2ZY4A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
527
structure length
524
Chain Sequence
MSKDYQSLSPFELKDELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords L-aspartate beta-decarboxylase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
total genus 201
structure length 524
sequence length 527
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy4A01
1CZCA 2CJHA 1D7VA 1FG7A 2FNIA 3LVKA 3EI7A 4LW2A 2AY7A 1QIRA 1AX4A 1TARA 2PO3A 3BS8A 4ISYA 5DB5A 3VOMA 3NX3A 2AY9A 3FVSA 4P3MA 2VI9A 3PDBB 3LVJA 1AHFA 1B5OA 2GSAA 2W7KA 4AOAA 4BA5A 3L44A 1OHWA 2W8VA 2W8TA 3CQ6A 5E5IA 1E5FA 1M0PA 2QA3A 4R5ZA 4B98A 2CTZA 4MQRA 4W1WA 4WXBA 7AATA 5EFSA 2WK7A 3A9YA 1I29A 2W7EA 4XAUA 3F0HA 2QB3A 1M0NA 3F9TA 2XBNA 1FG3A 1YIYA 3T32A 4JEXA 4OCAA 1X2AA 3B1CA 3II0A 3Q8NA 4U2HA 1RV4A 4W8IA 4LC3A 1OXOA 3PIUA 2R5EA 2HOYA 1GDEA 4CBSA 3OKSA 2W7LA 4EB7A 1SVVA 2VMVA 1ASMA 4K2MA 2VMQA 2O0RA 5HHYA 2ZY5A 2BYJA 2VMZA 1J32A 2VGVA 1JS6A 2D7YA 2BKWA 2VLHA 3A8UX 1BS0A 3FCRA 4F4EA 5HDMA 4M2MA 1WKHA 1O62A 3QPGA 4WBTA 3B8XA 4L0OA 3K7YA 3EIAA 3MAFA 1M6SA 5AX8A 4BMKA 4ZAHA 3GSBA 3EZSA 3MC6C 3FFHA 4OTLA 3R9AA 3KE3A 2WK9A 3MKJA 4Q75A 4W1VA 3NNKA 3E2ZA 1N31A 4A72A 3FSLA 1WYVB 3N0LA 1O4SA 2BWNA 1KKPA 2VIBA 1D2FA 2QMAA 5K8BA 1MDOA 1ZOBA 1YJZA 3EI9A 3KKIA 4LNJA 1DGEA 1W7MA 4IX8A 4WLHA 4ATPA 1WYUB 1GBNA 1QISA 4WD2A 3ZRRA 1ASEA 4MKKA 5G0AA 2C44A 3PAAA 2Z20A 5G4JA 1AIBA 1AJSA 4F5LA 1YJYA 3BN1A 3NU8A 4ZSWA 4HVKA 1AY5A 1W23A 4XJOA 2G6WA 3COGA 1YOOA 3PPLA 3KGWA 2QB2A 3GBXA 3E9KA 1M32A 5EUEA 3DXVA 4A00A 3MBBA 3PGYA 2ZY2A 3D6KA 4MKJA 4M2JA 1EJIA 2CH1A 4ZLVA 5DJ1A 2DKBA 3AELA 4K2IA 2VMNA 1ARHA 3BWNC 4Y0IA 2BI1A 2YOBA 2C0RA 5EIGB 1MLYA 4W5KA 1SPAA 1TOJA 2W7FA 3RQ1A 1LC7A 3MC6A 4F5MA 1RVUA 5F8VA 3L8AA 3LV2A 3MAUA 1AMQA 3WZFA 5DX5A 3AOWA 5EQCA 1G7WA 2E7IA 2HUUA 3EI6A 1Z3ZA 2YRIA 1WKGA 1J04A 2X8UA 3GJUA 2HZPA 1X28A 5EUDA 1IUGA 2W7DA 3H7FA 2OGAA 2PB0A 3CQ5A 1W3UA 2QBTA 2CANA 1WYTB 2YKXA 3WKSA 5F9SA 3PD6A 2W7IA 2JJHA 4MY5A 3BWOA 2CH2A 4R2NA 2VGSA 1CQ8A 3JTXA 3OP7A 3PDBA 1GC3A 2V0YA 1ASDA 4Q76A 2YCTA 4JF0A 4Q31A 1V2FA 3TFUA 2ORDA 2VGTA 2TPLA 3BCBA 1CJ0A 1D7RA 3DR7A 3FQ8A 4ATQA 3ACZA 4WYFA 4N0WA 1ECXA 1OXPA 1V2DA 2BIEA 4AH3A 3BC8A 4ZWMA 2ZYJA 5FT6A 1AICA 4WYCA 3M5UA 1IAYA 4Q6RA 2VMOA 3BWNA 4UQVA 5G09A 2YKVA 1B5PA 1BJOB 2D65A 4GDYA 4BA4A 4F5HA 4W91A 1QJ3A 1AKCA 2HP2A 1B9HA 2ZSLA 3ATHA 4J5UA 2AY3A 4O6ZA 1CQ6A 1G4VA 4TN4A 1I48A 4IXSA 4IYOB 1Y4IA 4IXOA 2R5CA 3QI6A 4OYTA 4IW7A 4WYDA 4B9BA 1AAWA 3DXWA 3GZDC 3DC1A 3UWCA 4ZM4A 1MLZA 3DRDA 5I92A 2AY2A 2CY8A 2Q7WA 3VK4A 1ARSA 1GEWA 1M7YA 1O61A 4A0FA 4H51A 2XH1A 1DKAA 2YKYA 3LVLB 2AY1A 2ZP7A 1KKJA 3ZZJA 4ADCA 4OC9A 4WXGA 1B9IA 4WP0A 4UHNA 1WYVA 1MDZA 2CFBA 1IX7A 2VI8A 1GC2A 3B1EA 1AAMA 3DR4A 4KXKA 1QITA 1TOEA 1ASBA 1V2EA 2NMPA 2YHKA 4MQPA 3RI6A 1TOGA 5M4BA 1WYUA 1VEFA 2YRRA 3PJ0A 4JF1A 2BHXA 3P6KA 4F5IA 5J8QA 2FYFA 2CJDA 2VMRA 4GE4A 2D5YA 5C6UA 1GEYA 1AHXA 4E3RA 3I5TA 4XK1A 1MAPA 3AEPA 3E2YA 4OT8A 3PDXA 1IVRA 3AENB 3ZRQA 4I8AA 3RCHA 2F8JA 1V72A 2VGZA 4R5FA 3KGXA 1LK9A 2VYCA 3VK2A 2X5FA 1KMKA 4Y0DA 3TQXA 1G4XA 3WLXA 1ARIA 5BJ3A 1OATA 1CL1A 1U08A 3RUYA 4FFCA 4PIWA 1H1CA 4XEWA 4CXQA 1TOKA 2EO5A 3NUIA 4LNLA 4RJYA 9AATA 3K40A 4PVFA 3GZDA 3FDBA 1ORDA 1C7OA 3EZ1A 5EIGA 1DFOA 3ELPA 5EAAA 1GEXA 1JG8A 4PFFA 2W7JA 2BI2A 3WKRA 1SZSA 2W8UA 1AMAA 2BI9A 2Z1YA 3PA9A 3NUBA 3WY7A 3BV0A 4WXFA 1AMSA 3GR9A 3QBOA 3WGBA 4OMAA 2Z9WA 2VMPA 4AO4A 4P7YA 2VGWA 3TCMA 4NOGA 2PB2A 2QLRA 2Z9XA 1WYTA 3HL2A 5G2QA 4UHOA 4BQ0A 1ELUA 1MAQA 1B4XA 3UE8A 2FM1A 3QM2A 1CQ7A 4ZASA 4F5GA 3TFTA 1ELQA 4AO9A 2RFVA 1S06A 2ZJGA 3DODA 1C4KA 3BCAA 1ASAA 4Y0HA 3ASAA 3AATA 4WB0A 1LW5A 4PFNA 4XJPA 3NU7A 4EU1A 4RKCA 3ECDA 4TMRA 1YAAA 4BHDA 1LW4A 2YCNA 2R0TA 1WSTA 3MEBA 1X0MA 3AEMC 1AHYA 3E6GA 4GEBA 1T3IA 3A2BA 2JJFA 1RV3A 2VMSA 1S08A 1DJ9A 1I41A 5EUNA 5M49A 2AY6A 1VP4A 1BJOA 4AZKA 1KMJA 1SZUA 3NYTA 2E54A 5TF5A 1BJWA 3ZRPA 1C7NA 1S0AA 2BI3A 4MSOA 1IJIA 5FT5A 4A6RA 4CXRA 1IX6A 3FDDA 4QGRA 4IYOA 1C0NA 2OQXA 4MQQA 1EG5A 2GMUA 3NDNA 3DZZA 2X5DA 1XI9A 2JJGA 1AJRA 4XJLA 1Z7DA 5E3KA 1IAXA 3HQTA 2DKJA 2VMYA 1BQAA 3NRAA 3RBLA 3A9ZA 4HF8A 1YIZA 1ZODA 2FNUA 4W1XA 4RAEA 2BWOA 1AY8A 1S09A 4E1OA 1H0CA 5E4ZA 1YNUA 4AZJA 4GE7A 2R2NA 1GC4A 1BT4A 4IY7A 1RVYA 1YJSA 2GMSA 1TOIA 3F6TA 1QZ9A 1BJ4A 3ZZKA 1GD9A 1N8PA 1N2TA 3G8MA 2VMWA 1ASFA 3N5MA 1IX8A 1AMRA 3VK3A 1CS1A 1SFFA 3K28A 1DJEA 3EIBA 4E77A 3G7QA 4XJMA 2BI5A 2C81A 2FN6A 2Z61A 4A6TA 3AEMA 2AATA 4CBRA 2VMUA 3AOVA 4WYGA 3PD6B 5EAVA 5FT8A 3NYSA 3NTJA 3GZCA 3LG0A 3AENA 4ZDPA 3RBFA 4A0RA 4DQ6A 1W7LA 2JGTA 2Z1ZA 2JG2A 3FTBA 2Z9UA 1GC0A 3AEOA 1G7XA 3FFRA 3QGUA 5D5SA 2W7HA 5M4DA 5JAYA 5IWQA 1UU0A 4F5JA 4ADEA 4JEVA 3BCXA 2WK8A 1M4NA 2VGUA 2YCPA 3WGCA 3B1DA 4DGTA 2DR1A 2OGEA 3ASBA 4EB5A 1D7SA 1ASLA 4CVQA 2EPJA 5HXXA 2D63A 4ZSYA 1SF2A 1TATA 3GETA 4GRXA 4F5FA 1M0QA 1SZKA 2D61A 3JWAA 4ZWVA 2CJGA 2BYLA 2D7ZA 2W7GA 1BJNA 1ASCA 1W7NA 3N75A 5DJ9A 8AATA 4R8DA 3USFA 1OHYA 2WKAA 4LW4A 2E7UA 4ZDOA 3UAKA 3FQAA 3NYUA 3HLMA 3ISLA 1JF9A 2C7TA 2ZY4A 1BW0A 1TASA 3FVXA 1ASNA 3EI5A 1AKBA 2GB3A 2CSTA 1LC8A 1IBJA 1AY4A 2R5CB 4JEYA 2HUIA 2EH6A 5D95A 3CAIA 2AY5A 2VMTA 3QN6A 1JS3A 2BIAA 1ARGA 2EZ2A 2HORA 3EI8A 5BJ4A 2D66A 4ITXA 4KAMA 1PFFA 4RKDA 1ZC9A 3R4TA 3QHXA 3WX9A 3DU4A 3AEJC 1LKCA 2AY8A 1DJUA 4UHMA 1MDXA 1EQBA 1GCKA 1ARTA 2OATA 4A6UA 2AY4A 4E3QA 4XQ2A 4K2BA 3LWSA 1TPLA 1QGNA 2CB1A 4M2KA 1P3WA 4ADDA 1E5EA 3FVUA 2O1BA 1CL2A 1QJ5A 3FKDA 4GE9A 3CQ4A 3MAFB 4F5KA 2HP1A 4JEZA 4WYAA 5G4IA 1AHGA 2V1PA 3HDOA 3RCHB 3CBFA 2W8JA 3E2ZB 3JWBA 2DOUA 3I4JA 4WLJA 2D64A 2W7MA 1KL1A 2ZUKA 1DTYA 3A9XA 4JEWA 4ADBA 3ELEA 4KYOA 1UKJA 5FT4A 1MGVA 1VJOA 1B8GA 4LNMA 4ZDLA 3E77A 1AIAA 2ZY3A 1KL2A 2W8WA 1AJSB 2ZC0A 3FRKA 1D7UA 1LS3A 3MADA 1AHEA 3AEJA 1OHVA 3B46A 2ZSMA 2EGYA 4FL0A 4GSAA 1S07A 1FC4A 3LY1A 5G2PA 2VLFA 3IHJA 1X29A 2O7CA 2JJEA 3P1TA 4ZM3A 1C7GA 4DBCA 4WYEA 3DYDA 1ASGA 3VAXA 2BWPA 1UU2A 3LVMA 3E2FA 2VIAA 2VMXA 1M0OA 3BB8A 4ITGA 1BQDA 2E7JA 2HUFA 3EUCA 1LC5A 3HMUA 4A0GA 2HOZA 2YKUA 2HOXA 3FQ7A 4EFFA 2EZ1A 2CINA 5M46A 1CZEA 1I43A 1AKAA 4UOYA 1DGDA 1O69A 4WB0B 3JW9A 2BIGA 4A0HA 1PG8A 4U1TA 1BKGA 4EMYA 3AV7A 4IXZA 1C9CA 1UU1A 2GQNA 2FQ6A 2Z9VA 3TATA
chains in the Genus database with same CATH superfamily
1CZCA 2CJHA 2FNIA 1TARA 1AX4A 1HQ3D 3NX3A 4XUJA 2AY9A 4X23A 5BT1C 1N1JB 4AOAA 5CPKD 3L44A 3O62C 3B6FD 1M0PA 3X1VD 3AZGC 4KGCA 3GWPA 1I29A 3AFAB 1M0NA 3WKJD 2XBNA 3N4RA 3KXBB 3REKD 3B1CA 3REHA 1RV4A 3PIUA 2R5EA 3AZED 1SVVA 3VH6W 4AWLB 2O0RA 3KFUG 1KU5A 2BYMB 4CSRB 1JS6A 2VLHA 1P3MD 4M2MA 4WBTA 3X1TC 3R9AA 3KE3A 2WK9A 5B0ZA 2NQBB 3E2ZA 3FZ7A 4J8VA 2BWNA 2VIBA 1D2FA 4WU8C 3EI9A 5AY8A 1DGEA 4IX8A 5AVBD 4WLHA 4ATPA 1QISA 3ZRRA 4ZUXA 1HTAA 1XEYA 3AZIA 5G4JA 1YJYA 3NU8A 4HVKA 3COGA 3W1JA 2F2AC 3KGWA 3AFAC 5B1LD 3GBXA 3PGYA 4UPKA 2PYOB 4KUDB 1P3GD 4M2JA 3LZ1D 5DJ1A 2DKBA 4Y0IA 2C0RA 2NZDD 5EIGB 2W7FA 3RQ1A 5F8VA 3MGRC 1AMQA 5DX5A 2E7IA 2HUUA 5B32C 3FZ6A 2X8UA 2HZPA 3KWQB 2DGMA 3H7FA 2PB0A 1P3KA 1W3UA 1WYTB 5F9SA 2FJ7B 5BNVB 2W7IA 4XZQB 5AV6A 4R2NA 1M1AA 1CQ8A 2NQBC 1ULYA 3NQJA 5BS7A 1KX5B 1GC3A 1ASDA 2YCTA 4JF0A 1V2FA 3UTAB 1P34A 1U35D 4LD9B 3WTPA 4J8WD 2VGTA 3FQ8A 4N0WA 1OXPA 5FT6A 5CPJB 1P3FC 1P3LD 5C3IB 5E5AB 1B5PA 2YKVA 1BJOB 4GDYA 2L5AA 4UUZB 3REJB 1Z2CB 1QJ3A 1AKCA 2ZSLA 2PYOC 4KUDC 1M18D 1CQ6A 4IYOB 1Y4IA 5F99D 2R5CA 4IW7A 3C1BB 2AY2A 4H9QA 3RELA 1GEWA 4A0FA 4R8PC 2XH1A 4WNNA 1DKAA 3ZZJA 4ADCA 1P3PA 4OC9A 2DGKA 5B31D 3KWQC 4KXKA 3AV2B 5M4BA 2FJ7C 3KUYA 4JF1A 1VEFA 4XZQC 5J8QA 4GE4A 4QLCB 3WAAD 1KX5C 3I5TA 4XK1A 1MAPA 3PDXA 3ZRQA 3UTAC 4I8AA 2F8JA 2VGZA 4LD9C 3VH6T 1G4XA 1ARIA 5BJ3A 1U08A 4FFCA 4PIWA 4CXQA 1H3OA 9AATA 4PVFA 1Q9CA 3GZDA 1ORDA 5C3IC 1P3AA 3REJC 1BH8A 1F66C 2BI2A 5GT0D 1F1EA 5GT3B 2BI9A 2WB6A 3PA9A 2CV5D 2HIOA 3C1BC 3A6ND 3MGSA 3AZMD 4BQ0A 1ELUA 2F8NK 1ELQA 3VH5A 5B1MA 2RFVA 1S06A 2ZJGA 3DODA 1C4KA 4Y0HA 3AATA 3AV2C 3NU7A 3WA9B 4Z5TD 4QLCC 3AZGD 4WU8A 3E6GA 1AHYA 1T3IA 2JJFA 1P3OD 1DJ9A 5EUNA 3N4XA 1M19A 1B6WA 1S0AA 3MVDB 1P3IB 3R45A 1C0NA 3DZZA 3AZNB 5E3KA 3HQTA 2VMYA 3RBLA 3A9ZA 1YIZA 4W1XA 1AY8A 5DNMD 1H0CA 5B0YD 5GT3C 1ID3B 1YJSA 1S32B 3ZZKA 1GD9A 3MGRA 2BYMA 1AMRA 1CS1A 5B32A 4CSRA 1SFFA 1P3BB 3K28A 2IO5C 4RITA 1KX4B 3GZCA 3LG0A 3AV1D 2NQBA 3WA9C 2Z9UA 1GC0A 3AEOA 3FFRA 4HGAC 4CAYA 1UU0A 3EPKA 1M4NA 3WGCA 3B1DA 3KXBD 1EQZB 4J8UD 5CPIB 5HXXA 3GETA 1M0QA 1SZKA 4ZWVA 2D7ZA 3MVDC 1P3IC 1P3FA 1ASCA 4J8XA 4XUJB 1OHYA 4X23B 2WKAA 3AZNC 3NYUA 3HLMA 3ISLA 3UT9C 1ASNA 3EI5A 1AKBA 2GB3A 1IBJA 4KGCB 5B2JC 3X1SD 2EH6A 1ID3C 3CAIA 3QN6A 5BNXA 1S32C 3EI8A 5BJ4A 4RKDA 4R8PA 3LJAA 3QHXA 3W99D 4YS3D 1P3BC 2AY8A 3KWQA 1EQBA 2DQNC 4XQ2A 3LWSA 1KX4C 4XZQA 3FVUA 