2ZY4A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
527
structure length
524
Chain Sequence
MSKDYQSLSPFELKDELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
molecule keywords L-aspartate beta-decarboxylase
total genus 201
structure length 524
sequence length 527
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy4A01
1J04A 2AY8A 5EUEA 2D64A 2W8UA 2ZSMA 4WYCA 3LWSA 3MADA 5EIGA 2W7DA 1WYVA 1AHXA 2QA3A 1GBNA 1Z7DA 1SZSA 2BYJA 3FQ8A 4LW4A 1LW5A 1WSTA 2C0RA 3H7FA 1DJ9A 3QM2A 4IYOB 3LG0A 1CL1A 1BJ4A 4PVFA 1S06A 4WYEA 1H1CA 1U08A 3EIBA 4TMRA 3RI6A 1ASFA 1BQDA 2O1BA 2W8JA 3BWNC 4E3QA 2VGTA 3E2ZB 4F5MA 1QGNA 2VMWA 3E6GA 2VMNA 1LC5A 1TOEA 3WKSA 2YCTA 1SZKA 3PD6B 4O6ZA 4XJLA 5DB5A 2VI8A 1YJYA 1DJEA 1ELQA 3KE3A 2D7ZA 4IXSA 3WX9A 1AY4A 1FG3A 3FFRA 3NU7A 4F5LA 1AICA 2TPLA 4WLHA 5I92A 1AMRA 2DOUA 1BT4A 1W23A 3D6KA 3FTBA 3HDOA 1VJOA 4XQ2A 1CQ8A 2VMVA 2E7JA 4Q76A 5E5IA 1DJUA 1LK9A 2ZUKA 1GC0A 1S08A 3AELA 3R4TA 1ASLA 3K28A 2GSAA 1RV3A 1V2DA 3II0A 1AMAA 3A9ZA 3VOMA 2JJFA 1PG8A 3QHXA 4GDYA 4AO9A 4AH3A 2E7UA 1UKJA 2C81A 2HUUA 3EUCA 2W8WA 2EZ1A 4E3RA 2D61A 4F5HA 3T32A 1G4XA 1QISA 2JJHA 4RKCA 1M0OA 2YRIA 4A6RA 3B1DA 4B9BA 4UOYA 1OATA 3FDBA 2CB1A 2PB0A 1AAMA 4DBCA 1CS1A 4BHDA 2DKBA 1TATA 4N0WA 3EI7A 3MC6A 3BWNA 4ADCA 1AJSA 3KGWA 4CBRA 1IX8A 2D66A 3BWOA 3GJUA 4ADEA 1ASCA 1GEWA 3FQAA 3GR9A 3ATHA 1M6SA 2Z20A 4FFCA 4MQRA 3PA9A 4F5GA 2VLHA 3MC6C 4W5KA 1WYVB 1ASDA 1MDXA 2R5EA 3M5UA 1D2FA 3OP7A 4LC3A 2VMSA 2W7JA 3A8UX 1VP4A 2OQXA 2VMQA 4R5FA 1CJ0A 2VGZA 4JEXA 5F9SA 2EO5A 2Z9XA 3B46A 2BI5A 3Q8NA 4IW7A 1M0PA 4ISYA 3AEMC 3HLMA 3E2YA 4TN4A 1MAPA 4WXGA 4HVKA 4MKJA 1B9IA 1M7YA 2R2NA 3IHJA 4AOAA 1MDOA 2HOXA 3HMUA 2VMOA 1TOGA 3JW9A 3ZRPA 3EZ1A 3MKJA 4ADBA 1BJNA 1GC4A 2YKVA 3CQ4A 4P7YA 1C7OA 2NMPA 2WKAA 3LVJA 4KXKA 5E4ZA 2ZY2A 3MAUA 2VIAA 3DR7A 3FRKA 2QB2A 1X29A 1TPLA 3G7QA 3HL2A 3KKIA 1BQAA 2CJDA 2O7CA 2W8VA 3BV0A 4IX8A 1QZ9A 4GRXA 3WKRA 2QLRA 3MBBA 3NYSA 1ASGA 2AY5A 3ACZA 2Q7WA 3NUBA 4JEWA 2HORA 4ZSYA 1C9CA 3F9TA 4ZM4A 4EFFA 2GB3A 3WZFA 2BYLA 1SF2A 5IWQA 3TQXA 4XJPA 2HP2A 2JG2A 4UQVA 4ZASA 4ZWMA 4GEBA 4IY7A 4WYGA 4Y0DA 4GE9A 5J8QA 5G2PA 2CANA 2W7LA 1M4NA 1MLZA 3NX3A 4ATPA 1AJSB 4ZM3A 3NDNA 2YHKA 3DR4A 1W3UA 4R5ZA 5FT6A 3F0HA 4WXBA 1C4KA 2OGAA 2XBNA 2W7IA 1AJRA 3FVXA 4EMYA 4ITGA 3NUIA 1IX6A 3VAXA 4F5KA 3DC1A 4M2MA 4GE7A 4QGRA 4XK1A 3FKDA 3UAKA 1AX4A 4KYOA 4OT8A 5D95A 2PO3A 2ZJGA 3LVLB 3HQTA 1VEFA 3LVKA 2W7EA 2GMSA 4A0RA 1YJSA 3ZZKA 3PDBB 1X0MA 2X5DA 5DJ9A 1TOJA 2VGUA 2HUFA 2EH6A 2HOYA 4H51A 1YNUA 4RKDA 4J5UA 3B8XA 1GC3A 3GSBA 5M46A 1AY8A 1TOKA 3I4JA 1W7MA 2VMUA 4RJYA 3RCHB 4WYFA 3MAFB 4AZKA 2FQ6A 3QPGA 5M49A 3VK4A 4R2NA 4IXZA 4K2MA 1FG7A 1WKGA 4MKKA 4WB0A 4RAEA 1MGVA 5F8VA 3USFA 2R0TA 2EGYA 3NU8A 2QBTA 2EPJA 3TATA 1RVUA 4IYOA 3DXVA 5G2QA 1ARTA 1UU0A 3WGBA 4F5JA 5FT8A 4ZWVA 1EJIA 5HHYA 1O4SA 1MDZA 5M4DA 4XAUA 3FFHA 4WXFA 1SVVA 4EB7A 2BHXA 1LW4A 2CY8A 5EFSA 1GEYA 3PD6A 3PIUA 3AATA 2R5CA 3ZZJA 2AY7A 1AHFA 3TCMA 4LNJA 3ZRRA 3FDDA 1J32A 1I48A 1C0NA 1IAYA 1ECXA 1ASEA 2DKJA 4BA4A 2BKWA 3EIAA 2BWPA 4WD2A 5E3KA 1KMJA 3FSLA 1ASMA 4UHOA 2C44A 3PAAA 2E7IA 1GEXA 1UU1A 1W7LA 4A72A 2WK8A 2JJEA 5G09A 3JWBA 4A0GA 4W91A 1AMSA 2G6WA 3EI9A 3EI6A 3CQ6A 5DJ1A 2VGVA 1CQ7A 2Z1YA 3GBXA 2V0YA 1I29A 3PDBA 4BQ0A 2BWNA 4PFFA 2Z9UA 1OXOA 2OGEA 3A2BA 2ZP7A 2EZ2A 4AO4A 1QITA 1QJ3A 3QBOA 2QMAA 3PPLA 4UHNA 4Q31A 3RCHA 1IJIA 4Y0IA 3GETA 5EUDA 3DRDA 1D7RA 3WY7A 3RQ1A 2YRRA 1IUGA 5G4JA 3E2FA 1KKJA 1P3WA 2CH2A 1SFFA 4P3MA 1B8GA 4JEYA 3CAIA 1CL2A 4MQQA 4OC9A 3DODA 4PIWA 4WYDA 3N0LA 1O61A 1LS3A 1Y4IA 3N75A 4EB5A 4ZDPA 1TARA 1IBJA 3BCBA 2D5YA 3CQ5A 3A9YA 3EI5A 2AY6A 3AEJC 4KAMA 2GQNA 4M2KA 4CVQA 1G4VA 1YJZA 2QB3A 2WK7A 3NYTA 3JTXA 4ZDLA 2W7MA 4E1OA 4CXQA 5EUNA 1BKGA 2AATA 2R5CB 3F6TA 3E9KA 3ELPA 4K2BA 4XJOA 2ZY5A 1LC7A 1AKBA 4U2HA 2VMTA 2BI3A 2ZY3A 1RVYA 3NYUA 2W7GA 3G8MA 2C7TA 5FT4A 2OATA 7AATA 