHYA 1LKCA 1YIYA 3NTJA 3WKSA 3KSYA 2HOZA 3QM2A 2VGSA 4F5JA 2Y2OA 5DNMC 1O61A 1A7WA 5FUGB 2E7IA 4R8DA 3B6FB 3W1JA 1P34B 5B1LC 1PZRA 3A1IA 1Z3ZA 5AVBD 2DGLA 4UUZB 1O62A 2BWNA 4DGTA 2BI1A 3RBFA 2AY7A 3PD6B 2VGTA 5CHLB 3MAFB 2BYKB 5B33C 4A0GA 3E77A 1D2FA 3ELEA 4UQVA 2W8JA 4JEXA 4MY5A 1W3UA 4WYCA 4RJ0A 1TOJA 2VMNA 3AV1C 5CPJC 3MEBA 1IX6A 1F66D 1WYUB 4GE4A 5GXQA 4CAYB 1DKAA 2YHKA 3B1CA 4H9PA 3REHB 3TU4B 3AZLC 2W7JA 3AZID 1KX5A 1HQ3D 3N0LA 5BO0B 3W98B 2UWXA 3AFAD 5AV9C 3MVDD 3CQ6A 5DB5A 2BI3A 4ATPA 4J8UD 4N0WA 3B6GC 2PYOA 3QHXA 2V0YA 4DBCA 4ZM4A 3GZDA 3X1TB 1TATA 4KUDD 2AATA 1W7LA 2Y2KA 2GQNA 1P3GC 3LWSA 3II0A 4JJND 4XJOA 3BWNC 3MGSA 4F5IA 3WY7A 3KXBB 2VMVA 1KX4A 4ZDLA 3C1CA 1LK9A 1BQAA 3AYWA 3AN2A 3MBBA 1M0QA 4XUJB 1P3PC 2Z9UA 1P3FC 1KMJA 1IVRA 4H9OB 2YKVA 3NQUB 4XZQD 2VGZA 4F5LA 1M18A 4Z2MG 3WKJD 2LY8A 4H9QB 5AVCB 5F99A 4AWLB 3N4RA 4WYFA 2DGMA 2YFVB 3W99A 2OKKA 3EPHA 4IXZA 2NZDD 4IYOB 4WXBA 2ZY5A 3H0MC 3AZHA 4A0RA 2Y2MA 4WU8D 4GDYA 3ASBA 3H9XA 3MGPA 3IP4C 5AY8D 4JEZA 1SPAA 3RELA 3FDBA 2ZUKA 3X1SA 1TOGA 2VMUA 5B2JD 5BS7A 1N31A 3ACZA 1QJ5A 4IXSA 3NQJA 1KX5C 3AEMA 1I41A 4E44A 2OGEA 3EI8A 2QB2A 2CJHA 2PO3A 5GT0A 3BS8A 3REID 5D95A 1DJUA 4F5GA 4HF8A 2VI9A 2PYOC 1T3IA 1B5PA 3PIUA 1M1AD 4LD9A 2D7ZA 3AV2B 4M6BA 2NMPA 2CJGA 4Z66A 3GZDC 5B32D 2C44A 3O62D 3EIAA 1CQ8A 2GMSA 1ASBA 5HXXA 2ZSLA 2F8ND 2BG1A 3P1TA 3UTBD 3X1UD 5M4DA 1P3AA 3AZED 5GSUD 5JRGA 2YFWA 3WTPA 3MGSC 2G5HC 1TZYB 4A6RA 1KX4C 5C3IC 3C1CC 4R8PB 3KUYB 5BNXB 3AYWC 3AN2C 4E77A 4DQ6A 3DYDA 2FJ7A 1ASMA 4FFCA 2GSAA 3WAAA 1M18C 5J8QA 5M49A 3VH5A 3W1IA 1YAAA 4J8XB 5E5AD 3ATHA 3MGRA 5F99C 4RLGA 1U35D 5DNNA 5AV5D 3W96B 2E7JA 3UT9A 3W99C 3COGA 3AZJB 3HMUA 1P3MD 5JAYA 3X1VB 3DRDA 1M7YA 3MC6A 3AZHC 4JEVA 4WV4B 5JA4A 1M19D 3FSLA 3WLXA 1P3OA 3AZFD 3MAUA 5AVBB 3AZMD 1AHYA 4OBVA 3MGQD 4KGCD 2AY8A 3RELC 3VH6T 4YM6A 3X1SC 5BS7C 2C7TA 1W7MA 4BMKA 3WGBA 2Z1YA 3AEMC 5FUGA 3B6FA 1MAPA 1P34A 1LC8A 3AZKD 4ZDPA 4UUZA 3REKD 3H0RC 5GT0C 2W8UA 3FZ8A 5G49B 1F66B 3KFUG 4PFNA 4AO4A 3AEOA 5B24D 2AY5A 3PD6A 2QLRA 3MAFA 3H7FA 2BYKA 3AZIB 4LD9C 4CXQA 4ZSWA 1HQ3B 3GZCA 4Z66C 4TMRA 3AFAB 1GC2A 3MVDB 4J8WD 3EI6A 1S07A 3N75A 3USFA 1G7WA 3CQ4A 4RIZA 3N4XA 3VAXA 1WYUA 4J8UB 3AEPA 4CVQA 3WCNA 1AKCA 4CAYA 4ZUXD 3REHA 3TU4A 4RITA 1TPLA 2KFPA 2HZPA 1P3AC 5JRGC 4LW2A 1G4VA 1S32D 1QZ9A 2ZY2A 1OHYA 2G7JA 5BO0A 3B1DA 4KUDB 3W98A 3WX9A 3KXBD 1Q9CA 2EO5A 3PGYA 4ZBJC 2FJ7C 4ADBA 4JJNB 1M1AC 2VMRA 2GB3A 3LELD 3WAAC 4CSRB 4K2BA 4HGAC 1T3UA 3ZZKA 4EFFA 2HUEC 2X5DA 3MGRC 2XD1A 3X1TA 5DNNC 3BCXA 3UT9C 2WK8A 1H0CA 4A00A 1TASA 4R2NA 3JZLA 5M46A 2Z1ZA 4RM1A 2BYMB 2ORDA 4XZQB 4OTLA 5F8VA 3WKJB 5EIGB 3MC6C 3E6GA 2BIAA 1X0MA 2Y2GA 4RAEA 2Z61A 3E2ZB 4DRBA 2Z9XA 3KGWA 1P3OC 4XUJA 4M2JA 5I92A 3RI6A 3LZ1D 1V2EA 2CSTA 4YM6C 3I4JA 2NZDB 4H9OA 3NQUA 4QLCD 1ASLA 4WU8B 4H9QA 3JWAA 5AVCA 2X3LA 5CPID 4PIWA 2AY1A 1TOEA 3B6FC 1YJSA 2YFVA 1P34C 4H9SA 3P5JB 3GJUA 2R0TA 1ASGA 1YJZA 2FNIA 2R2NA 2L5AA 1B8GA 2JISA 2TPLA 4NE3A 3JWBA 5B2JB 4IYOA 1XI9A 3MNND 3HL2A 3EG5B 2ZSMA 3WZFA 1W23A 2AEUA 2D7YA 5EQCA 1AMSA 2D64A 2OGAA 4KAMA 2BI5A 2HP1A 4XK1A 3B46A 3REIB 2CANA 1C9CA 4A6TA 1I43A 4J8LA 5B40D 3REHC 3TU4C 1H3OB 4EO5B 1P3LD 4OYTA 3V9RB 3B0DB 2DF4C 5B32B 3W98C 5B2IB 1IX7A 3O62B 3UE8A 2O7CA 2ZYJA 5G4JA 1RV3A 3NYUA 4WXGA 4H9NB 3LJAD 2F8NB 4UHOA 3UTBB 1W2EA 3X1UB 3NUBA 2FM1A 3AZEB 3WA9B 5GSUB 1ZODA 3VK2A 1N1JB 2CV5D 4Y0HA 4XJMA 3AV2A 4Q31A 3LZ0D 3AL0C 1BFMA 3X1TC 3W97D 3HT4A 1Z7DA 4A6UA 3FDDA 1D7UA 1J32A 4G91B 1AIAA 2JJFA 3C1BD 3CBFA 4W91A 3A6ND 5E5AB 1TZYA 1C7NA 3KXBC 4F5FA 1U35B 4WB0B 5FT5A 3CQ5A 4UOYA 5AV5B 4R8PA 3KUYA 5BNXA 2W7EA 4XUJC 1P3MB 4F5HA 4MKJA 1PG8A 4WYEA 4MQQA 3FVSA 2YKYA 5AVCC 4J8XA 4DQYB 2WK9A 1M19B 1P3KD 5EAVA 4AWLC 4OCAA 3AZFB 1ECXA 3I5TA 3AZMB 3W96A 1D7RA 1XEYA 3PA9A 4H9SC 1BH8B 3MGQB 4F5MA 4KGCB 3A9ZA 5E4ZA 3AZJA 1GCKA 3X1VA 2BI2A 4R5FA 1X2AA 2VMXA 3AZND 2YCNA 2VMOA 2YRIA 2D66A 1LW5A 3OP7A 1DTYA 3EPLA 3NU7A 3KKIA 3AELA 1P3WA 4CXRA 1ASEA 3AZKB 5AVBA 1IX8A 3REKB 5IWQA 2VGUA 3FRKA 3HVYA 2W7HA 5B24B 2JJGA 3R9AA 2JCHA 4W1XA 3N4SA 2HIOD 2YOBA 3HQTA 5AV6D 1C0NA 1FG3A 3P6KA 1ZLAD 4XQ2A 1AY4A 1G4XA 3K28A 4J8WB 3LG0A 1BKGA 3NDNA 4GRXA 5G49A 1F66A 1JFIB 1O4SA 4ZUXB 5G0AA 2DGKA 2BHXA 3AZIA 1S32B 1HQ3A 3AV2C 3B0BA 2W8WA 1KKPA 3AFAA 2ZJGA 4ADEA 2YCPA 2VI8A 2XD5A 3MVDA 4WZSB 3EI7A 3FFRA 4XJPA 4F5KA 3JTXA 3ASAA 4J8UA 4ZSYA 3LELB 3DU4A 3FFHA 1QIRA 5B31G 1S0AA 2FKIA 4WP0A 1TZYC 3B0CW 4KUDA 4R8PC 3KUYC 1P3BD 2R5CB 1TOKA 2X5FA 3LVLB 2AROD 4JJNA 3KWQD 2CH2A 3QN6A 4ATQA 2NQBD 5CP6D 1KU5A 4CSRA 4J8VD 2CB1A 2F2AC 1AOID 5DJ9A 1AY5A 4J8XC 4UHNA 1OHVA 3FZ7A 4W1WA 3E9KA 4Q6RA 3W96C 4B9BA 1WYTB 7AATA 4DRAA 3LZ1B 3TCMA 3AZJC 3X1VC 2BYMA 4XZQA 2AY6A 3DR7A 4QLCB 1P3ID 1WSTA 2CWEA 3WKJA 5EIGA 1MLZA 3VH6W 3PDXA 5CPIB 3VH5W 2BIEA 3R4TA 1ELQA 1GBNA 1WYVB 2HOYA 2Z9WA 3TFUA 4EB5A 3GWPA 5AVBC 1WWSA 4X23D 4ADDA 5EUNA 3UTAD 2NZDA 1AMAA 3MNNB 4WU8A 3N7NA 1KAFA 1CJ0A 4AH3A 4FL0A 5AY8A 4YS3D 1AAWA 1B67A 3WTPD 4ZWVA 3TFTA 2QMAA 4GE9A 2ZC0A 5B2ID 2DQNC 1F66C 4WYAA 2RVQD 5B40B 5B2JA 2AY3A 5C6UA 3MKJA 2W7GA 4WU9D 5B0ZD 3AZIC 1P3LB 1MGVA 2QA3A 1B9HA 5AX8A 1HQ3C 3H0LC 3WA9D 3QGUA 3AFAC 4E1OA 2X8UA 3MVDC 1GD9A 4AZJA 4NE6A 4GEBA 1QJ3A 3REIA 3LJAB 3EPJA 3UAKA 1S06A 4J8UC 2VMSA 1LC7A 2C0RA 1PMMA 3BN1A 2CV5B 1M1AA 1H3OA 1EQZD 3LZ0B 3VH6A 1WKGA 4ZDOA 3V9RA 1KX3D 2F8JA 5B32A 4KUDC 5BT1D 3O62A 3W97B 2D65A 1AIBA 1SVVA 4H9NA 2GMUA 3QPGA 4AO9A 2F8NA 4JJNC 2Y2HA 3UTBA 3X1UA 3C1BB 3AZEA 5GSUA 3A6NB 1N1JA 1ARIA 2RFVA 3MADA 3A8UX 2RIQA 3QBOA 2EH6A 3BCAA 1FC4A 2EGYA 2WKAA 1AAMA 2VMWA 5CPKD 3A9YA 1TARA 3ZRPA 4EMYA 2VYCA 1C7OA 5B0YD 4XZQC 3VK3A 3WKJC 4KYOA 5DX5A 1BT4A 1GC3A 4MKKA 5GXQB 5E5AA 5B1MD 1P3KB 1U35A 4WB0A 1AHXA 3REJD 5AV5A 3BV0A 5EAAA 2YKUA 1D7VA 5AV8D 1QISA 1QITA 1P3MA 3CAIA 2NZDC 1BJOB 4Y0DA 3PPLA 2W8VA 3BC8A 4WLJA 3AZNB 4WU8C 4Z5TD 2Y2QA 1ORDA 4LNMA 3EZSA 5AY8C 1M19A 3D6KA 4G92B 3AZFA 3HDOA 3AZMA 4WJ3C 1BH8A 3MGQA 2A1VA 4KGCA 5GT3D 3LY1A 5B2JC 1ID3D 1G7XA 2VQRA 1EG5A 1GC0A 2HIOB 4WNNB 5M4BA 2JG2A 5AV6B 2BIGA 2EYQA 1ZLAB 3VP6A 4NFTA 3AZKA 3F0HA 2ZM5A 3REKA 2YRRA 1AJSB 1S09A 3REIC 3FTBA 5B24A 5TF5A 1JS6A 3GR9A 2DR1A 5B31D 4EO5C 1CL2A 1C4KA 3AZGD 4HVKA 1SF2A 3B0DC 5B32C 5B2IC 4J8WA 3O62C 4Q75A 3HLMA 1GEYA 2QB3A 2F8NH 1GDEA 3FCRA 1JFIA 1IUGA 4IY7A 3PDBB 4ZUXA 3UTBC 3X1UC 1CQ7A 1ASCA 5DNMD 3AZEC 3PAAA 3WA9C 5GSUC 2J8PA 2OQXA 5B1LD 2WK7A 1S32A 4JF0A 1AMRA 3EI5A 1BJ4A 1X28A 3KXBA 1P3BB 3FKDA 3MGPB 4BQ0A 5B33D 5FT4A 1WKHA 3OKSA 2AROB 4A72A 2OATA 3RUYA 2VMPA 4G91C 2HORA 3KWQB 2NQBB 5CP6B 3B1EA 3LELA 4J8VB 3ZZJA 1AOIB 3AV1D 5CPJD 1BH9B 5E5AC 1U35C 1RVUA 5AV5C 1SZUA 3AZLD 1ASAA 2HOXA 2R5CA 3F9TA 1GC4A 1MLYA 4JF1A 4M2MA 4P7YA 1P3MC 3PJ0A 4LNLA 2W7IA 1P3IB 2DKJA 5AV9D 2W7FA 3LVKA 1KKJA 3LVMA 1IAXA 1M19C 3AZFC 3AZMC 2HUIA 3B6GD 1WYTA 4X23B 3MGQC 4KGCC 1H1CA 3LZ1A 3UTAB 3BWOA 2FNUA 3G8MA 2E54A 1AJRA 3ECDA 4QLCA 4EU1A 1BQDA 1IBJA 4YS3B 5CPIA 1P3GD 3WTPB 2IO5B 2F8NK 1WYVA 3AZKC 4RJYA 3REKC 1OXOA 2VIBA 4EB7A 5B24C 4WLHA 4WU9B 5B0ZB 3MNNA 4MQPA 1P3PD 2CY8A 4WYGA 4WXFA 1OHWA 1P3FD 3FVUA 4IX8A 1TAFB 1O69A 2BYJA 4J8WC 4ITGA 1B9IA 2G5IC 3FVXA 1CZEA 3DR4A 3N5MA 5G2PA 3Q8NA 3R45B 5B40A 4ZUXC 1P3LA 1CS1A 1EQZB 2Y2IA 1S32C 4WBTA 1KX3B 4PVFA 2ZP7A 8AATA 1ARTA 3ISLA 1OXPA 1V2DA 3LJAA 4Z2MH 4U2HA 4K2MA 4RKCA 2AEVA 2VGWA 3LELC 2CV5A 1PMOA 1ELUA 1S08A 3LZ0A 1LW4A 2Z20A 1C7GA 9AATA 5GXQD 4LC3A 3W97A 5CPKB 4ITXA 1KX5D 3EPKA 5B0YB 3C1BA 1EJIA 2HUUA 3A6NA 4Y0IA 3WCOA 1DGDA 4E3QA 5B1MB 1DFOA 2HP2A 1ASFA 2Z9VA 4IW7A 1AKBA 3REJB 4H63Q 3KGXA 2O1BA 5AV8B 1VEFA 2PYOD 3LZ1C 2VMZA 3E2YA 1SZKA 3EZ1A 3RQ1A 3EUCA 1B4XA 4QLCC 2BWPA 2FYFA 1QGNA 4Z5TB 1UU0A 4A0FA 