2O1BA 5B0ZB 3E2ZB 2DOUA 4WLJA 2PYOD 4J8VB 4JEWA 4ADBA 3EPJA 1EQZC 2X3LA 5CPIC 5AY8B 1B8GA 4LNMA 3E77A 4ZUXB 4XUJC 3B6GA 2W8WA 4X23C 3AZIB 3FRKA 1F66A 1OHVA 4KGCC 4FL0A 2VLFA 3IHJA 3P1TA 3DYDA 3EUCA 4EO5C 2YKUA 3FQ7A 4WB0B 3JW9A 3HVYA 1PG8A 3AV7A 4IXZA 2FQ6A 2Z9VA 4WJ3C 1P3KB 3LVKA 5CPJD 2AY7A 3BS8A 5E5AD 5AV6B 5B0ZC 1M1AB 3FVSA 2VI9A 3NQJB 4J8VC 2W8VA 1E5FA 2QA3A 4R5ZA 1P34B 4W1WA 5AY8C 3WTPB 3F0HA 5CP6A 4ZUXC 3F9TA 5JA4A 4JEXA 3W97A 5AV5C 3AZIC 1X2AA 4OCAA 4U2HA 2Y2KA 4LC3A 1GDEA 4CBSA 5B32G 3MGPD 3OKSA 4EB7A 2VMQA 3LELD 5KDMA 2D7YA 2BKWA 1BS0A 1O62A 3B8XA 3MAFA 4H9QB 3GSBA 3EZSA 3FFHA 4OTLA 3AZHB 4WNNB 4Q75A 1P3PB 3FSLA 5K8BA 4YM6D 1ZOBA 2W8SA 1P3KC 3KKIA 3AZKC 1W7MA 3AZJA 3KUYB 1GBNA 4WD2A 5AV6C 5B24A 1ASEA 1M1AC 3PAAA 5BS7C 2Z20A 3H9XA 3BN1A 4ZSWA 4JJND 5DNND 1P34C 3TU4D 3WTPC 3C1CD 4A00A 1M32A 5EUEA 2F8ND 2ZY2A 3I16A 3UT9A 1EJIA 4K2IA 5B2JA 2OKKA 1P3AB 4W5KA 1ZLAD 1S32A 1SPAA 1LC7A 3L8AA 5B33D 5EQCA 5G49A 2HIOB 1IUGA 5AV8D 4WU9D 2OGAA 3CQ5A 3MGSB 2YKXA 2Y2HA 3AZHC 2JJHA 1HQ3A 3UTBB 2VGSA 3LZ0B 5B1MB 1WWIA 1P3ID 5GXQD 3B6FA 4ATQA 3X1UC 4WU8B 2BIEA 4AH3A 3BC8A 3REKA 1IAYA 3BWNA 5G09A 4BA4A 3W98D 1M19B 2HP2A 4J5UA 3V9RA 3MNNC 4O6ZA 1P3BD 4TN4A 3R45B 4B9BA 1AAWA 3GZDC 1P3AC 3DRDA 1ARSA 1M7YA 4H51A 2YKYA 4WXGA 1B9IA 2HIOC 4UHNA 2CFBA 1IX7A 3DR4A 3MGRB 3MGSC 1KX3D 2F8NH 1TOEA 1V2EA 3RI6A 5B32B 2YRRA 2BHXA 1AOID 2CJDA 3UTBC 5C6UA 3EPLA 4E3RA 5B2IA 3LZ0C 5B1MC 3W1IA 3E2YA 1V72A 3VK2A 4CAYB 5B1LA 3WLXA 1OATA 2FFFB 1CL1A 3RUYA 2RVQC 1P3GA 3NUIA 4LNLA 3EZ1A 4H9RA 3REHD 3ELPA 5AV5A 2NZDA 1M19C 1AMAA 3AZFD 1P3FB 4J8XB 2Y2NA 3BV0A 1AMSA 3GR9A 3QBOA 2VGWA 2HUEB 2PB2A 3AYWD 1BH9B 2AROA 4G91B 1B4XA 3UE8A 5BNXB 3QM2A 3BCAA 2DGLA 2BYKA 4R8PB 3LJAB 4WB0A 1LW5A 4PFNA 4DQYB 4RKCA 1U35A 2Y2QA 4TMRA 4Z66D 4J8WA 2YCNA 4GEBA 3AN2D 2Y2IA 3AZKA 1RV3A 3AZLA 2AY6A 4H9PA 5TF5A 2E54A 3ZRPA 2BI3A 4MSOA 1IJIA 5FT5A 4NE5A 2OQXA 4MQQA 2GMUA 3NDNA 1XI9A 5F99A 5AV9D 2DKJA 1BQAA 3NRAA 1ZODA 2BWOA 1S09A 1YNUA 2R2NA 4J8XC 4J8LA 2GMSA 3B6GB 3F6TA 1BJ4A 1F66B 1N2TA 2HUEC 1IX8A 1PZRA 4G91C 1DJEA 3EIBA 4E77A 2Y2GA 2C81A 2FN6A 2Z61A 4A6TA 2JCHA 4CBRA 2VMUA 4E45A 3NTJA 3AZHA 3LJAC 2JGTA 5D5SA 1P34D 5IWQA 1R4VA 4EB5A 3X1UA 1ASLA 2D63A 4ZSYA 1SF2A 1TATA 4F5FA 2Y2PA 2CJGA 2DF4C 1BJNA 1W7NA 5GT0A 5DJ9A 4ZDOA 3FQAA 3MNNA 2ZY4A 1BW0A 1TASA 4RJ0A 3AZMA 2HUIA 5CP6B 3NQUA 2VMTA 5AVCA 3RELD 5JA4B 3B6GC 2HORA 3W97B 1P3PD 1PFFA 3R4TA 3WX9A 5JRGA 1MDXA 1GCKA 1ARTA 4A6UA 2AY4A 3KUYD 5KDMB 1TPLA 1QGNA 2IO5B 1E5EA 3UTBA 1P3OA 4E44A 3FKDA 3CQ4A 3MAFB 3LZ0A 4WYAA 4H9SA 3HDOA 3RCHB 3CBFA 3REIB 5BT1D 3I4JA 3N4SA 1DTYA 3O62D 4HGAB 3ELEA 5FT4A 1MGVA 3AZJB 1VJOA 3EG5B 5DNMA 5B24B 5B0YA 1KL2A 1A7WA 3AEJA 2ZSMA 4GSAA 5G2PA 5CP6C 2O7CA 3W97C 3UT9B 4WYEA 1ASGA 5B2JB 4ITGA 3BB8A 3AV1A 3X1TD 1LC5A 2HOZA 1TZYC 1CZEA 2UWXA 5G49B 4A0HA 4WU8D 1C9CA 1D7VA 1FG7A 4J8UA 3EI7A 4H9NA 3REIC 1HQ3B 3A1KA 1AHFA 1B5OA 3LVJA 2GSAA 2W7KA 1OHWA 3CQ6A 5E5IA 5CPKB 4B98A 3AFAD 2CTZA 3AZJC 3B6FB 5B40A 4XAUA 2W7EA 2QB3A 5B24C 5GSUA 1YIYA 3T32A 3Q8NA 3II0A 3REKB 3VH6A 2W7LA 3W99A 3MGRD 2VMVA 1ASMA 4K2MA 3V9RB 5B32D 5HHYA 2BYJA 1BH9A 5HDMA 3K7YA 1M6SA 2NQBD 4W1VA 3NNKA 1N31A 4A72A 4EO5B 1O4SA 1KKPA 2QMAA 1YJZA 4LNJA 4DRAA 1HQ3C 5AVBB 3MGQA 2C44A 1AIBA 1AJSA 5B2IB 1P3FD 1AY5A 5CPKC 3HBXA 1W23A 3B0CW 1YOOA 3B6FC 3PPLA 3X1VC 4KUDD 2QB2A 3MBBA 3D6KA 3H0LC 5B1LB 4MKJA 4ZLVA 1P3GB 3REKC 1ARHA 3BWNC 2BI1A 2YOBA 4H9RB 3WCNA 3AZEC 4R8PD 1TOJA 5AV5B 2NZDB 3MC6A 4F5MA 3MAUA 3WZFA 3KWQD 2YRIA 1WKGA 3GJUA 2W7DA 1P3MC 2FJ7D 2QBTA 4ZBJB 2CANA 4XZQD 1PMOA 2AROB 3BWOA 1KX5D 3JTXA 3PDBA 2V0YA 3UTAD 4Q76A 4LD9D 2BYKB 3VP6A 3TFUA 2ORDA 1U35B 3BCBA 5AVBC 4J8WB 2A1VA 3ACZA 1ECXA 5B2IC 3AZKB 4ZWMA 3EPHA 4WYCA 4UQVA 4Q6RA 4NE6A 2VMOA 3REJD 3AZLB 1F66D 2D65A 4F5HA 4H9PB 1P3LB 3MGPA 5B1LC 1I48A 4IXSA 3W96A 1P3GC 3C1BD 4IXOA 3LZ1C 3DXWA 5F99B 3UWCA 4ZM4A 1MLZA 2CY8A 4Z2MG 2Q7WA 3VK4A 2NZDC 2Y2MA 4WV4B 3LVLB 2AY1A 2ZP7A 4WP0A 1WYVA 5B31B 2VI8A 1TZYA 3AV2D 1AAMA 1GC2A 3B1EA 4YM6A 4ZBJC 4MQPA 1TOGA 1WYUA 3PJ0A 4QLCD 2AROC 3P6KA 2FYFA 2VMRA 3KSYA 1GEYA 1AHXA 3AEPA 1IVRA 3RCHA 4JJNA 3REIA 4R5FA 5DNNA 1U35C 2VYCA 1KMKA 4Y0DA 4J8WC 3C1CA 2F8NA 4XEWA 1H1CA 1TOKA 4RJYA 3W97D 3AZLC 1C7OA 3X1UB 1DFOA 5EAAA 1P3LC 4PFFA 2W7JA 5GT3D 1SZSA 2LY8A 2W8UA 5B33A 5GT0B 3WY7A 1W2EA 3WGBA 5F99C 4OMAA 4AO4A 3MNNB 3TCMA 2Z9XA 3HL2A 5AV8A 5G2QA 3AZMB 3IP4C 3NQUB 5AVCB 4F5GA 4AO9A 5B31C 1ASAA 3WA9D 3VH5W 2Y2JA 5JRGB 3B0CT 3AZJD 2R0TA 4Z5TB 3A2BA 3WAAC 1S08A 1I41A 1P3OB 4AZKA 1KMJA 3HT4A 3NYTA 3MVDD 5CPKA 1IX6A 3FDDA 4H63Q 4QGRA 3AZND 3X1VA 2JJGA 4XJLA 3UT9D 1Z7DA 1IAXA 4HF8A 5B2JD 2FNUA 3WKJA 4RAEA 4RLGA 1ID3D 3H0RC 4GE7A 1S32D 1GC4A 5DNMB 1BT4A 1RVYA 5GT0C 5B0YB 1QZ9A 3AZEA 1N8PA 3B0DB 3G8MA 2VMWA 3N5MA 2JSSA 3AZMC 1KX3A 2J8PA 5AVCC 4M6BA 1AOIA 3G0TA 1P3MA 1KX4D 4G92B 3AEMA 3PD6B 5EAVA 5FT8A 3AENA 4ZDPA 3RBFA 4A0RA 2Z1ZA 5JRGC 3AV1B 1G7XA 3QGUA 5M4DA 5JAYA 3H0MC 4F5JA 4Z5TC 1EQZD 3BCXA 2YCPA 5CPID 2VGUA 4DGTA 2DR1A 5AVBA 1P3OC 4OBUA 4J8UB 4GRXA 3JWAA 4H9NB 4H9SC 4XUJD 2BYLA 2W7GA 4X23D 3N75A 3AZFA 3USFA 8AATA 2E7UA 1JF9A 2C7TA 3FVXA 4KGCD 2CSTA 1AY4A 5B40B 3AYWA 3LZ1A 5DNMC 5B0YC 3X1SB 4K05A 2BIAA 5GSUB 1ARGA 1T3UA 4ITXA 4KAMA 3B0DC 1ZC9A 3DU4A 3AEJC 1LKCA 3FZ8A 3W99B 4UHMA 4YS3B 4Z66A 4G92C 4K2BA 4M2KA 3AN2A 1TAFA 5B2ID 2JE5A 1CL2A 3AV1C 4GE9A 4F5KA 5G4IA 5B0ZD 1AHGA 2F8NG 4J8VD 2ZUKA 1KL1A 1PMMA 5AY8D 3KXBC 5AV9A 4NE3A 4J8UC 4ZUXD 4ZDLA 3AZID 5AV5D 3MGQB 1P3LA 1AJSB 2ZC0A 1D7UA 4AWLC 3MADA 1AHEA 3B46A 3VH5T 1M18A 5B40C 1S07A 3X1SC 5GSUC 1C7GA 2AROD 4DBCA 3VAXA 2BWPA 2VIAA 2VMXA 1M0OA 1BQDA 2G5HC 4A0GA 3W99C 2HOXA 4EFFA 4YS3C 5B31A 2CINA 5M46A 1I43A 1DGDA 1O69A 4RM1A 2QSRA 4EMYA 1BKGA 1P3KD 1UU1A 3AZKD 2GQNA 4LW2A 5AV6D 3WAAA 3AZLD 1QIRA 2PO3A 4ISYA 5DB5A 1M1AD 3AL0C 3VOMA 4P3MA 3PDBB 4BA5A 2W8TA 3WTPD 4MQRA 4WXBA 7AATA 5EFSA 2WK7A 3A9YA 3MGQC 5BO0B 1FG3A 1BFMA 4W8IA 2YFWB 2XD5A 1OXOA 2HOYA 2YFVA 3MGPB 2CV5A 1JFIB 2ZY5A 3LELB 2VMZA 1J32A 3W96B 3A6NA 2AEUA 2VGVA 3A8UX 4F4EA 3FCRA 3WCOA 5FUGA 1WKHA 3QPGA 4L0OA 4BMKA 3EIAA 4ZAHA 5AX8A 3AZHD 2XD1A 3MC6C 5KTBA 4H9OA 3WTPE 3MKJA 1B67A 3N0LA 1WYVB 1MDOA 1TZYB 3O62A 4Z5TA 4YM6B 3AZGA 3X1UD 1WYUB 5CPJC 5E5AC 4MKKA 5G0AA 4F5LA 4JJNB 2G6WA 4XJOA 5DNNB 3MNND 3E9KA 3DXVA 3TU4B 3C1CB 1KAFA 4KHAA 2F8NB 2CH1A 3AELA 5AVCD 1P3AD 2VMNA 1MLYA 3MGPC 3X1TA 1RVUA 1ZLAB 2G7JA 3LV2A 3AOWA 5JRGD 1G7WA 2HIOD 3EI6A 1Z3ZA 3LELC 5B33B 3W96C 1J04A 1X28A 5EUDA 3MGSD 5AV8B 4WU9B 3WKSA 3PD6A 3UTBD 4MY5A 2CH2A 3OP7A 3LZ0D 5B1MD 2EYQA 1N1JA 4Q31A 4YM6C 5GXQB 3AFAA 2TPLA 3DR7A 1CJ0A 1D7RA 2RVQD 4WYFA 3KXBA 1V2DA 2ZYJA 1AICA 3M5UA 2KFPA 4JJNC 5DNNC 1M19D 4W91A 2BG1A 3TU4C 4NFTA 1B9HA 3ATHA 3C1CC 3W98B 2AY3A 1G4VA 3A1IA 4OYTA 4WYDA 3QI6A 3X1VB 2AEVA 3DC1A 5I92A 3X1SA 3WKJB 5B31G 1O61A 1ZLAC 3N7NA 4DRBA 1KKJA 5B33C 1MDZA 3AZEB 4YS3A 1QITA 2NMPA 1ASBA 2YHKA 5AV8C 4WU9C 5CHLB 1KX3B 4F5IA 2D5YA 1AOIB 1P3MB 3FD0A 4OT8A 3AENB 5GXQC 3KGXA 1LK9A 2X5FA 3TQXA 2PYOA 4KUDA 5B40D 3P5JB 2EO5A 5GSUD 3K40A 3FDBA 5EIGA 1GEXA 1JG8A 3REHB 3WKRA 3W98C 4J8XD 2Z1YA 3AZFB 3NUBA 4WXFA 1WWSA 2Z9WA 2VMPA 4P7YA 4NOGA 2QLRA 3WKJC 1WYTA 2FJ7A 4UHOA 5BNVA 1MAQA 3AYWB 3LZ1B 2FM1A 4ZASA 1CQ7A 3TFTA 2JISA 1KX5A 3LJAD 3UTAA 3ASAA 4LD9A 4XJPA 4EU1A 1KX3C 3ECDA 1YAAA 4BHDA 1LW4A 1AOIC 1WSTA 3MEBA 4Z66B 1X0MA 3AEMC 2VMSA 3MGQD 3AN2B 5CPJA 5M49A 1TAFB 5E5AA 1VP4A 1BJOA 4Z2MH 1SZUA 4UUZA 3REJA 1BJWA 1C7NA 4A6RA 4CXRA 4IYOA 4WZSB 1EG5A 2X5DA 1AJRA 3C1BA 5BO0A 4E1OA 5AV9B 3REHC 5E4ZA 2YFWA 4AZJA 3B6GD 4IY7A 3AZFC 1TOIA 1JFIA 1ASFA 3AV2A 3LELA 3VK3A 1M18B 3AYWC 3G7QA 4XJMA 2BI5A 4QLCA 2AATA 3AOVA 4WYGA 2Y2OA 3NYSA 4DQ6A 1W7LA 2JG2A 3FTBA 3B0BA 2W7HA 4Z66C 4ADEA 4JEVA 2WK8A 3AN2C 2CWEA 2OGEA 3ASBA 1D7SA 4CVQA 2EPJA 3WAAB 2D61A 5GT3A 4R8DA 4LW4A 3TU4A 3UAKA 3W96D 5AV9C 5CP6D 1LC8A 2R5CB 4JEYA 5D95A 3W1HA 2AY5A 1JS3A 2EZ2A 3JZLA 3RELB 2D66A 1ZLAA 4RIZA 3WA9A 1M18C 1TZYD 1DJUA 2YFVB 2Y2LA 2CV5B 2OATA 4E3QA 2RIQA 4WU9A 3A6NB 2CB1A 2VQRA 1P3WA 4ADDA 4OBVA 5FUGB 1QJ5A 2HP1A 3REID 4JEZA 4H9OB 2V1PA 3MVDA 1P3IA 5GXQA 2W8JA 3JWBA 2D64A 2W7MA 3AZNA 3A9XA 3O62B 4KYOA 1UKJA 3AZGB 1H3OB 5B24D 2OKJA 1ID3A 1AIAA 2ZY3A 1BH8B 3W98A 1LS3A 2FKIA 2ZM5A 2EGYA 1P3BA 1FC4A 3LY1A 1X29A 2JJEA 4ZM3A 4KHAB 3RELC 1KX4A 3LVMA 1UU2A 3E2FA 1P3PC 2HUFA 2E7JA 3HMUA 2EZ1A 2CV5C 3X1TB 1AKAA 4UOYA 3A6NC 3KUYC 2BIGA 4U1TA 1EQZA 2G5IC 5CPIA 3TATA
chains in the Genus database with same CATH topology