2AY4A 1DGDA 4Q75A 3I5TA 1BJOB 4W1XA 3CBFA 1CQ6A 4Q6RA 2ZY4A 3ASAA 3ELEA 4UHMA 2BIAA 1MLYA 2VMPA 4B98A 1YOOA 4DGTA 1V2EA 3BC8A 2BI9A 4OMAA 1ZC9A 5EAAA 1AHGA 2ORDA 4JF0A 1M0QA 2Z9WA 1YIYA 5DX5A 3B1EA 1SZUA 2ZYJA 4LNMA 3AOWA 4CBSA 1AHYA 1ASBA 3MEBA 3GZDA 2E54A 1X28A 1KL2A 3AEPA 1PFFA 3PGYA 1WKHA 2XH1A 5JAYA 3L44A 5EQCA 3LVMA 1V2FA 2RFVA 4ZLVA 2BI1A 1M32A 1N8PA 1DFOA 3KGXA 4L0OA 3ZRQA 1ARIA 2FNIA 5BJ3A 1GCKA 1EG5A 4A00A 2O0RA 2ZSLA 5TF5A 4ZAHA 1BJWA 3VK3A 4JEVA 1XI9A 3E2ZA 1G7WA 3ISLA 1KMKA 1ELUA 2VI9A 1YIZA 2HOZA 1W7NA 2DR1A 2Z1ZA 1O62A 3AEOA 3GZCA 3BN1A 3EI8A 3FCRA 3E77A 4ZSWA 1T3IA 3AOVA 4OYTA 3P1TA 1G7XA 1WYTB 2V1PA 2VLFA 1DGEA 1AMQA 2CH1A 5G0AA 1EQBA 1MAQA 1ORDA 2D63A 3UE8A 3WLXA 1RV4A 1JG8A 1Z3ZA 4BMKA 1WYUA 5EAVA 1QIRA 1CZEA 2BWOA 4HF8A 4NOGA 3OKSA 1BJOA 1AAWA 4BA5A 1S0AA 3MAFA 4ATQA 3PDXA 2D7YA 2F8JA 2VYCA 3NNKA 2VMRA 2D65A 2AY1A 1LKCA 1TOIA 1YAAA 4WB0B 1KKPA 4JF1A 4WLJA 1B5PA 4U1TA 4M2JA 1AHEA 1JS3A 1S09A 5C6UA 5K8BA 3JWAA 1BS0A 4GE4A 4MQPA 4F5FA 1SPAA 2AY2A 1IAXA 3TFUA 2HZPA 3FQ7A 4OTLA 1OHWA 3A9XA 2YCPA 4F4EA 1AKCA 2YOBA 3K7YA 4XJMA 1ARHA 1ASNA 2CJGA 2BIGA 1ZOBA 4ITXA 4MSOA 1AIAA 1IX7A 1AY5A 5G4IA 2VIBA 2W7KA 2YCNA 4WP0A 3RBFA 1E5EA 8AATA 4DQ6A 3NTJA 1B4XA 3VK2A 2Z61A 1LC8A 1H0CA 3QI6A 3ECDA 1N31A 2AY3A 1DKAA 2VGWA 1ASAA 1JF9A 1C7GA 2GMUA 1GC2A 3QGUA 4GSAA 5AX8A 4ZDOA 3LV2A 4WBTA 4A6UA 3BB8A 1GDEA 4W1WA 1IVRA 4LW2A 3K40A 1WYTA 4A6TA 1OXPA 2Z9VA 1UU2A 2HP1A 4E77A 2BIEA 5HDMA 3P6KA 3R9AA 2AY9A 1WYUB 2FM1A 2YKXA 4MY5A 2W7FA 4Y0HA 3NRAA 4WYAA 3AENB 2X5FA 3UWCA 1N2TA 2ZC0A 1TASA 3L8AA 3DXWA 1E5FA 1ARSA 3LY1A 4LNLA 3DYDA 1DTYA 1JS6A 1X2AA 1QJ5A 5EIGB 5D5SA 1I41A 3COGA 4I8AA 2WK9A 5HXXA 2FNUA 3BCAA 3GZDC 4W1VA 4A0FA 2VMYA 3AEJA 3AEMA 1D7UA 3RBLA 2CJHA 1AKAA 1D7VA 3AV7A 4OCAA 1BW0A 4EU1A 1ZODA 2CTZA 2W7HA 2PB2A 3N5MA 4K2IA 4AZJA 3EZSA 3FVSA 4JEZA 4IXOA 1S07A 3QN6A 5FT5A 3RUYA 4CXRA 1O69A 1CZCA 3TFTA 1ARGA 1KL1A 4R8DA 4W8IA 3PJ0A 2JGTA 2W8TA 1V72A 2VMXA 4ADDA 3WGCA 4A0HA 1C7NA 3B1CA 2X8UA 1B9HA 2FYFA 2YKUA 2CSTA 2VGSA 1GD9A 3FVUA 2JJGA 3BCXA 3BS8A 1B5OA 2CINA 5M4BA 3DU4A 1FC4A 1D7SA 1OHVA 2FN6A 2VMZA 3DZZA 9AATA 1AIBA 4FL0A 4PFNA 3ASBA 3AENA 4XEWA 4F5IA 2CFBA 1OHYA 2BI2A 2YKYA 5BJ4A 1M0NA 1I43A 2HUIA
chains in the Genus database with same CATH superfamily
2AY8A 5EUEA 4WYCA 3MADA 3HBXA 3A1IA 1WYVA 1Z7DA 1LW5A 3AZEA 2Y2IA 1P3PC 3LG0A 4PVFA 4Z2MG 4UUZA 3EIBA 1ASFA 2W8JA 4F5MA 1QGNA 2VMWA 3LELD 3H0RC 5CPJB 4YM6D 3KE3A 4XUJD 1P3IB 4IXSA 2AROC 3AV2A 2CV5D 5I92A 1P3OC 1AMRA 3D6KA 1BT4A 1W23A 5E5IA 1KX4C 1CQ8A 2BYKB 2GSAA 3AL0C 1V2DA 3II0A 3A9ZA 4AH3A 3KWQA 1UKJA 3MGSB 3EUCA 3RELA 4A6RA 3EPKA 4UOYA 1EQZC 1OATA 2CB1A 5DNNC 1AAMA 3AFAD 3MC6A 1AJSA 3MGRC 3AZKD 3BWOA 4ADEA 1ASCA 3FQAA 3GR9A 1KX5D 4J8UC 2Z20A 1D2FA 4LC3A 3A8UX 4R8PB 4KUDA 4HVKA 4R8PD 3JW9A 1TOGA 4ADBA 1GC4A 5AV5B 2WKAA 3WA9C 1KX5B 5CHLB 1BQAA 3LELC 3AZGD 1P3MB 3BV0A 4GRXA 2QLRA 2XD5A 3NYSA 3ACZA 1AOIB 2HORA 4ZSYA 1R4VA 4CSRB 4ZM4A 4EFFA 2GB3A 2BYLA 1TZYB 3B6GB 2NQBC 3X1VD 4RLGA 5BNXB 5G2PA 2CANA 5B33B 3NX3A 5AVCB 4ATPA 3F0HA 3FVXA 2ZM5A 4EMYA 2NZDA 4ITGA 3NUIA 3DC1A 5B1MC 4XUJB 1P3ID 4KYOA 3KSYA 2PO3A 5AV8B 2ZJGA 4HGAC 2GMSA 3AYWC 5BO0A 2X5DA 5FUGB 4H51A 1M18B 3LJAA 3MGQB 1AY8A 5B0YC 3KXBB 4XZQD 1TOKA 4ZUXD 1W7MA 3RCHB 1FG7A 1P3AA 4MKKA 1MGVA 5AV6A 2R0TA 5B32A 2QBTA 4F5JA 5G2QA 2DQNC 4NE3A 1ARTA 4H9PA 1UU0A 5FT8A 1BH8B 5HHYA 1ID3A 1MDZA 5KTBA 2CY8A 5EFSA 4H9QB 5BS7A 3PIUA 3AATA 5CPJA 4LNJA 3ZRRA 3AN2C 1M19D 4J8WC 5GT0B 3REID 1ECXA 1P3KC 1ASEA 5B0ZC 5B24C 3EIAA 3X1UA 5E3KA 1KMJA 4UHOA 2J8PA 2E7IA 1GEXA 3REJC 2JJEA 1AMSA 3NQJA 3WKJA 2DGMA 1CQ7A 3AZIA 3H9XA 1P3OA 2BWNA 4PFFA 4UPKA 1OXOA 2OKKA 3A2BA 2ZP7A 2EZ2A 1ZLAD 3UTBB 2QMAA 4Q31A 3GETA 3WY7A 1S32A 5G4JA 2LY8A 4P3MA 4MQQA 3DODA 4PIWA 3AYWD 3N0LA 1LS3A 2AROD 3CQ5A 3VH6A 2AY6A 3AEJC 4KAMA 2F2AC 3N4RA 4M2KA 4CVQA 2WK7A 3JTXA 3REKD 1P3BB 