3ELPA 5CPIC 1P3KA 3FQ8A 1RVYA 2EZ1A 3GBXA 1IJIA 1UU2A 5GT3B 1YJYA 3MGSD 4NE5A 1TOIA 2W7KA 2FFFB 2OKJA 1MDOA 1GEXA 1ID3B 1KX4D 1BJOA 2E7UA 3C1CD 3MNNC 3AZNA 3AYWD 3AN2D 5G4IA 3AENB 5HDMA 4H9RB 2XH1A 2VMTA 4AOAA 2JJHA 1M18D 3EI9A 3NU8A 3NNKA 1YIZA 5BNVB 1PFFA 5F99D 2G6WA 5B40C 5B31B 2HIOA 3RCHB 4WNNA 1P3LC 3W99D 5AV6A 3AZGB 1ZLAA 1ARSA 3QI6A 1MDXA 4M2KA 4O6ZA 4TN4A 4E45A 2W8TA 1E5EA 3AZHD 1AJSA 3LJAC 2FQ6A 3MGPD 2JE5A 3G7QA 3VOMA 5DNMB 1ARHA 3DC1A 1N8PA 2CV5C 5B1LB 3AEJA 5BJ3A 3LZ0C 1IAYA 4XJLA 3RELD 3X1SD 3NUIA 2JGTA 1YOOA 3W97C 3W1HA 5B33B 4XEWA 1VJOA 2Y2NA 3PDBA 4MSOA 4CBRA 3C1BC 4KHAB 4Q76A 3A6NC 4BHDA 3AV1B 1J04A 5CPJB 5GT0D 5KTBA 2VMYA 1AHFA 1YNUA 1P3BA 3WKRA 3AZLB 3FQAA 3E2ZA 1OATA 4LD9D 1I29A 2AROA 2DOUA 2BKWA 2D5YA 3KWQA 4Z66D 1CQ6A 2NQBA 5CP6A 1F1EA 5AV9B 4J8VA 4MQRA 1AOIA 3DZZA 5GXQC 4U1TA 1BH9A 1B6WA 5KDMB 1P3KC 3BB8A 3B6GB 4NOGA 2CTZA 1P3AD 5DJ1A 5JRGD 1AHGA 3FD0A 3M5UA 1ULYA 1ASNA 1P3IA 2CH1A 3AZNC 1P3GB 2QBTA 4IXOA 2FJ7D 3UWCA 4AZKA 1B5OA 4G92C 2PB2A 1M0NA 4KXKA 3WAAD 1DJ9A 4X23A 3UTAA 4I8AA 1U08A 1M0PA 3MGRD 4JEWA 1BJNA 5DNND 3DXVA 3K40A 2HIOC 1P3PB 3UT9D 4L0OA 5AV6C 4YS3A 1P3FB 5E3KA 1ZLAC 5FT6A 5B2IA 1BJWA 2Y2PA 3DXWA 3WGCA 5FT8A 4WU9A 5B0ZA 1P3OD 3AEJC 3A9XA 3WA9A 4RKDA 2O0RA 2WB6A 3B0CT 1TAFA 2V1PA 4YM6D 1EQBA 3I16A 1ASDA 4XAUA 2W7LA 3HBXA 4UPKA 4LNJA 1AKAA 4W5KA 1DGEA
chains in the Genus database with same CATH topology
4OMAA 3R45A 5G2QA 4ZLVA 2Y2JA 1BW0A 3B6FD 4LW4A 1P34D 5E5IA 1V72A 1EQZA 3EIBA 3TQXA 1I48A 1KX3A 3FZ6A 5G09A 1R4VA 4H9PB 3T32A 4W8IA 2W7MA 1P3BC 3MGPC 1V2FA 2VIAA 4F4EA 1KX5B 2AROC 1UU1A 3KWQC 2NQBC 5CP6C 5EUEA 4J8VC 1AOIC 3VH5T 5K8BA 4P3MA 5CPKA 3REHD 3TU4D 2PYOB 3KE3A 4K2IA 3K7YA 1Y4IA 3RBLA 3LV2A 5B0YA 1KMKA 4BA4A 1P3IC 1KL2A 3W98D 2VLFA 1AMQA 3NYTA 5B1MA 1AY8A 4A0HA 3REJA 4ADCA 5AV8A 3MGSB 4X23C 1D7SA 3ZRRA 3WTPE 2PB0A 1WWIA 3GETA 3UTAC 1KX4B 5C3IB 3C1CB 1UKJA 3X1TD 3AYWB 3AN2B 4Z5TA 2YKXA 4H51A 2R5EA 1N2TA 3A1KA 2BI9A 3NX3A 2W7DA 4YS3C 2DKBA 1CL1A 2AY2A 3WTPC 2ZY4A 2IO5C 1M18B 4GSAA 2ZY3A 5GT3A 1VP4A 2RVQC 5F99B 4J5UA 4K05A 1ID3A 4WU9C 2BWOA 5B0ZC 2D63A 3W99B 1E5FA 3A2BA 4PFFA 3AATA 4XUJD 1LS3A 2HUFA 3AENA 3ZRQA 1AICA 5EUDA 4H9RA 3AZHB 3F6TA 2JSSA 5AVCD 1ZC9A 4ZWMA 2D61A 1M0OA 5BNVA 2CINA 4QGRA 1KL1A 2QSRA 3B8XA 1JG8A 2VLHA 5B31A 3RCHA 1RV4A 1EQZC 3AZGA 3RELB 1KX3C 3X1SB 2AY4A 5BT1C 1HTAA 4ISYA 2C81A 1MAQA 3NQJB 1DJEA 1CZCA 2VMQA 5DNMA 1Z2CB 4R5ZA 2AY9A 5B1LA 1AX4A 5GT0B 1JS3A 1BS0A 3E2FA 2CFBA 5CPKC 2FN6A 5AY8B 5B33A 4LD9B 1GEWA 3GSBA 4Z66B 5B0YC 2YCTA 4KHAA 1ZOBA 3AV1A 5CPJA 3L8AA 2BYLA 2EPJA 5B1MC 3FQ7A 1W7NA 4OC9A 3REJC 2CJDA 4BA5A 3AZLA 1P3AB 5JRGB 5AV8C 2YFWB 2W8SA 3AV2D 4JEYA 5D5SA 1M32A 2Y2LA 5AV9A 4Z5TC 4CBSA 3G0TA 1M6SA 4B98A 1AHEA 4ZAHA 4ZBJB 2FJ7B 5KDMA 3NYSA 1M1AB 4ZASA 4GE7A 4UHMA 3NRAA 3L44A 3LVJA 3B6GA 2VGVA 3VK4A 3WAAB 4HGAB 4WD2A 5GT3C 3DODA 2HUEB 1TZYD 3MGRB 1SFFA 1ID3C 5BJ4A 5F9SA 5DNNB 4OT8A 4E3RA 5B32G 4R8PD 3KUYD 3UT9B 3AOVA 1P3GA 4ZM3A 3JW9A 5EFSA 3AV7A 1ARGA 4WYDA 2F8NG 3BWNA 3IHJA 1MDZA 4W1VA 2JJEA 2EZ2A 1SZSA 5JA4B 4J8XD 2Q7WA 1X29A 3BCBA 5B31C 1P3OB 1JF9A 3W96D 1P3PA 1FG7A 2XBNA 3AOWA 1P3FA 3AZGC 3TATA 4YM6B 3AZJD 4OBUA 3X1VD 1LC5A 1M4NA 5HHYA 1LKCA 1YIYA 3NTJA 3WKSA 3KSYA 2HOZA 3QM2A 2VGSA 4F5JA 2Y2OA 5DNMC 1O61A 1A7WA 5FUGB 2E7IA 4R8DA 3B6FB 3W1JA 1P34B 5B1LC 1PZRA 3A1IA 1Z3ZA 5AVBD 2DGLA 4UUZB 1O62A 2BWNA 4DGTA 2BI1A 3RBFA 2AY7A 3PD6B 2VGTA 5CHLB 3MAFB 2BYKB 5B33C 4A0GA 3E77A 1D2FA 3ELEA 4UQVA 2W8JA 4JEXA 4MY5A 1W3UA 4WYCA 4RJ0A 1TOJA 2VMNA 3AV1C 5CPJC 3MEBA 1IX6A 1F66D 1WYUB 4GE4A 5GXQA 4CAYB 1DKAA 2YHKA 3B1CA 4H9PA 3REHB 3TU4B 3AZLC 2W7JA 3AZID 1KX5A 1HQ3D 3N0LA 5BO0B 3W98B 2UWXA 3AFAD 5AV9C 3MVDD 3CQ6A 5DB5A 2BI3A 4ATPA 4J8UD 4N0WA 3B6GC 2PYOA 3QHXA 2V0YA 4DBCA 4ZM4A 3GZDA 3X1TB 1TATA 4KUDD 2AATA 1W7LA 2Y2KA 2GQNA 1P3GC 3LWSA 3II0A 4JJND 4XJOA 3BWNC 3MGSA 4F5IA 3WY7A 3KXBB 2VMVA 1KX4A 4ZDLA 3C1CA 1LK9A 1BQAA 3AYWA 3AN2A 3MBBA 1M0QA 4XUJB 1P3PC 2Z9UA 1P3FC 1KMJA 1IVRA 4H9OB 2YKVA 3NQUB 4XZQD 2VGZA 4F5LA 1M18A 4Z2MG 3WKJD 2LY8A 4H9QB 5AVCB 5F99A 4AWLB 3N4RA 4WYFA 2DGMA 2YFVB 3W99A 2OKKA 3EPHA 4IXZA 2NZDD 4IYOB 4WXBA 2ZY5A 3H0MC 3AZHA 4A0RA 2Y2MA 4WU8D 4GDYA 3ASBA 3H9XA 3MGPA 3IP4C 5AY8D 4JEZA 1SPAA 3RELA 3FDBA 2ZUKA 3X1SA 1TOGA 2VMUA 5B2JD 5BS7A 1N31A 3ACZA 1QJ5A 4IXSA 3NQJA 1KX5C 3AEMA 1I41A 4E44A 2OGEA 3EI8A 2QB2A 2CJHA 2PO3A 5GT0A 3BS8A 3REID 5D95A 1DJUA 4F5GA 4HF8A 2VI9A 2PYOC 1T3IA 1B5PA 3PIUA 1M1AD 4LD9A 2D7ZA 3AV2B 4M6BA 2NMPA 2CJGA 4Z66A 3GZDC 5B32D 2C44A 3O62D 3EIAA 1CQ8A 2GMSA 1ASBA 5HXXA 2ZSLA 2F8ND 2BG1A 3P1TA 3UTBD 3X1UD 5M4DA 1P3AA 3AZED 5GSUD 5JRGA 2YFWA 3WTPA 3MGSC 2G5HC 1TZYB 4A6RA 1KX4C 5C3IC 3C1CC 4R8PB 3KUYB 5BNXB 3AYWC 3AN2C 4E77A 4DQ6A 3DYDA 2FJ7A 1ASMA 4FFCA 2GSAA 3WAAA 1M18C 5J8QA 5M49A 3VH5A 3W1IA 1YAAA 4J8XB 5E5AD 3ATHA 3MGRA 5F99C 4RLGA 1U35D 5DNNA 5AV5D 3W96B 2E7JA 3UT9A 3W99C 3COGA 3AZJB 3HMUA 1P3MD 5JAYA 3X1VB 3DRDA 1M7YA 3MC6A 3AZHC 4JEVA 4WV4B 5JA4A 1M19D 3FSLA 3WLXA 1P3OA 3AZFD 3MAUA 5AVBB 3AZMD 1AHYA 4OBVA 3MGQD 4KGCD 2AY8A 3RELC 3VH6T 4YM6A 3X1SC 5BS7C 2C7TA 1W7MA 4BMKA 3WGBA 2Z1YA 3AEMC 5FUGA 3B6FA 1MAPA 1P34A 1LC8A 3AZKD 4ZDPA 4UUZA 3REKD 3H0RC 5GT0C 2W8UA 3FZ8A 5G49B 1F66B 3KFUG 4PFNA 4AO4A 3AEOA 5B24D 2AY5A 3PD6A 2QLRA 3MAFA 3H7FA 2BYKA 3AZIB 4LD9C 4CXQA 4ZSWA 1HQ3B 3GZCA 4Z66C 4TMRA 3AFAB 1GC2A 3MVDB 4J8WD 3EI6A 1S07A 3N75A 3USFA 1G7WA 3CQ4A 4RIZA 3N4XA 3VAXA 1WYUA 4J8UB 3AEPA 4CVQA 3WCNA 1AKCA 4CAYA 4ZUXD 3REHA 3TU4A 4RITA 1TPLA 2KFPA 2HZPA 1P3AC 5JRGC 4LW2A 1G4VA 1S32D 1QZ9A 2ZY2A 1OHYA 2G7JA 5BO0A 3B1DA 4KUDB 3W98A 3WX9A 3KXBD 1Q9CA 2EO5A 3PGYA 4ZBJC 2FJ7C 4ADBA 4JJNB 1M1AC 2VMRA 2GB3A 3LELD 3WAAC 4CSRB 4K2BA 4HGAC 1T3UA 3ZZKA 4EFFA 2HUEC 2X5DA 3MGRC 2XD1A 3X1TA 5DNNC 3BCXA 3UT9C 2WK8A 1H0CA 4A00A 1TASA 4R2NA 3JZLA 5M46A 2Z1ZA 4RM1A 2BYMB 2ORDA 4XZQB 4OTLA 5F8VA 3WKJB 5EIGB 3MC6C 3E6GA 2BIAA 1X0MA 2Y2GA 4RAEA 2Z61A 3E2ZB 4DRBA 2Z9XA 3KGWA 1P3OC 4XUJA 4M2JA 5I92A 3RI6A 3LZ1D 1V2EA 2CSTA 4YM6C 3I4JA 2NZDB 4H9OA 3NQUA 4QLCD 1ASLA 4WU8B 4H9QA 3JWAA 5AVCA 2X3LA 5CPID 4PIWA 2AY1A 1TOEA 3B6FC 1YJSA 2YFVA 1P34C 4H9SA 3P5JB 3GJUA 2R0TA 1ASGA 1YJZA 2FNIA 2R2NA 2L5AA 1B8GA 2JISA 2TPLA 4NE3A 3JWBA 5B2JB 4IYOA 1XI9A 3MNND 3HL2A 3EG5B 2ZSMA 3WZFA 1W23A 2AEUA 2D7YA 5EQCA 1AMSA 2D64A 2OGAA 4KAMA 2BI5A 2HP1A 4XK1A 3B46A 3REIB 2CANA 1C9CA 4A6TA 1I43A 4J8LA 5B40D 3REHC 3TU4C 1H3OB 4EO5B 1P3LD 4OYTA 3V9RB 3B0DB 2DF4C 5B32B 3W98C 5B2IB 1IX7A 3O62B 3UE8A 2O7CA 2ZYJA 5G4JA 1RV3A 3NYUA 4WXGA 4H9NB 3LJAD 2F8NB 4UHOA 3UTBB 1W2EA 3X1UB 3NUBA 2FM1A 3AZEB 3WA9B 5GSUB 1ZODA 3VK2A 1N1JB 2CV5D 4Y0HA 4XJMA 3AV2A 4Q31A 3LZ0D 3AL0C 1BFMA 3X1TC 3W97D 3HT4A 1Z7DA 4A6UA 3FDDA 1D7UA 1J32A 4G91B 1AIAA 2JJFA 3C1BD 3CBFA 4W91A 3A6ND 5E5AB 1TZYA 1C7NA 3KXBC 4F5FA 1U35B 4WB0B 5FT5A 3CQ5A 4UOYA 5AV5B 4R8PA 3KUYA 5BNXA 2W7EA 4XUJC 1P3MB 4F5HA 4MKJA 1PG8A 4WYEA 4MQQA 3FVSA 2YKYA 5AVCC 4J8XA 4DQYB 2WK9A 1M19B 1P3KD 5EAVA 4AWLC 4OCAA 3AZFB 1ECXA 3I5TA 3AZMB 3W96A 1D7RA 1XEYA 3PA9A 4H9SC 1BH8B 3MGQB 4F5MA 4KGCB 3A9ZA 5E4ZA 3AZJA 1GCKA 3X1VA 2BI2A 4R5FA 1X2AA 2VMXA 3AZND 2YCNA 2VMOA 2YRIA 2D66A 1LW5A 3OP7A 1DTYA 3EPLA 3NU7A 3KKIA 3AELA 1P3WA 4CXRA 1ASEA 3AZKB 5AVBA 1IX8A 3REKB 5IWQA 2VGUA 3FRKA 3HVYA 2W7HA 5B24B 2JJGA 3R9AA 2JCHA 4W1XA 3N4SA 2HIOD 2YOBA 3HQTA 5AV6D 1C0NA 1FG3A 3P6KA 1ZLAD 4XQ2A 1AY4A 1G4XA 3K28A 4J8WB 3LG0A 1BKGA 3NDNA 4GRXA 5G49A 1F66A 1JFIB 1O4SA 4ZUXB 5G0AA 2DGKA 2BHXA 3AZIA 1S32B 1HQ3A 3AV2C 3B0BA 2W8WA 1KKPA 3AFAA 2ZJGA 4ADEA 2YCPA 2VI8A 2XD5A 3MVDA 4WZSB 3EI7A 3FFRA 4XJPA 4F5KA 3JTXA 3ASAA 4J8UA 4ZSYA 3LELB 3DU4A 3FFHA 1QIRA 5B31G 1S0AA 2FKIA 4WP0A 1TZYC 