1CZCA 2CJHA 2FNIA 1TARA 1AX4A 1HQ3D 3NX3A 4XUJA 2AY9A 4X23A 5BT1C 1N1JB 4AOAA 5CPKD 3L44A 3O62C 3B6FD 1M0PA 3X1VD 3AZGC 4KGCA 3GWPA 1I29A 3AFAB 1M0NA 3WKJD 2XBNA 3N4RA 3KXBB 3REKD 3B1CA 3REHA 1RV4A 3PIUA 2R5EA 3AZED 1SVVA 3VH6W 4AWLB 2O0RA 3KFUG 1KU5A 2BYMB 4CSRB 1JS6A 2VLHA 1P3MD 4M2MA 4WBTA 3X1TC 3R9AA 3KE3A 2WK9A 5B0ZA 2NQBB 3E2ZA 3FZ7A 4J8VA 2BWNA 2VIBA 1D2FA 4WU8C 3EI9A 5AY8A 1DGEA 4IX8A 5AVBD 4WLHA 4ATPA 1QISA 3ZRRA 4ZUXA 1HTAA 1XEYA 3AZIA 5G4JA 1YJYA 3NU8A 4HVKA 3COGA 3W1JA 2F2AC 3KGWA 3AFAC 5B1LD 3GBXA 3PGYA 4UPKA 2PYOB 4KUDB 1P3GD 4M2JA 3LZ1D 5DJ1A 2DKBA 4Y0IA 2C0RA 2NZDD 5EIGB 2W7FA 3RQ1A 5F8VA 3MGRC 1AMQA 5DX5A 2E7IA 2HUUA 5B32C 3FZ6A 2X8UA 2HZPA 3KWQB 2DGMA 3H7FA 2PB0A 1P3KA 1W3UA 1WYTB 5F9SA 2FJ7B 5BNVB 2W7IA 4XZQB 5AV6A 4R2NA 1M1AA 1CQ8A 2NQBC 1ULYA 3NQJA 5BS7A 1KX5B 1GC3A 1ASDA 2YCTA 4JF0A 1V2FA 3UTAB 1P34A 1U35D 4LD9B 3WTPA 4J8WD 2VGTA 3FQ8A 4N0WA 1OXPA 5FT6A 5CPJB 1P3FC 1P3LD 5C3IB 5E5AB 1B5PA 2YKVA 1BJOB 4GDYA 2L5AA 4UUZB 3REJB 1Z2CB 1QJ3A 1AKCA 2ZSLA 2PYOC 4KUDC 1M18D 1CQ6A 4IYOB 1Y4IA 5F99D 2R5CA 4IW7A 3C1BB 2AY2A 4H9QA 3RELA 1GEWA 4A0FA 4R8PC 2XH1A 4WNNA 1DKAA 3ZZJA 4ADCA 1P3PA 4OC9A 2DGKA 5B31D 3KWQC 4KXKA 3AV2B 5M4BA 2FJ7C 3KUYA 4JF1A 1VEFA 4XZQC 5J8QA 4GE4A 4QLCB 3WAAD 1KX5C 3I5TA 4XK1A 1MAPA 3PDXA 3ZRQA 3UTAC 4I8AA 2F8JA 2VGZA 4LD9C 3VH6T 1G4XA 1ARIA 5BJ3A 1U08A 4FFCA 4PIWA 4CXQA 1H3OA 9AATA 4PVFA 1Q9CA 3GZDA 1ORDA 5C3IC 1P3AA 3REJC 1BH8A 1F66C 2BI2A 5GT0D 1F1EA 5GT3B 2BI9A 2WB6A 3PA9A 2CV5D 2HIOA 3C1BC 3A6ND 3MGSA 3AZMD 4BQ0A 1ELUA 2F8NK 1ELQA 3VH5A 5B1MA 2RFVA 1S06A 2ZJGA 3DODA 1C4KA 4Y0HA 3AATA 3AV2C 3NU7A 3WA9B 4Z5TD 4QLCC 3AZGD 4WU8A 3E6GA 1AHYA 1T3IA 2JJFA 1P3OD 1DJ9A 5EUNA 3N4XA 1M19A 1B6WA 1S0AA 3MVDB 1P3IB 3R45A 1C0NA 3DZZA 3AZNB 5E3KA 3HQTA 2VMYA 3RBLA 3A9ZA 1YIZA 4W1XA 1AY8A 5DNMD 1H0CA 5B0YD 5GT3C 1ID3B 1YJSA 1S32B 3ZZKA 1GD9A 3MGRA 2BYMA 1AMRA 1CS1A 5B32A 4CSRA 1SFFA 1P3BB 3K28A 2IO5C 4RITA 1KX4B 3GZCA 3LG0A 3AV1D 2NQBA 3WA9C 2Z9UA 1GC0A 3AEOA 3FFRA 4HGAC 4CAYA 1UU0A 3EPKA 1M4NA 3WGCA 3B1DA 3KXBD 1EQZB 4J8UD 5CPIB 5HXXA 3GETA 1M0QA 1SZKA 4ZWVA 2D7ZA 3MVDC 1P3IC 1P3FA 1ASCA 4J8XA 4XUJB 1OHYA 4X23B 2WKAA 3AZNC 3NYUA 3HLMA 3ISLA 3UT9C 1ASNA 3EI5A 1AKBA 2GB3A 1IBJA 4KGCB 5B2JC 3X1SD 2EH6A 1ID3C 3CAIA 3QN6A 5BNXA 1S32C 3EI8A 5BJ4A 4RKDA 4R8PA 3LJAA 3QHXA 3W99D 4YS3D 1P3BC 2AY8A 3KWQA 1EQBA 2DQNC 4XQ2A 3LWSA 1KX4C 4XZQA 3FVUA 2O1BA 5B0ZB 3E2ZB 2DOUA 4WLJA 2PYOD 4J8VB 4JEWA 4ADBA 3EPJA 1EQZC 2X3LA 5CPIC 5AY8B 1B8GA 4LNMA 3E77A 4ZUXB 4XUJC 3B6GA 2W8WA 4X23C 3AZIB 3FRKA 1F66A 1OHVA 4KGCC 4FL0A 2VLFA 3IHJA 3P1TA 3DYDA 3EUCA 4EO5C 2YKUA 3FQ7A 4WB0B 3JW9A 3HVYA 1PG8A 3AV7A 4IXZA 2FQ6A 2Z9VA 4WJ3C 1P3KB 3LVKA 5CPJD 2AY7A 3BS8A 5E5AD 5AV6B 5B0ZC 1M1AB 3FVSA 2VI9A 3NQJB 4J8VC 2W8VA 1E5FA 2QA3A 4R5ZA 1P34B 4W1WA 5AY8C 3WTPB 3F0HA 5CP6A 4ZUXC 3F9TA 5JA4A 4JEXA 3W97A 5AV5C 3AZIC 1X2AA 4OCAA 4U2HA 2Y2KA 4LC3A 1GDEA 4CBSA 5B32G 3MGPD 3OKSA 4EB7A 2VMQA 3LELD 5KDMA 2D7YA 2BKWA 1BS0A 1O62A 3B8XA 3MAFA 4H9QB 3GSBA 3EZSA 3FFHA 4OTLA 3AZHB 4WNNB 4Q75A 1P3PB 3FSLA 5K8BA 4YM6D 1ZOBA 2W8SA 1P3KC 3KKIA 3AZKC 1W7MA 3AZJA 3KUYB 1GBNA 4WD2A 5AV6C 5B24A 1ASEA 1M1AC 3PAAA 5BS7C 2Z20A 3H9XA 3BN1A 4ZSWA 4JJND 5DNND 1P34C 3TU4D 3WTPC 3C1CD 4A00A 1M32A 5EUEA 2F8ND 2ZY2A 3I16A 3UT9A 1EJIA 4K2IA 5B2JA 2OKKA 1P3AB 4W5KA 1ZLAD 1S32A 1SPAA 1LC7A 3L8AA 5B33D 5EQCA 5G49A 2HIOB 1IUGA 5AV8D 4WU9D 2OGAA 3CQ5A 3MGSB 2YKXA 2Y2HA 3AZHC 2JJHA 1HQ3A 3UTBB 2VGSA 3LZ0B 5B1MB 1WWIA 1P3ID 5GXQD 3B6FA 4ATQA 3X1UC 4WU8B 2BIEA 4AH3A 3BC8A 3REKA 1IAYA 3BWNA 5G09A 4BA4A 3W98D 1M19B 2HP2A 4J5UA 3V9RA 3MNNC 4O6ZA 1P3BD 4TN4A 3R45B 4B9BA 1AAWA 3GZDC 1P3AC 3DRDA 1ARSA 1M7YA 4H51A 2YKYA 4WXGA 1B9IA 2HIOC 4UHNA 2CFBA 1IX7A 3DR4A 3MGRB 3MGSC 1KX3D 2F8NH 1TOEA 1V2EA 3RI6A 5B32B 2YRRA 2BHXA 1AOID 2CJDA 3UTBC 5C6UA 3EPLA 4E3RA 5B2IA 3LZ0C 5B1MC 3W1IA 3E2YA 1V72A 3VK2A 4CAYB 5B1LA 3WLXA 1OATA 2FFFB 1CL1A 3RUYA 2RVQC 1P3GA 3NUIA 4LNLA 3EZ1A 4H9RA 3REHD 3ELPA 5AV5A 2NZDA 1M19C 1AMAA 3AZFD 1P3FB 4J8XB 2Y2NA 3BV0A 1AMSA 3GR9A 3QBOA 2VGWA 2HUEB 2PB2A 3AYWD 1BH9B 2AROA 4G91B 1B4XA 3UE8A 5BNXB 3QM2A 3BCAA 2DGLA 2BYKA 4R8PB 3LJAB 4WB0A 1LW5A 4PFNA 4DQYB 4RKCA 1U35A 2Y2QA 4TMRA 4Z66D 4J8WA 2YCNA 4GEBA 3AN2D 2Y2IA 3AZKA 1RV3A 3AZLA 2AY6A 4H9PA 5TF5A 2E54A 3ZRPA 2BI3A 4MSOA 1IJIA 5FT5A 4NE5A 2OQXA 4MQQA 2GMUA 3NDNA 1XI9A 5F99A 5AV9D 2DKJA 1BQAA 3NRAA 1ZODA 2BWOA 1S09A 1YNUA 2R2NA 4J8XC 4J8LA 2GMSA 3B6GB 3F6TA 1BJ4A 1F66B 1N2TA 2HUEC 1IX8A 1PZRA 4G91C 1DJEA 3EIBA 4E77A 2Y2GA 2C81A 2FN6A 2Z61A 4A6TA 2JCHA 4CBRA 2VMUA 4E45A 3NTJA 3AZHA 3LJAC 2JGTA 5D5SA 1P34D 5IWQA 1R4VA 4EB5A 3X1UA 1ASLA 2D63A 4ZSYA 1SF2A 1TATA 4F5FA 2Y2PA 2CJGA 2DF4C 1BJNA 1W7NA 5GT0A 5DJ9A 4ZDOA 3FQAA 3MNNA 2ZY4A 1BW0A 1TASA 4RJ0A 3AZMA 2HUIA 5CP6B 3NQUA 2VMTA 5AVCA 3RELD 5JA4B 3B6GC 2HORA 3W97B 1P3PD 1PFFA 3R4TA 3WX9A 5JRGA 1MDXA 1GCKA 1ARTA 4A6UA 2AY4A 3KUYD 5KDMB 1TPLA 1QGNA 2IO5B 1E5EA 3UTBA 1P3OA 4E44A 3FKDA 3CQ4A 3MAFB 3LZ0A 4WYAA 4H9SA 3HDOA 3RCHB 3CBFA 3REIB 5BT1D 3I4JA 3N4SA 1DTYA 3O62D 4HGAB 3ELEA 5FT4A 1MGVA 3AZJB 1VJOA 3EG5B 5DNMA 5B24B 5B0YA 1KL2A 1A7WA 3AEJA 2ZSMA 4GSAA 5G2PA 5CP6C 2O7CA 3W97C 3UT9B 4WYEA 1ASGA 5B2JB 4ITGA 3BB8A 3AV1A 3X1TD 1LC5A 2HOZA 1TZYC 1CZEA 2UWXA 5G49B 4A0HA 4WU8D 1C9CA 1D7VA 1FG7A 4J8UA 3EI7A 4H9NA 3REIC 1HQ3B 3A1KA 1AHFA 1B5OA 3LVJA 2GSAA 2W7KA 1OHWA 3CQ6A 5E5IA 5CPKB 4B98A 3AFAD 2CTZA 3AZJC 3B6FB 5B40A 4XAUA 2W7EA 2QB3A 5B24C 5GSUA 1YIYA 3T32A 3Q8NA 3II0A 3REKB 3VH6A 2W7LA 3W99A 3MGRD 2VMVA 1ASMA 4K2MA 3V9RB 5B32D 5HHYA 2BYJA 1BH9A 5HDMA 3K7YA 1M6SA 2NQBD 4W1VA 3NNKA 1N31A 4A72A 4EO5B 1O4SA 1KKPA 2QMAA 1YJZA 4LNJA 4DRAA 1HQ3C 5AVBB 3MGQA 2C44A 1AIBA 1AJSA 5B2IB 1P3FD 1AY5A 5CPKC 3HBXA 1W23A 3B0CW 1YOOA 3B6FC 3PPLA 3X1VC 4KUDD 2QB2A 3MBBA 3D6KA 3H0LC 5B1LB 4MKJA 4ZLVA 1P3GB 3REKC 1ARHA 3BWNC 2BI1A 2YOBA 4H9RB 3WCNA 3AZEC 4R8PD 1TOJA 5AV5B 2NZDB 3MC6A 4F5MA 3MAUA 3WZFA 3KWQD 2YRIA 1WKGA 3GJUA 2W7DA 1P3MC 2FJ7D 2QBTA 4ZBJB 2CANA 4XZQD 1PMOA 2AROB 3BWOA 1KX5D 3JTXA 3PDBA 2V0YA 3UTAD 4Q76A 4LD9D 2BYKB 3VP6A 3TFUA 2ORDA 1U35B 3BCBA 5AVBC 4J8WB 2A1VA 3ACZA 1ECXA 5B2IC 3AZKB 4ZWMA 3EPHA 4WYCA 4UQVA 4Q6RA 4NE6A 2VMOA 3REJD 3AZLB 1F66D 2D65A 4F5HA 4H9PB 1P3LB 3MGPA 5B1LC 1I48A 4IXSA 3W96A 1P3GC 3C1BD 4IXOA 3LZ1C 3DXWA 5F99B 3UWCA 4ZM4A 1MLZA 2CY8A 4Z2MG 2Q7WA 3VK4A 2NZDC 2Y2MA 4WV4B 3LVLB 2AY1A 2ZP7A 4WP0A 1WYVA 5B31B 2VI8A 1TZYA 3AV2D 1AAMA 1GC2A 3B1EA 4YM6A 4ZBJC 4MQPA 1TOGA 1WYUA 3PJ0A 4QLCD 2AROC 3P6KA 2FYFA 2VMRA 3KSYA 1GEYA 1AHXA 3AEPA 1IVRA 3RCHA 4JJNA 3REIA 4R5FA 5DNNA 1U35C 2VYCA 1KMKA 4Y0DA 4J8WC 3C1CA 2F8NA 4XEWA 1H1CA 1TOKA 4RJYA 3W97D 3AZLC 1C7OA 3X1UB 1DFOA 5EAAA 1P3LC 4PFFA 2W7JA 5GT3D 1SZSA 2LY8A 2W8UA 5B33A 5GT0B 3WY7A 1W2EA 3WGBA 5F99C 4OMAA 4AO4A 3MNNB 3TCMA 2Z9XA 3HL2A 5AV8A 5G2QA 3AZMB 3IP4C 3NQUB 5AVCB 4F5GA 4AO9A 5B31C 1ASAA 3WA9D 3VH5W 2Y2JA 5JRGB 3B0CT 3AZJD 2R0TA 4Z5TB 3A2BA 3WAAC 1S08A 1I41A 1P3OB 4AZKA 1KMJA 3HT4A 3NYTA 3MVDD 5CPKA 1IX6A 3FDDA 4H63Q 4QGRA 3AZND 3X1VA 2JJGA 4XJLA 3UT9D 1Z7DA 1IAXA 4HF8A 5B2JD 2FNUA 3WKJA 4RAEA 4RLGA 1ID3D 3H0RC 4GE7A 1S32D 1GC4A 5DNMB 1BT4A 1RVYA 5GT0C 5B0YB 1QZ9A 3AZEA 1N8PA 3B0DB 3G8MA 2VMWA 3N5MA 2JSSA 3AZMC 1KX3A 2J8PA 5AVCC 4M6BA 1AOIA 3G0TA 1P3MA 1KX4D 4G92B 3AEMA 3PD6B 5EAVA 5FT8A 3AENA 4ZDPA 3RBFA 4A0RA 2Z1ZA 5JRGC 3AV1B 1G7XA 3QGUA 5M4DA 5JAYA 3H0MC 4F5JA 4Z5TC 1EQZD 3BCXA 2YCPA 5CPID 2VGUA 4DGTA 2DR1A 5AVBA 1P3OC 4OBUA 4J8UB 4GRXA 3JWAA 4H9NB 4H9SC 4XUJD 2BYLA 2W7GA 4X23D 3N75A 3AZFA 3USFA 8AATA 2E7UA 1JF9A 2C7TA 3FVXA 4KGCD 2CSTA 1AY4A 5B40B 3AYWA 3LZ1A 5DNMC 5B0YC 3X1SB 4K05A 2BIAA 5GSUB 1ARGA 1T3UA 4ITXA 4KAMA 3B0DC 1ZC9A 3DU4A 3AEJC 1LKCA 3FZ8A 3W99B 4UHMA 4YS3B 4Z66A 4G92C 4K2BA 4M2KA 3AN2A 1TAFA 5B2ID 2JE5A 1CL2A 3AV1C 4GE9A 4F5KA 5G4IA 5B0ZD 1AHGA 2F8NG 4J8VD 2ZUKA 1KL1A 1PMMA 5AY8D 3KXBC 5AV9A 4NE3A 4J8UC 4ZUXD 4ZDLA 3AZID 5AV5D 3MGQB 1P3LA 1AJSB 2ZC0A 1D7UA 4AWLC 3MADA 1AHEA 3B46A 3VH5T 1M18A 5B40C 1S07A 3X1SC 5GSUC 1C7GA 2AROD 4DBCA 3VAXA 2BWPA 2VIAA 2VMXA 1M0OA 1BQDA 2G5HC 4A0GA 3W99C 2HOXA 4EFFA 4YS3C 5B31A 2CINA 5M46A 1I43A 1DGDA 1O69A 4RM1A 2QSRA 4EMYA 1BKGA 1P3KD 1UU1A 3AZKD 2GQNA 4LW2A 5AV6D 3WAAA 3AZLD 1QIRA 2PO3A 4ISYA 5DB5A 1M1AD 3AL0C 3VOMA 4P3MA 3PDBB 4BA5A 2W8TA 3WTPD 4MQRA 4WXBA 7AATA 5EFSA 2WK7A 3A9YA 3MGQC 5BO0B 1FG3A 1BFMA 4W8IA 2YFWB 2XD5A 1OXOA 2HOYA 2YFVA 3MGPB 2CV5A 1JFIB 2ZY5A 3LELB 2VMZA 1J32A 3W96B 3A6NA 2AEUA 2VGVA 3A8UX 4F4EA 3FCRA 3WCOA 5FUGA 1WKHA 3QPGA 4L0OA 4BMKA 3EIAA 4ZAHA 5AX8A 3AZHD 2XD1A 3MC6C 5KTBA 4H9OA 3WTPE 3MKJA 1B67A 3N0LA 1WYVB 1MDOA 1TZYB 3O62A 4Z5TA 4YM6B 3AZGA 3X1UD 1WYUB 5CPJC 5E5AC 4MKKA 5G0AA 4F5LA 4JJNB 2G6WA 4XJOA 5DNNB 3MNND 3E9KA 3DXVA 3TU4B 3C1CB 4KHAA 2F8NB 2CH1A 3AELA 5AVCD 1P3AD 2VMNA 1MLYA 3MGPC 3X1TA 1RVUA 1ZLAB 2G7JA 3LV2A 3AOWA 5JRGD 1G7WA 2HIOD 3EI6A 1Z3ZA 3LELC 5B33B 3W96C 