2ZY5A 1LC7A 2JISA 1RVYA 5F99D 2PYOC 5B1LD 2RIQA 5GSUB 1KX5A 4Q75A 3WKJD 3HVYA 5GSUD 5GXQA 1BJOB 4W1XA 4Q6RA 1P3MA 3ELEA 1KX3D 5B2IB 4DGTA 2JSSA 4KGCD 4WU8C 2Z9WA 5B40C 3B1EA 5DX5A 3AZLB 2ZYJA 3AZEC 3AOWA 4CBSA 1AHYA 5E5AA 3MEBA 5BNXA 3AEPA 3B6FC 4X23D 3N4XA 1M32A 5AV8D 1GCKA 5BS7C 1P3AD 4A00A 2O0RA 2ZSLA 1G7WA 3UTAD 1KMKA 3GZCA 3EI8A 3FCRA 3E77A 2V1PA 1DGEA 1AMQA 2CH1A 1MAQA 1ORDA 3WLXA 4J8UD 5FUGA 1JG8A 1Z3ZA 4BMKA 3JZLA 1CZEA 3LJAB 2A1VA 4QLCC 3OKSA 1TZYD 3REIB 5BT1C 4KUDC 4H9NB 3NNKA 2D65A 1TOIA 4YS3C 1P3IC 1JS3A 1BH8A 4WNNB 2AY2A 4OTLA 4WU9B 2YCPA 2BG1A 3MGPA 1AKCA 2YOBA 3K7YA 1H3OA 2CJGA 4ITXA 1IX7A 2FKIA 4Z66B 2YCNA 3X1UB 3WAAA 3VK2A 1H0CA 4GSAA 3QGUA 5AX8A 1GDEA 1IVRA 2Z9VA 1P3OB 5CPIC 2HP1A 4E77A 3A6NB 5AV9B 1WYUB 2FM1A 4MY5A 2Y2PA 4Y0HA 3NRAA 3KUYA 3UWCA 3WTPC 5CPIA 1KU5A 3L8AA 1ARSA 4J8VC 1X2AA 1M19C 4NE5A 3COGA 1P3OD 5KDMA 1P3PA 3B0DB 1PMMA 2CJHA 3AZHC 1AKAA 1BW0A 2PB2A 3N5MA 3LELB 4Z5TA 3MGQC 4IXOA 3QN6A 1P3MD 1O69A 3WTPD 1ZLAB 4R8DA 1BH9A 3PJ0A 5AVBB 5AV5D 2W8TA 3WGCA 5GT3D 4AWLB 3REHD 2FYFA 2YKUA 2CSTA 3MGSA 3EPHA 2JJGA 1M1AC 1B5OA 1FC4A 2FN6A 9AATA 4FL0A 4PFNA 3ASBA 3AENA 3A1KA 2HUIA 3FZ6A 1J04A 5JA4A 4XZQA 2W8UA 2ZSMA 5EIGA 4G92B 1GBNA 4LW4A 3AZKB 3AN2A 2C0RA 2F8NK 3QM2A 3TU4A 1CL1A 1BJ4A 1S06A 3MVDC 1H1CA 5DNNA 3BWNC 2VGTA 2VMNA 1TOEA 3WKSA 2YCTA 3P5JB 3PD6B 3W99D 4WU8A 5DB5A 1YJYA 1ELQA 1F66C 3WX9A 1AY4A 3WTPA 3NU7A 3AV1C 1KX4D 3REKB 4XQ2A 3WA9A 2ZUKA 1GC0A 1S08A 3AELA 1ASLA 3REIA 3AZNC 4RJ0A 3QHXA 1PG8A 2C81A 4CSRA 4Z66C 4E3RA 1G4XA 1KX4B 3VH5W 2YRIA 3MNNC 5AV8C 3B1DA 4WNNA 3X1SB 4BHDA 1TATA 3EI7A 4WU9D 2VQRA 4CBRA 1IX8A 3GJUA 3ATHA 4FFCA 4MQRA 5AVCD 4W5KA 3I16A 3UT9A 2VMSA 2OQXA 2VMQA 4R5FA 2X3LA 2Z9XA 2IO5B 4IW7A 1M0PA 3B6GC 3AEMC 4ISYA 3AZND 3E2YA 4TN4A 1MAPA 5B0YA 4MKJA 3VP6A 5CP6B 3AZLC 4NE6A 3AV2B 1BJNA 2DGKA 4P7YA 2NMPA 3LVJA 5E4ZA 2ZY2A 3MAUA 4WZSB 3DR7A 3FRKA 2QB2A 5CPIB 1TPLA 3C1CD 3HL2A 3KKIA 1EQZD 1QZ9A 3WKRA 1F66D 3NUBA 3F9TA 3RELD 3AZFD 3WZFA 5B32B 2FJ7A 3W97B 1SF2A 2RVQD 3C1CA 2HP2A 5AY8A 2IO5C 4IY7A 2W7LA 5B2JB 2HUEB 1AJSB 5AY8D 3DR4A 4R5ZA 5FT6A 4WXBA 2XBNA 2W7IA 1AJRA 3AZNA 2KFPA 1ID3C 1IX6A 3VAXA 1ZLAA 4YM6A 3REHA 3AZGC 1AX4A 3LVLB 2W7EA 4A0RA 2HUFA 2EH6A 3W1JA 3NQUA 2HOYA 2NQBD 4RKDA 3UTBA 1PMOA 4J5UA 1GC3A 3GSBA 2YFWB 3EG5B 3I4JA 4WYFA 3MAFB 4ZUXB 5M49A 3AV1B 5CPJD 1M18D 5F8VA 4WB0A 1HQ3B 4RAEA 5CPKA 3USFA 3NU8A 4IYOA 3AFAA 5BNVA 1W2EA 5DNNB 4WXFA 1SVVA 2BHXA 4YS3B 1LW4A 5GT3B 5AV6D 3V9RB 3PD6A 1M1AD 3FDDA 1I48A 4XZQC 4WD2A 3REJD 3FSLA 2C44A 5G09A 3JWBA 4A0GA 4W91A 3O62B 2G6WA 4M6BA 3VH6T 3GBXA 1KX4A 5DNMD 3AZLA 1M18A 3N4SA 1QITA 4AO4A 3MGQA 3PPLA 3FZ8A 4UHNA 3RCHA 1IJIA 2Y2HA 3W99C 4Y0IA 5EUDA 1IUGA 3E2FA 1P3WA 2CH2A 4YM6C 3IP4C 1O61A 1Y4IA 3N75A 4NFTA 4ZDPA 1TARA 1IBJA 5B31C 2GQNA 5B40B 5B33C 1G4VA 1YJZA 3NYTA 4K05A 4E1OA 4JJND 4EO5C 4CXQA 5B0YB 3KXBC 2AATA 4DRAA 5EUNA 5CP6A 4XJOA 3W97C 3AZJD 1EQZA 3G8MA 5FT4A 4QLCA 7AATA 5B2ID 1DGDA 1KX3B 4H9RA 2ZY4A 2BIAA 3NQJB 1V2EA 2UWXA 4OMAA 5EAAA 1S32D 1AHGA 3AZIB 2Y2NA 2ORDA 3MGPC 2FJ7B 4LNMA 3REJA 3MGSD 5GT0C 2HIOD 5B2JC 2E54A 1X28A 4CAYB 1PFFA 3PGYA 2YFVB 4Z5TC 3L44A 4LD9B 5E5AD 5F99C 1N8PA 3KGXA 1ARIA 2FNIA 3AZEB 3C1CC 4UUZB 1BJWA 3VK3A 4YM6B 3WAAB 1AOID 1ELUA 1O62A 3AEOA 3BN1A 1T3IA 4OYTA 1G7XA 1WYTB 1KX3C 2VLFA 4WU8D 3W99A 1BFMA 2D63A 3LZ1B 3RELC 3MGSC 5EAVA 4NOGA 3KUYC 2YFWA 3LZ1D 4BA5A 1S0AA 1P3FD 3KWQB 3PDXA 2D7YA 3VH5A 1LKCA 1YAAA 4WB0B 1KKPA 4JF1A 4U1TA 2EYQA 4M2JA 1S09A 3WAAC 3X1TA 1BS0A 5DNND 1P34A 3AZHA 1F1EA 1OHWA 1ARHA 1S32C 3LELA 3AV1D 4MSOA 1AIAA 2VIBA 2HIOB 1JFIB 3AZFC 3RBFA 2Y2JA 2FJ7D 3FQ7A 1N31A 4ZUXC 2VGWA 1DKAA 2AY3A 2GMUA 4Z5TD 4ZDOA 3BB8A 2AEVA 4LW2A 3K40A 2F8ND 3P6KA 5AV5A 2W7FA 3X1VA 4WYAA 3AENB 2ZC0A 3MVDA 3DXWA 4LNLA 3DYDA 1DTYA 3W96D 1JS6A 1AOIA 4H9NA 3WTPE 4I8AA 4W1VA 1D7UA 3RBLA 5B40A 3AV7A 5B31B 4OCAA 4EU1A 3MGPB 2CTZA 