3B0CW 4KUDA 4R8PC 3KUYC 1P3BD 2R5CB 1TOKA 2X5FA 3LVLB 2AROD 4JJNA 3KWQD 2CH2A 3QN6A 4ATQA 2NQBD 5CP6D 1KU5A 4CSRA 4J8VD 2CB1A 2F2AC 1AOID 5DJ9A 1AY5A 4J8XC 4UHNA 1OHVA 3FZ7A 4W1WA 3E9KA 4Q6RA 3W96C 4B9BA 1WYTB 7AATA 4DRAA 3LZ1B 3TCMA 3AZJC 3X1VC 2BYMA 4XZQA 2AY6A 3DR7A 4QLCB 1P3ID 1WSTA 2CWEA 3WKJA 5EIGA 1MLZA 3VH6W 3PDXA 5CPIB 3VH5W 2BIEA 3R4TA 1ELQA 1GBNA 1WYVB 2HOYA 2Z9WA 3TFUA 4EB5A 3GWPA 5AVBC 1WWSA 4X23D 4ADDA 5EUNA 3UTAD 2NZDA 1AMAA 3MNNB 4WU8A 3N7NA 1CJ0A 4AH3A 4FL0A 5AY8A 4YS3D 1AAWA 1B67A 3WTPD 4ZWVA 3TFTA 2QMAA 4GE9A 2ZC0A 5B2ID 2DQNC 1F66C 4WYAA 2RVQD 5B40B 5B2JA 2AY3A 5C6UA 3MKJA 2W7GA 4WU9D 5B0ZD 3AZIC 1P3LB 1MGVA 2QA3A 1B9HA 5AX8A 1HQ3C 3H0LC 3WA9D 3QGUA 3AFAC 4E1OA 2X8UA 3MVDC 1GD9A 4AZJA 4NE6A 4GEBA 1QJ3A 3REIA 3LJAB 3EPJA 3UAKA 1S06A 4J8UC 2VMSA 1LC7A 2C0RA 1PMMA 3BN1A 2CV5B 1M1AA 1H3OA 1EQZD 3LZ0B 3VH6A 1WKGA 4ZDOA 3V9RA 1KX3D 2F8JA 5B32A 4KUDC 5BT1D 3O62A 3W97B 2D65A 1AIBA 1SVVA 4H9NA 2GMUA 3QPGA 4AO9A 2F8NA 4JJNC 2Y2HA 3UTBA 3X1UA 3C1BB 3AZEA 5GSUA 3A6NB 1N1JA 1ARIA 2RFVA 3MADA 3A8UX 2RIQA 3QBOA 2EH6A 3BCAA 1FC4A 2EGYA 2WKAA 1AAMA 2VMWA 5CPKD 3A9YA 1TARA 3ZRPA 4EMYA 2VYCA 1C7OA 5B0YD 4XZQC 3VK3A 3WKJC 4KYOA 5DX5A 1BT4A 1GC3A 4MKKA 5GXQB 5E5AA 5B1MD 1P3KB 1U35A 4WB0A 1AHXA 3REJD 5AV5A 3BV0A 5EAAA 2YKUA 1D7VA 5AV8D 1QISA 1QITA 1P3MA 3CAIA 2NZDC 1BJOB 4Y0DA 3PPLA 2W8VA 3BC8A 4WLJA 3AZNB 4WU8C 4Z5TD 2Y2QA 1ORDA 4LNMA 3EZSA 5AY8C 1M19A 3D6KA 4G92B 3AZFA 3HDOA 3AZMA 4WJ3C 1BH8A 3MGQA 2A1VA 4KGCA 5GT3D 3LY1A 5B2JC 1ID3D 1G7XA 2VQRA 1EG5A 1GC0A 2HIOB 4WNNB 5M4BA 2JG2A 5AV6B 2BIGA 2EYQA 1ZLAB 3VP6A 4NFTA 3AZKA 3F0HA 2ZM5A 3REKA 2YRRA 1AJSB 1S09A 3REIC 3FTBA 5B24A 5TF5A 1JS6A 3GR9A 2DR1A 5B31D 4EO5C 1CL2A 1C4KA 3AZGD 4HVKA 1SF2A 3B0DC 5B32C 5B2IC 4J8WA 3O62C 4Q75A 3HLMA 1GEYA 2QB3A 2F8NH 1GDEA 3FCRA 1JFIA 1IUGA 4IY7A 3PDBB 4ZUXA 3UTBC 3X1UC 1CQ7A 1ASCA 5DNMD 3AZEC 3PAAA 3WA9C 5GSUC 2J8PA 2OQXA 5B1LD 2WK7A 1S32A 4JF0A 1AMRA 3EI5A 1BJ4A 1X28A 3KXBA 1P3BB 3FKDA 3MGPB 4BQ0A 5B33D 5FT4A 1WKHA 3OKSA 2AROB 4A72A 2OATA 3RUYA 2VMPA 4G91C 2HORA 3KWQB 2NQBB 5CP6B 3B1EA 3LELA 4J8VB 3ZZJA 1AOIB 3AV1D 5CPJD 1BH9B 5E5AC 1U35C 1RVUA 5AV5C 1SZUA 3AZLD 1ASAA 2HOXA 2R5CA 3F9TA 1GC4A 1MLYA 4JF1A 4M2MA 4P7YA 1P3MC 3PJ0A 4LNLA 2W7IA 1P3IB 2DKJA 5AV9D 2W7FA 3LVKA 1KKJA 3LVMA 1IAXA 1M19C 3AZFC 3AZMC 2HUIA 3B6GD 1WYTA 4X23B 3MGQC 4KGCC 1H1CA 3LZ1A 3UTAB 3BWOA 2FNUA 3G8MA 2E54A 1AJRA 3ECDA 4QLCA 4EU1A 1BQDA 1IBJA 4YS3B 5CPIA 1P3GD 3WTPB 2IO5B 2F8NK 1WYVA 3AZKC 4RJYA 3REKC 1OXOA 2VIBA 4EB7A 5B24C 4WLHA 4WU9B 5B0ZB 3MNNA 4MQPA 1P3PD 2CY8A 4WYGA 4WXFA 1OHWA 1P3FD 3FVUA 4IX8A 1TAFB 1O69A 2BYJA 4J8WC 4ITGA 1B9IA 2G5IC 3FVXA 1CZEA 3DR4A 3N5MA 5G2PA 3Q8NA 3R45B 5B40A 4ZUXC 1P3LA 1CS1A 1EQZB 2Y2IA 1S32C 4WBTA 1KX3B 4PVFA 2ZP7A 8AATA 1ARTA 3ISLA 1OXPA 1V2DA 3LJAA 4Z2MH 4U2HA 4K2MA 4RKCA 2AEVA 2VGWA 3LELC 2CV5A 1PMOA 1ELUA 1S08A 3LZ0A 1LW4A 2Z20A 1C7GA 9AATA 5GXQD 4LC3A 3W97A 5CPKB 4ITXA 1KX5D 3EPKA 5B0YB 3C1BA 1EJIA 2HUUA 3A6NA 4Y0IA 3WCOA 1DGDA 4E3QA 5B1MB 1DFOA 2HP2A 1ASFA 2Z9VA 4IW7A 1AKBA 3REJB 4H63Q 3KGXA 2O1BA 5AV8B 1VEFA 2PYOD 3LZ1C 2VMZA 3E2YA 1SZKA 3EZ1A 3RQ1A 3EUCA 1B4XA 4QLCC 2BWPA 2FYFA 1QGNA 4Z5TB 1UU0A 4A0FA 3ELPA 5CPIC 1P3KA 3FQ8A 1RVYA 2EZ1A 3GBXA 1IJIA 1UU2A 5GT3B 1YJYA 3MGSD 4NE5A 1TOIA 2W7KA 2FFFB 2OKJA 1MDOA 1GEXA 1ID3B 1KX4D 1BJOA 2E7UA 3C1CD 3MNNC 3AZNA 3AYWD 3AN2D 5G4IA 3AENB 5HDMA 4H9RB 2XH1A 2VMTA 4AOAA 2JJHA 1M18D 3EI9A 3NU8A 3NNKA 1YIZA 5BNVB 1PFFA 5F99D 2G6WA 5B40C 5B31B 2HIOA 3RCHB 4WNNA 1P3LC 3W99D 5AV6A 3AZGB 1ZLAA 1ARSA 3QI6A 1MDXA 4M2KA 4O6ZA 4TN4A 4E45A 2W8TA 1E5EA 3AZHD 1AJSA 3LJAC 2FQ6A 3MGPD 2JE5A 3G7QA 3VOMA 5DNMB 1ARHA 3DC1A 1N8PA 2CV5C 5B1LB 3AEJA 5BJ3A 3LZ0C 1IAYA 4XJLA 3RELD 3X1SD 3NUIA 2JGTA 1YOOA 3W97C 3W1HA 5B33B 4XEWA 1VJOA 2Y2NA 3PDBA 4MSOA 4CBRA 3C1BC 4KHAB 4Q76A 3A6NC 4BHDA 3AV1B 1J04A 5CPJB 5GT0D 5KTBA 2VMYA 1AHFA 1YNUA 1P3BA 3WKRA 3AZLB 3FQAA 3E2ZA 1OATA 4LD9D 1I29A 2AROA 2DOUA 2BKWA 2D5YA 3KWQA 4Z66D 1CQ6A 2NQBA 5CP6A 1F1EA 5AV9B 4J8VA 4MQRA 1AOIA 3DZZA 5GXQC 4U1TA 1BH9A 1B6WA 5KDMB 1P3KC 3BB8A 3B6GB 4NOGA 2CTZA 1P3AD 5DJ1A 5JRGD 1AHGA 3FD0A 3M5UA 1ULYA 1ASNA 1P3IA 2CH1A 3AZNC 1P3GB 2QBTA 4IXOA 2FJ7D 3UWCA 4AZKA 1B5OA 4G92C 2PB2A 1M0NA 4KXKA 3WAAD 1DJ9A 4X23A 3UTAA 4I8AA 1U08A 1M0PA 3MGRD 4JEWA 1BJNA 5DNND 3DXVA 3K40A 2HIOC 1P3PB 3UT9D 4L0OA 5AV6C 4YS3A 1P3FB 5E3KA 1ZLAC 5FT6A 5B2IA 1BJWA 2Y2PA 3DXWA 3WGCA 5FT8A 4WU9A 5B0ZA 1P3OD 3AEJC 3A9XA 3WA9A 4RKDA 2O0RA 2WB6A 3B0CT 1TAFA 2V1PA 4YM6D 1EQBA 3I16A 1ASDA 4XAUA 2W7LA 3HBXA 4UPKA 4LNJA 1AKAA 4W5KA 1DGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKS A;  4A72 A;  2W7E A;  2OAT A;  4OMA A;  5G2Q A;  4ZLV A;  3RUY A;  2VMP A;  2HOR A;  1BW0 A;  4LW4 A;  3B1E A;  5E5I A;  1V72 A;  4F5H A;  4MKJ A;  1PG8 A;  3EIB A;  3TQX A;  3ZZJ A;  4WYE A;  4MQQ A;  1I48 A;  4IXZ A;  4IYO B;  4WXB A;  5G09 A;  3FVS A;  2YKY A;  1RVU A;  3T32 A;  2ZY5 A;  4W8I A;  2W7M A;  4A0R A;  1V2F A;  2WK9 A;  4GDY A;  2VIA A;  3ASB A;  4F4E A;  1SZU A;  5EAV A;  4OCA A;  1ASA A;  1ECX A;  2HOX A;  2R5C A;  1GC4 A;  3F9T A;  3I5T A;  1MLY A;  1D7R A;  1UU1 A;  3PA9 A;  4JF1 A;  4M2M A;  4P7Y A;  4JEZ A;  4F5M A;  1SPA A;  3PJ0 A;  4LNL A;  2W7I A;  5EUE A;  3A9Z A;  5E4Z A;  1GCK A;  2DKJ A;  2BI2 A;  4R5F A;  3FDB A;  2ZUK A;  2VMU A;  1TOG A;  5K8B A;  1X2A A;  2W7F A;  3LVK A;  2VMX A;  1KKJ A;  1N31 A;  2YCN A;  3ACZ A;  1IAX A;  2VMO A;  1QJ5 A;  3LVM A;  2YRI A;  4IXS A;  4P3M A;  2D66 A;  1LW5 A;  3OP7 A;  1DTY A;  3KE3 A;  4K2I A;  3NU7 A;  3K7Y A;  3KKI A;  3AEM A;  1I41 A;  2HUI A;  3AEL A;  1P3W A;  4CXR A;  1ASE A;  1WYT A;  1Y4I A;  3RBL A;  3LV2 A;  1IX8 A;  1H1C A;  2OGE A;  3EI8 A;  5IWQ A;  2QB2 A;  2VGU A;  1KMK A;  4BA4 A;  3BWO A;  1KL2 A;  2CJH A;  2FNU A;  2VLF A;  2E54 A;  3FRK A;  2PO3 A;  3G8M A;  2W7H A;  1AMQ A;  1AJR A;  3ECD A;  3NYT A;  3BS8 A;  5D95 A;  4EU1 A;  1DJU A;  1AY8 A;  2JJG A;  1BQD A;  3R9A A;  4F5G A;  1IBJ A;  4A0H A;  4HF8 A;  4W1X A;  2VI9 A;  2YOB A;  1T3I A;  3PIU A;  1B5P A;  3HQT A;  4ADC A;  1C0N A;  1FG3 A;  2D7Z A;  3P6K A;  4XQ2 A;  1WYV A;  2NMP A;  1AY4 A;  1G4X A;  2CJG A;  1D7S A;  3K28 A;  4RJY A;  3LG0 A;  2VIB A;  1OXO A;  3ZRR A;  3GZD C;  2PB0 A;  3GET A;  1BKG A;  4EB7 A;  3NDN A;  2C44 A;  4GRX A;  3EIA A;  1CQ8 A;  4WLH A;  2GMS A;  1UKJ A;  1O4S A;  1ASB A;  2YKX A;  5HXX A;  4H51 A;  2R5E A;  1N2T A;  2BI9 A;  2ZSL A;  4MQP A;  5G0A A;  3NX3 A;  2W7D A;  3P1T A;  2BHX A;  2DKB A;  2CY8 A;  1CL1 A;  4WYG A;  4WXF A;  5M4D A;  2AY2 A;  1OHW A;  3FVU A;  2ZY4 A;  4IX8 A;  1O69 A;  4GSA A;  2BYJ A;  2W8W A;  4ITG A;  1KKP A;  2ZY3 A;  4A6R A;  2ZJG A;  1VP4 A;  1B9I A;  4ADE A;  2YCP A;  2VI8 A;  4J5U A;  3FVX A;  3EI7 A;  1CZE A;  3DR4 A;  3FFR A;  4XJP A;  4F5K A;  3N5M A;  3JTX A;  3ASA A;  5G2P A;  2BWO A;  3Q8N A;  4E77 A;  2D63 A;  4DQ6 A;  1E5F A;  3A2B A;  3DYD A;  1ASM A;  4FFC A;  4PFF A;  3AAT A;  4ZSY A;  1LS3 A;  1CS1 A;  3DU4 A;  2GSA A;  3FFH A;  2HUF A;  3AEN A;  1QIR A;  4WBT A;  3ZRQ A;  1AIC A;  1S0A A;  5EUD A;  5J8Q A;  4WP0 A;  4PVF A;  2ZP7 A;  8AAT A;  5M49 A;  1ART A;  1YAA A;  3ISL A;  3F6T A;  1OXP A;  3ATH A;  1ZC9 A;  4ZWM A;  2D61 A;  1M0O A;  1V2D A;  2CIN A;  4QGR A;  2R5C B;  4K2M A;  1KL1 A;  3B8X A;  1TOK A;  4U2H A;  1JG8 A;  2E7J A;  2X5F A;  2VLH A;  4RKC A;  3LVL B;  2VGW A;  3RCH A;  3COG A;  1RV4 A;  2CH2 A;  3QN6 A;  4ATQ A;  3HMU A;  5JAY A;  1ELU A;  3DRD A;  1S08 A;  1M7Y A;  2CB1 A;  2AY4 A;  1LW4 A;  2Z20 A;  5DJ9 A;  3MC6 A;  1AY5 A;  4ISY A;  1C7G A;  4UHN A;  1OHV A;  9AAT A;  