1J04A 1X28A 5EUDA 3MGSD 5AV8B 4WU9B 3WKSA 3PD6A 3UTBD 4MY5A 2CH2A 3OP7A 3LZ0D 5B1MD 2EYQA 1N1JA 4Q31A 4YM6C 5GXQB 3AFAA 2TPLA 3DR7A 1CJ0A 1D7RA 2RVQD 4WYFA 3KXBA 1V2DA 2ZYJA 1AICA 3M5UA 2KFPA 4JJNC 5DNNC 1M19D 4W91A 2BG1A 3TU4C 4NFTA 1B9HA 3ATHA 3C1CC 3W98B 2AY3A 1G4VA 3A1IA 4OYTA 4WYDA 3QI6A 3X1VB 2AEVA 3DC1A 5I92A 3X1SA 3WKJB 5B31G 1O61A 1ZLAC 3N7NA 4DRBA 1KKJA 5B33C 1MDZA 3AZEB 4YS3A 1QITA 2NMPA 1ASBA 2YHKA 5AV8C 4WU9C 5CHLB 1KX3B 4F5IA 2D5YA 1AOIB 1P3MB 3FD0A 4OT8A 3AENB 5GXQC 3KGXA 1LK9A 2X5FA 3TQXA 2PYOA 4KUDA 5B40D 3P5JB 2EO5A 5GSUD 3K40A 3FDBA 5EIGA 1GEXA 1JG8A 3REHB 3WKRA 3W98C 4J8XD 2Z1YA 3AZFB 3NUBA 4WXFA 1WWSA 2Z9WA 2VMPA 4P7YA 4NOGA 2QLRA 3WKJC 1WYTA 2FJ7A 4UHOA 5BNVA 1MAQA 3AYWB 3LZ1B 2FM1A 4ZASA 1CQ7A 3TFTA 2JISA 1KX5A 3LJAD 3UTAA 3ASAA 4LD9A 4XJPA 4EU1A 1KX3C 3ECDA 1YAAA 4BHDA 1LW4A 1AOIC 1WSTA 3MEBA 4Z66B 1X0MA 3AEMC 2VMSA 3MGQD 3AN2B 5CPJA 5M49A 1TAFB 5E5AA 1VP4A 1BJOA 4Z2MH 1SZUA 4UUZA 3REJA 1BJWA 1C7NA 4A6RA 4CXRA 4IYOA 4WZSB 1EG5A 2X5DA 1AJRA 3C1BA 5BO0A 4E1OA 5AV9B 3REHC 5E4ZA 2YFWA 4AZJA 3B6GD 4IY7A 3AZFC 1TOIA 1JFIA 1ASFA 3AV2A 3LELA 3VK3A 1M18B 3AYWC 3G7QA 4XJMA 2BI5A 4QLCA 2AATA 3AOVA 4WYGA 2Y2OA 3NYSA 4DQ6A 1W7LA 2JG2A 3FTBA 3B0BA 2W7HA 4Z66C 4ADEA 4JEVA 2WK8A 3AN2C 2CWEA 2OGEA 3ASBA 1D7SA 4CVQA 2EPJA 3WAAB 2D61A 5GT3A 4R8DA 4LW4A 3TU4A 3UAKA 3W96D 5AV9C 5CP6D 1LC8A 2R5CB 4JEYA 5D95A 3W1HA 2AY5A 1JS3A 2EZ2A 3JZLA 3RELB 2D66A 1ZLAA 4RIZA 3WA9A 1M18C 1TZYD 1DJUA 2YFVB 2Y2LA 2CV5B 2OATA 4E3QA 2RIQA 4WU9A 3A6NB 2CB1A 2VQRA 1P3WA 4ADDA 4OBVA 5FUGB 1QJ5A 2HP1A 3REID 4JEZA 4H9OB 2V1PA 3MVDA 1P3IA 5GXQA 2W8JA 3JWBA 2D64A 2W7MA 3AZNA 3A9XA 3O62B 4KYOA 1UKJA 3AZGB 1H3OB 5B24D 2OKJA 1ID3A 1AIAA 2ZY3A 1BH8B 3W98A 1LS3A 2FKIA 2ZM5A 2EGYA 1P3BA 1FC4A 3LY1A 1X29A 2JJEA 4ZM3A 4KHAB 3RELC 1KX4A 3LVMA 1UU2A 3E2FA 1P3PC 2HUFA 2E7JA 3HMUA 2EZ1A 2CV5C 3X1TB 1AKAA 4UOYA 3A6NC 3KUYC 2BIGA 4U1TA 1EQZA 2G5IC 5CPIA 3TATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZC A;  2CJH A;  1D7V A;  1FG7 A;  2FNI A;  3LVK A;  3EI7 A;  4LW2 A;  2AY7 A;  1QIR A;  1AX4 A;  1TAR A;  2PO3 A;  3BS8 A;  4ISY A;  5DB5 A;  3VOM A;  3NX3 A;  2AY9 A;  3FVS A;  4P3M A;  2VI9 A;  3PDB B;  3LVJ A;  1AHF A;  1B5O A;  2GSA A;  2W7K A;  4AOA A;  4BA5 A;  3L44 A;  1OHW A;  2W8V A;  2W8T A;  3CQ6 A;  5E5I A;  1E5F A;  1M0P A;  2QA3 A;  4R5Z A;  4B98 A;  2CTZ A;  4MQR A;  4W1W A;  4WXB A;  7AAT A;  5EFS A;  2WK7 A;  3A9Y A;  1I29 A;  2W7E A;  4XAU A;  3F0H A;  2QB3 A;  1M0N A;  3F9T A;  2XBN A;  1FG3 A;  1YIY A;  3T32 A;  4JEX A;  4OCA A;  1X2A A;  3B1C A;  3II0 A;  3Q8N A;  4U2H A;  1RV4 A;  4W8I A;  4LC3 A;  1OXO A;  3PIU A;  2R5E A;  2HOY A;  1GDE A;  4CBS A;  3OKS A;  2W7L A;  4EB7 A;  1SVV A;  2VMV A;  1ASM A;  4K2M A;  2VMQ A;  2O0R A;  5HHY A;  2ZY5 A;  2BYJ A;  2VMZ A;  1J32 A;  2VGV A;  1JS6 A;  2D7Y A;  2BKW A;  2VLH A;  3A8U X;  1BS0 A;  3FCR A;  4F4E A;  5HDM A;  4M2M A;  1WKH A;  1O62 A;  3QPG A;  4WBT A;  3B8X A;  4L0O A;  3K7Y A;  3EIA A;  3MAF A;  1M6S A;  5AX8 A;  4BMK A;  4ZAH A;  3GSB A;  3EZS A;  3MC6 C;  3FFH A;  4OTL A;  3R9A A;  3KE3 A;  2WK9 A;  3MKJ A;  4Q75 A;  4W1V A;  3NNK A;  3E2Z A;  1N31 A;  4A72 A;  3FSL A;  1WYV B;  3N0L A;  1O4S A;  2BWN A;  1KKP A;  2VIB A;  1D2F A;  2QMA A;  5K8B A;  1MDO A;  1ZOB A;  1YJZ A;  3EI9 A;  3KKI A;  4LNJ A;  1DGE A;  1W7M A;  4IX8 A;  4WLH A;  4ATP A;  1WYU B;  1GBN A;  1QIS A;  4WD2 A;  3ZRR A;  1ASE A;  4MKK A;  5G0A A;  2C44 A;  3PAA A;  2Z20 A;  5G4J A;  1AIB A;  1AJS A;  4F5L A;  1YJY A;  3BN1 A;  3NU8 A;  4ZSW A;  4HVK A;  1AY5 A;  1W23 A;  4XJO A;  2G6W A;  3COG A;  1YOO A;  3PPL A;  3KGW A;  2QB2 A;  3GBX A;  3E9K A;  1M32 A;  5EUE A;  3DXV A;  4A00 A;  3MBB A;  3PGY A;  2ZY2 A;  3D6K A;  4MKJ A;  4M2J A;  1EJI A;  2CH1 A;  4ZLV A;  5DJ1 A;  2DKB A;  3AEL A;  4K2I A;  2VMN A;  1ARH A;  3BWN C;  4Y0I A;  2BI1 A;  2YOB A;  2C0R A;  5EIG B;  1MLY A;  4W5K A;  1SPA A;  1TOJ A;  2W7F A;  3RQ1 A;  1LC7 A;  3MC6 A;  4F5M A;  1RVU A;  5F8V A;  3L8A A;  3LV2 A;  3MAU A;  1AMQ A;  3WZF A;  5DX5 A;  3AOW A;  5EQC A;  1G7W A;  2E7I A;  2HUU A;  3EI6 A;  1Z3Z A;  2YRI A;  1WKG A;  1J04 A;  2X8U A;  3GJU A;  2HZP A;  1X28 A;  5EUD A;  1IUG A;  2W7D A;  3H7F A;  2OGA A;  2PB0 A;  3CQ5 A;  1W3U A;  2QBT A;  2CAN A;  1WYT B;  2YKX A;  3WKS A;  5F9S A;  3PD6 A;  2W7I A;  2JJH A;  4MY5 A;  3BWO A;  2CH2 A;  4R2N A;  2VGS A;  1CQ8 A;  3JTX A;  3OP7 A;  3PDB A;  1GC3 A;  2V0Y A;  1ASD A;  4Q76 A;  2YCT A;  4JF0 A;  4Q31 A;  1V2F A;  3TFU A;  2ORD A;  2VGT A;  2TPL A;  3BCB A;  1CJ0 A;  1D7R A;  3DR7 A;  3FQ8 A;  4ATQ A;  3ACZ A;  4WYF A;  4N0W A;  1ECX A;  1OXP A;  1V2D A;  2BIE A;  4AH3 A;  3BC8 A;  4ZWM A;  2ZYJ A;  5FT6 A;  1AIC A;  4WYC A;  3M5U A;  1IAY A;  4Q6R A;  2VMO A;  3BWN A;  4UQV A;  5G09 A;  2YKV A;  1B5P A;  1BJO B;  2D65 A;  4GDY A;  4BA4 A;  4F5H A;  4W91 A;  1QJ3 A;  1AKC A;  2HP2 A;  1B9H A;  2ZSL A;  3ATH A;  4J5U A;  2AY3 A;  4O6Z A;  1CQ6 A;  1G4V A;  4TN4 A;  1I48 A;  4IXS A;  4IYO B;  1Y4I A;  4IXO A;  2R5C A;  3QI6 A;  4OYT A;  4IW7 A;  4WYD A;  4B9B A;  1AAW A;  3DXW A;  3GZD C;  3DC1 A;  3UWC A;  4ZM4 A;  1MLZ A;  3DRD A;  5I92 A;  2AY2 A;  2CY8 A;  2Q7W A;  3VK4 A;  1ARS A;  1GEW A;  1M7Y A;  1O61 A;  4A0F A;  4H51 A;  2XH1 A;  1DKA A;  2YKY A;  3LVL B;  2AY1 A;  2ZP7 A;  1KKJ A;  3ZZJ A;  4ADC A;  4OC9 A;  4WXG A;  1B9I A;  4WP0 A;  4UHN A;  1WYV A;  1MDZ A;  2CFB A;  1IX7 A;  2VI8 A;  1GC2 A;  3B1E A;  1AAM A;  3DR4 A;  4KXK A;  1QIT A;  1TOE A;  1ASB A;  1V2E A;  2NMP A;  2YHK A;  4MQP A;  3RI6 A;  1TOG A;  5M4B A;  1WYU A;  1VEF A;  2YRR A;  3PJ0 A;  4JF1 A;  2BHX A;  3P6K A;  4F5I A;  5J8Q A;  2FYF A;  2CJD A;  2VMR A;  4GE4 A;  2D5Y A;  5C6U A;  1GEY A;  1AHX A;  4E3R A;  3I5T A;  4XK1 A;  1MAP A;  3AEP A;  3E2Y A;  4OT8 A;  3PDX A;  1IVR A;  3AEN B;  3ZRQ A;  4I8A A;  3RCH A;  2F8J A;  1V72 A;  2VGZ A;  4R5F A;  3KGX A;  1LK9 A;  2VYC A;  3VK2 A;  2X5F A;  1KMK A;  4Y0D A;  3TQX A;  1G4X A;  3WLX A;  1ARI A;  5BJ3 A;  1OAT A;  1CL1 A;  1U08 A;  3RUY A;  4FFC A;  4PIW A;  1H1C A;  4XEW A;  4CXQ A;  1TOK A;  2EO5 A;  3NUI A;  4LNL A;  4RJY A;  9AAT A;  3K40 A;  4PVF A;  3GZD A;  3FDB A;  1ORD A;  1C7O A;  3EZ1 A;  5EIG A;  1DFO A;  3ELP A;  5EAA A;  1GEX A;  1JG8 A;  4PFF A;  2W7J A;  2BI2 A;  3WKR A;  1SZS A;  2W8U A;  1AMA A;  2BI9 A;  2Z1Y A;  3PA9 A;  3NUB A;  3WY7 A;  3BV0 A;  4WXF A;  1AMS A;  3GR9 A;  3QBO A;  3WGB A;  4OMA A;  2Z9W A;  2VMP A;  4AO4 A;  4P7Y A;  2VGW A;  3TCM A;  4NOG A;  2PB2 A;  2QLR A;  2Z9X A;  1WYT A;  3HL2 A;  5G2Q A;  4UHO A;  4BQ0 A;  1ELU A;  1MAQ A;  1B4X A;  3UE8 A;  2FM1 A;  3QM2 A;  1CQ7 A;  4ZAS A;  4F5G A;  3TFT A;  1ELQ A;  4AO9 A;  2RFV A;  1S06 A;  2ZJG A;  3DOD A;  1C4K A;  3BCA A;  1ASA A;  4Y0H A;  3ASA A;  3AAT A;  4WB0 A;  1LW5 A;  4PFN A;  4XJP A;  3NU7 A;  4EU1 A;  4RKC A;  3ECD A;  4TMR A;  1YAA A;  4BHD A;  1LW4 A;  2YCN A;  2R0T A;  1WST A;  3MEB A;  1X0M A;  3AEM C;  1AHY A;  3E6G A;  4GEB A;  1T3I A;  3A2B A;  2JJF A;  1RV3 A;  2VMS A;  1S08 A;  1DJ9 A;  1I41 A;  5EUN A;  5M49 A;  2AY6 A;  1VP4 A;  1BJO A;  4AZK A;  1KMJ A;  1SZU A;  3NYT A;  2E54 A;  5TF5 A;  1BJW A;  3ZRP A;  1C7N A;  1S0A A;  2BI3 A;  4MSO A;  1IJI A;  5FT5 A;  4A6R A;  4CXR A;  1IX6 A;  3FDD A;  4QGR A;  4IYO A;  1C0N A;  2OQX A;  4MQQ A;  1EG5 A;  2GMU A;  3NDN A;  3DZZ A;  2X5D A;  1XI9 A;  2JJG A;  1AJR A;  4XJL A;  1Z7D A;  5E3K A;  1IAX A;  3HQT A;  2DKJ A;  2VMY A;  1BQA A;  3NRA A;  3RBL A;  3A9Z A;  4HF8 A;  1YIZ A;  1ZOD A;  2FNU A;  4W1X A;  4RAE A;  2BWO A;  1AY8 A;  1S09 A;  4E1O A;  1H0C A;  5E4Z A;  1YNU A;  4AZJ A;  4GE7 A;  2R2N A;  1GC4 A;  1BT4 A;  4IY7 A;  1RVY A;  1YJS A;  2GMS A;  1TOI A;  3F6T A;  1QZ9 A;  1BJ4 A;  3ZZK A;  1GD9 A;  1N8P A;  1N2T A;  3G8M A;  2VMW A;  1ASF A;  3N5M A;  1IX8 A;  1AMR A;  3VK3 A;  1CS1 A;  1SFF A;  3K28 A;  1DJE A;  3EIB A;  4E77 A;  3G7Q A;  4XJM A;  2BI5 A;  2C81 A;  2FN6 A;  2Z61 A;  4A6T A;  3AEM A;  2AAT A;  4CBR A;  2VMU A;  3AOV A;  4WYG A;  3PD6 B;  5EAV A;  5FT8 A;  3NYS A;  3NTJ A;  3GZC A;  3LG0 A;  3AEN A;  4ZDP A;  3RBF A;  4A0R A;  4DQ6 A;  1W7L A;  2JGT A;  2Z1Z A;  2JG2 A;  3FTB A;  2Z9U A;  1GC0 A;  3AEO A;  1G7X A;  3FFR A;  3QGU A;  5D5S A;  2W7H A;  5M4D A;  5JAY A;  5IWQ A;  1UU0 A;  4F5J A;  4ADE A;  4JEV A;  3BCX A;  2WK8 A;  1M4N A;  2VGU A;  2YCP A;  3WGC A;  3B1D A;  4DGT A;  2DR1 A;  2OGE A;  3ASB A;  4EB5 A;  1D7S A;  1ASL A;  4CVQ A;  2EPJ A;  5HXX A;  2D63 A;  4ZSY A;  1SF2 A;  1TAT A;  3GET A;  4GRX A;  4F5F