1M1AA 3FVSA 1S07A 3HT4A 1EQZB 4Z66A 1M19B 5CPKC 3WA9B 3WAAD 5JRGB 1KX3A 3UTBC 3VH5T 2VMXA 2AROA 2PYOB 5CP6C 2VGSA 1GD9A 3BS8A 2F8NA 2CINA 5M4BA 1P3BC 3REJB 5GXQC 2CFBA 2BI2A 3X1SA 1I43A 4CAYA 2DGLA 5B24A 3LWSA 2W7DA 3FQ8A 5AV6B 3H7FA 5AVBD 1WWSA 3X1SD 1U08A 4TMRA 1BQDA 1P3LC 2O1BA 3MNNB 3W96B 3UTAC 4J8UA 4O6ZA 4XJLA 1DJEA 2D7ZA 1FG3A 4F5LA 2TPLA 4WLHA 2DOUA 3W1HA 3FTBA 4Q76A 1DJUA 5B40D 1LK9A 5B0ZB 2NZDC 3VOMA 2E7UA 2EZ1A 2D61A 2G5HC 3W97A 1M0OA 1P3LB 4B9BA 3FDBA 2PB0A 4DBCA 3MGRD 5AV6C 3AZKC 2DKBA 1Z2CB 5DNMB 3KGWA 2D66A 1TAFA 4X23A 1M6SA 4F5GA 3FD0A 3MC6C 1ASDA 2NQBA 2R5EA 3MGRA 3M5UA 3OP7A 1VP4A 1CJ0A 4JEXA 2EO5A 3HLMA 2NZDD 1P3BA 1B9IA 3IHJA 4AOAA 1MDOA 2HOXA 3HMUA 2VMOA 3EZ1A 3REKA 5CPID 1ZLAC 2VIAA 1X29A 3G7QA 5B1LA 4IX8A 4ZUXA 1P3KA 1ASGA 2AY5A 3AYWA 5B2IA 2Q7WA 1C9CA 5CPKB 5IWQA 4XJPA 2JG2A 4UQVA 4ZASA 4GEBA 5E5AB 4WYGA 4Y0DA 3R45A 1M4NA 1MLZA 4ZM3A 3AZMA 2YHKA 5F99A 5DNMC 1P3MC 2CV5B 4F5KA 2JE5A 5JRGA 4M2MA 4GE7A 4XK1A 3FKDA 3WCOA 2PYOA 3HQTA 3O62A 3X1TD 2F8NB 3ZZKA 4KHAA 1TOJA 2Y2OA 3B8XA 5M46A 2VMUA 4RJYA 5B0YD 3N7NA 4AZKA 2FQ6A 5B24B 4IXZA 3B6FD 1HTAA 2EPJA 4RM1A 3TATA 3C1CB 1EJIA 1O4SA 3EPLA 3B6FA 4XAUA 5M4DA 3FFHA 4EB7A 1B6WA 4J8XC 1P34C 4WU9A 2R5CA 3ZZJA 2AY7A 1AHFA 5CP6D 1C0NA 1IAYA 3AZNB 4BA4A 4QLCB 3KWQD 3LJAD 5B0ZA 5BT1D 3EI9A 3EI6A 5DJ1A 1U35B 5B1LC 1I29A 3PDBA 3RELB 2OGEA 3WKJC 5AVBC 3QBOA 4OBUA 1Q9CA 5DNMA 3RQ1A 4J8VD 2YRRA 1KKJA 3X1TC 2YFVA 3AV1A 4KGCC 4X23B 5B1MA 3AZED 3TU4D 4EB5A 3AN2D 5BNVB 2QB3A 4LD9C 4ZDLA 4KUDB 2W7MA 3W98B 4KGCB 3E9KA 3ELPA 4K2BA 1P3FA 4J8LA 4U2HA 3W99B 2Y2GA 4AWLC 4E45A 3AZIC 5GSUC 2OATA 2AY4A 3CBFA 5B1LB 5AVBA 3ASAA 4UHMA 1MLYA 4B98A 3BC8A 1ZC9A 4J8XA 1M0QA 1YIYA 1TZYA 3X1UD 3B6GA 3R45B 3GZDA 5B33A 1KL2A 5JA4B 5E5AC 3AZMB 1WKHA 2XH1A 5JAYA 1V2FA 3LZ0D 2BI1A 4L0OA 3UT9D 3ZRQA 2FFFB 2HIOA 1JFIA 1EG5A 5TF5A 1ID3D 1P3AC 4JEVA 1XI9A 3E2ZA 3ISLA 2Z1ZA 2HOZA 1W7NA 2DR1A 5AV8A 1KX5C 4ZSWA 3AOVA 2Y2QA 3UE8A 3AV2C 1RV4A 1QIRA 2BWOA 4HF8A 3X1VB 3KXBA 4LD9D 3W98C 1P3GB 3AZJA 2VMRA 4JJNA 3AZGB 3AZID 1AHEA 5C6UA 5K8BA 1ID3B 3JWAA 4GE4A 4F5FA 1IAXA 3TFUA 2G5IC 2HZPA 4H9QA 4F4EA 4H9OA 2HUEC 4XJMA 5GT0A 3REIC 4WP0A 1E5EA 8AATA 4DQ6A 2BYMA 4DQYB 1B4XA 2Z61A 1LC8A 1ASAA 1GC2A 5G49A 3LZ1C 3LV2A 4W1WA 1WYTA 4A6TA 1M18C 3LZ1A 2BIEA 1P3LD 1N2TA 4HGAB 5JRGC 1E5FA 3LY1A 3UTAA 5D5SA 5B1MB 1I41A 5AV9D 1P3GD 2OKJA 5HXXA 4A0FA 4EO5B 5B31G 5B32G 5AY8B 3B6GD 3AZHB 3W96A 4J8UB 5B2JA 1ZODA 1P3PD 3W97D 3WCNA 4JEZA 5FT5A 3C1BC 3UTBD 1KL1A 5AV5C 4W8IA 3REHB 1V72A 4A0HA 1C7NA 2X8UA 1B9HA 1P34D 3A6NC 4XUJC 2W8SA 1OHVA 1D7SA 1HQ3D 1P3LA 2VMZA 3DZZA 4QLCD 4XEWA 1OHYA 5GT0D 1T3UA 1M0NA 5BJ4A 2D64A 2Y2MA 1TAFB 5AY8C 5CPJC 1AHXA 1HQ3A 2QA3A 2NQBB 1SZSA 2BYJA 1WSTA 1ULYA 4H63Q 1DJ9A 4IYOB 3AFAB 5B32C 4WYEA 3RI6A 4E3QA 3E2ZB 4YS3A 3E6GA 1AOIC 1LC5A 1WWIA 1SZKA 2VI8A 3FFRA 1AICA 3HDOA 1P3BD 3O62C 1VJOA 2VMVA 2E7JA 1M19A 3R4TA 3AZMD 3K28A 1RV3A 5B2JD 1AMAA 2AROB 1P3KB 2JJFA 4GDYA 4AO9A 3AYWB 2HUUA 2W8WA 4R8PC 4F5HA 3T32A 3AZGA 1QISA 2JJHA 4Z66D 4RKCA 5B32D 1F66B 1CS1A 4N0WA 3BWNA 4ADCA 1GEWA 4H9OB 1H3OB 4DRBA 3PA9A 2VLHA 1WYVB 2RVQC 4ZBJB 1MDXA 5F99B 5AVCC 1XEYA 2W7JA 3H0MC 3AV2D 2CV5A 5F9SA 2VGZA 4XUJA 3B46A 2BI5A 3Q8NA 3W98D 4WXGA 5G49B 4H9SA 4Z2MH 1P3IA 1M7YA 2R2NA 3ZRPA 3MKJA 2YKVA 2PYOD 3CQ4A 1C7OA 4KXKA 3C1BB 2L5AA 2CJDA 2O7CA 2W8VA 3MBBA 3UTAB 4JEWA 3H0LC 1N1JB 5C3IC 5KDMB 1P3PB 3TQXA 4H9PB 4ZWMA 2HIOC 3LZ0B 5J8QA 4GE9A 3AZHD 3NDNA 4LD9A 1W3UA 1C4KA 3B0DC 2OGAA 3B0BA 3AZLD 3MGRB 4E44A 1BH9B 4R8PA 4QGRA 3UAKA 4OT8A 5D95A 1VEFA 3LVKA 3WKJB 3REHC 4OBVA 1YJSA 5B0ZD 3PDBB 5AV9C 1X0MA 5DJ9A 2VGUA 4J8WD 1YNUA 3X1UC 5B24D 4G91B 3AZFA 1S32B 3QPGA 4XZQB 4KUDD 3VK4A 4R2NA 4K2MA 1WKGA 2EGYA 3AN2B 1RVUA 3TU4B 3DXVA 1KAFA 3MNND 3WGBA 4ZWVA 3X1SC 3X1TB 2CWEA 1P34B 3AFAC 4J8VB 1GEYA 5AVCA 4KGCA 3TCMA 3WTPB 4WV4B 1HQ3C 1J32A 2NZDB 2DKJA 3X1VC 