4JEV A;  4LC3 A;  2C81 A;  4W1W A;  3E9K A;  1MAQ A;  1DJE A;  3FSL A;  3WLX A;  1CZC A;  4Q6R A;  4ITX A;  4B9B A;  2VMQ A;  1WYT B;  7AAT A;  4R5Z A;  3MAU A;  2AY9 A;  1AHY A;  1EJI A;  3TCM A;  1AX4 A;  2HUU A;  4Y0I A;  2AY8 A;  1DGD A;  2AY6 A;  4E3Q A;  3DR7 A;  1JS3 A;  1WST A;  5EIG A;  1DFO A;  2HP2 A;  1ASF A;  1BS0 A;  2Z9V A;  1MLZ A;  3E2F A;  3PDX A;  4IW7 A;  1AKB A;  2CFB A;  2C7T A;  2FN6 A;  1W7M A;  4BMK A;  3WGB A;  2BIE A;  2Z1Y A;  3AEM C;  1ELQ A;  1GBN A;  1GEW A;  3KGX A;  2O1B A;  1VEF A;  3R4T A;  1WYV B;  2HOY A;  2Z9W A;  3TFU A;  4EB5 A;  3GSB A;  2YCT A;  1MAP A;  2VMZ A;  3E2Y A;  1LC8 A;  1SZK A;  4ADD A;  3EZ1 A;  4ZDP A;  1ZOB A;  3EUC A;  2W8U A;  3RQ1 A;  1B4X A;  3L8A A;  5EUN A;  2BYL A;  2BWP A;  2EPJ A;  2FYF A;  4PFN A;  1QGN A;  1AMA A;  3FQ7 A;  1UU0 A;  1W7N A;  3AEO A;  4AO4 A;  4OC9 A;  2AY5 A;  4A0F A;  3PD6 A;  2QLR A;  3ELP A;  3MAF A;  2CJD A;  3H7F A;  4BA5 A;  1CJ0 A;  3FQ8 A;  4FL0 A;  4AH3 A;  4ZSW A;  4CXQ A;  1AAW A;  1RVY A;  3GZC A;  2EZ1 A;  3GBX A;  1IJI A;  4ZWV A;  1UU2 A;  4TMR A;  3TFT A;  2QMA A;  1GC2 A;  1YJY A;  4GE9 A;  4JEY A;  5D5S A;  1TOI A;  2W7K A;  1M32 A;  3EI6 A;  1MDO A;  2ZC0 A;  1S07 A;  1GEX A;  3N75 A;  3USF A;  4WYA A;  1BJO A;  1G7W A;  2E7U A;  4CBS A;  3CQ4 A;  3VAX A;  1M6S A;  4B98 A;  1AHE A;  1WYU A;  2AY3 A;  4ZAH A;  3AEP A;  3MKJ A;  2W7G A;  4CVQ A;  5C6U A;  1AKC A;  5G4I A;  3NYS A;  4ZAS A;  4GE7 A;  1TPL A;  1MGV A;  3NRA A;  3L44 A;  2HZP A;  2QA3 A;  1B9H A;  4UHM A;  5AX8 A;  4LW2 A;  3LVJ A;  3AEN B;  5HDM A;  2VGV A;  1G4V A;  3VK4 A;  3QGU A;  2XH1 A;  1QZ9 A;  4WD2 A;  2ZY2 A;  1OHY A;  2VMT A;  4AOA A;  3DOD A;  2JJH A;  4E1O A;  3B1D A;  2X8U A;  3EI9 A;  1SFF A;  1GD9 A;  3NU8 A;  3WX9 A;  3NNK A;  4AZJ A;  1YIZ A;  4GEB A;  5BJ4 A;  5F9S A;  1QJ3 A;  4OT8 A;  1PFF A;  2EO5 A;  2G6W A;  3UAK A;  4E3R A;  3PGY A;  1S06 A;  3AOV A;  2VMS A;  1LC7 A;  2C0R A;  4ADB A;  4ZM3 A;  3RCH B;  3BN1 A;  2VMR A;  3JW9 A;  2GB3 A;  5EFS A;  3AV7 A;  1ARS A;  1ARG A;  4WYD A;  4K2B A;  3BWN A;  3IHJ A;  3ZZK A;  3QI6 A;  1MDX A;  1WKG A;  4M2K A;  4O6Z A;  4TN4 A;  4EFF A;  1MDZ A;  4ZDO A;  2F8J A;  4W1V A;  2JJE A;  2X5D A;  1E5E A;  2W8T A;  2D65 A;  2EZ2 A;  1SZS A;  1AJS A;  2Q7W A;  1AIB A;  3BCX A;  1SVV A;  1X29 A;  3BCB A;  2FQ6 A;  3G7Q A;  2GMU A;  3VOM A;  3QPG A;  2WK8 A;  4AO9 A;  1JF9 A;  1ARH A;  1H0C A;  4A00 A;  1TAS A;  4R2N A;  3DC1 A;  1N8P A;  1FG7 A;  2XBN A;  5M46 A;  3AOW A;  2Z1Z A;  3AEJ A;  3TAT A;  5BJ3 A;  2ORD A;  1ARI A;  4OTL A;  2RFV A;  3MAD A;  3A8U X;  1IAY A;  5F8V A;  4XJL A;  1LC5 A;  5EIG B;  1M4N A;  3MC6 C;  3E6G A;  5HHY A;  1LKC A;  1YIY A;  2EH6 A;  3NUI A;  3NTJ A;  3QBO A;  3WKS A;  3BCA A;  2JGT A;  1YOO A;  2BIA A;  1X0M A;  1FC4 A;  2EGY A;  2WKA A;  4RAE A;  1VJO A;  2Z61 A;  4XEW A;  3E2Z B;  1AAM A;  2VMW A;  2HOZ A;  2Z9X A;  3A9Y A;  1TAR A;  2VGS A;  3KGW A;  3QM2 A;  3ZRP A;  1O61 A;  4EMY A;  4F5J A;  2E7I A;  4R8D A;  3PDB A;  4MSO A;  2VYC A;  4CBR A;  1C7O A;  1Z3Z A;  4M2J A;  5I92 A;  4Q76 A;  3RI6 A;  1V2E A;  4BHD A;  1O62 A;  1J04 A;  2CST A;  3I4J A;  3VK3 A;  2BWN A;  4DGT A;  2BI1 A;  4KYO A;  5DX5 A;  1BT4 A;  1GC3 A;  4MKK A;  3RBF A;  2AY7 A;  1ASL A;  3PD6 B;  2VGT A;  2VMY A;  1AHF A;  3JWA A;  3MAF B;  4WB0 A;  1YNU A;  1AHX A;  3WKR A;  4A0G A;  3E77 A;  1D2F A;  3FQA A;  4PIW A;  2AY1 A;  3BV0 A;  3E2Z A;  1OAT A;  5EAA A;  3ELE A;  1I29 A;  2W8J A;  4UQV A;  1TOE A;  2YKU A;  4JEX A;  1D7V A;  2DOU A;  1QIS A;  4MY5 A;  1YJS A;  1W3U A;  4WYC A;  2BKW A;  1TOJ A;  2D5Y A;  1CQ6 A;  1QIT A;  2VMN A;  3GJU A;  3CAI A;  2R0T A;  1ASG A;  3MEB A;  1YJZ A;  1BJO B;  2FNI A;  4Y0D A;  2R2N A;  4MQR A;  1IX6 A;  3PPL A;  3JWB A;  1B8G A;  2TPL A;  3DZZ A;  2W8V A;  4U1T A;  3BC8 A;  1WYU B;  4GE4 A;  4IYO A;  4WLJ A;  1XI9 A;  1DKA A;  2YHK A;  3B1C A;  1ORD A;  3BB8 A;  4LNM A;  3HL2 A;  3EZS A;  3D6K A;  4NOG A;  2W7J A;  2CTZ A;  2ZSM A;  3WZF A;  1W23 A;  5DJ1 A;  3HDO A;  2D7Y A;  3N0L A;  1AHG A;  5EQC A;  1AMS A;  2D64 A;  2OGA A;  3M5U A;  4KAM A;  2BI5 A;  2HP1 A;  4XK1 A;  1ASN A;  3LY1 A;  3B46 A;  2CAN A;  3CQ6 A;  1C9C A;  2CH1 A;  5DB5 A;  1G7X A;  4A6T A;  1I43 A;  1EG5 A;  1GC0 A;  2QBT A;  4IXO A;  2BI3 A;  4ATP A;  5M4B A;  2JG2 A;  2BIG A;  3UWC A;  4AZK A;  4N0W A;  1B5O A;  3QHX A;  2V0Y A;  2PB2 A;  4OYT A;  1M0N A;  4KXK A;  4DBC A;  1DJ9 A;  1IX7 A;  3F0H A;  4ZM4 A;  3UE8 A;  2O7C A;  3GZD A;  2YRR A;  1AJS B;  1S09 A;  1TAT A;  1RV3 A;  2ZYJ A;  1U08 A;  3FTB A;  1M0P A;  3NYU A;  4I8A A;  5G4J A;  4JEW A;  4WXG A;  5TF5 A;  1BJN A;  2AAT A;  1W7L A;  2GQN A;  1JS6 A;  3DXV A;  3GR9 A;  3K40 A;  4UHO A;  2DR1 A;  3LWS A;  3II0 A;  3NUB A;  2FM1 A;  4L0O A;  1CL2 A;  1ZOD A;  3VK2 A;  5E3K A;  1C4K A;  4XJO A;  3BWN C;  4Y0H A;  4XJM A;  5FT6 A;  4HVK A;  1SF2 A;  4F5I A;  4Q31 A;  3WY7 A;  4Q75 A;  3HLM A;  1GEY A;  2QB3 A;  1GDE A;  1BJW A;  2VMV A;  3DXW A;  4ZDL A;  3WGC A;  1LK9 A;  1Z7D A;  3FCR A;  4A6U A;  3FDD A;  5FT8 A;  1IUG A;  4IY7 A;  1BQA A;  1D7U A;  3MBB A;  1J32 A;  3PDB B;  1M0Q A;  1CQ7 A;  1ASC A;  1AIA A;  2JJF A;  2Z9U A;  3PAA A;  3AEJ C;  3A9X A;  2OQX A;  1KMJ A;  4RKD A;  2O0R A;  2WK7 A;  1IVR A;  3CBF A;  2YKV A;  4W91 A;  2V1P A;  2VGZ A;  4F5L A;  4JF0 A;  1AMR A;  3EI5 A;  1EQB A;  1C7N A;  1ASD A;  4XAU A;  2W7L A;  4F5F A;  1BJ4 A;  1X28 A;  4WB0 B;  3FKD A;  4LNJ A;  1AKA A;  5FT5 A;  4BQ0 A;  3CQ5 A;  4W5K A;  1DGE A;  4UOY A;  5FT4 A;  1WKH A;  4WYF A; 
#chains in the Genus database with same CATH topology
 4OMA A;  3R45 A;  5G2Q A;  4ZLV A;  2Y2J A;  1BW0 A;  3B6F D;  4LW4 A;  1P34 D;  5E5I A;  1V72 A;  1EQZ A;  3EIB A;  3TQX A;  1I48 A;  1KX3 A;  3FZ6 A;  5G09 A;  1R4V A;  4H9P B;  3T32 A;  4W8I A;  2W7M A;  1P3B C;  3MGP C;  1V2F A;  2VIA A;  4F4E A;  1KX5 B;  2ARO C;  1UU1 A;  3KWQ C;  2NQB C;  5CP6 C;  5EUE A;  4J8V C;  1AOI C;  3VH5 T;  5K8B A;  4P3M A;  5CPK A;  3REH D;  3TU4 D;  2PYO B;  3KE3 A;  4K2I A;  3K7Y A;  1Y4I A;  3RBL A;  3LV2 A;  5B0Y A;  1KMK A;  4BA4 A;  1P3I C;  1KL2 A;  3W98 D;  2VLF A;  1AMQ A;  3NYT A;  5B1M A;  1AY8 A;  4A0H A;  3REJ A;  4ADC A;  5AV8 A;  3MGS B;  4X23 C;  1D7S A;  3ZRR A;  3WTP E;  2PB0 A;  1WWI A;  3GET A;  3UTA C;  1KX4 B;  5C3I B;  3C1C B;  1UKJ A;  3X1T D;  3AYW B;  3AN2 B;  4Z5T A;  2YKX A;  4H51 A;  2R5E A;  1N2T A;  3A1K A;  2BI9 A;  3NX3 A;  2W7D A;  4YS3 C;  2DKB A;  1CL1 A;  2AY2 A;  3WTP C;  2ZY4 A;  2IO5 C;  1M18 B;  4GSA A;  2ZY3 A;  5GT3 A;  1VP4 A;  2RVQ C;  5F99 B;  4J5U A;  4K05 A;  1ID3 A;  4WU9 C;  2BWO A;  5B0Z C;  2D63 A;  3W99 B;  1E5F A;  3A2B A;  4PFF A;  3AAT A;  4XUJ D;  1LS3 A;  2HUF A;  3AEN A;  3ZRQ A;  1AIC A;  5EUD A;  4H9R A;  3AZH B;  3F6T A;  2JSS A;  5AVC D;  1ZC9 A;  4ZWM A;  2D61 A;  1M0O A;  5BNV A;  2CIN A;  4QGR A;  1KL1 A;  2QSR A;  3B8X A;  1JG8 A;  2VLH A;  5B31 A;  3RCH A;  1RV4 A;  1EQZ C;  3AZG A;  3REL B;  1KX3 C;  3X1S B;  2AY4 A;  5BT1 C;  1HTA A;  4ISY A;  2C81 A;  1MAQ A;  3NQJ B;  1DJE A;  1CZC A;  2VMQ A;  5DNM A;  1Z2C B;  4R5Z A;  2AY9 A;  5B1L A;  1AX4 A;  5GT0 B;  1JS3 A;  1BS0 A;  3E2F A;  2CFB A;  5CPK C;  2FN6 A;  5AY8 B;  5B33 A;  4LD9 B;  1GEW A;  3GSB A;  4Z66 B;  5B0Y C;  2YCT A;  4KHA A;  1ZOB A;  3AV1 A;  5CPJ A;  3L8A A;  2BYL A;  2EPJ A;  5B1M C;  3FQ7 A;  1W7N A;  4OC9 A;  3REJ C;  2CJD A;  4BA5 A;  3AZL A;  1P3A B;  5JRG B;  5AV8 C;  2YFW B;  2W8S A;  3AV2 D;  4JEY A;  5D5S A;  1M32 A;  2Y2L A;  