A;  1M0Q A;  1SZK A;  2D61 A;  3JWA A;  4ZWV A;  2CJG A;  2BYL A;  2D7Z A;  2W7G A;  1BJN A;  1ASC A;  1W7N A;  3N75 A;  5DJ9 A;  8AAT A;  4R8D A;  3USF A;  1OHY A;  2WKA A;  4LW4 A;  2E7U A;  4ZDO A;  3UAK A;  3FQA A;  3NYU A;  3HLM A;  3ISL A;  1JF9 A;  2C7T A;  2ZY4 A;  1BW0 A;  1TAS A;  3FVX A;  1ASN A;  3EI5 A;  1AKB A;  2GB3 A;  2CST A;  1LC8 A;  1IBJ A;  1AY4 A;  2R5C B;  4JEY A;  2HUI A;  2EH6 A;  5D95 A;  3CAI A;  2AY5 A;  2VMT A;  3QN6 A;  1JS3 A;  2BIA A;  1ARG A;  2EZ2 A;  2HOR A;  3EI8 A;  5BJ4 A;  2D66 A;  4ITX A;  4KAM A;  1PFF A;  4RKD A;  1ZC9 A;  3R4T A;  3QHX A;  3WX9 A;  3DU4 A;  3AEJ C;  1LKC A;  2AY8 A;  1DJU A;  4UHM A;  1MDX A;  1EQB A;  1GCK A;  1ART A;  2OAT A;  4A6U A;  2AY4 A;  4E3Q A;  4XQ2 A;  4K2B A;  3LWS A;  1TPL A;  1QGN A;  2CB1 A;  4M2K A;  1P3W A;  4ADD A;  1E5E A;  3FVU A;  2O1B A;  1CL2 A;  1QJ5 A;  3FKD A;  4GE9 A;  3CQ4 A;  3MAF B;  4F5K A;  2HP1 A;  4JEZ A;  4WYA A;  5G4I A;  1AHG A;  2V1P A;  3HDO A;  3RCH B;  3CBF A;  2W8J A;  3E2Z B;  3JWB A;  2DOU A;  3I4J A;  4WLJ A;  2D64 A;  2W7M A;  1KL1 A;  2ZUK A;  1DTY A;  3A9X A;  4JEW A;  4ADB A;  3ELE A;  4KYO A;  1UKJ A;  5FT4 A;  1MGV A;  1VJO A;  1B8G A;  4LNM A;  4ZDL A;  3E77 A;  1AIA A;  2ZY3 A;  1KL2 A;  2W8W A;  1AJS B;  2ZC0 A;  3FRK A;  1D7U A;  1LS3 A;  3MAD A;  1AHE A;  3AEJ A;  1OHV A;  3B46 A;  2ZSM A;  2EGY A;  4FL0 A;  4GSA A;  1S07 A;  1FC4 A;  3LY1 A;  5G2P A;  2VLF A;  3IHJ A;  1X29 A;  2O7C A;  2JJE A;  3P1T A;  4ZM3 A;  1C7G A;  4DBC A;  4WYE A;  3DYD A;  1ASG A;  3VAX A;  2BWP A;  1UU2 A;  3LVM A;  3E2F A;  2VIA A;  2VMX A;  1M0O A;  3BB8 A;  4ITG A;  1BQD A;  2E7J A;  2HUF A;  3EUC A;  1LC5 A;  3HMU A;  4A0G A;  2HOZ A;  2YKU A;  2HOX A;  3FQ7 A;  4EFF A;  2EZ1 A;  2CIN A;  5M46 A;  1CZE A;  1I43 A;  1AKA A;  4UOY A;  1DGD A;  1O69 A;  4WB0 B;  3JW9 A;  2BIG A;  4A0H A;  1PG8 A;  4U1T A;  1BKG A;  4EMY A;  3AV7 A;  4IXZ A;  1C9C A;  1UU1 A;  2GQN A;  2FQ6 A;  2Z9V A;  3TAT A; 
#chains in the Genus database with same CATH topology
 1CZC A;  2CJH A;  2FNI A;  1TAR A;  1AX4 A;  1HQ3 D;  3NX3 A;  4XUJ A;  2AY9 A;  4X23 A;  5BT1 C;  1N1J B;  4AOA A;  5CPK D;  3L44 A;  3O62 C;  3B6F D;  1M0P A;  3X1V D;  3AZG C;  4KGC A;  3GWP A;  1I29 A;  3AFA B;  1M0N A;  3WKJ D;  2XBN A;  3N4R A;  3KXB B;  3REK D;  3B1C A;  3REH A;  1RV4 A;  3PIU A;  2R5E A;  3AZE D;  1SVV A;  3VH6 W;  4AWL B;  2O0R A;  3KFU G;  1KU5 A;  2BYM B;  4CSR B;  1JS6 A;  2VLH A;  1P3M D;  4M2M A;  4WBT A;  3X1T C;  3R9A A;  3KE3 A;  2WK9 A;  5B0Z A;  2NQB B;  3E2Z A;  3FZ7 A;  4J8V A;  2BWN A;  2VIB A;  1D2F A;  4WU8 C;  3EI9 A;  5AY8 A;  1DGE A;  4IX8 A;  5AVB D;  4WLH A;  4ATP A;  1QIS A;  3ZRR A;  4ZUX A;  1HTA A;  1XEY A;  3AZI A;  5G4J A;  1YJY A;  3NU8 A;  4HVK A;  3COG A;  3W1J A;  2F2A C;  3KGW A;  3AFA C;  5B1L D;  3GBX A;  3PGY A;  4UPK A;  2PYO B;  4KUD B;  1P3G D;  4M2J A;  3LZ1 D;  5DJ1 A;  2DKB A;  4Y0I A;  2C0R A;  2NZD D;  5EIG B;  2W7F A;  3RQ1 A;  5F8V A;  3MGR C;  1AMQ A;  5DX5 A;  2E7I A;  2HUU A;  5B32 C;  3FZ6 A;  2X8U A;  2HZP A;  3KWQ B;  2DGM A;  3H7F A;  2PB0 A;  1P3K A;  1W3U A;  1WYT B;  5F9S A;  2FJ7 B;  5BNV B;  2W7I A;  4XZQ B;  5AV6 A;  4R2N A;  1M1A A;  1CQ8 A;  2NQB C;  1ULY A;  3NQJ A;  5BS7 A;  1KX5 B;  1GC3 A;  1ASD A;  2YCT A;  4JF0 A;  1V2F A;  3UTA B;  1P34 A;  1U35 D;  4LD9 B;  3WTP A;  4J8W D;  2VGT A;  3FQ8 A;  4N0W A;  1OXP A;  5FT6 A;  5CPJ B;  1P3F C;  1P3L D;  5C3I B;  5E5A B;  1B5P A;  2YKV A;  1BJO B;  4GDY A;  2L5A A;  4UUZ B;  3REJ B;  1Z2C B;  1QJ3 A;  1AKC A;  2ZSL A;  2PYO C;  4KUD C;  1M18 D;  1CQ6 A;  4IYO B;  1Y4I A;  5F99 D;  2R5C A;  4IW7 A;  3C1B B;  2AY2 A;  4H9Q A;  3REL A;  1GEW A;  4A0F A;  4R8P C;  2XH1 A;  4WNN A;  1DKA A;  3ZZJ A;  4ADC A;  1P3P A;  4OC9 A;  2DGK A;  5B31 D;  3KWQ C;  4KXK A;  3AV2 B;  5M4B A;  2FJ7 C;  3KUY A;  4JF1 A;  1VEF A;  4XZQ C;  5J8Q A;  4GE4 A;  4QLC B;  3WAA D;  1KX5 C;  3I5T A;  4XK1 A;  1MAP A;  3PDX A;  3ZRQ A;  3UTA C;  4I8A A;  2F8J A;  2VGZ A;  4LD9 C;  3VH6 T;  1G4X A;  1ARI A;  5BJ3 A;  1U08 A;  4FFC A;  4PIW A;  4CXQ A;  1H3O A;  9AAT A;  4PVF A;  1Q9C A;  3GZD A;  1ORD A;  5C3I C;  1P3A A;  3REJ C;  1BH8 A;  1F66 C;  2BI2 A;  5GT0 D;  1F1E A;  5GT3 B;  2BI9 A;  2WB6 A;  3PA9 A;  2CV5 D;  2HIO A;  3C1B C;  3A6N D;  3MGS A;  3AZM D;  4BQ0 A;  1ELU A;  2F8N K;  1ELQ A;  3VH5 A;  5B1M A;  2RFV A;  1S06 A;  2ZJG A;  3DOD A;  1C4K A;  4Y0H A;  3AAT A;  3AV2 C;  3NU7 A;  3WA9 B;  4Z5T D;  4QLC C;  3AZG D;  4WU8 A;  3E6G A;  1AHY A;  1T3I A;  2JJF A;  1P3O D;  1DJ9 A;  5EUN A;  3N4X A;  1M19 A;  1B6W A;  1S0A A;  3MVD B;  1P3I B;  3R45 A;  1C0N A;  3DZZ A;  3AZN B;  5E3K A;  3HQT A;  2VMY A;  3RBL A;  3A9Z A;  1YIZ A;  4W1X A;  1AY8 A;  5DNM D;  1H0C A;  5B0Y D;  5GT3 C;  1ID3 B;  1YJS A;  1S32 B;  3ZZK A;  1GD9 A;  3MGR A;  2BYM A;  1AMR A;  1CS1 A;  5B32 A;  4CSR A;  1SFF A;  1P3B B;  3K28 A;  2IO5 C;  4RIT A;  1KX4 B;  3GZC A;  3LG0 A;  3AV1 D;  2NQB A;  3WA9 C;  2Z9U A;  1GC0 A;  3AEO A;  3FFR A;  4HGA C;  4CAY A;  1UU0 A;  3EPK A;  1M4N A;  3WGC A;  3B1D A;  3KXB D;  1EQZ B;  4J8U D;  5CPI B;  5HXX A;  3GET A;  1M0Q A;  1SZK A;  4ZWV A;  2D7Z A;  3MVD C;  1P3I C;  1P3F A;  1ASC A;  4J8X A;  4XUJ B;  1OHY A;  4X23 B;  2WKA A;  3AZN C;  3NYU A;  3HLM A;  3ISL A;  3UT9 C;  1ASN A;  3EI5 A;  1AKB A;  2GB3 A;  1IBJ A;  4KGC B;  5B2J C;  3X1S D;  2EH6 A;  1ID3 C;  3CAI A;  3QN6 A;  5BNX A;  1S32 C;  3EI8 A;  5BJ4 A;  4RKD A;  4R8P A;  3LJA A;  3QHX A;  3W99 D;  4YS3 D;  1P3B C;  2AY8 A;  3KWQ A;  1EQB A;  2DQN C;  4XQ2 A;  3LWS A;  1KX4 C;  4XZQ A;  3FVU A;  2O1B A;  5B0Z B;  3E2Z B;  2DOU A;  4WLJ A;  2PYO D;  4J8V B;  4JEW A;  4ADB A;  3EPJ A;  1EQZ C;  2X3L A;  5CPI C;  5AY8 B;  1B8G A;  4LNM A;  3E77 A;  4ZUX B;  4XUJ C;  3B6G A;  2W8W A;  4X23 C;  3AZI B;  3FRK A;  1F66 A;  1OHV A;  4KGC C;  4FL0 A;  2VLF A;  3IHJ A;  3P1T A;  3DYD A;  3EUC A;  4EO5 C;  2YKU A;  3FQ7 A;  4WB0 B;  3JW9 A;  3HVY A;  1PG8 A;  3AV7 A;  4IXZ A;  2FQ6 A;  2Z9V A;  4WJ3 C;  1P3K B;  3LVK A;  5CPJ D;  2AY7 A;  3BS8 A;  5E5A D;  5AV6 B;  5B0Z C;  1M1A B;  3FVS A;  2VI9 A;  3NQJ B;  4J8V C;  2W8V A;  1E5F A;  2QA3 A;  4R5Z A;  1P34 B;  4W1W A;  5AY8 C;  3WTP B;  3F0H A;  5CP6 A;  4ZUX C;  3F9T A;  5JA4 A;  4JEX A;  3W97 A;  5AV5 C;  3AZI C;  1X2A A;  4OCA A;  4U2H A;  2Y2K A;  4LC3 A;  1GDE A;  4CBS A;  5B32 G;  3MGP D;  3OKS A;  4EB7 A;  2VMQ A;  3LEL D;  5KDM A;  2D7Y A;  2BKW A;  1BS0 A;  1O62 A;  3B8X A;  3MAF A;  4H9Q B;  3GSB A;  3EZS A;  3FFH A;  4OTL A;  3AZH B;  4WNN B;  4Q75 A;  1P3P B;  3FSL A;  5K8B A;  4YM6 D;  1ZOB A;  2W8S A;  1P3K C;  3KKI A;  3AZK C;  1W7M A;  3AZJ A;  3KUY B;  1GBN A;  4WD2 A;  5AV6 C;  5B24 A;  1ASE A;  1M1A C;  3PAA A;  5BS7 C;  2Z20 A;  3H9X A;  3BN1 A;  4ZSW A;  4JJN D;  5DNN D;  1P34 C;  3TU4 D;  3WTP C;  3C1C D;  4A00 A;  1M32 A;  5EUE A;  2F8N D;  2ZY2 A;  3I16 A;  3UT9 A;  1EJI A;  4K2I A;  5B2J A;  2OKK A;  1P3A B;  4W5K A;  1ZLA D;  1S32 A;  1SPA A;  1LC7 A;  3L8A A;  5B33 D;  5EQC A;  5G49 A;  2HIO B;  1IUG A;  5AV8 D;  4WU9 D;  2OGA A;  3CQ5 A;  3MGS B;  2YKX A;  2Y2H A;  3AZH C;  2JJH A;  1HQ3 A;  3UTB B;  2VGS A;  3LZ0 B;  5B1M B;  1WWI A;  1P3I D;  5GXQ D;  3B6F A;  4ATQ A;  3X1U C;  4WU8 B;  2BIE A;  4AH3 A;  3BC8 A;  3REK A;  1IAY A;  3BWN A;  5G09 A;  4BA4 A;  3W98 D;  1M19 B;  2HP2 A;  4J5U A;  3V9R A;  3MNN C;  4O6Z A;  1P3B D;  4TN4 A;  3R45 B;  4B9B A;  1AAW A;  3GZD C;  1P3A C;  3DRD A;  1ARS A;  1M7Y A;  4H51 A;  2YKY A;  4WXG A;  1B9I A;  2HIO C;  4UHN A;  2CFB A;  1IX7 A;  3DR4 A;  3MGR B;  3MGS C;  1KX3 D;  2F8N H;  1TOE A;  1V2E A;  3RI6 A;  5B32 B;  2YRR A;  2BHX A;  1AOI D;  2CJD A;  3UTB C;  5C6U A;  3EPL A;  4E3R A;  5B2I A;  3LZ0 C;  5B1M C;  3W1I A;  3E2Y A;  1V72 A;  3VK2 A;  4CAY B;  5B1L A;  3WLX A;  1OAT A;  2FFF B;  1CL1 A;  3RUY A;  2RVQ C;  1P3G A;  3NUI A;  4LNL A;  3EZ1 A;  4H9R A;  3REH D;  3ELP A;  5AV5 A;  2NZD A;  1M19 C;  1AMA A;  3AZF D;  1P3F B;  4J8X B;  2Y2N A;  3BV0 A;  1AMS A;  3GR9 A;  3QBO A;  2VGW A;  2HUE B;  2PB2 A;  3AYW D;  1BH9 B;  2ARO A;  4G91 B;  1B4X A;  3UE8 A;  5BNX B;  3QM2 A;  3BCA A;  2DGL A;  2BYK A;  4R8P B;  3LJA B;  4WB0 A;  1LW5 A;  4PFN A;  4DQY B;  4RKC A;  1U35 A;  2Y2Q A;  4TMR A;  4Z66 D;  4J8W A;  2YCN A;  4GEB A;  3AN2 D;  2Y2I A;  3AZK A;  1RV3 A;  3AZL A;  2AY6 A;  4H9P A;  5TF5 A;  2E54 A;  3ZRP A;  2BI3 A;  4MSO A;  1IJI A;  5FT5 A;  4NE5 A;  2OQX A;  4MQQ A;  2GMU A;  3NDN A;  1XI9 A;  5F99 A;  5AV9 D;  2DKJ A;  