2BKWA 2BWPA 3LJAC 3KUYD 1ASMA 3PAAA 5GXQB 1UU1A 1W7LA 4A72A 2WK8A 1P3FC 3REKC 3CQ6A 2VGVA 2Z1YA 2V0YA 5BO0B 3B0CW 4BQ0A 2Z9UA 4H9SC 1QJ3A 3WA9D 5B1MD 1F66A 3DRDA 3MVDB 2Y2LA 1D7RA 4WU9C 1SFFA 1B8GA 4JEYA 3MGPD 4G92C 3CAIA 1CL2A 3O62D 4OC9A 1P3AB 4WYDA 3A6ND 5B31D 3UT9B 3BCBA 2D5YA 3A9YA 3EI5A 3GWPA 3B6FB 2FJ7C 3KWQC 5B31A 2JCHA 4G91C 4X23C 1BKGA 2R5CB 3F6TA 1M1AB 5C3IB 1AKBA 2VMTA 2BI3A 2ZY3A 3NYUA 2W7GA 2C7TA 3C1BA 3I5TA 1CQ6A 4WJ3C 2DF4C 1P3GA 2VMPA 1YOOA 3AZJB 1N1JA 2BI9A 1U35A 4JF0A 1SZUA 3LZ0A 1ASBA 4J8WB 3VH6W 3AZMC 3B0CT 3LZ0C 5EQCA 3LVMA 4JJNC 2RFVA 4ZLVA 1DFOA 2QSRA 4ZBJC 5BJ3A 3MVDD 5CPKD 4ZAHA 2BYMB 3MNNA 2VI9A 1YIZA 5B2IC 3W98A 2Y2KA 3P1TA 1P3FB 1P3GC 5G0AA 1EQBA 3NQUB 3A6NA 1WYUA 1U35C 5GXQD 5GSUA 2BYKA 3KUYB 1BJOA 1AAWA 3AZFB 3MAFA 4ATQA 2F8JA 2VYCA 2AY1A 3W1IA 4J8XB 4WLJA 1B5PA 3UT9C 3C1BD 4YS3D 4MQPA 1SPAA 3W96C 5GT3A 3V9RA 4J8VA 3A9XA 4RIZA 2AEUA 1ASNA 2BIGA 1ZOBA 4Z5TB 1AY5A 5G4IA 2W7KA 3EPJA 2XD1A 3NTJA 3QI6A 3ECDA 1JF9A 1C7GA 3KXBD 4WBTA 4A6UA 3MGQD 1PZRA 3AZJC 1OXPA 4RITA 1UU2A 5HDMA 3R9AA 2AY9A 2YKXA 2X5FA 1TASA 4J8XD 2G7JA 1QJ5A 5GT3C 2WB6A 5EIGB 1P3KD 4JJNB 2WK9A 2CV5C 3AZKA 3G0TA 2FNUA 3BCAA 3GZDC 3TU4C 2VMYA 3AEJA 1U35D 3AEMA 1TZYC 5B33D 1D7VA 4WU8B 2W7HA 3FZ7A 4K2IA 4AZJA 3EZSA 2F8NG 3RUYA 4CXRA 3KFUG 1CZCA 3TFTA 1ARGA 1B67A 4H9RB 2JGTA 4ADDA 3B1CA 3FVUA 5JRGD 3BCXA 4KHAB 3DU4A 5AV9A 1AIBA 4F5IA 4J8WA 2YKYA 2F8NH 1A7WA
chains in the Genus database with same CATH topology
2AY8A 5EUEA 4WYCA 3MADA 3HBXA 3A1IA 1WYVA 1Z7DA 1LW5A 3AZEA 2Y2IA 1P3PC 3LG0A 4PVFA 4Z2MG 4UUZA 3EIBA 1ASFA 2W8JA 4F5MA 1QGNA 2VMWA 3LELD 3H0RC 5CPJB 4YM6D 3KE3A 4XUJD 1P3IB 4IXSA 2AROC 3AV2A 2CV5D 5I92A 1P3OC 1AMRA 3D6KA 1BT4A 1W23A 5E5IA 1KX4C 1CQ8A 2BYKB 2GSAA 3AL0C 1V2DA 3II0A 3A9ZA 4AH3A 3KWQA 1UKJA 3MGSB 3EUCA 3RELA 4A6RA 3EPKA 4UOYA 1EQZC 1OATA 2CB1A 5DNNC 1AAMA 3AFAD 3MC6A 1AJSA 3MGRC 3AZKD 3BWOA 4ADEA 1ASCA 3FQAA 3GR9A 1KX5D 4J8UC 2Z20A 1D2FA 4LC3A 3A8UX 4R8PB 4KUDA 4HVKA 4R8PD 3JW9A 1TOGA 4ADBA 1GC4A 5AV5B 2WKAA 3WA9C 1KX5B 5CHLB 1BQAA 3LELC 3AZGD 1P3MB 3BV0A 4GRXA 2QLRA 2XD5A 3NYSA 3ACZA 1AOIB 2HORA 4ZSYA 1R4VA 4CSRB 4ZM4A 4EFFA 2GB3A 2BYLA 1TZYB 3B6GB 2NQBC 3X1VD 4RLGA 5BNXB 5G2PA 2CANA 5B33B 3NX3A 5AVCB 4ATPA 3F0HA 3FVXA 2ZM5A 4EMYA 2NZDA 4ITGA 3NUIA 3DC1A 5B1MC 4XUJB 1P3ID 4KYOA 3KSYA 2PO3A 5AV8B 2ZJGA 4HGAC 2GMSA 3AYWC 5BO0A 2X5DA 5FUGB 4H51A 1M18B 3LJAA 3MGQB 1AY8A 5B0YC 3KXBB 4XZQD 1TOKA 4ZUXD 1W7MA 3RCHB 1FG7A 1P3AA 4MKKA 1MGVA 5AV6A 2R0TA 5B32A 2QBTA 4F5JA 5G2QA 2DQNC 4NE3A 1ARTA 4H9PA 1UU0A 5FT8A 1BH8B 5HHYA 1ID3A 1MDZA 5KTBA 2CY8A 5EFSA 4H9QB 5BS7A 3PIUA 3AATA 5CPJA 4LNJA 3ZRRA 3AN2C 1M19D 4J8WC 5GT0B 3REID 1ECXA 1P3KC 1ASEA 5B0ZC 5B24C 3EIAA 3X1UA 5E3KA 1KMJA 4UHOA 2J8PA 2E7IA 1GEXA 3REJC 2JJEA 1AMSA 3NQJA 3WKJA 2DGMA 1CQ7A 3AZIA 3H9XA 1P3OA 2BWNA 4PFFA 4UPKA 1OXOA 2OKKA 3A2BA 2ZP7A 2EZ2A 1ZLAD 3UTBB 2QMAA 4Q31A 3GETA 3WY7A 1S32A 5G4JA 2LY8A 4P3MA 4MQQA 3DODA 4PIWA 3AYWD 3N0LA 1LS3A 2AROD 3CQ5A 3VH6A 2AY6A 3AEJC 4KAMA 2F2AC 3N4RA 4M2KA 4CVQA 2WK7A 3JTXA 3REKD 1P3BB 2ZY5A 1LC7A 2JISA 1RVYA 5F99D 2PYOC 5B1LD 2RIQA 5GSUB 1KX5A 4Q75A 3WKJD 3HVYA 5GSUD 5GXQA 1BJOB 4W1XA 4Q6RA 1P3MA 3ELEA 1KX3D 5B2IB 4DGTA 2JSSA 4KGCD 4WU8C 2Z9WA 5B40C 3B1EA 5DX5A 3AZLB 2ZYJA 3AZEC 3AOWA 4CBSA 1AHYA 5E5AA 3MEBA 5BNXA 3AEPA 3B6FC 4X23D 3N4XA 1M32A 5AV8D 1GCKA 5BS7C 1P3AD 4A00A 2O0RA 2ZSLA 1G7WA 3UTAD 1KMKA 3GZCA 3EI8A 3FCRA 3E77A 2V1PA 1DGEA 1AMQA 2CH1A 1MAQA 1ORDA 3WLXA 4J8UD 5FUGA 1JG8A 1Z3ZA 4BMKA 3JZLA 1CZEA 3LJAB 2A1VA 4QLCC 3OKSA 1TZYD 3REIB 5BT1C 4KUDC 4H9NB 3NNKA 2D65A 1TOIA 4YS3C 1P3IC 1JS3A 1BH8A 4WNNB 2AY2A 4OTLA 4WU9B 2YCPA 2BG1A 3MGPA 1AKCA 2YOBA 3K7YA 1H3OA 2CJGA 4ITXA 1IX7A 2FKIA 4Z66B 2YCNA 3X1UB 3WAAA 3VK2A 1H0CA 4GSAA 3QGUA 5AX8A 1GDEA 1IVRA 2Z9VA 1P3OB 5CPIC 2HP1A 4E77A 3A6NB 5AV9B 1WYUB 2FM1A 4MY5A 2Y2PA 4Y0HA 3NRAA 3KUYA 