5AV9 A;  4Z5T C;  4CBS A;  3G0T A;  1M6S A;  4B98 A;  1AHE A;  4ZAH A;  4ZBJ B;  2FJ7 B;  5KDM A;  3NYS A;  1M1A B;  4ZAS A;  4GE7 A;  4UHM A;  3NRA A;  3L44 A;  3LVJ A;  3B6G A;  2VGV A;  3VK4 A;  3WAA B;  4HGA B;  4WD2 A;  5GT3 C;  3DOD A;  2HUE B;  1TZY D;  3MGR B;  1SFF A;  1ID3 C;  5BJ4 A;  5F9S A;  5DNN B;  4OT8 A;  4E3R A;  5B32 G;  4R8P D;  3KUY D;  3UT9 B;  3AOV A;  1P3G A;  4ZM3 A;  3JW9 A;  5EFS A;  3AV7 A;  1ARG A;  4WYD A;  2F8N G;  3BWN A;  3IHJ A;  1MDZ A;  4W1V A;  2JJE A;  2EZ2 A;  1SZS A;  5JA4 B;  4J8X D;  2Q7W A;  1X29 A;  3BCB A;  5B31 C;  1P3O B;  1JF9 A;  3W96 D;  1P3P A;  1FG7 A;  2XBN A;  3AOW A;  1P3F A;  3AZG C;  3TAT A;  4YM6 B;  3AZJ D;  4OBU A;  3X1V D;  1LC5 A;  1M4N A;  5HHY A;  1LKC A;  1YIY A;  3NTJ A;  3WKS A;  3KSY A;  2HOZ A;  3QM2 A;  2VGS A;  4F5J A;  2Y2O A;  5DNM C;  1O61 A;  1A7W A;  5FUG B;  2E7I A;  4R8D A;  3B6F B;  3W1J A;  1P34 B;  5B1L C;  1PZR A;  3A1I A;  1Z3Z A;  5AVB D;  2DGL A;  4UUZ B;  1O62 A;  2BWN A;  4DGT A;  2BI1 A;  3RBF A;  2AY7 A;  3PD6 B;  2VGT A;  5CHL B;  3MAF B;  2BYK B;  5B33 C;  4A0G A;  3E77 A;  1D2F A;  3ELE A;  4UQV A;  2W8J A;  4JEX A;  4MY5 A;  1W3U A;  4WYC A;  4RJ0 A;  1TOJ A;  2VMN A;  3AV1 C;  5CPJ C;  3MEB A;  1IX6 A;  1F66 D;  1WYU B;  4GE4 A;  5GXQ A;  4CAY B;  1DKA A;  2YHK A;  3B1C A;  4H9P A;  3REH B;  3TU4 B;  3AZL C;  2W7J A;  3AZI D;  1KX5 A;  1HQ3 D;  3N0L A;  5BO0 B;  3W98 B;  2UWX A;  3AFA D;  5AV9 C;  3MVD D;  3CQ6 A;  5DB5 A;  2BI3 A;  4ATP A;  4J8U D;  4N0W A;  3B6G C;  2PYO A;  3QHX A;  2V0Y A;  4DBC A;  4ZM4 A;  3GZD A;  3X1T B;  1TAT A;  4KUD D;  2AAT A;  1W7L A;  2Y2K A;  2GQN A;  1P3G C;  3LWS A;  3II0 A;  4JJN D;  4XJO A;  3BWN C;  3MGS A;  4F5I A;  3WY7 A;  3KXB B;  2VMV A;  1KX4 A;  4ZDL A;  3C1C A;  1LK9 A;  1BQA A;  3AYW A;  3AN2 A;  3MBB A;  1M0Q A;  4XUJ B;  1P3P C;  2Z9U A;  1P3F C;  1KMJ A;  1IVR A;  4H9O B;  2YKV A;  3NQU B;  4XZQ D;  2VGZ A;  4F5L A;  1M18 A;  4Z2M G;  3WKJ D;  2LY8 A;  4H9Q B;  5AVC B;  5F99 A;  4AWL B;  3N4R A;  4WYF A;  2DGM A;  2YFV B;  3W99 A;  2OKK A;  3EPH A;  4IXZ A;  2NZD D;  4IYO B;  4WXB A;  2ZY5 A;  3H0M C;  3AZH A;  4A0R A;  2Y2M A;  4WU8 D;  4GDY A;  3ASB A;  3H9X A;  3MGP A;  3IP4 C;  5AY8 D;  4JEZ A;  1SPA A;  3REL A;  3FDB A;  2ZUK A;  3X1S A;  1TOG A;  2VMU A;  5B2J D;  5BS7 A;  1N31 A;  3ACZ A;  1QJ5 A;  4IXS A;  3NQJ A;  1KX5 C;  3AEM A;  1I41 A;  4E44 A;  2OGE A;  3EI8 A;  2QB2 A;  2CJH A;  2PO3 A;  5GT0 A;  3BS8 A;  3REI D;  5D95 A;  1DJU A;  4F5G A;  4HF8 A;  2VI9 A;  2PYO C;  1T3I A;  1B5P A;  3PIU A;  1M1A D;  4LD9 A;  2D7Z A;  3AV2 B;  4M6B A;  2NMP A;  2CJG A;  4Z66 A;  3GZD C;  5B32 D;  2C44 A;  3O62 D;  3EIA A;  1CQ8 A;  2GMS A;  1ASB A;  5HXX A;  2ZSL A;  2F8N D;  2BG1 A;  3P1T A;  3UTB D;  3X1U D;  5M4D A;  1P3A A;  3AZE D;  5GSU D;  5JRG A;  2YFW A;  3WTP A;  3MGS C;  2G5H C;  1TZY B;  4A6R A;  1KX4 C;  5C3I C;  3C1C C;  4R8P B;  3KUY B;  5BNX B;  3AYW C;  3AN2 C;  4E77 A;  4DQ6 A;  3DYD A;  2FJ7 A;  1ASM A;  4FFC A;  2GSA A;  3WAA A;  1M18 C;  5J8Q A;  5M49 A;  3VH5 A;  3W1I A;  1YAA A;  4J8X B;  5E5A D;  3ATH A;  3MGR A;  5F99 C;  4RLG A;  1U35 D;  5DNN A;  5AV5 D;  3W96 B;  2E7J A;  3UT9 A;  3W99 C;  3COG A;  3AZJ B;  3HMU A;  1P3M D;  5JAY A;  3X1V B;  3DRD A;  1M7Y A;  3MC6 A;  3AZH C;  4JEV A;  4WV4 B;  5JA4 A;  1M19 D;  3FSL A;  3WLX A;  1P3O A;  3AZF D;  3MAU A;  5AVB B;  3AZM D;  1AHY A;  4OBV A;  3MGQ D;  4KGC D;  2AY8 A;  3REL C;  3VH6 T;  4YM6 A;  3X1S C;  5BS7 C;  2C7T A;  1W7M A;  4BMK A;  3WGB A;  2Z1Y A;  3AEM C;  5FUG A;  3B6F A;  1MAP A;  1P34 A;  1LC8 A;  3AZK D;  4ZDP A;  4UUZ A;  3REK D;  3H0R C;  5GT0 C;  2W8U A;  3FZ8 A;  5G49 B;  1F66 B;  3KFU G;  4PFN A;  4AO4 A;  3AEO A;  5B24 D;  2AY5 A;  3PD6 A;  2QLR A;  3MAF A;  3H7F A;  2BYK A;  3AZI B;  4LD9 C;  4CXQ A;  4ZSW A;  1HQ3 B;  3GZC A;  4Z66 C;  4TMR A;  3AFA B;  1GC2 A;  3MVD B;  4J8W D;  3EI6 A;  1S07 A;  3N75 A;  3USF A;  1G7W A;  3CQ4 A;  4RIZ A;  3N4X A;  3VAX A;  1WYU A;  4J8U B;  3AEP A;  4CVQ A;  3WCN A;  1AKC A;  4CAY A;  4ZUX D;  3REH A;  3TU4 A;  4RIT A;  1TPL A;  2KFP A;  2HZP A;  1P3A C;  5JRG C;  4LW2 A;  1G4V A;  1S32 D;  1QZ9 A;  2ZY2 A;  1OHY A;  2G7J A;  5BO0 A;  3B1D A;  4KUD B;  3W98 A;  3WX9 A;  3KXB D;  1Q9C A;  2EO5 A;  3PGY A;  4ZBJ C;  2FJ7 C;  4ADB A;  4JJN B;  1M1A C;  2VMR A;  2GB3 A;  3LEL D;  3WAA C;  4CSR B;  4K2B A;  4HGA C;  1T3U A;  3ZZK A;  4EFF A;  2HUE C;  2X5D A;  3MGR C;  2XD1 A;  3X1T A;  5DNN C;  3BCX A;  3UT9 C;  2WK8 A;  1H0C A;  4A00 A;  1TAS A;  4R2N A;  3JZL A;  5M46 A;  2Z1Z A;  4RM1 A;  2BYM B;  2ORD A;  4XZQ B;  4OTL A;  5F8V A;  3WKJ B;  5EIG B;  3MC6 C;  3E6G A;  2BIA A;  1X0M A;  2Y2G A;  4RAE A;  2Z61 A;  3E2Z B;  4DRB A;  2Z9X A;  3KGW A;  1P3O C;  4XUJ A;  4M2J A;  5I92 A;  3RI6 A;  3LZ1 D;  1V2E A;  2CST A;  4YM6 C;  3I4J A;  2NZD B;  4H9O A;  3NQU A;  4QLC D;  1ASL A;  4WU8 B;  4H9Q A;  3JWA A;  5AVC A;  2X3L A;  5CPI D;  4PIW A;  2AY1 A;  1TOE A;  3B6F C;  1YJS A;  2YFV A;  1P34 C;  4H9S A;  3P5J B;  3GJU A;  2R0T A;  1ASG A;  1YJZ A;  2FNI A;  2R2N A;  2L5A A;  1B8G A;  2JIS A;  2TPL A;  4NE3 A;  3JWB A;  5B2J B;  4IYO A;  1XI9 A;  3MNN D;  3HL2 A;  3EG5 B;  2ZSM A;  3WZF A;  1W23 A;  2AEU A;  2D7Y A;  5EQC A;  1AMS A;  2D64 A;  2OGA A;  4KAM A;  2BI5 A;  2HP1 A;  4XK1 A;  3B46 A;  3REI B;  2CAN A;  1C9C A;  4A6T A;  1I43 A;  4J8L A;  5B40 D;  3REH C;  3TU4 C;  1H3O B;  4EO5 B;  1P3L D;  4OYT A;  3V9R B;  3B0D B;  2DF4 C;  5B32 B;  3W98 C;  5B2I B;  1IX7 A;  3O62 B;  3UE8 A;  2O7C A;  2ZYJ A;  5G4J A;  1RV3 A;  3NYU A;  4WXG A;  4H9N B;  3LJA D;  2F8N B;  4UHO A;  3UTB B;  1W2E A;  3X1U B;  3NUB A;  2FM1 A;  3AZE B;  3WA9 B;  5GSU B;  1ZOD A;  3VK2 A;  1N1J B;  2CV5 D;  4Y0H A;  4XJM A;  3AV2 A;  4Q31 A;  3LZ0 D;  3AL0 C;  1BFM A;  3X1T C;  3W97 D;  3HT4 A;  1Z7D A;  4A6U A;  3FDD A;  1D7U A;  1J32 A;  4G91 B;  1AIA A;  2JJF A;  3C1B D;  3CBF A;  4W91 A;  3A6N D;  5E5A B;  1TZY A;  1C7N A;  3KXB C;  4F5F A;  1U35 B;  4WB0 B;  5FT5 A;  3CQ5 A;  4UOY A;  5AV5 B;  4R8P A;  3KUY A;  5BNX A;  2W7E A;  4XUJ C;  1P3M B;  4F5H A;  4MKJ A;  1PG8 A;  4WYE A;  4MQQ A;  3FVS A;  2YKY A;  5AVC C;  4J8X A;  4DQY B;  2WK9 A;  1M19 B;  1P3K D;  5EAV A;  4AWL C;  4OCA A;  3AZF B;  1ECX A;  3I5T A;  3AZM B;  3W96 A;  1D7R A;  1XEY A;  3PA9 A;  4H9S C;  1BH8 B;  3MGQ B;  4F5M A;  4KGC B;  3A9Z A;  5E4Z A;  3AZJ A;  1GCK A;  3X1V A;  2BI2 A;  4R5F A;  1X2A A;  2VMX A;  3AZN D;  2YCN A;  2VMO A;  2YRI A;  2D66 A;  1LW5 A;  3OP7 A;  1DTY A;  3EPL A;  3NU7 A;  3KKI A;  3AEL A;  1P3W A;  4CXR A;  1ASE A;  3AZK B;  5AVB A;  1IX8 A;  3REK B;  5IWQ A;  2VGU A;  3FRK A;  3HVY A;  2W7H A;  5B24 B;  2JJG A;  3R9A A;  2JCH A;  4W1X A;  3N4S A;  2HIO D;  2YOB A;  3HQT A;  5AV6 D;  1C0N A;  1FG3 A;  3P6K A;  1ZLA D;  4XQ2 A;  1AY4 A;  1G4X A;  3K28 A;  4J8W B;  3LG0 A;  1BKG A;  3NDN A;  4GRX A;  5G49 A;  1F66 A;  1JFI B;  1O4S A;  4ZUX B;  5G0A A;  2DGK A;  2BHX A;  3AZI A;  1S32 B;  1HQ3 A;  3AV2 C;  3B0B A;  2W8W A;  1KKP A;  3AFA A;  2ZJG A;  4ADE A;  2YCP A;  2VI8 A;  2XD5 A;  3MVD A;  4WZS B;  3EI7 A;  3FFR A;  4XJP A;  4F5K A;  3JTX A;  3ASA A;  4J8U A;  4ZSY A;  3LEL B;  3DU4 A;  3FFH A;  1QIR A;  5B31 G;  1S0A A;  2FKI A;  4WP0 A;  1TZY C;  3B0C W;  4KUD A;  4R8P C;  3KUY C;  1P3B D;  2R5C B;  1TOK A;  2X5F A;  3LVL B;  2ARO D;  4JJN A;  3KWQ D;  2CH2 A;  3QN6 A;  4ATQ A;  2NQB D;  5CP6 D;  1KU5 A;  4CSR A;  4J8V D;  2CB1 A;  2F2A C;  1AOI D;  5DJ9 A;  1AY5 A;  4J8X C;  4UHN A;  