1BQA A;  3NRA A;  1ZOD A;  2BWO A;  1S09 A;  1YNU A;  2R2N A;  4J8X C;  4J8L A;  2GMS A;  3B6G B;  3F6T A;  1BJ4 A;  1F66 B;  1N2T A;  2HUE C;  1IX8 A;  1PZR A;  4G91 C;  1DJE A;  3EIB A;  4E77 A;  2Y2G A;  2C81 A;  2FN6 A;  2Z61 A;  4A6T A;  2JCH A;  4CBR A;  2VMU A;  4E45 A;  3NTJ A;  3AZH A;  3LJA C;  2JGT A;  5D5S A;  1P34 D;  5IWQ A;  1R4V A;  4EB5 A;  3X1U A;  1ASL A;  2D63 A;  4ZSY A;  1SF2 A;  1TAT A;  4F5F A;  2Y2P A;  2CJG A;  2DF4 C;  1BJN A;  1W7N A;  5GT0 A;  5DJ9 A;  4ZDO A;  3FQA A;  3MNN A;  2ZY4 A;  1BW0 A;  1TAS A;  4RJ0 A;  3AZM A;  2HUI A;  5CP6 B;  3NQU A;  2VMT A;  5AVC A;  3REL D;  5JA4 B;  3B6G C;  2HOR A;  3W97 B;  1P3P D;  1PFF A;  3R4T A;  3WX9 A;  5JRG A;  1MDX A;  1GCK A;  1ART A;  4A6U A;  2AY4 A;  3KUY D;  5KDM B;  1TPL A;  1QGN A;  2IO5 B;  1E5E A;  3UTB A;  1P3O A;  4E44 A;  3FKD A;  3CQ4 A;  3MAF B;  3LZ0 A;  4WYA A;  4H9S A;  3HDO A;  3RCH B;  3CBF A;  3REI B;  5BT1 D;  3I4J A;  3N4S A;  1DTY A;  3O62 D;  4HGA B;  3ELE A;  5FT4 A;  1MGV A;  3AZJ B;  1VJO A;  3EG5 B;  5DNM A;  5B24 B;  5B0Y A;  1KL2 A;  1A7W A;  3AEJ A;  2ZSM A;  4GSA A;  5G2P A;  5CP6 C;  2O7C A;  3W97 C;  3UT9 B;  4WYE A;  1ASG A;  5B2J B;  4ITG A;  3BB8 A;  3AV1 A;  3X1T D;  1LC5 A;  2HOZ A;  1TZY C;  1CZE A;  2UWX A;  5G49 B;  4A0H A;  4WU8 D;  1C9C A;  1D7V A;  1FG7 A;  4J8U A;  3EI7 A;  4H9N A;  3REI C;  1HQ3 B;  3A1K A;  1AHF A;  1B5O A;  3LVJ A;  2GSA A;  2W7K A;  1OHW A;  3CQ6 A;  5E5I A;  5CPK B;  4B98 A;  3AFA D;  2CTZ A;  3AZJ C;  3B6F B;  5B40 A;  4XAU A;  2W7E A;  2QB3 A;  5B24 C;  5GSU A;  1YIY A;  3T32 A;  3Q8N A;  3II0 A;  3REK B;  3VH6 A;  2W7L A;  3W99 A;  3MGR D;  2VMV A;  1ASM A;  4K2M A;  3V9R B;  5B32 D;  5HHY A;  2BYJ A;  1BH9 A;  5HDM A;  3K7Y A;  1M6S A;  2NQB D;  4W1V A;  3NNK A;  1N31 A;  4A72 A;  4EO5 B;  1O4S A;  1KKP A;  2QMA A;  1YJZ A;  4LNJ A;  4DRA A;  1HQ3 C;  5AVB B;  3MGQ A;  2C44 A;  1AIB A;  1AJS A;  5B2I B;  1P3F D;  1AY5 A;  5CPK C;  3HBX A;  1W23 A;  3B0C W;  1YOO A;  3B6F C;  3PPL A;  3X1V C;  4KUD D;  2QB2 A;  3MBB A;  3D6K A;  3H0L C;  5B1L B;  4MKJ A;  4ZLV A;  1P3G B;  3REK C;  1ARH A;  3BWN C;  2BI1 A;  2YOB A;  4H9R B;  3WCN A;  3AZE C;  4R8P D;  1TOJ A;  5AV5 B;  2NZD B;  3MC6 A;  4F5M A;  3MAU A;  3WZF A;  3KWQ D;  2YRI A;  1WKG A;  3GJU A;  2W7D A;  1P3M C;  2FJ7 D;  2QBT A;  4ZBJ B;  2CAN A;  4XZQ D;  1PMO A;  2ARO B;  3BWO A;  1KX5 D;  3JTX A;  3PDB A;  2V0Y A;  3UTA D;  4Q76 A;  4LD9 D;  2BYK B;  3VP6 A;  3TFU A;  2ORD A;  1U35 B;  3BCB A;  5AVB C;  4J8W B;  2A1V A;  3ACZ A;  1ECX A;  5B2I C;  3AZK B;  4ZWM A;  3EPH A;  4WYC A;  4UQV A;  4Q6R A;  4NE6 A;  2VMO A;  3REJ D;  3AZL B;  1F66 D;  2D65 A;  4F5H A;  4H9P B;  1P3L B;  3MGP A;  5B1L C;  1I48 A;  4IXS A;  3W96 A;  1P3G C;  3C1B D;  4IXO A;  3LZ1 C;  3DXW A;  5F99 B;  3UWC A;  4ZM4 A;  1MLZ A;  2CY8 A;  4Z2M G;  2Q7W A;  3VK4 A;  2NZD C;  2Y2M A;  4WV4 B;  3LVL B;  2AY1 A;  2ZP7 A;  4WP0 A;  1WYV A;  5B31 B;  2VI8 A;  1TZY A;  3AV2 D;  1AAM A;  1GC2 A;  3B1E A;  4YM6 A;  4ZBJ C;  4MQP A;  1TOG A;  1WYU A;  3PJ0 A;  4QLC D;  2ARO C;  3P6K A;  2FYF A;  2VMR A;  3KSY A;  1GEY A;  1AHX A;  3AEP A;  1IVR A;  3RCH A;  4JJN A;  3REI A;  4R5F A;  5DNN A;  1U35 C;  2VYC A;  1KMK A;  4Y0D A;  4J8W C;  3C1C A;  2F8N A;  4XEW A;  1H1C A;  1TOK A;  4RJY A;  3W97 D;  3AZL C;  1C7O A;  3X1U B;  1DFO A;  5EAA A;  1P3L C;  4PFF A;  2W7J A;  5GT3 D;  1SZS A;  2LY8 A;  2W8U A;  5B33 A;  5GT0 B;  3WY7 A;  1W2E A;  3WGB A;  5F99 C;  4OMA A;  4AO4 A;  3MNN B;  3TCM A;  2Z9X A;  3HL2 A;  5AV8 A;  5G2Q A;  3AZM B;  3IP4 C;  3NQU B;  5AVC B;  4F5G A;  4AO9 A;  5B31 C;  1ASA A;  3WA9 D;  3VH5 W;  2Y2J A;  5JRG B;  3B0C T;  3AZJ D;  2R0T A;  4Z5T B;  3A2B A;  3WAA C;  1S08 A;  1I41 A;  1P3O B;  4AZK A;  1KMJ A;  3HT4 A;  3NYT A;  3MVD D;  5CPK A;  1IX6 A;  3FDD A;  4H63 Q;  4QGR A;  3AZN D;  3X1V A;  2JJG A;  4XJL A;  3UT9 D;  1Z7D A;  1IAX A;  4HF8 A;  5B2J D;  2FNU A;  3WKJ A;  4RAE A;  4RLG A;  1ID3 D;  3H0R C;  4GE7 A;  1S32 D;  1GC4 A;  5DNM B;  1BT4 A;  1RVY A;  5GT0 C;  5B0Y B;  1QZ9 A;  3AZE A;  1N8P A;  3B0D B;  3G8M A;  2VMW A;  3N5M A;  2JSS A;  3AZM C;  1KX3 A;  2J8P A;  5AVC C;  4M6B A;  1AOI A;  3G0T A;  1P3M A;  1KX4 D;  4G92 B;  3AEM A;  3PD6 B;  5EAV A;  5FT8 A;  3AEN A;  4ZDP A;  3RBF A;  4A0R A;  2Z1Z A;  5JRG C;  3AV1 B;  1G7X A;  3QGU A;  5M4D A;  5JAY A;  3H0M C;  4F5J A;  4Z5T C;  1EQZ D;  3BCX A;  2YCP A;  5CPI D;  2VGU A;  4DGT A;  2DR1 A;  5AVB A;  1P3O C;  4OBU A;  4J8U B;  4GRX A;  3JWA A;  4H9N B;  4H9S C;  4XUJ D;  2BYL A;  2W7G A;  4X23 D;  3N75 A;  3AZF A;  3USF A;  8AAT A;  2E7U A;  1JF9 A;  2C7T A;  3FVX A;  4KGC D;  2CST A;  1AY4 A;  5B40 B;  3AYW A;  3LZ1 A;  5DNM C;  5B0Y C;  3X1S B;  4K05 A;  2BIA A;  5GSU B;  1ARG A;  1T3U A;  4ITX A;  4KAM A;  3B0D C;  1ZC9 A;  3DU4 A;  3AEJ C;  1LKC A;  3FZ8 A;  3W99 B;  4UHM A;  4YS3 B;  4Z66 A;  4G92 C;  4K2B A;  4M2K A;  3AN2 A;  1TAF A;  5B2I D;  2JE5 A;  1CL2 A;  3AV1 C;  4GE9 A;  4F5K A;  5G4I A;  5B0Z D;  1AHG A;  2F8N G;  4J8V D;  2ZUK A;  1KL1 A;  1PMM A;  5AY8 D;  3KXB C;  5AV9 A;  4NE3 A;  4J8U C;  4ZUX D;  4ZDL A;  3AZI D;  5AV5 D;  3MGQ B;  1P3L A;  1AJS B;  2ZC0 A;  1D7U A;  4AWL C;  3MAD A;  1AHE A;  3B46 A;  3VH5 T;  1M18 A;  5B40 C;  1S07 A;  3X1S C;  5GSU C;  1C7G A;  2ARO D;  4DBC A;  3VAX A;  2BWP A;  2VIA A;  2VMX A;  1M0O A;  1BQD A;  2G5H C;  4A0G A;  3W99 C;  2HOX A;  4EFF A;  4YS3 C;  5B31 A;  2CIN A;  5M46 A;  1I43 A;  1DGD A;  1O69 A;  4RM1 A;  2QSR A;  4EMY A;  1BKG A;  1P3K D;  1UU1 A;  3AZK D;  2GQN A;  4LW2 A;  5AV6 D;  3WAA A;  3AZL D;  1QIR A;  2PO3 A;  4ISY A;  5DB5 A;  1M1A D;  3AL0 C;  3VOM A;  4P3M A;  3PDB B;  4BA5 A;  2W8T A;  3WTP D;  4MQR A;  4WXB A;  7AAT A;  5EFS A;  2WK7 A;  3A9Y A;  3MGQ C;  5BO0 B;  1FG3 A;  1BFM A;  4W8I A;  2YFW B;  2XD5 A;  1OXO A;  2HOY A;  2YFV A;  3MGP B;  2CV5 A;  1JFI B;  2ZY5 A;  3LEL B;  2VMZ A;  1J32 A;  3W96 B;  3A6N A;  2AEU A;  2VGV A;  3A8U X;  4F4E A;  3FCR A;  3WCO A;  5FUG A;  1WKH A;  3QPG A;  4L0O A;  4BMK A;  3EIA A;  4ZAH A;  5AX8 A;  3AZH D;  2XD1 A;  3MC6 C;  5KTB A;  4H9O A;  3WTP E;  3MKJ A;  1B67 A;  3N0L A;  1WYV B;  1MDO A;  1TZY B;  3O62 A;  4Z5T A;  4YM6 B;  3AZG A;  3X1U D;  1WYU B;  5CPJ C;  5E5A C;  4MKK A;  5G0A A;  4F5L A;  4JJN B;  2G6W A;  4XJO A;  5DNN B;  3MNN D;  3E9K A;  3DXV A;  3TU4 B;  3C1C B;  1KAF A;  4KHA A;  2F8N B;  2CH1 A;  3AEL A;  5AVC D;  1P3A D;  2VMN A;  1MLY A;  3MGP C;  3X1T A;  1RVU A;  1ZLA B;  2G7J A;  3LV2 A;  3AOW A;  5JRG D;  1G7W A;  2HIO D;  3EI6 A;  1Z3Z A;  3LEL C;  5B33 B;  3W96 C;  1J04 A;  1X28 A;  5EUD A;  3MGS D;  5AV8 B;  4WU9 B;  3WKS A;  3PD6 A;  3UTB D;  4MY5 A;  2CH2 A;  3OP7 A;  3LZ0 D;  5B1M D;  2EYQ A;  1N1J A;  4Q31 A;  4YM6 C;  5GXQ B;  3AFA A;  2TPL A;  3DR7 A;  1CJ0 A;  1D7R A;  2RVQ D;  4WYF A;  3KXB A;  1V2D A;  2ZYJ A;  1AIC A;  3M5U A;  2KFP A;  4JJN C;  5DNN C;  1M19 D;  4W91 A;  2BG1 A;  3TU4 C;  4NFT A;  1B9H A;  3ATH A;  3C1C C;  3W98 B;  2AY3 A;  1G4V A;  3A1I A;  4OYT A;  4WYD A;  3QI6 A;  3X1V B;  2AEV A;  3DC1 A;  5I92 A;  3X1S A;  3WKJ B;  5B31 G;  1O61 A;  1ZLA C;  3N7N A;  4DRB A;  1KKJ A;  5B33 C;  1MDZ A;  3AZE B;  4YS3 A;  1QIT A;  2NMP A;  1ASB A;  2YHK A;  5AV8 C;  4WU9 C;  5CHL B;  1KX3 B;  4F5I A;  2D5Y A;  1AOI B;  1P3M B;  3FD0 A;  4OT8 A;  3AEN B;  5GXQ C;  3KGX A;  1LK9 A;  2X5F A;  3TQX A;  2PYO A;  4KUD A;  5B40 D;  3P5J B;  2EO5 A;  5GSU D;  3K40 A;  3FDB A;  5EIG A;  1GEX A;  1JG8 A;  3REH B;  3WKR A;  3W98 C;  4J8X D;  2Z1Y A;  3AZF B;  3NUB A;  4WXF A;  1WWS A;  2Z9W A;  2VMP A;  4P7Y A;  4NOG A;  2QLR A;  3WKJ C;  1WYT A;  2FJ7 A;  4UHO A;  5BNV A;  1MAQ A;  3AYW B;  3LZ1 B;  2FM1 A;  4ZAS A;  1CQ7 A;  3TFT A;  2JIS A;  1KX5 A;  3LJA D;  3UTA A;  3ASA A;  4LD9 A;  4XJP A;  4EU1 A;  1KX3 C;  3ECD A;  1YAA A;  4BHD A;  1LW4 A;  1AOI C;  1WST A;  3MEB A;  4Z66 B;  1X0M A;  3AEM C;  2VMS A;  3MGQ D;  3AN2 B;  5CPJ A;  5M49 A;  1TAF B;  5E5A A;  1VP4 A;  1BJO A;  4Z2M H;  1SZU A;  4UUZ A;  3REJ A;  1BJW A;  1C7N A;  4A6R A;  4CXR A;  4IYO A;  4WZS B;  1EG5 A;  2X5D A;  1AJR A;  3C1B A;  5BO0 A;  4E1O A;  5AV9 B;  3REH C;  5E4Z A;  2YFW A;  4AZJ A;  3B6G D;  4IY7 A;  3AZF C;  1TOI A;  1JFI A;  1ASF A;  3AV2 A;  3LEL A;  3VK3 A;  1M18 B;  3AYW C;  3G7Q A;  4XJM A;  2BI5 A;  4QLC A;  2AAT A;  3AOV A;  4WYG A;  2Y2O A;  3NYS A;  4DQ6 A;  1W7L A;  2JG2 A;  3FTB A;  3B0B A;  2W7H A;  4Z66 C;  4ADE A;  4JEV A;  2WK8 A;  3AN2 C;  2CWE A;  2OGE A;  3ASB A;  1D7S A;  4CVQ A;  2EPJ A;  3WAA B;  2D61 A;  5GT3 A;  4R8D A;  4LW4 A;  3TU4 A;  3UAK A;  3W96 D;  5AV9 C;  5CP6 D;  1LC8 A;  2R5C B;  4JEY A;  5D95 A;  3W1H A;  2AY5 A;  1JS3 A;  2EZ2 A;  3JZL A;  3REL B;  2D66 A;  1ZLA A;  4RIZ A;  3WA9 A;  1M18 C;  1TZY D;  1DJU A;  2YFV B;  2Y2L A;  2CV5 B;  2OAT A;  4E3Q A;  2RIQ A;  4WU9 A;  3A6N B;  2CB1 A;  2VQR A;  1P3W A;  4ADD A;  4OBV A;  5FUG B;  1QJ5 A;  2HP1 A;  3REI D;  4JEZ A;  4H9O B;  2V1P A;  3MVD A;  1P3I A;  5GXQ A;  2W8J A;  3JWB A;  2D64 A;  2W7M A;  3AZN A;  3A9X A;  3O62 B;  4KYO A;  1UKJ A;  3AZG B;  1H3O B;  5B24 D;  2OKJ A;  1ID3 A;  1AIA A;  2ZY3 A;  1BH8 B;  3W98 A;  1LS3 A;  2FKI A;  2ZM5 A;  2EGY A;  1P3B A;  1FC4 A;  3LY1 A;  1X29 A;  2JJE A;  4ZM3 A;  4KHA B;  3REL C;  1KX4 A;  3LVM A;  1UU2 A;  3E2F A;  1P3P C;  2HUF A;  2E7J A;  3HMU A;  2EZ1 A;  2CV5 C;  3X1T B;  1AKA A;  4UOY A;  3A6N C;  3KUY C;  2BIG A;  4U1T A;  1EQZ A;  2G5I C;  5CPI A;  3TAT A; 