3UWCA 3WTPC 5CPIA 1KU5A 3L8AA 1ARSA 4J8VC 1X2AA 1M19C 4NE5A 3COGA 1P3OD 5KDMA 1P3PA 3B0DB 1PMMA 2CJHA 3AZHC 1AKAA 1BW0A 2PB2A 3N5MA 3LELB 4Z5TA 3MGQC 4IXOA 3QN6A 1P3MD 1O69A 3WTPD 1ZLAB 4R8DA 1BH9A 3PJ0A 5AVBB 5AV5D 2W8TA 3WGCA 5GT3D 4AWLB 3REHD 2FYFA 2YKUA 2CSTA 3MGSA 3EPHA 2JJGA 1M1AC 1B5OA 1FC4A 2FN6A 9AATA 4FL0A 4PFNA 3ASBA 3AENA 3A1KA 2HUIA 3FZ6A 1J04A 5JA4A 4XZQA 2W8UA 2ZSMA 5EIGA 4G92B 1GBNA 4LW4A 3AZKB 3AN2A 2C0RA 2F8NK 3QM2A 3TU4A 1CL1A 1BJ4A 1S06A 3MVDC 1H1CA 5DNNA 3BWNC 2VGTA 2VMNA 1TOEA 3WKSA 2YCTA 3P5JB 3PD6B 3W99D 4WU8A 5DB5A 1YJYA 1ELQA 1F66C 3WX9A 1AY4A 3WTPA 3NU7A 3AV1C 1KX4D 3REKB 4XQ2A 3WA9A 2ZUKA 1GC0A 1S08A 3AELA 1ASLA 3REIA 3AZNC 4RJ0A 3QHXA 1PG8A 2C81A 4CSRA 4Z66C 4E3RA 1G4XA 1KX4B 3VH5W 2YRIA 3MNNC 5AV8C 3B1DA 4WNNA 3X1SB 4BHDA 1TATA 3EI7A 4WU9D 2VQRA 4CBRA 1IX8A 3GJUA 3ATHA 4FFCA 4MQRA 5AVCD 4W5KA 3I16A 3UT9A 2VMSA 2OQXA 2VMQA 4R5FA 2X3LA 2Z9XA 2IO5B 4IW7A 1M0PA 3B6GC 3AEMC 4ISYA 3AZND 3E2YA 4TN4A 1MAPA 5B0YA 4MKJA 3VP6A 5CP6B 3AZLC 4NE6A 3AV2B 1BJNA 2DGKA 4P7YA 2NMPA 3LVJA 5E4ZA 2ZY2A 3MAUA 4WZSB 3DR7A 3FRKA 2QB2A 5CPIB 1TPLA 3C1CD 3HL2A 3KKIA 1EQZD 1QZ9A 3WKRA 1F66D 3NUBA 3F9TA 3RELD 3AZFD 3WZFA 5B32B 2FJ7A 3W97B 1SF2A 2RVQD 3C1CA 2HP2A 5AY8A 2IO5C 4IY7A 2W7LA 5B2JB 2HUEB 1AJSB 5AY8D 3DR4A 4R5ZA 5FT6A 4WXBA 2XBNA 2W7IA 1AJRA 3AZNA 2KFPA 1ID3C 1IX6A 3VAXA 1ZLAA 4YM6A 3REHA 3AZGC 1AX4A 3LVLB 2W7EA 4A0RA 2HUFA 2EH6A 3W1JA 3NQUA 2HOYA 2NQBD 4RKDA 3UTBA 1PMOA 4J5UA 1GC3A 3GSBA 2YFWB 3EG5B 3I4JA 4WYFA 3MAFB 4ZUXB 5M49A 3AV1B 5CPJD 1M18D 5F8VA 4WB0A 1HQ3B 4RAEA 5CPKA 3USFA 3NU8A 4IYOA 3AFAA 5BNVA 1W2EA 5DNNB 4WXFA 1SVVA 2BHXA 4YS3B 1LW4A 5GT3B 5AV6D 3V9RB 3PD6A 1M1AD 3FDDA 1I48A 4XZQC 4WD2A 3REJD 3FSLA 2C44A 5G09A 3JWBA 4A0GA 4W91A 3O62B 2G6WA 4M6BA 3VH6T 3GBXA 1KX4A 5DNMD 3AZLA 1M18A 3N4SA 1QITA 4AO4A 3MGQA 3PPLA 3FZ8A 4UHNA 3RCHA 1IJIA 2Y2HA 3W99C 4Y0IA 5EUDA 1IUGA 3E2FA 1P3WA 2CH2A 4YM6C 3IP4C 1O61A 1Y4IA 3N75A 4NFTA 4ZDPA 1TARA 1IBJA 5B31C 2GQNA 5B40B 5B33C 1G4VA 1YJZA 3NYTA 4K05A 4E1OA 4JJND 4EO5C 4CXQA 5B0YB 3KXBC 2AATA 4DRAA 5EUNA 5CP6A 4XJOA 3W97C 3AZJD 1EQZA 3G8MA 5FT4A 4QLCA 7AATA 5B2ID 1DGDA 1KX3B 4H9RA 2ZY4A 2BIAA 3NQJB 1V2EA 2UWXA 4OMAA 5EAAA 1S32D 1AHGA 3AZIB 2Y2NA 2ORDA 3MGPC 2FJ7B 4LNMA 3REJA 3MGSD 5GT0C 2HIOD 5B2JC 2E54A 1X28A 4CAYB 1PFFA 3PGYA 2YFVB 4Z5TC 3L44A 4LD9B 5E5AD 5F99C 1N8PA 3KGXA 1ARIA 2FNIA 3AZEB 3C1CC 4UUZB 1BJWA 3VK3A 4YM6B 3WAAB 1AOID 1ELUA 1O62A 3AEOA 3BN1A 1T3IA 4OYTA 1G7XA 1WYTB 1KX3C 2VLFA 4WU8D 3W99A 1BFMA 2D63A 3LZ1B 3RELC 3MGSC 5EAVA 4NOGA 3KUYC 2YFWA 3LZ1D 4BA5A 1S0AA 1P3FD 3KWQB 3PDXA 2D7YA 3VH5A 1LKCA 1YAAA 4WB0B 1KKPA 4JF1A 4U1TA 2EYQA 4M2JA 1S09A 3WAAC 3X1TA 1BS0A 5DNND 1P34A 3AZHA 1F1EA 1OHWA 1ARHA 1S32C 3LELA 3AV1D 4MSOA 1AIAA 2VIBA 2HIOB 1JFIB 3AZFC 3RBFA 2Y2JA 2FJ7D 3FQ7A 1N31A 4ZUXC 2VGWA 1DKAA 2AY3A 2GMUA 4Z5TD 4ZDOA 3BB8A 2AEVA 4LW2A 3K40A 2F8ND 3P6KA 5AV5A 2W7FA 3X1VA 4WYAA 3AENB 2ZC0A 3MVDA 3DXWA 4LNLA 3DYDA 1DTYA 3W96D 1JS6A 1AOIA 4H9NA 3WTPE 4I8AA 4W1VA 1D7UA 3RBLA 5B40A 3AV7A 5B31B 4OCAA 4EU1A 3MGPB 2CTZA 1M1AA 3FVSA 1S07A 3HT4A 1EQZB 4Z66A 1M19B 5CPKC 3WA9B 3WAAD 5JRGB 1KX3A 3UTBC 3VH5T 2VMXA 2AROA 2PYOB 5CP6C 2VGSA 1GD9A 3BS8A 2F8NA 2CINA 5M4BA 1P3BC 3REJB 5GXQC 2CFBA 2BI2A 3X1SA 1I43A 4CAYA 2DGLA 5B24A 3LWSA 2W7DA 3FQ8A 5AV6B 3H7FA 5AVBD 1WWSA 3X1SD 1U08A 4TMRA 1BQDA 1P3LC 2O1BA 3MNNB 3W96B 3UTAC 4J8UA 4O6ZA 4XJLA 1DJEA 2D7ZA 1FG3A 4F5LA 2TPLA 4WLHA 2DOUA 3W1HA 3FTBA 4Q76A 1DJUA 5B40D 1LK9A 5B0ZB 2NZDC 3VOMA 2E7UA 2EZ1A 2D61A 2G5HC 3W97A 1M0OA 1P3LB 4B9BA 3FDBA 2PB0A 4DBCA 3MGRD 5AV6C 3AZKC 2DKBA 1Z2CB 5DNMB 3KGWA 2D66A 1TAFA 4X23A 1M6SA 4F5GA 3FD0A 3MC6C 1ASDA 2NQBA 2R5EA 3MGRA 3M5UA 3OP7A 1VP4A 1CJ0A 4JEXA 2EO5A 3HLMA 2NZDD 1P3BA 1B9IA 3IHJA 4AOAA 1MDOA 2HOXA 3HMUA 2VMOA 3EZ1A 3REKA 5CPID 1ZLAC 2VIAA 1X29A 3G7QA 5B1LA 4IX8A 4ZUXA 1P3KA 1ASGA 2AY5A 3AYWA 