1OHV A;  3FZ7 A;  4W1W A;  3E9K A;  4Q6R A;  3W96 C;  4B9B A;  1WYT B;  7AAT A;  4DRA A;  3LZ1 B;  3TCM A;  3AZJ C;  3X1V C;  2BYM A;  4XZQ A;  2AY6 A;  3DR7 A;  4QLC B;  1P3I D;  1WST A;  2CWE A;  3WKJ A;  5EIG A;  1MLZ A;  3VH6 W;  3PDX A;  5CPI B;  3VH5 W;  2BIE A;  3R4T A;  1ELQ A;  1GBN A;  1WYV B;  2HOY A;  2Z9W A;  3TFU A;  4EB5 A;  3GWP A;  5AVB C;  1WWS A;  4X23 D;  4ADD A;  5EUN A;  3UTA D;  2NZD A;  1AMA A;  3MNN B;  4WU8 A;  3N7N A;  1KAF A;  1CJ0 A;  4AH3 A;  4FL0 A;  5AY8 A;  4YS3 D;  1AAW A;  1B67 A;  3WTP D;  4ZWV A;  3TFT A;  2QMA A;  4GE9 A;  2ZC0 A;  5B2I D;  2DQN C;  1F66 C;  4WYA A;  2RVQ D;  5B40 B;  5B2J A;  2AY3 A;  5C6U A;  3MKJ A;  2W7G A;  4WU9 D;  5B0Z D;  3AZI C;  1P3L B;  1MGV A;  2QA3 A;  1B9H A;  5AX8 A;  1HQ3 C;  3H0L C;  3WA9 D;  3QGU A;  3AFA C;  4E1O A;  2X8U A;  3MVD C;  1GD9 A;  4AZJ A;  4NE6 A;  4GEB A;  1QJ3 A;  3REI A;  3LJA B;  3EPJ A;  3UAK A;  1S06 A;  4J8U C;  2VMS A;  1LC7 A;  2C0R A;  1PMM A;  3BN1 A;  2CV5 B;  1M1A A;  1H3O A;  1EQZ D;  3LZ0 B;  3VH6 A;  1WKG A;  4ZDO A;  3V9R A;  1KX3 D;  2F8J A;  5B32 A;  4KUD C;  5BT1 D;  3O62 A;  3W97 B;  2D65 A;  1AIB A;  1SVV A;  4H9N A;  2GMU A;  3QPG A;  4AO9 A;  2F8N A;  4JJN C;  2Y2H A;  3UTB A;  3X1U A;  3C1B B;  3AZE A;  5GSU A;  3A6N B;  1N1J A;  1ARI A;  2RFV A;  3MAD A;  3A8U X;  2RIQ A;  3QBO A;  2EH6 A;  3BCA A;  1FC4 A;  2EGY A;  2WKA A;  1AAM A;  2VMW A;  5CPK D;  3A9Y A;  1TAR A;  3ZRP A;  4EMY A;  2VYC A;  1C7O A;  5B0Y D;  4XZQ C;  3VK3 A;  3WKJ C;  4KYO A;  5DX5 A;  1BT4 A;  1GC3 A;  4MKK A;  5GXQ B;  5E5A A;  5B1M D;  1P3K B;  1U35 A;  4WB0 A;  1AHX A;  3REJ D;  5AV5 A;  3BV0 A;  5EAA A;  2YKU A;  1D7V A;  5AV8 D;  1QIS A;  1QIT A;  1P3M A;  3CAI A;  2NZD C;  1BJO B;  4Y0D A;  3PPL A;  2W8V A;  3BC8 A;  4WLJ A;  3AZN B;  4WU8 C;  4Z5T D;  2Y2Q A;  1ORD A;  4LNM A;  3EZS A;  5AY8 C;  1M19 A;  3D6K A;  4G92 B;  3AZF A;  3HDO A;  3AZM A;  4WJ3 C;  1BH8 A;  3MGQ A;  2A1V A;  4KGC A;  5GT3 D;  3LY1 A;  5B2J C;  1ID3 D;  1G7X A;  2VQR A;  1EG5 A;  1GC0 A;  2HIO B;  4WNN B;  5M4B A;  2JG2 A;  5AV6 B;  2BIG A;  2EYQ A;  1ZLA B;  3VP6 A;  4NFT A;  3AZK A;  3F0H A;  2ZM5 A;  3REK A;  2YRR A;  1AJS B;  1S09 A;  3REI C;  3FTB A;  5B24 A;  5TF5 A;  1JS6 A;  3GR9 A;  2DR1 A;  5B31 D;  4EO5 C;  1CL2 A;  1C4K A;  3AZG D;  4HVK A;  1SF2 A;  3B0D C;  5B32 C;  5B2I C;  4J8W A;  3O62 C;  4Q75 A;  3HLM A;  1GEY A;  2QB3 A;  2F8N H;  1GDE A;  3FCR A;  1JFI A;  1IUG A;  4IY7 A;  3PDB B;  4ZUX A;  3UTB C;  3X1U C;  1CQ7 A;  1ASC A;  5DNM D;  3AZE C;  3PAA A;  3WA9 C;  5GSU C;  2J8P A;  2OQX A;  5B1L D;  2WK7 A;  1S32 A;  4JF0 A;  1AMR A;  3EI5 A;  1BJ4 A;  1X28 A;  3KXB A;  1P3B B;  3FKD A;  3MGP B;  4BQ0 A;  5B33 D;  5FT4 A;  1WKH A;  3OKS A;  2ARO B;  4A72 A;  2OAT A;  3RUY A;  2VMP A;  4G91 C;  2HOR A;  3KWQ B;  2NQB B;  5CP6 B;  3B1E A;  3LEL A;  4J8V B;  3ZZJ A;  1AOI B;  3AV1 D;  5CPJ D;  1BH9 B;  5E5A C;  1U35 C;  1RVU A;  5AV5 C;  1SZU A;  3AZL D;  1ASA A;  2HOX A;  2R5C A;  3F9T A;  1GC4 A;  1MLY A;  4JF1 A;  4M2M A;  4P7Y A;  1P3M C;  3PJ0 A;  4LNL A;  2W7I A;  1P3I B;  2DKJ A;  5AV9 D;  2W7F A;  3LVK A;  1KKJ A;  3LVM A;  1IAX A;  1M19 C;  3AZF C;  3AZM C;  2HUI A;  3B6G D;  1WYT A;  4X23 B;  3MGQ C;  4KGC C;  1H1C A;  3LZ1 A;  3UTA B;  3BWO A;  2FNU A;  3G8M A;  2E54 A;  1AJR A;  3ECD A;  4QLC A;  4EU1 A;  1BQD A;  1IBJ A;  4YS3 B;  5CPI A;  1P3G D;  3WTP B;  2IO5 B;  2F8N K;  1WYV A;  3AZK C;  4RJY A;  3REK C;  1OXO A;  2VIB A;  4EB7 A;  5B24 C;  4WLH A;  4WU9 B;  5B0Z B;  3MNN A;  4MQP A;  1P3P D;  2CY8 A;  4WYG A;  4WXF A;  1OHW A;  1P3F D;  3FVU A;  4IX8 A;  1TAF B;  1O69 A;  2BYJ A;  4J8W C;  4ITG A;  1B9I A;  2G5I C;  3FVX A;  1CZE A;  3DR4 A;  3N5M A;  5G2P A;  3Q8N A;  3R45 B;  5B40 A;  4ZUX C;  1P3L A;  1CS1 A;  1EQZ B;  2Y2I A;  1S32 C;  4WBT A;  1KX3 B;  4PVF A;  2ZP7 A;  8AAT A;  1ART A;  3ISL A;  1OXP A;  1V2D A;  3LJA A;  4Z2M H;  4U2H A;  4K2M A;  4RKC A;  2AEV A;  2VGW A;  3LEL C;  2CV5 A;  1PMO A;  1ELU A;  1S08 A;  3LZ0 A;  1LW4 A;  2Z20 A;  1C7G A;  9AAT A;  5GXQ D;  4LC3 A;  3W97 A;  5CPK B;  4ITX A;  1KX5 D;  3EPK A;  5B0Y B;  3C1B A;  1EJI A;  2HUU A;  3A6N A;  4Y0I A;  3WCO A;  1DGD A;  4E3Q A;  5B1M B;  1DFO A;  2HP2 A;  1ASF A;  2Z9V A;  4IW7 A;  1AKB A;  3REJ B;  4H63 Q;  3KGX A;  2O1B A;  5AV8 B;  1VEF A;  2PYO D;  3LZ1 C;  2VMZ A;  3E2Y A;  1SZK A;  3EZ1 A;  3RQ1 A;  3EUC A;  1B4X A;  4QLC C;  2BWP A;  2FYF A;  1QGN A;  4Z5T B;  1UU0 A;  4A0F A;  3ELP A;  5CPI C;  1P3K A;  3FQ8 A;  1RVY A;  2EZ1 A;  3GBX A;  1IJI A;  1UU2 A;  5GT3 B;  1YJY A;  3MGS D;  4NE5 A;  1TOI A;  2W7K A;  2FFF B;  2OKJ A;  1MDO A;  1GEX A;  1ID3 B;  1KX4 D;  1BJO A;  2E7U A;  3C1C D;  3MNN C;  3AZN A;  3AYW D;  3AN2 D;  5G4I A;  3AEN B;  5HDM A;  4H9R B;  2XH1 A;  2VMT A;  4AOA A;  2JJH A;  1M18 D;  3EI9 A;  3NU8 A;  3NNK A;  1YIZ A;  5BNV B;  1PFF A;  5F99 D;  2G6W A;  5B40 C;  5B31 B;  2HIO A;  3RCH B;  4WNN A;  1P3L C;  3W99 D;  5AV6 A;  3AZG B;  1ZLA A;  1ARS A;  3QI6 A;  1MDX A;  4M2K A;  4O6Z A;  4TN4 A;  4E45 A;  2W8T A;  1E5E A;  3AZH D;  1AJS A;  3LJA C;  2FQ6 A;  3MGP D;  2JE5 A;  3G7Q A;  3VOM A;  5DNM B;  1ARH A;  3DC1 A;  1N8P A;  2CV5 C;  5B1L B;  3AEJ A;  5BJ3 A;  3LZ0 C;  1IAY A;  4XJL A;  3REL D;  3X1S D;  3NUI A;  2JGT A;  1YOO A;  3W97 C;  3W1H A;  5B33 B;  4XEW A;  1VJO A;  2Y2N A;  3PDB A;  4MSO A;  4CBR A;  3C1B C;  4KHA B;  4Q76 A;  3A6N C;  4BHD A;  3AV1 B;  1J04 A;  5CPJ B;  5GT0 D;  5KTB A;  2VMY A;  1AHF A;  1YNU A;  1P3B A;  3WKR A;  3AZL B;  3FQA A;  3E2Z A;  1OAT A;  4LD9 D;  1I29 A;  2ARO A;  2DOU A;  2BKW A;  2D5Y A;  3KWQ A;  4Z66 D;  1CQ6 A;  2NQB A;  5CP6 A;  1F1E A;  5AV9 B;  4J8V A;  4MQR A;  1AOI A;  3DZZ A;  5GXQ C;  4U1T A;  1BH9 A;  1B6W A;  5KDM B;  1P3K C;  3BB8 A;  3B6G B;  4NOG A;  2CTZ A;  1P3A D;  5DJ1 A;  5JRG D;  1AHG A;  3FD0 A;  3M5U A;  1ULY A;  1ASN A;  1P3I A;  2CH1 A;  3AZN C;  1P3G B;  2QBT A;  4IXO A;  2FJ7 D;  3UWC A;  4AZK A;  1B5O A;  4G92 C;  2PB2 A;  1M0N A;  4KXK A;  3WAA D;  1DJ9 A;  4X23 A;  3UTA A;  4I8A A;  1U08 A;  1M0P A;  3MGR D;  4JEW A;  1BJN A;  5DNN D;  3DXV A;  3K40 A;  2HIO C;  1P3P B;  3UT9 D;  4L0O A;  5AV6 C;  4YS3 A;  1P3F B;  5E3K A;  1ZLA C;  5FT6 A;  5B2I A;  1BJW A;  2Y2P A;  3DXW A;  3WGC A;  5FT8 A;  4WU9 A;  5B0Z A;  1P3O D;  3AEJ C;  3A9X A;  3WA9 A;  4RKD A;  2O0R A;  2WB6 A;  3B0C T;  1TAF A;  2V1P A;  4YM6 D;  1EQB A;  3I16 A;  1ASD A;  4XAU A;  2W7L A;  3HBX A;  4UPK A;  4LNJ A;  1AKA A;  4W5K A;  1DGE A; 
#chains in the Genus database with same CATH homology