#chains in the Genus database with same CATH homology
 1CZC A;  2CJH A;  2FNI A;  1TAR A;  1AX4 A;  1HQ3 D;  3NX3 A;  4XUJ A;  2AY9 A;  4X23 A;  5BT1 C;  1N1J B;  4AOA A;  5CPK D;  3L44 A;  3O62 C;  3B6F D;  1M0P A;  3X1V D;  3AZG C;  4KGC A;  3GWP A;  1I29 A;  3AFA B;  1M0N A;  3WKJ D;  2XBN A;  3N4R A;  3KXB B;  3REK D;  3B1C A;  3REH A;  1RV4 A;  3PIU A;  2R5E A;  3AZE D;  1SVV A;  3VH6 W;  4AWL B;  2O0R A;  3KFU G;  1KU5 A;  2BYM B;  4CSR B;  1JS6 A;  2VLH A;  1P3M D;  4M2M A;  4WBT A;  3X1T C;  3R9A A;  3KE3 A;  2WK9 A;  5B0Z A;  2NQB B;  3E2Z A;  3FZ7 A;  4J8V A;  2BWN A;  2VIB A;  1D2F A;  4WU8 C;  3EI9 A;  5AY8 A;  1DGE A;  4IX8 A;  5AVB D;  4WLH A;  4ATP A;  1QIS A;  3ZRR A;  4ZUX A;  1HTA A;  1XEY A;  3AZI A;  5G4J A;  1YJY A;  3NU8 A;  4HVK A;  3COG A;  3W1J A;  2F2A C;  3KGW A;  3AFA C;  5B1L D;  3GBX A;  3PGY A;  4UPK A;  2PYO B;  4KUD B;  1P3G D;  4M2J A;  3LZ1 D;  5DJ1 A;  2DKB A;  4Y0I A;  2C0R A;  2NZD D;  5EIG B;  2W7F A;  3RQ1 A;  5F8V A;  3MGR C;  1AMQ A;  5DX5 A;  2E7I A;  2HUU A;  5B32 C;  3FZ6 A;  2X8U A;  2HZP A;  3KWQ B;  2DGM A;  3H7F A;  2PB0 A;  1P3K A;  1W3U A;  1WYT B;  5F9S A;  2FJ7 B;  5BNV B;  2W7I A;  4XZQ B;  5AV6 A;  4R2N A;  1M1A A;  1CQ8 A;  2NQB C;  1ULY A;  3NQJ A;  5BS7 A;  1KX5 B;  1GC3 A;  1ASD A;  2YCT A;  4JF0 A;  1V2F A;  3UTA B;  1P34 A;  1U35 D;  4LD9 B;  3WTP A;  4J8W D;  2VGT A;  3FQ8 A;  4N0W A;  1OXP A;  5FT6 A;  5CPJ B;  1P3F C;  1P3L D;  5C3I B;  5E5A B;  1B5P A;  2YKV A;  1BJO B;  4GDY A;  2L5A A;  4UUZ B;  3REJ B;  1Z2C B;  1QJ3 A;  1AKC A;  2ZSL A;  2PYO C;  4KUD C;  1M18 D;  1CQ6 A;  4IYO B;  1Y4I A;  5F99 D;  2R5C A;  4IW7 A;  3C1B B;  2AY2 A;  4H9Q A;  3REL A;  1GEW A;  4A0F A;  4R8P C;  2XH1 A;  4WNN A;  1DKA A;  3ZZJ A;  4ADC A;  1P3P A;  4OC9 A;  2DGK A;  5B31 D;  3KWQ C;  4KXK A;  3AV2 B;  5M4B A;  2FJ7 C;  3KUY A;  4JF1 A;  1VEF A;  4XZQ C;  5J8Q A;  4GE4 A;  4QLC B;  3WAA D;  1KX5 C;  3I5T A;  4XK1 A;  1MAP A;  3PDX A;  3ZRQ A;  3UTA C;  4I8A A;  2F8J A;  2VGZ A;  4LD9 C;  3VH6 T;  1G4X A;  1ARI A;  5BJ3 A;  1U08 A;  4FFC A;  4PIW A;  4CXQ A;  1H3O A;  9AAT A;  4PVF A;  1Q9C A;  3GZD A;  1ORD A;  5C3I C;  1P3A A;  3REJ C;  1BH8 A;  1F66 C;  2BI2 A;  5GT0 D;  1F1E A;  5GT3 B;  2BI9 A;  2WB6 A;  3PA9 A;  2CV5 D;  2HIO A;  3C1B C;  3A6N D;  3MGS A;  3AZM D;  4BQ0 A;  1ELU A;  2F8N K;  1ELQ A;  3VH5 A;  5B1M A;  2RFV A;  1S06 A;  2ZJG A;  3DOD A;  1C4K A;  4Y0H A;  3AAT A;  3AV2 C;  3NU7 A;  3WA9 B;  4Z5T D;  4QLC C;  3AZG D;  4WU8 A;  3E6G A;  1AHY A;  1T3I A;  2JJF A;  1P3O D;  1DJ9 A;  5EUN A;  3N4X A;  1M19 A;  1B6W A;  1S0A A;  3MVD B;  1P3I B;  3R45 A;  1C0N A;  3DZZ A;  3AZN B;  5E3K A;  3HQT A;  2VMY A;  3RBL A;  3A9Z A;  1YIZ A;  4W1X A;  1AY8 A;  5DNM D;  1H0C A;  5B0Y D;  5GT3 C;  1ID3 B;  1YJS A;  1S32 B;  3ZZK A;  1GD9 A;  3MGR A;  2BYM A;  1AMR A;  1CS1 A;  5B32 A;  4CSR A;  1SFF A;  1P3B B;  3K28 A;  2IO5 C;  4RIT A;  1KX4 B;  3GZC A;  3LG0 A;  3AV1 D;  2NQB A;  3WA9 C;  2Z9U A;  1GC0 A;  3AEO A;  3FFR A;  4HGA C;  4CAY A;  1UU0 A;  3EPK A;  1M4N A;  3WGC A;  3B1D A;  3KXB D;  1EQZ B;  4J8U D;  5CPI B;  5HXX A;  3GET A;  1M0Q A;  1SZK A;  4ZWV A;  2D7Z A;  3MVD C;  1P3I C;  1P3F A;  1ASC A;  4J8X A;  4XUJ B;  1OHY A;  4X23 B;  2WKA A;  3AZN C;  3NYU A;  3HLM A;  3ISL A;  3UT9 C;  1ASN A;  3EI5 A;  1AKB A;  2GB3 A;  1IBJ A;  4KGC B;  5B2J C;  3X1S D;  2EH6 A;  1ID3 C;  3CAI A;  3QN6 A;  5BNX A;  1S32 C;  3EI8 A;  5BJ4 A;  4RKD A;  4R8P A;  3LJA A;  3QHX A;  3W99 D;  4YS3 D;  1P3B C;  2AY8 A;  3KWQ A;  1EQB A;  2DQN C;  4XQ2 A;  3LWS A;  1KX4 C;  4XZQ A;  3FVU A;  2O1B A;  5B0Z B;  3E2Z B;  2DOU A;  4WLJ A;  2PYO D;  4J8V B;  4JEW A;  4ADB A;  3EPJ A;  1EQZ C;  2X3L A;  5CPI C;  5AY8 B;  1B8G A;  4LNM A;  3E77 A;  4ZUX B;  4XUJ C;  3B6G A;  2W8W A;  4X23 C;  3AZI B;  3FRK A;  1F66 A;  1OHV A;  4KGC C;  4FL0 A;  2VLF A;  3IHJ A;  3P1T A;  3DYD A;  3EUC A;  4EO5 C;  2YKU A;  3FQ7 A;  4WB0 B;  3JW9 A;  3HVY A;  1PG8 A;  3AV7 A;  4IXZ A;  2FQ6 A;  2Z9V A;  4WJ3 C;  1P3K B;  3LVK A;  5CPJ D;  2AY7 A;  3BS8 A;  5E5A D;  5AV6 B;  5B0Z C;  1M1A B;  3FVS A;  2VI9 A;  3NQJ B;  4J8V C;  2W8V A;  1E5F A;  2QA3 A;  4R5Z A;  1P34 B;  4W1W A;  5AY8 C;  3WTP B;  3F0H A;  5CP6 A;  4ZUX C;  3F9T A;  5JA4 A;  4JEX A;  3W97 A;  5AV5 C;  3AZI C;  1X2A A;  4OCA A;  4U2H A;  2Y2K A;  4LC3 A;  1GDE A;  4CBS A;  5B32 G;  3MGP D;  3OKS A;  4EB7 A;  2VMQ A;  3LEL D;  5KDM A;  2D7Y A;  2BKW A;  1BS0 A;  1O62 A;  3B8X A;  3MAF A;  4H9Q B;  3GSB A;  3EZS A;  3FFH A;  4OTL A;  3AZH B;  4WNN B;  4Q75 A;  1P3P B;  3FSL A;  5K8B A;  4YM6 D;  1ZOB A;  2W8S A;  1P3K C;  3KKI A;  3AZK C;  1W7M A;  3AZJ A;  3KUY B;  1GBN A;  4WD2 A;  5AV6 C;  5B24 A;  1ASE A;  1M1A C;  3PAA A;  5BS7 C;  2Z20 A;  3H9X A;  3BN1 A;  4ZSW A;  4JJN D;  5DNN D;  1P34 C;  3TU4 D;  3WTP C;  3C1C D;  4A00 A;  1M32 A;  5EUE A;  2F8N D;  2ZY2 A;  3I16 A;  3UT9 A;  1EJI A;  4K2I A;  5B2J A;  2OKK A;  1P3A B;  4W5K A;  1ZLA D;  1S32 A;  1SPA A;  1LC7 A;  3L8A A;  5B33 D;  5EQC A;  5G49 A;  2HIO B;  1IUG A;  5AV8 D;  4WU9 D;  2OGA A;  3CQ5 A;  3MGS B;  2YKX A;  2Y2H A;  3AZH C;  2JJH A;  1HQ3 A;  3UTB B;  2VGS A;  3LZ0 B;  5B1M B;  1WWI A;  1P3I D;  5GXQ D;  3B6F A;  4ATQ A;  3X1U C;  4WU8 B;  2BIE A;  4AH3 A;  3BC8 A;  3REK A;  1IAY A;  3BWN A;  5G09 A;  4BA4 A;  3W98 D;  1M19 B;  2HP2 A;  4J5U A;  3V9R A;  3MNN C;  4O6Z A;  1P3B D;  4TN4 A;  3R45 B;  4B9B A;  1AAW A;  3GZD C;  1P3A C;  3DRD A;  1ARS A;  1M7Y A;  4H51 A;  2YKY A;  4WXG A;  1B9I A;  2HIO C;  4UHN A;  2CFB A;  1IX7 A;  3DR4 A;  3MGR B;  3MGS C;  1KX3 D;  2F8N H;  1TOE A;  1V2E A;  3RI6 A;  5B32 B;  2YRR A;  2BHX A;  1AOI D;  2CJD A;  3UTB C;  5C6U A;  3EPL A;  4E3R A;  5B2I A;  3LZ0 C;  5B1M C;  3W1I A;  3E2Y A;  1V72 A;  3VK2 A;  4CAY B;  5B1L A;  3WLX A;  1OAT A;  2FFF B;  1CL1 A;  3RUY A;  2RVQ C;  1P3G A;  3NUI A;  4LNL A;  3EZ1 A;  4H9R A;  3REH D;  3ELP A;  5AV5 A;  2NZD A;  1M19 C;  1AMA A;  3AZF D;  1P3F B;  4J8X B;  2Y2N A;  3BV0 A;  1AMS A;  3GR9 A;  3QBO A;  2VGW A;  2HUE B;  2PB2 A;  3AYW D;  1BH9 B;  2ARO A;  4G91 B;  1B4X A;  3UE8 A;  5BNX B;  3QM2 A;  3BCA A;  2DGL A;  2BYK A;  4R8P B;  3LJA B;  4WB0 A;  1LW5 A;  4PFN A;  4DQY B;  4RKC A;  1U35 A;  2Y2Q A;  4TMR A;  4Z66 D;  4J8W A;  2YCN A;  4GEB A;  3AN2 D;  2Y2I A;  3AZK A;  1RV3 A;  3AZL A;  2AY6 A;  4H9P A;  5TF5 A;  2E54 A;  3ZRP A;  2BI3 A;  4MSO A;  1IJI A;  5FT5 A;  4NE5 A;  2OQX A;  4MQQ A;  2GMU A;  3NDN A;  1XI9 A;  5F99 A;  5AV9 D;  2DKJ A;  1BQA A;  3NRA A;  1ZOD A;  2BWO A;  1S09 A;  1YNU A;  2R2N A;  4J8X C;  4J8L A;  2GMS A;  3B6G B;  3F6T A;  1BJ4 A;  1F66 B;  1N2T A;  2HUE C;  1IX8 A;  1PZR A;  4G91 C;  1DJE A;  3EIB A;  4E77 A;  2Y2G A;  2C81 A;  2FN6 A;  2Z61 A;  4A6T A;  2JCH A;  4CBR A;  2VMU A;  4E45 A;  3NTJ A;  3AZH A;  3LJA C;  2JGT A;  5D5S A;  1P34 D;  5IWQ A;  1R4V A;  4EB5 A;  3X1U A;  1ASL A;  2D63 A;  4ZSY A;  1SF2 A;  1TAT A;  4F5F A;  2Y2P A;  2CJG A;  2DF4 C;  1BJN A;  1W7N A;  5GT0 A;  5DJ9 A;  4ZDO A;  3FQA A;  3MNN A;  2ZY4 A;  1BW0 A;  1TAS A;  4RJ0 A;  3AZM A;  2HUI A;  5CP6 B;  3NQU A;  2VMT A;  5AVC A;  3REL D;  5JA4 B;  3B6G C;  2HOR A;  3W97 B;  1P3P D;  1PFF A;  3R4T A;  3WX9 A;  5JRG A;  1MDX A;  1GCK A;  1ART A;  4A6U A;  2AY4 A;  3KUY D;  5KDM B;  1TPL A;  1QGN A;  2IO5 B;  1E5E A;  3UTB A;  1P3O A;  4E44 A;  3FKD A;  3CQ4 A;  3MAF B;  3LZ0 A;  4WYA A;  4H9S A;  3HDO A;  3RCH B;  3CBF A;  3REI B;  5BT1 D;  3I4J A;  3N4S A;  1DTY A;  3O62 D;  4HGA B;  3ELE A;  5FT4 A;  