5B2IA 2Q7WA 1C9CA 5CPKB 5IWQA 4XJPA 2JG2A 4UQVA 4ZASA 4GEBA 5E5AB 4WYGA 4Y0DA 3R45A 1M4NA 1MLZA 4ZM3A 3AZMA 2YHKA 5F99A 5DNMC 1P3MC 2CV5B 4F5KA 2JE5A 5JRGA 4M2MA 4GE7A 4XK1A 3FKDA 3WCOA 2PYOA 3HQTA 3O62A 3X1TD 2F8NB 3ZZKA 4KHAA 1TOJA 2Y2OA 3B8XA 5M46A 2VMUA 4RJYA 5B0YD 3N7NA 4AZKA 2FQ6A 5B24B 4IXZA 3B6FD 1HTAA 2EPJA 4RM1A 3TATA 3C1CB 1EJIA 1O4SA 3EPLA 3B6FA 4XAUA 5M4DA 3FFHA 4EB7A 1B6WA 4J8XC 1P34C 4WU9A 2R5CA 3ZZJA 2AY7A 1AHFA 5CP6D 1C0NA 1IAYA 3AZNB 4BA4A 4QLCB 3KWQD 3LJAD 5B0ZA 5BT1D 3EI9A 3EI6A 5DJ1A 1U35B 5B1LC 1I29A 3PDBA 3RELB 2OGEA 3WKJC 5AVBC 3QBOA 4OBUA 1Q9CA 5DNMA 3RQ1A 4J8VD 2YRRA 1KKJA 3X1TC 2YFVA 3AV1A 4KGCC 4X23B 5B1MA 3AZED 3TU4D 4EB5A 3AN2D 5BNVB 2QB3A 4LD9C 4ZDLA 4KUDB 2W7MA 3W98B 4KGCB 3E9KA 3ELPA 4K2BA 1P3FA 4J8LA 4U2HA 3W99B 2Y2GA 4AWLC 4E45A 3AZIC 5GSUC 2OATA 2AY4A 3CBFA 5B1LB 5AVBA 3ASAA 4UHMA 1MLYA 4B98A 3BC8A 1ZC9A 4J8XA 1M0QA 1YIYA 1TZYA 3X1UD 3B6GA 3R45B 3GZDA 5B33A 1KL2A 5JA4B 5E5AC 3AZMB 1WKHA 2XH1A 5JAYA 1V2FA 3LZ0D 2BI1A 4L0OA 3UT9D 3ZRQA 2FFFB 2HIOA 1JFIA 1EG5A 5TF5A 1ID3D 1P3AC 4JEVA 1XI9A 3E2ZA 3ISLA 2Z1ZA 2HOZA 1W7NA 2DR1A 5AV8A 1KX5C 4ZSWA 3AOVA 2Y2QA 3UE8A 3AV2C 1RV4A 1QIRA 2BWOA 4HF8A 3X1VB 3KXBA 4LD9D 3W98C 1P3GB 3AZJA 2VMRA 4JJNA 3AZGB 3AZID 1AHEA 5C6UA 5K8BA 1ID3B 3JWAA 4GE4A 4F5FA 1IAXA 3TFUA 2G5IC 2HZPA 4H9QA 4F4EA 4H9OA 2HUEC 4XJMA 5GT0A 3REIC 4WP0A 1E5EA 8AATA 4DQ6A 2BYMA 4DQYB 1B4XA 2Z61A 1LC8A 1ASAA 1GC2A 5G49A 3LZ1C 3LV2A 4W1WA 1WYTA 4A6TA 1M18C 3LZ1A 2BIEA 1P3LD 1N2TA 4HGAB 5JRGC 1E5FA 3LY1A 3UTAA 5D5SA 5B1MB 1I41A 5AV9D 1P3GD 2OKJA 5HXXA 4A0FA 4EO5B 5B31G 5B32G 5AY8B 3B6GD 3AZHB 3W96A 4J8UB 5B2JA 1ZODA 1P3PD 3W97D 3WCNA 4JEZA 5FT5A 3C1BC 3UTBD 1KL1A 5AV5C 4W8IA 3REHB 1V72A 4A0HA 1C7NA 2X8UA 1B9HA 1P34D 3A6NC 4XUJC 2W8SA 1OHVA 1D7SA 1HQ3D 1P3LA 2VMZA 3DZZA 4QLCD 4XEWA 1OHYA 5GT0D 1T3UA 1M0NA 5BJ4A 2D64A 2Y2MA 1TAFB 5AY8C 5CPJC 1AHXA 1HQ3A 2QA3A 2NQBB 1SZSA 2BYJA 1WSTA 1ULYA 4H63Q 1DJ9A 4IYOB 3AFAB 5B32C 4WYEA 3RI6A 4E3QA 3E2ZB 4YS3A 3E6GA 1AOIC 1LC5A 1WWIA 1SZKA 2VI8A 3FFRA 1AICA 3HDOA 1P3BD 3O62C 1VJOA 2VMVA 2E7JA 1M19A 3R4TA 3AZMD 3K28A 1RV3A 5B2JD 1AMAA 2AROB 1P3KB 2JJFA 4GDYA 4AO9A 3AYWB 2HUUA 2W8WA 4R8PC 4F5HA 3T32A 3AZGA 1QISA 2JJHA 4Z66D 4RKCA 5B32D 1F66B 1CS1A 4N0WA 3BWNA 4ADCA 1GEWA 4H9OB 1H3OB 4DRBA 3PA9A 2VLHA 1WYVB 2RVQC 4ZBJB 1MDXA 5F99B 5AVCC 1XEYA 2W7JA 3H0MC 3AV2D 2CV5A 5F9SA 2VGZA 4XUJA 3B46A 2BI5A 3Q8NA 3W98D 4WXGA 5G49B 4H9SA 4Z2MH 1P3IA 1M7YA 2R2NA 3ZRPA 3MKJA 2YKVA 2PYOD 3CQ4A 1C7OA 4KXKA 3C1BB 2L5AA 2CJDA 2O7CA 2W8VA 3MBBA 3UTAB 4JEWA 3H0LC 1N1JB 5C3IC 5KDMB 1P3PB 3TQXA 4H9PB 4ZWMA 2HIOC 3LZ0B 5J8QA 4GE9A 3AZHD 3NDNA 4LD9A 1W3UA 1C4KA 3B0DC 2OGAA 3B0BA 3AZLD 3MGRB 4E44A 1BH9B 4R8PA 4QGRA 3UAKA 4OT8A 5D95A 1VEFA 3LVKA 3WKJB 3REHC 4OBVA 1YJSA 5B0ZD 3PDBB 5AV9C 1X0MA 5DJ9A 2VGUA 4J8WD 1YNUA 3X1UC 5B24D 4G91B 3AZFA 1S32B 3QPGA 4XZQB 4KUDD 3VK4A 4R2NA 4K2MA 1WKGA 2EGYA 3AN2B 1RVUA 3TU4B 3DXVA 3MNND 3WGBA 4ZWVA 3X1SC 3X1TB 2CWEA 1P34B 3AFAC 4J8VB 1GEYA 5AVCA 4KGCA 3TCMA 3WTPB 4WV4B 1HQ3C 1J32A 2NZDB 2DKJA 3X1VC 2BKWA 2BWPA 3LJAC 3KUYD 1ASMA 3PAAA 5GXQB 1UU1A 1W7LA 4A72A 2WK8A 1P3FC 3REKC 3CQ6A 2VGVA 2Z1YA 2V0YA 5BO0B 3B0CW 4BQ0A 2Z9UA 4H9SC 1QJ3A 3WA9D 5B1MD 1F66A 3DRDA 3MVDB 2Y2LA 1D7RA 4WU9C 1SFFA 1B8GA 4JEYA 3MGPD 4G92C 3CAIA 1CL2A 3O62D 4OC9A 1P3AB 4WYDA 3A6ND 5B31D 3UT9B 3BCBA 2D5YA 3A9YA 3EI5A 3GWPA 3B6FB 2FJ7C 3KWQC 5B31A 2JCHA 4G91C 4X23C 1BKGA 2R5CB 3F6TA 1M1AB 5C3IB 1AKBA 2VMTA 2BI3A 2ZY3A 3NYUA 2W7GA 2C7TA 3C1BA 3I5TA 1CQ6A 4WJ3C 2DF4C 1P3GA 2VMPA 1YOOA 3AZJB 1N1JA 2BI9A 1U35A 4JF0A 1SZUA 3LZ0A 1ASBA 4J8WB 3VH6W 3AZMC 3B0CT 3LZ0C 5EQCA 3LVMA 4JJNC 2RFVA 4ZLVA 1DFOA 2QSRA 4ZBJC 5BJ3A 3MVDD 5CPKD 4ZAHA 2BYMB 3MNNA 2VI9A 1YIZA 5B2IC 3W98A 2Y2KA 3P1TA 1P3FB 1P3GC 5G0AA 1EQBA 3NQUB 3A6NA 1WYUA 1U35C 5GXQD 5GSUA 2BYKA 3KUYB 1BJOA 1AAWA 3AZFB 3MAFA 4ATQA 2F8JA 2VYCA 