 4OMA A;  3R45 A;  5G2Q A;  4ZLV A;  2Y2J A;  1BW0 A;  3B6F D;  4LW4 A;  1P34 D;  5E5I A;  1V72 A;  1EQZ A;  3EIB A;  3TQX A;  1I48 A;  1KX3 A;  3FZ6 A;  5G09 A;  1R4V A;  4H9P B;  3T32 A;  4W8I A;  2W7M A;  1P3B C;  3MGP C;  1V2F A;  2VIA A;  4F4E A;  1KX5 B;  2ARO C;  1UU1 A;  3KWQ C;  2NQB C;  5CP6 C;  5EUE A;  4J8V C;  1AOI C;  3VH5 T;  5K8B A;  4P3M A;  5CPK A;  3REH D;  3TU4 D;  2PYO B;  3KE3 A;  4K2I A;  3K7Y A;  1Y4I A;  3RBL A;  3LV2 A;  5B0Y A;  1KMK A;  4BA4 A;  1P3I C;  1KL2 A;  3W98 D;  2VLF A;  1AMQ A;  3NYT A;  5B1M A;  1AY8 A;  4A0H A;  3REJ A;  4ADC A;  5AV8 A;  3MGS B;  4X23 C;  1D7S A;  3ZRR A;  3WTP E;  2PB0 A;  1WWI A;  3GET A;  3UTA C;  1KX4 B;  5C3I B;  3C1C B;  1UKJ A;  3X1T D;  3AYW B;  3AN2 B;  4Z5T A;  2YKX A;  4H51 A;  2R5E A;  1N2T A;  3A1K A;  2BI9 A;  3NX3 A;  2W7D A;  4YS3 C;  2DKB A;  1CL1 A;  2AY2 A;  3WTP C;  2ZY4 A;  2IO5 C;  1M18 B;  4GSA A;  2ZY3 A;  5GT3 A;  1VP4 A;  2RVQ C;  5F99 B;  4J5U A;  4K05 A;  1ID3 A;  4WU9 C;  2BWO A;  5B0Z C;  2D63 A;  3W99 B;  1E5F A;  3A2B A;  4PFF A;  3AAT A;  4XUJ D;  1LS3 A;  2HUF A;  3AEN A;  3ZRQ A;  1AIC A;  5EUD A;  4H9R A;  3AZH B;  3F6T A;  2JSS A;  5AVC D;  1ZC9 A;  4ZWM A;  2D61 A;  1M0O A;  5BNV A;  2CIN A;  4QGR A;  1KL1 A;  2QSR A;  3B8X A;  1JG8 A;  2VLH A;  5B31 A;  3RCH A;  1RV4 A;  1EQZ C;  3AZG A;  3REL B;  1KX3 C;  3X1S B;  2AY4 A;  5BT1 C;  1HTA A;  4ISY A;  2C81 A;  1MAQ A;  3NQJ B;  1DJE A;  1CZC A;  2VMQ A;  5DNM A;  1Z2C B;  4R5Z A;  2AY9 A;  5B1L A;  1AX4 A;  5GT0 B;  1JS3 A;  1BS0 A;  3E2F A;  2CFB A;  5CPK C;  2FN6 A;  5AY8 B;  5B33 A;  4LD9 B;  1GEW A;  3GSB A;  4Z66 B;  5B0Y C;  2YCT A;  4KHA A;  1ZOB A;  3AV1 A;  5CPJ A;  3L8A A;  2BYL A;  2EPJ A;  5B1M C;  3FQ7 A;  1W7N A;  4OC9 A;  3REJ C;  2CJD A;  4BA5 A;  3AZL A;  1P3A B;  5JRG B;  5AV8 C;  2YFW B;  2W8S A;  3AV2 D;  4JEY A;  5D5S A;  1M32 A;  2Y2L A;  5AV9 A;  4Z5T C;  4CBS A;  3G0T A;  1M6S A;  4B98 A;  1AHE A;  4ZAH A;  4ZBJ B;  2FJ7 B;  5KDM A;  3NYS A;  1M1A B;  4ZAS A;  4GE7 A;  4UHM A;  3NRA A;  3L44 A;  3LVJ A;  3B6G A;  2VGV A;  3VK4 A;  3WAA B;  4HGA B;  4WD2 A;  5GT3 C;  3DOD A;  2HUE B;  1TZY D;  3MGR B;  1SFF A;  1ID3 C;  5BJ4 A;  5F9S A;  5DNN B;  4OT8 A;  4E3R A;  5B32 G;  4R8P D;  3KUY D;  3UT9 B;  3AOV A;  1P3G A;  4ZM3 A;  3JW9 A;  5EFS A;  3AV7 A;  1ARG A;  4WYD A;  2F8N G;  3BWN A;  3IHJ A;  1MDZ A;  4W1V A;  2JJE A;  2EZ2 A;  1SZS A;  5JA4 B;  4J8X D;  2Q7W A;  1X29 A;  3BCB A;  5B31 C;  1P3O B;  1JF9 A;  3W96 D;  1P3P A;  1FG7 A;  2XBN A;  3AOW A;  1P3F A;  3AZG C;  3TAT A;  4YM6 B;  3AZJ D;  4OBU A;  3X1V D;  1LC5 A;  1M4N A;  5HHY A;  1LKC A;  1YIY A;  3NTJ A;  3WKS A;  3KSY A;  2HOZ A;  3QM2 A;  2VGS A;  4F5J A;  2Y2O A;  5DNM C;  1O61 A;  1A7W A;  5FUG B;  2E7I A;  4R8D A;  3B6F B;  3W1J A;  1P34 B;  5B1L C;  1PZR A;  3A1I A;  1Z3Z A;  5AVB D;  2DGL A;  4UUZ B;  1O62 A;  2BWN A;  4DGT A;  2BI1 A;  3RBF A;  2AY7 A;  3PD6 B;  2VGT A;  5CHL B;  3MAF B;  2BYK B;  5B33 C;  4A0G A;  3E77 A;  1D2F A;  3ELE A;  4UQV A;  2W8J A;  4JEX A;  4MY5 A;  1W3U A;  4WYC A;  4RJ0 A;  1TOJ A;  2VMN A;  3AV1 C;  5CPJ C;  3MEB A;  1IX6 A;  1F66 D;  1WYU B;  4GE4 A;  5GXQ A;  4CAY B;  1DKA A;  2YHK A;  3B1C A;  4H9P A;  3REH B;  3TU4 B;  3AZL C;  2W7J A;  3AZI D;  1KX5 A;  1HQ3 D;  3N0L A;  5BO0 B;  3W98 B;  2UWX A;  3AFA D;  5AV9 C;  3MVD D;  3CQ6 A;  5DB5 A;  2BI3 A;  4ATP A;  4J8U D;  4N0W A;  3B6G C;  2PYO A;  3QHX A;  2V0Y A;  4DBC A;  4ZM4 A;  3GZD A;  3X1T B;  1TAT A;  4KUD D;  2AAT A;  1W7L A;  2Y2K A;  2GQN A;  1P3G C;  3LWS A;  3II0 A;  4JJN D;  4XJO A;  3BWN C;  3MGS A;  4F5I A;  3WY7 A;  3KXB B;  2VMV A;  1KX4 A;  4ZDL A;  3C1C A;  1LK9 A;  1BQA A;  3AYW A;  3AN2 A;  3MBB A;  1M0Q A;  4XUJ B;  1P3P C;  2Z9U A;  1P3F C;  1KMJ A;  1IVR A;  4H9O B;  2YKV A;  3NQU B;  4XZQ D;  2VGZ A;  4F5L A;  1M18 A;  4Z2M G;  3WKJ D;  2LY8 A;  4H9Q B;  5AVC B;  5F99 A;  4AWL B;  3N4R A;  4WYF A;  2DGM A;  2YFV B;  3W99 A;  2OKK A;  3EPH A;  4IXZ A;  2NZD D;  4IYO B;  4WXB A;  2ZY5 A;  3H0M C;  3AZH A;  4A0R A;  2Y2M A;  4WU8 D;  4GDY A;  3ASB A;  3H9X A;  3MGP A;  3IP4 C;  5AY8 D;  4JEZ A;  1SPA A;  3REL A;  3FDB A;  2ZUK A;  3X1S A;  1TOG A;  2VMU A;  5B2J D;  5BS7 A;  1N31 A;  3ACZ A;  1QJ5 A;  4IXS A;  3NQJ A;  1KX5 C;  3AEM A;  1I41 A;  4E44 A;  2OGE A;  3EI8 A;  2QB2 A;  2CJH A;  2PO3 A;  5GT0 A;  3BS8 A;  3REI D;  5D95 A;  1DJU A;  4F5G A;  4HF8 A;  2VI9 A;  2PYO C;  1T3I A;  1B5P A;  3PIU A;  1M1A D;  4LD9 A;  2D7Z A;  3AV2 B;  4M6B A;  2NMP A;  2CJG A;  4Z66 A;  3GZD C;  5B32 D;  2C44 A;  3O62 D;  3EIA A;  1CQ8 A;  2GMS A;  1ASB A;  5HXX A;  2ZSL A;  2F8N D;  2BG1 A;  3P1T A;  3UTB D;  3X1U D;  5M4D A;  1P3A A;  3AZE D;  5GSU D;  5JRG A;  2YFW A;  3WTP A;  3MGS C;  2G5H C;  1TZY B;  4A6R A;  1KX4 C;  5C3I C;  3C1C C;  4R8P B;  3KUY B;  5BNX B;  3AYW C;  3AN2 C;  4E77 A;  4DQ6 A;  3DYD A;  2FJ7 A;  1ASM A;  4FFC A;  2GSA A;  3WAA A;  1M18 C;  5J8Q A;  5M49 A;  3VH5 A;  3W1I A;  1YAA A;  4J8X B;  5E5A D;  3ATH A;  3MGR A;  5F99 C;  4RLG A;  1U35 D;  5DNN A;  5AV5 D;  3W96 B;  2E7J A;  3UT9 A;  3W99 C;  3COG A;  3AZJ B;  3HMU A;  1P3M D;  5JAY A;  3X1V B;  3DRD A;  1M7Y A;  3MC6 A;  3AZH C;  4JEV A;  4WV4 B;  5JA4 A;  1M19 D;  3FSL A;  3WLX A;  1P3O A;  3AZF D;  3MAU A;  5AVB B;  3AZM D;  1AHY A;  4OBV A;  3MGQ D;  4KGC D;  2AY8 A;  3REL C;  3VH6 T;  4YM6 A;  3X1S C;  5BS7 C;  2C7T A;  1W7M A;  4BMK A;  3WGB A;  2Z1Y A;  3AEM C;  5FUG A;  3B6F A;  1MAP A;  1P34 A;  1LC8 A;  3AZK D;  4ZDP A;  4UUZ A;  3REK D;  3H0R C;  5GT0 C;  2W8U A;  3FZ8 A;  5G49 B;  1F66 B;  3KFU G;  4PFN A;  4AO4 A;  3AEO A;  5B24 D;  2AY5 A;  3PD6 A;  2QLR A;  3MAF A;  3H7F A;  2BYK A;  3AZI B;  4LD9 C;  4CXQ A;  4ZSW A;  1HQ3 B;  3GZC A;  4Z66 C;  4TMR A;  3AFA B;  1GC2 A;  3MVD B;  4J8W D;  3EI6 A;  1S07 A;  3N75 A;  3USF A;  1G7W A;  3CQ4 A;  4RIZ A;  3N4X A;  3VAX A;  1WYU A;  4J8U B;  3AEP A;  4CVQ A;  3WCN A;  1AKC A;  4CAY A;  4ZUX D;  3REH A;  3TU4 A;  4RIT A;  1TPL A;  2KFP A;  2HZP A;  1P3A C;  5JRG C;  4LW2 A;  1G4V A;  1S32 D;  1QZ9 A;  2ZY2 A;  1OHY A;  2G7J A;  5BO0 A;  3B1D A;  4KUD B;  3W98 A;  3WX9 A;  3KXB D;  1Q9C A;  2EO5 A;  3PGY A;  4ZBJ C;  2FJ7 C;  4ADB A;  4JJN B;  1M1A C;  2VMR A;  2GB3 A;  3LEL D;  3WAA C;  4CSR B;  4K2B A;  4HGA C;  1T3U A;  3ZZK A;  4EFF A;  2HUE C;  2X5D A;  3MGR C;  2XD1 A;  3X1T A;  5DNN C;  3BCX A;  3UT9 C;  2WK8 A;  1H0C A;  4A00 A;  1TAS A;  4R2N A;  3JZL A;  5M46 A;  2Z1Z A;  4RM1 A;  2BYM B;  2ORD A;  4XZQ B;  4OTL A;  5F8V A;  3WKJ B;  5EIG B;  3MC6 C;  3E6G A;  2BIA A;  1X0M A;  2Y2G A;  4RAE A;  2Z61 A;  3E2Z B;  4DRB A;  2Z9X A;  3KGW A;  1P3O C;  4XUJ A;  4M2J A;  5I92 A;  3RI6 A;  3LZ1 D;  1V2E A;  2CST A;  4YM6 C;  3I4J A;  2NZD B;  4H9O A;  3NQU A;  4QLC D;  1ASL A;  4WU8 B;  4H9Q A;  3JWA A;  5AVC A;  2X3L A;  5CPI D;  4PIW A;  2AY1 A;  1TOE A;  3B6F C;  1YJS A;  2YFV A;  1P34 C;  4H9S A;  3P5J B;  3GJU A;  2R0T A;  1ASG A;  1YJZ A;  2FNI A;  2R2N A;  2L5A A;  1B8G A;  2JIS A;  2TPL A;  4NE3 A;  3JWB A;  5B2J B;  4IYO A;  1XI9 A;  3MNN D;  3HL2 A;  3EG5 B;  2ZSM A;  3WZF A;  1W23 A;  2AEU A;  2D7Y A;  5EQC A;  1AMS A;  2D64 A;  2OGA A;  4KAM A;  2BI5 A;  2HP1 A;  4XK1 A;  3B46 A;  3REI B;  2CAN A;  1C9C A;  4A6T A;  1I43 A;  4J8L A;  5B40 D;  3REH C;  3TU4 C;  1H3O B;  4EO5 B;  1P3L D;  4OYT A;  3V9R B;  3B0D B;  2DF4 C;  5B32 B;  3W98 C;  5B2I B;  1IX7 A;  3O62 B;  3UE8 A;  2O7C A;  2ZYJ A;  5G4J A;  1RV3 A;  3NYU A;  4WXG A;  4H9N B;  3LJA D;  2F8N B;  4UHO A;  3UTB B;  1W2E A;  3X1U B;  3NUB A;  2FM1 A;  3AZE B;  3WA9 B;  5GSU B;  1ZOD A;  3VK2 A;  1N1J B;  2CV5 D;  4Y0H A;  4XJM A;  3AV2 A;  4Q31 A;  3LZ0 D;  3AL0 C;  1BFM A;  3X1T C;  3W97 D;  3HT4 A;  1Z7D A;  4A6U A;  3FDD A;  1D7U A;  1J32 A;  4G91 B;  1AIA A;  2JJF A;  3C1B D;  3CBF A;  4W91 A;  3A6N D;  5E5A B;  1TZY A;  1C7N A;  3KXB C;  4F5F A;  1U35 B;  4WB0 B;  5FT5 A;  3CQ5 A;  4UOY A;  5AV5 B;  4R8P A;  3KUY A;  5BNX A;  2W7E A;  4XUJ C;  1P3M B;  4F5H A;  4MKJ A;  1PG8 A;  4WYE A;  4MQQ A;  3FVS A;  2YKY A;  5AVC C;  4J8X A;  4DQY B;  2WK9 A;  1M19 B;  1P3K D;  5EAV A;  4AWL C;  4OCA A;  3AZF B;  1ECX A;  3I5T A;  3AZM B;  3W96 A;  1D7R A;  1XEY A;  3PA9 A;  4H9S C;  1BH8 B;  3MGQ B;  4F5M A;  4KGC B;  3A9Z A;  5E4Z A;  3AZJ A;  1GCK A;  3X1V A;  2BI2 A;  4R5F A;  1X2A A;  2VMX A;  3AZN D;  2YCN A;  2VMO A;  2YRI A;  2D66 A;  1LW5 A;  3OP7 A;  1DTY A;  3EPL A;  3NU7 A;  3KKI A;  