1MGV A;  3AZJ B;  1VJO A;  3EG5 B;  5DNM A;  5B24 B;  5B0Y A;  1KL2 A;  1A7W A;  3AEJ A;  2ZSM A;  4GSA A;  5G2P A;  5CP6 C;  2O7C A;  3W97 C;  3UT9 B;  4WYE A;  1ASG A;  5B2J B;  4ITG A;  3BB8 A;  3AV1 A;  3X1T D;  1LC5 A;  2HOZ A;  1TZY C;  1CZE A;  2UWX A;  5G49 B;  4A0H A;  4WU8 D;  1C9C A;  1D7V A;  1FG7 A;  4J8U A;  3EI7 A;  4H9N A;  3REI C;  1HQ3 B;  3A1K A;  1AHF A;  1B5O A;  3LVJ A;  2GSA A;  2W7K A;  1OHW A;  3CQ6 A;  5E5I A;  5CPK B;  4B98 A;  3AFA D;  2CTZ A;  3AZJ C;  3B6F B;  5B40 A;  4XAU A;  2W7E A;  2QB3 A;  5B24 C;  5GSU A;  1YIY A;  3T32 A;  3Q8N A;  3II0 A;  3REK B;  3VH6 A;  2W7L A;  3W99 A;  3MGR D;  2VMV A;  1ASM A;  4K2M A;  3V9R B;  5B32 D;  5HHY A;  2BYJ A;  1BH9 A;  5HDM A;  3K7Y A;  1M6S A;  2NQB D;  4W1V A;  3NNK A;  1N31 A;  4A72 A;  4EO5 B;  1O4S A;  1KKP A;  2QMA A;  1YJZ A;  4LNJ A;  4DRA A;  1HQ3 C;  5AVB B;  3MGQ A;  2C44 A;  1AIB A;  1AJS A;  5B2I B;  1P3F D;  1AY5 A;  5CPK C;  3HBX A;  1W23 A;  3B0C W;  1YOO A;  3B6F C;  3PPL A;  3X1V C;  4KUD D;  2QB2 A;  3MBB A;  3D6K A;  3H0L C;  5B1L B;  4MKJ A;  4ZLV A;  1P3G B;  3REK C;  1ARH A;  3BWN C;  2BI1 A;  2YOB A;  4H9R B;  3WCN A;  3AZE C;  4R8P D;  1TOJ A;  5AV5 B;  2NZD B;  3MC6 A;  4F5M A;  3MAU A;  3WZF A;  3KWQ D;  2YRI A;  1WKG A;  3GJU A;  2W7D A;  1P3M C;  2FJ7 D;  2QBT A;  4ZBJ B;  2CAN A;  4XZQ D;  1PMO A;  2ARO B;  3BWO A;  1KX5 D;  3JTX A;  3PDB A;  2V0Y A;  3UTA D;  4Q76 A;  4LD9 D;  2BYK B;  3VP6 A;  3TFU A;  2ORD A;  1U35 B;  3BCB A;  5AVB C;  4J8W B;  2A1V A;  3ACZ A;  1ECX A;  5B2I C;  3AZK B;  4ZWM A;  3EPH A;  4WYC A;  4UQV A;  4Q6R A;  4NE6 A;  2VMO A;  3REJ D;  3AZL B;  1F66 D;  2D65 A;  4F5H A;  4H9P B;  1P3L B;  3MGP A;  5B1L C;  1I48 A;  4IXS A;  3W96 A;  1P3G C;  3C1B D;  4IXO A;  3LZ1 C;  3DXW A;  5F99 B;  3UWC A;  4ZM4 A;  1MLZ A;  2CY8 A;  4Z2M G;  2Q7W A;  3VK4 A;  2NZD C;  2Y2M A;  4WV4 B;  3LVL B;  2AY1 A;  2ZP7 A;  4WP0 A;  1WYV A;  5B31 B;  2VI8 A;  1TZY A;  3AV2 D;  1AAM A;  1GC2 A;  3B1E A;  4YM6 A;  4ZBJ C;  4MQP A;  1TOG A;  1WYU A;  3PJ0 A;  4QLC D;  2ARO C;  3P6K A;  2FYF A;  2VMR A;  3KSY A;  1GEY A;  1AHX A;  3AEP A;  1IVR A;  3RCH A;  4JJN A;  3REI A;  4R5F A;  5DNN A;  1U35 C;  2VYC A;  1KMK A;  4Y0D A;  4J8W C;  3C1C A;  2F8N A;  4XEW A;  1H1C A;  1TOK A;  4RJY A;  3W97 D;  3AZL C;  1C7O A;  3X1U B;  1DFO A;  5EAA A;  1P3L C;  4PFF A;  2W7J A;  5GT3 D;  1SZS A;  2LY8 A;  2W8U A;  5B33 A;  5GT0 B;  3WY7 A;  1W2E A;  3WGB A;  5F99 C;  4OMA A;  4AO4 A;  3MNN B;  3TCM A;  2Z9X A;  3HL2 A;  5AV8 A;  5G2Q A;  3AZM B;  3IP4 C;  3NQU B;  5AVC B;  4F5G A;  4AO9 A;  5B31 C;  1ASA A;  3WA9 D;  3VH5 W;  2Y2J A;  5JRG B;  3B0C T;  3AZJ D;  2R0T A;  4Z5T B;  3A2B A;  3WAA C;  1S08 A;  1I41 A;  1P3O B;  4AZK A;  1KMJ A;  3HT4 A;  3NYT A;  3MVD D;  5CPK A;  1IX6 A;  3FDD A;  4H63 Q;  4QGR A;  3AZN D;  3X1V A;  2JJG A;  4XJL A;  3UT9 D;  1Z7D A;  1IAX A;  4HF8 A;  5B2J D;  2FNU A;  3WKJ A;  4RAE A;  4RLG A;  1ID3 D;  3H0R C;  4GE7 A;  1S32 D;  1GC4 A;  5DNM B;  1BT4 A;  1RVY A;  5GT0 C;  5B0Y B;  1QZ9 A;  3AZE A;  1N8P A;  3B0D B;  3G8M A;  2VMW A;  3N5M A;  2JSS A;  3AZM C;  1KX3 A;  2J8P A;  5AVC C;  4M6B A;  1AOI A;  3G0T A;  1P3M A;  1KX4 D;  4G92 B;  3AEM A;  3PD6 B;  5EAV A;  5FT8 A;  3AEN A;  4ZDP A;  3RBF A;  4A0R A;  2Z1Z A;  5JRG C;  3AV1 B;  1G7X A;  3QGU A;  5M4D A;  5JAY A;  3H0M C;  4F5J A;  4Z5T C;  1EQZ D;  3BCX A;  2YCP A;  5CPI D;  2VGU A;  4DGT A;  2DR1 A;  5AVB A;  1P3O C;  4OBU A;  4J8U B;  4GRX A;  3JWA A;  4H9N B;  4H9S C;  4XUJ D;  2BYL A;  2W7G A;  4X23 D;  3N75 A;  3AZF A;  3USF A;  8AAT A;  2E7U A;  1JF9 A;  2C7T A;  3FVX A;  4KGC D;  2CST A;  1AY4 A;  5B40 B;  3AYW A;  3LZ1 A;  5DNM C;  5B0Y C;  3X1S B;  4K05 A;  2BIA A;  5GSU B;  1ARG A;  1T3U A;  4ITX A;  4KAM A;  3B0D C;  1ZC9 A;  3DU4 A;  3AEJ C;  1LKC A;  3FZ8 A;  3W99 B;  4UHM A;  4YS3 B;  4Z66 A;  4G92 C;  4K2B A;  4M2K A;  3AN2 A;  1TAF A;  5B2I D;  2JE5 A;  1CL2 A;  3AV1 C;  4GE9 A;  4F5K A;  5G4I A;  5B0Z D;  1AHG A;  2F8N G;  4J8V D;  2ZUK A;  1KL1 A;  1PMM A;  5AY8 D;  3KXB C;  5AV9 A;  4NE3 A;  4J8U C;  4ZUX D;  4ZDL A;  3AZI D;  5AV5 D;  3MGQ B;  1P3L A;  1AJS B;  2ZC0 A;  1D7U A;  4AWL C;  3MAD A;  1AHE A;  3B46 A;  3VH5 T;  1M18 A;  5B40 C;  1S07 A;  3X1S C;  5GSU C;  1C7G A;  2ARO D;  4DBC A;  3VAX A;  2BWP A;  2VIA A;  2VMX A;  1M0O A;  1BQD A;  2G5H C;  4A0G A;  3W99 C;  2HOX A;  4EFF A;  4YS3 C;  5B31 A;  2CIN A;  5M46 A;  1I43 A;  1DGD A;  1O69 A;  4RM1 A;  2QSR A;  4EMY A;  1BKG A;  1P3K D;  1UU1 A;  3AZK D;  2GQN A;  4LW2 A;  5AV6 D;  3WAA A;  3AZL D;  1QIR A;  2PO3 A;  4ISY A;  5DB5 A;  1M1A D;  3AL0 C;  3VOM A;  4P3M A;  3PDB B;  4BA5 A;  2W8T A;  3WTP D;  4MQR A;  4WXB A;  7AAT A;  5EFS A;  2WK7 A;  3A9Y A;  3MGQ C;  5BO0 B;  1FG3 A;  1BFM A;  4W8I A;  2YFW B;  2XD5 A;  1OXO A;  2HOY A;  2YFV A;  3MGP B;  2CV5 A;  1JFI B;  2ZY5 A;  3LEL B;  2VMZ A;  1J32 A;  3W96 B;  3A6N A;  2AEU A;  2VGV A;  3A8U X;  4F4E A;  3FCR A;  3WCO A;  5FUG A;  1WKH A;  3QPG A;  4L0O A;  4BMK A;  3EIA A;  4ZAH A;  5AX8 A;  3AZH D;  2XD1 A;  3MC6 C;  5KTB A;  4H9O A;  3WTP E;  3MKJ A;  1B67 A;  3N0L A;  1WYV B;  1MDO A;  1TZY B;  3O62 A;  4Z5T A;  4YM6 B;  3AZG A;  3X1U D;  1WYU B;  5CPJ C;  5E5A C;  4MKK A;  5G0A A;  4F5L A;  4JJN B;  2G6W A;  4XJO A;  5DNN B;  3MNN D;  3E9K A;  3DXV A;  3TU4 B;  3C1C B;  4KHA A;  2F8N B;  2CH1 A;  3AEL A;  5AVC D;  1P3A D;  2VMN A;  1MLY A;  3MGP C;  3X1T A;  1RVU A;  1ZLA B;  2G7J A;  3LV2 A;  3AOW A;  5JRG D;  1G7W A;  2HIO D;  3EI6 A;  1Z3Z A;  3LEL C;  5B33 B;  3W96 C;  1J04 A;  1X28 A;  5EUD A;  3MGS D;  5AV8 B;  4WU9 B;  3WKS A;  3PD6 A;  3UTB D;  4MY5 A;  2CH2 A;  3OP7 A;  3LZ0 D;  5B1M D;  2EYQ A;  1N1J A;  4Q31 A;  4YM6 C;  5GXQ B;  3AFA A;  2TPL A;  3DR7 A;  1CJ0 A;  1D7R A;  2RVQ D;  4WYF A;  3KXB A;  1V2D A;  2ZYJ A;  1AIC A;  3M5U A;  2KFP A;  4JJN C;  5DNN C;  1M19 D;  4W91 A;  2BG1 A;  3TU4 C;  4NFT A;  1B9H A;  3ATH A;  3C1C C;  3W98 B;  2AY3 A;  1G4V A;  3A1I A;  4OYT A;  4WYD A;  3QI6 A;  3X1V B;  2AEV A;  3DC1 A;  5I92 A;  3X1S A;  3WKJ B;  5B31 G;  1O61 A;  1ZLA C;  3N7N A;  4DRB A;  1KKJ A;  5B33 C;  1MDZ A;  3AZE B;  4YS3 A;  1QIT A;  2NMP A;  1ASB A;  2YHK A;  5AV8 C;  4WU9 C;  5CHL B;  1KX3 B;  4F5I A;  2D5Y A;  1AOI B;  1P3M B;  3FD0 A;  4OT8 A;  3AEN B;  5GXQ C;  3KGX A;  1LK9 A;  2X5F A;  3TQX A;  2PYO A;  4KUD A;  5B40 D;  3P5J B;  2EO5 A;  5GSU D;  3K40 A;  3FDB A;  5EIG A;  1GEX A;  1JG8 A;  3REH B;  3WKR A;  3W98 C;  4J8X D;  2Z1Y A;  3AZF B;  3NUB A;  4WXF A;  1WWS A;  2Z9W A;  2VMP A;  4P7Y A;  4NOG A;  2QLR A;  3WKJ C;  1WYT A;  2FJ7 A;  4UHO A;  5BNV A;  1MAQ A;  3AYW B;  3LZ1 B;  2FM1 A;  4ZAS A;  1CQ7 A;  3TFT A;  2JIS A;  1KX5 A;  3LJA D;  3UTA A;  3ASA A;  4LD9 A;  4XJP A;  4EU1 A;  1KX3 C;  3ECD A;  1YAA A;  4BHD A;  1LW4 A;  1AOI C;  1WST A;  3MEB A;  4Z66 B;  1X0M A;  3AEM C;  2VMS A;  3MGQ D;  3AN2 B;  5CPJ A;  5M49 A;  1TAF B;  5E5A A;  1VP4 A;  1BJO A;  4Z2M H;  1SZU A;  4UUZ A;  3REJ A;  1BJW A;  1C7N A;  4A6R A;  4CXR A;  4IYO A;  4WZS B;  1EG5 A;  2X5D A;  1AJR A;  3C1B A;  5BO0 A;  4E1O A;  5AV9 B;  3REH C;  5E4Z A;  2YFW A;  4AZJ A;  3B6G D;  4IY7 A;  3AZF C;  1TOI A;  1JFI A;  1ASF A;  3AV2 A;  3LEL A;  3VK3 A;  1M18 B;  3AYW C;  3G7Q A;  4XJM A;  2BI5 A;  4QLC A;  2AAT A;  3AOV A;  4WYG A;  2Y2O A;  3NYS A;  4DQ6 A;  1W7L A;  2JG2 A;  3FTB A;  3B0B A;  2W7H A;  4Z66 C;  4ADE A;  4JEV A;  2WK8 A;  3AN2 C;  2CWE A;  2OGE A;  3ASB A;  1D7S A;  4CVQ A;  2EPJ A;  3WAA B;  2D61 A;  5GT3 A;  4R8D A;  4LW4 A;  3TU4 A;  3UAK A;  3W96 D;  5AV9 C;  5CP6 D;  1LC8 A;  2R5C B;  4JEY A;  5D95 A;  3W1H A;  2AY5 A;  1JS3 A;  2EZ2 A;  3JZL A;  3REL B;  2D66 A;  1ZLA A;  4RIZ A;  3WA9 A;  1M18 C;  1TZY D;  1DJU A;  2YFV B;  2Y2L A;  2CV5 B;  2OAT A;  4E3Q A;  2RIQ A;  4WU9 A;  3A6N B;  2CB1 A;  2VQR A;  1P3W A;  4ADD A;  4OBV A;  5FUG B;  1QJ5 A;  2HP1 A;  3REI D;  4JEZ A;  4H9O B;  2V1P A;  3MVD A;  1P3I A;  5GXQ A;  2W8J A;  3JWB A;  2D64 A;  2W7M A;  3AZN A;  3A9X A;  3O62 B;  4KYO A;  1UKJ A;  3AZG B;  1H3O B;  5B24 D;  2OKJ A;  1ID3 A;  1AIA A;  2ZY3 A;  1BH8 B;  3W98 A;  1LS3 A;  2FKI A;  2ZM5 A;  2EGY A;  1P3B A;  1FC4 A;  3LY1 A;  1X29 A;  2JJE A;  4ZM3 A;  4KHA B;  3REL C;  1KX4 A;  3LVM A;  1UU2 A;  3E2F A;  1P3P C;  2HUF A;  2E7J A;  3HMU A;  2EZ1 A;  2CV5 C;  3X1T B;  1AKA A;  4UOY A;  3A6N C;  3KUY C;  2BIG A;  4U1T A;  1EQZ A;  2G5I C;  5CPI A;  3TAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...