3AEL A;  1P3W A;  4CXR A;  1ASE A;  3AZK B;  5AVB A;  1IX8 A;  3REK B;  5IWQ A;  2VGU A;  3FRK A;  3HVY A;  2W7H A;  5B24 B;  2JJG A;  3R9A A;  2JCH A;  4W1X A;  3N4S A;  2HIO D;  2YOB A;  3HQT A;  5AV6 D;  1C0N A;  1FG3 A;  3P6K A;  1ZLA D;  4XQ2 A;  1AY4 A;  1G4X A;  3K28 A;  4J8W B;  3LG0 A;  1BKG A;  3NDN A;  4GRX A;  5G49 A;  1F66 A;  1JFI B;  1O4S A;  4ZUX B;  5G0A A;  2DGK A;  2BHX A;  3AZI A;  1S32 B;  1HQ3 A;  3AV2 C;  3B0B A;  2W8W A;  1KKP A;  3AFA A;  2ZJG A;  4ADE A;  2YCP A;  2VI8 A;  2XD5 A;  3MVD A;  4WZS B;  3EI7 A;  3FFR A;  4XJP A;  4F5K A;  3JTX A;  3ASA A;  4J8U A;  4ZSY A;  3LEL B;  3DU4 A;  3FFH A;  1QIR A;  5B31 G;  1S0A A;  2FKI A;  4WP0 A;  1TZY C;  3B0C W;  4KUD A;  4R8P C;  3KUY C;  1P3B D;  2R5C B;  1TOK A;  2X5F A;  3LVL B;  2ARO D;  4JJN A;  3KWQ D;  2CH2 A;  3QN6 A;  4ATQ A;  2NQB D;  5CP6 D;  1KU5 A;  4CSR A;  4J8V D;  2CB1 A;  2F2A C;  1AOI D;  5DJ9 A;  1AY5 A;  4J8X C;  4UHN A;  1OHV A;  3FZ7 A;  4W1W A;  3E9K A;  4Q6R A;  3W96 C;  4B9B A;  1WYT B;  7AAT A;  4DRA A;  3LZ1 B;  3TCM A;  3AZJ C;  3X1V C;  2BYM A;  4XZQ A;  2AY6 A;  3DR7 A;  4QLC B;  1P3I D;  1WST A;  2CWE A;  3WKJ A;  5EIG A;  1MLZ A;  3VH6 W;  3PDX A;  5CPI B;  3VH5 W;  2BIE A;  3R4T A;  1ELQ A;  1GBN A;  1WYV B;  2HOY A;  2Z9W A;  3TFU A;  4EB5 A;  3GWP A;  5AVB C;  1WWS A;  4X23 D;  4ADD A;  5EUN A;  3UTA D;  2NZD A;  1AMA A;  3MNN B;  4WU8 A;  3N7N A;  1CJ0 A;  4AH3 A;  4FL0 A;  5AY8 A;  4YS3 D;  1AAW A;  1B67 A;  3WTP D;  4ZWV A;  3TFT A;  2QMA A;  4GE9 A;  2ZC0 A;  5B2I D;  2DQN C;  1F66 C;  4WYA A;  2RVQ D;  5B40 B;  5B2J A;  2AY3 A;  5C6U A;  3MKJ A;  2W7G A;  4WU9 D;  5B0Z D;  3AZI C;  1P3L B;  1MGV A;  2QA3 A;  1B9H A;  5AX8 A;  1HQ3 C;  3H0L C;  3WA9 D;  3QGU A;  3AFA C;  4E1O A;  2X8U A;  3MVD C;  1GD9 A;  4AZJ A;  4NE6 A;  4GEB A;  1QJ3 A;  3REI A;  3LJA B;  3EPJ A;  3UAK A;  1S06 A;  4J8U C;  2VMS A;  1LC7 A;  2C0R A;  1PMM A;  3BN1 A;  2CV5 B;  1M1A A;  1H3O A;  1EQZ D;  3LZ0 B;  3VH6 A;  1WKG A;  4ZDO A;  3V9R A;  1KX3 D;  2F8J A;  5B32 A;  4KUD C;  5BT1 D;  3O62 A;  3W97 B;  2D65 A;  1AIB A;  1SVV A;  4H9N A;  2GMU A;  3QPG A;  4AO9 A;  2F8N A;  4JJN C;  2Y2H A;  3UTB A;  3X1U A;  3C1B B;  3AZE A;  5GSU A;  3A6N B;  1N1J A;  1ARI A;  2RFV A;  3MAD A;  3A8U X;  2RIQ A;  3QBO A;  2EH6 A;  3BCA A;  1FC4 A;  2EGY A;  2WKA A;  1AAM A;  2VMW A;  5CPK D;  3A9Y A;  1TAR A;  3ZRP A;  4EMY A;  2VYC A;  1C7O A;  5B0Y D;  4XZQ C;  3VK3 A;  3WKJ C;  4KYO A;  5DX5 A;  1BT4 A;  1GC3 A;  4MKK A;  5GXQ B;  5E5A A;  5B1M D;  1P3K B;  1U35 A;  4WB0 A;  1AHX A;  3REJ D;  5AV5 A;  3BV0 A;  5EAA A;  2YKU A;  1D7V A;  5AV8 D;  1QIS A;  1QIT A;  1P3M A;  3CAI A;  2NZD C;  1BJO B;  4Y0D A;  3PPL A;  2W8V A;  3BC8 A;  4WLJ A;  3AZN B;  4WU8 C;  4Z5T D;  2Y2Q A;  1ORD A;  4LNM A;  3EZS A;  5AY8 C;  1M19 A;  3D6K A;  4G92 B;  3AZF A;  3HDO A;  3AZM A;  4WJ3 C;  1BH8 A;  3MGQ A;  2A1V A;  4KGC A;  5GT3 D;  3LY1 A;  5B2J C;  1ID3 D;  1G7X A;  2VQR A;  1EG5 A;  1GC0 A;  2HIO B;  4WNN B;  5M4B A;  2JG2 A;  5AV6 B;  2BIG A;  2EYQ A;  1ZLA B;  3VP6 A;  4NFT A;  3AZK A;  3F0H A;  2ZM5 A;  3REK A;  2YRR A;  1AJS B;  1S09 A;  3REI C;  3FTB A;  5B24 A;  5TF5 A;  1JS6 A;  3GR9 A;  2DR1 A;  5B31 D;  4EO5 C;  1CL2 A;  1C4K A;  3AZG D;  4HVK A;  1SF2 A;  3B0D C;  5B32 C;  5B2I C;  4J8W A;  3O62 C;  4Q75 A;  3HLM A;  1GEY A;  2QB3 A;  2F8N H;  1GDE A;  3FCR A;  1JFI A;  1IUG A;  4IY7 A;  3PDB B;  4ZUX A;  3UTB C;  3X1U C;  1CQ7 A;  1ASC A;  5DNM D;  3AZE C;  3PAA A;  3WA9 C;  5GSU C;  2J8P A;  2OQX A;  5B1L D;  2WK7 A;  1S32 A;  4JF0 A;  1AMR A;  3EI5 A;  1BJ4 A;  1X28 A;  3KXB A;  1P3B B;  3FKD A;  3MGP B;  4BQ0 A;  5B33 D;  5FT4 A;  1WKH A;  3OKS A;  2ARO B;  4A72 A;  2OAT A;  3RUY A;  2VMP A;  4G91 C;  2HOR A;  3KWQ B;  2NQB B;  5CP6 B;  3B1E A;  3LEL A;  4J8V B;  3ZZJ A;  1AOI B;  3AV1 D;  5CPJ D;  1BH9 B;  5E5A C;  1U35 C;  1RVU A;  5AV5 C;  1SZU A;  3AZL D;  1ASA A;  2HOX A;  2R5C A;  3F9T A;  1GC4 A;  1MLY A;  4JF1 A;  4M2M A;  4P7Y A;  1P3M C;  3PJ0 A;  4LNL A;  2W7I A;  1P3I B;  2DKJ A;  5AV9 D;  2W7F A;  3LVK A;  1KKJ A;  3LVM A;  1IAX A;  1M19 C;  3AZF C;  3AZM C;  2HUI A;  3B6G D;  1WYT A;  4X23 B;  3MGQ C;  4KGC C;  1H1C A;  3LZ1 A;  3UTA B;  3BWO A;  2FNU A;  3G8M A;  2E54 A;  1AJR A;  3ECD A;  4QLC A;  4EU1 A;  1BQD A;  1IBJ A;  4YS3 B;  5CPI A;  1P3G D;  3WTP B;  2IO5 B;  2F8N K;  1WYV A;  3AZK C;  4RJY A;  3REK C;  1OXO A;  2VIB A;  4EB7 A;  5B24 C;  4WLH A;  4WU9 B;  5B0Z B;  3MNN A;  4MQP A;  1P3P D;  2CY8 A;  4WYG A;  4WXF A;  1OHW A;  1P3F D;  3FVU A;  4IX8 A;  1TAF B;  1O69 A;  2BYJ A;  4J8W C;  4ITG A;  1B9I A;  2G5I C;  3FVX A;  1CZE A;  3DR4 A;  3N5M A;  5G2P A;  3Q8N A;  3R45 B;  5B40 A;  4ZUX C;  1P3L A;  1CS1 A;  1EQZ B;  2Y2I A;  1S32 C;  4WBT A;  1KX3 B;  4PVF A;  2ZP7 A;  8AAT A;  1ART A;  3ISL A;  1OXP A;  1V2D A;  3LJA A;  4Z2M H;  4U2H A;  4K2M A;  4RKC A;  2AEV A;  2VGW A;  3LEL C;  2CV5 A;  1PMO A;  1ELU A;  1S08 A;  3LZ0 A;  1LW4 A;  2Z20 A;  1C7G A;  9AAT A;  5GXQ D;  4LC3 A;  3W97 A;  5CPK B;  4ITX A;  1KX5 D;  3EPK A;  5B0Y B;  3C1B A;  1EJI A;  2HUU A;  3A6N A;  4Y0I A;  3WCO A;  1DGD A;  4E3Q A;  5B1M B;  1DFO A;  2HP2 A;  1ASF A;  2Z9V A;  4IW7 A;  1AKB A;  3REJ B;  4H63 Q;  3KGX A;  2O1B A;  5AV8 B;  1VEF A;  2PYO D;  3LZ1 C;  2VMZ A;  3E2Y A;  1SZK A;  3EZ1 A;  3RQ1 A;  3EUC A;  1B4X A;  4QLC C;  2BWP A;  2FYF A;  1QGN A;  4Z5T B;  1UU0 A;  4A0F A;  3ELP A;  5CPI C;  1P3K A;  3FQ8 A;  1RVY A;  2EZ1 A;  3GBX A;  1IJI A;  1UU2 A;  5GT3 B;  1YJY A;  3MGS D;  4NE5 A;  1TOI A;  2W7K A;  2FFF B;  2OKJ A;  1MDO A;  1GEX A;  1ID3 B;  1KX4 D;  1BJO A;  2E7U A;  3C1C D;  3MNN C;  3AZN A;  3AYW D;  3AN2 D;  5G4I A;  3AEN B;  5HDM A;  4H9R B;  2XH1 A;  2VMT A;  4AOA A;  2JJH A;  1M18 D;  3EI9 A;  3NU8 A;  3NNK A;  1YIZ A;  5BNV B;  1PFF A;  5F99 D;  2G6W A;  5B40 C;  5B31 B;  2HIO A;  3RCH B;  4WNN A;  1P3L C;  3W99 D;  5AV6 A;  3AZG B;  1ZLA A;  1ARS A;  3QI6 A;  1MDX A;  4M2K A;  4O6Z A;  4TN4 A;  4E45 A;  2W8T A;  1E5E A;  3AZH D;  1AJS A;  3LJA C;  2FQ6 A;  3MGP D;  2JE5 A;  3G7Q A;  3VOM A;  5DNM B;  1ARH A;  3DC1 A;  1N8P A;  2CV5 C;  5B1L B;  3AEJ A;  5BJ3 A;  3LZ0 C;  1IAY A;  4XJL A;  3REL D;  3X1S D;  3NUI A;  2JGT A;  1YOO A;  3W97 C;  3W1H A;  5B33 B;  4XEW A;  1VJO A;  2Y2N A;  3PDB A;  4MSO A;  4CBR A;  3C1B C;  4KHA B;  4Q76 A;  3A6N C;  4BHD A;  3AV1 B;  1J04 A;  5CPJ B;  5GT0 D;  5KTB A;  2VMY A;  1AHF A;  1YNU A;  1P3B A;  3WKR A;  3AZL B;  3FQA A;  3E2Z A;  1OAT A;  4LD9 D;  1I29 A;  2ARO A;  2DOU A;  2BKW A;  2D5Y A;  3KWQ A;  4Z66 D;  1CQ6 A;  2NQB A;  5CP6 A;  1F1E A;  5AV9 B;  4J8V A;  4MQR A;  1AOI A;  3DZZ A;  5GXQ C;  4U1T A;  1BH9 A;  1B6W A;  5KDM B;  1P3K C;  3BB8 A;  3B6G B;  4NOG A;  2CTZ A;  1P3A D;  5DJ1 A;  5JRG D;  1AHG A;  3FD0 A;  3M5U A;  1ULY A;  1ASN A;  1P3I A;  2CH1 A;  3AZN C;  1P3G B;  2QBT A;  4IXO A;  2FJ7 D;  3UWC A;  4AZK A;  1B5O A;  4G92 C;  2PB2 A;  1M0N A;  4KXK A;  3WAA D;  1DJ9 A;  4X23 A;  3UTA A;  4I8A A;  1U08 A;  1M0P A;  3MGR D;  4JEW A;  1BJN A;  5DNN D;  3DXV A;  3K40 A;  2HIO C;  1P3P B;  3UT9 D;  4L0O A;  5AV6 C;  4YS3 A;  1P3F B;  5E3K A;  1ZLA C;  5FT6 A;  5B2I A;  1BJW A;  2Y2P A;  3DXW A;  3WGC A;  5FT8 A;  4WU9 A;  5B0Z A;  1P3O D;  3AEJ C;  3A9X A;  3WA9 A;  4RKD A;  2O0R A;  2WB6 A;  3B0C T;  1TAF A;  2V1P A;  4YM6 D;  1EQB A;  3I16 A;  1ASD A;  4XAU A;  2W7L A;  3HBX A;  4UPK A;  4LNJ A;  1AKA A;  4W5K A;  1DGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...