2AY1A 3W1IA 4J8XB 4WLJA 1B5PA 3UT9C 3C1BD 4YS3D 4MQPA 1SPAA 3W96C 5GT3A 3V9RA 4J8VA 3A9XA 4RIZA 2AEUA 1ASNA 2BIGA 1ZOBA 4Z5TB 1AY5A 5G4IA 2W7KA 3EPJA 2XD1A 3NTJA 3QI6A 3ECDA 1JF9A 1C7GA 3KXBD 4WBTA 4A6UA 3MGQD 1PZRA 3AZJC 1OXPA 4RITA 1UU2A 5HDMA 3R9AA 2AY9A 2YKXA 2X5FA 1TASA 4J8XD 2G7JA 1QJ5A 5GT3C 2WB6A 5EIGB 1P3KD 4JJNB 2WK9A 2CV5C 3AZKA 3G0TA 2FNUA 3BCAA 3GZDC 3TU4C 2VMYA 3AEJA 1U35D 3AEMA 1TZYC 5B33D 1D7VA 4WU8B 2W7HA 3FZ7A 4K2IA 4AZJA 3EZSA 2F8NG 3RUYA 4CXRA 3KFUG 1CZCA 3TFTA 1ARGA 1B67A 4H9RB 2JGTA 4ADDA 3B1CA 3FVUA 5JRGD 3BCXA 4KHAB 3DU4A 5AV9A 1AIBA 4F5IA 4J8WA 2YKYA 2F8NH 1A7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J04 A;  2AY8 A;  5EUE A;  2D64 A;  2W8U A;  2ZSM A;  4WYC A;  3LWS A;  3MAD A;  5EIG A;  2W7D A;  1WYV A;  1AHX A;  2QA3 A;  1GBN A;  1Z7D A;  1SZS A;  2BYJ A;  3FQ8 A;  4LW4 A;  1LW5 A;  1WST A;  2C0R A;  3H7F A;  1DJ9 A;  3QM2 A;  4IYO B;  3LG0 A;  1CL1 A;  1BJ4 A;  4PVF A;  1S06 A;  4WYE A;  1H1C A;  1U08 A;  3EIB A;  4TMR A;  3RI6 A;  1ASF A;  1BQD A;  2O1B A;  2W8J A;  3BWN C;  4E3Q A;  2VGT A;  3E2Z B;  4F5M A;  1QGN A;  2VMW A;  3E6G A;  2VMN A;  1LC5 A;  1TOE A;  3WKS A;  2YCT A;  1SZK A;  3PD6 B;  4O6Z A;  4XJL A;  5DB5 A;  2VI8 A;  1YJY A;  1DJE A;  1ELQ A;  3KE3 A;  2D7Z A;  4IXS A;  3WX9 A;  1AY4 A;  1FG3 A;  3FFR A;  3NU7 A;  4F5L A;  1AIC A;  2TPL A;  4WLH A;  5I92 A;  1AMR A;  2DOU A;  1BT4 A;  1W23 A;  3D6K A;  3FTB A;  3HDO A;  1VJO A;  4XQ2 A;  1CQ8 A;  2VMV A;  2E7J A;  4Q76 A;  5E5I A;  1DJU A;  1LK9 A;  2ZUK A;  1GC0 A;  1S08 A;  3AEL A;  3R4T A;  1ASL A;  3K28 A;  2GSA A;  1RV3 A;  1V2D A;  3II0 A;  1AMA A;  3A9Z A;  3VOM A;  2JJF A;  1PG8 A;  3QHX A;  4GDY A;  4AO9 A;  4AH3 A;  2E7U A;  1UKJ A;  2C81 A;  2HUU A;  3EUC A;  2W8W A;  2EZ1 A;  4E3R A;  2D61 A;  4F5H A;  3T32 A;  1G4X A;  1QIS A;  2JJH A;  4RKC A;  1M0O A;  2YRI A;  4A6R A;  3B1D A;  4B9B A;  4UOY A;  1OAT A;  3FDB A;  2CB1 A;  2PB0 A;  1AAM A;  4DBC A;  1CS1 A;  4BHD A;  2DKB A;  1TAT A;  4N0W A;  3EI7 A;  3MC6 A;  3BWN A;  4ADC A;  1AJS A;  3KGW A;  4CBR A;  1IX8 A;  2D66 A;  3BWO A;  3GJU A;  4ADE A;  1ASC A;  1GEW A;  3FQA A;  3GR9 A;  3ATH A;  1M6S A;  2Z20 A;  4FFC A;  4MQR A;  3PA9 A;  4F5G A;  2VLH A;  3MC6 C;  4W5K A;  1WYV B;  1ASD A;  1MDX A;  2R5E A;  3M5U A;  1D2F A;  3OP7 A;  4LC3 A;  2VMS A;  2W7J A;  3A8U X;  1VP4 A;  2OQX A;  2VMQ A;  4R5F A;  1CJ0 A;  2VGZ A;  4JEX A;  5F9S A;  2EO5 A;  2Z9X A;  3B46 A;  2BI5 A;  3Q8N A;  4IW7 A;  1M0P A;  4ISY A;  3AEM C;  3HLM A;  3E2Y A;  4TN4 A;  1MAP A;  4WXG A;  4HVK A;  4MKJ A;  1B9I A;  1M7Y A;  2R2N A;  3IHJ A;  4AOA A;  1MDO A;  2HOX A;  3HMU A;  2VMO A;  1TOG A;  3JW9 A;  3ZRP A;  3EZ1 A;  3MKJ A;  4ADB A;  1BJN A;  1GC4 A;  2YKV A;  3CQ4 A;  4P7Y A;  1C7O A;  2NMP A;  2WKA A;  3LVJ A;  4KXK A;  5E4Z A;  2ZY2 A;  3MAU A;  2VIA A;  3DR7 A;  3FRK A;  2QB2 A;  1X29 A;  1TPL A;  3G7Q A;  3HL2 A;  3KKI A;  1BQA A;  2CJD A;  2O7C A;  2W8V A;  3BV0 A;  4IX8 A;  1QZ9 A;  4GRX A;  3WKR A;  2QLR A;  3MBB A;  3NYS A;  1ASG A;  2AY5 A;  3ACZ A;  2Q7W A;  3NUB A;  4JEW A;  2HOR A;  4ZSY A;  1C9C A;  3F9T A;  4ZM4 A;  4EFF A;  2GB3 A;  3WZF A;  2BYL A;  1SF2 A;  5IWQ A;  3TQX A;  4XJP A;  2HP2 A;  2JG2 A;  4UQV A;  4ZAS A;  4ZWM A;  4GEB A;  4IY7 A;  4WYG A;  4Y0D A;  4GE9 A;  5J8Q A;  5G2P A;  2CAN A;  2W7L A;  1M4N A;  1MLZ A;  3NX3 A;  4ATP A;  1AJS B;  4ZM3 A;  3NDN A;  2YHK A;  3DR4 A;  1W3U A;  4R5Z A;  5FT6 A;  3F0H A;  4WXB A;  1C4K A;  2OGA A;  2XBN A;  2W7I A;  1AJR A;  3FVX A;  4EMY A;  4ITG A;  3NUI A;  1IX6 A;  3VAX A;  4F5K A;  3DC1 A;  4M2M A;  4GE7 A;  4QGR A;  4XK1 A;  3FKD A;  3UAK A;  1AX4 A;  4KYO A;  4OT8 A;  5D95 A;  2PO3 A;  2ZJG A;  3LVL B;  3HQT A;  1VEF A;  3LVK A;  2W7E A;  2GMS A;  4A0R A;  1YJS A;  3ZZK A;  3PDB B;  1X0M A;  2X5D A;  5DJ9 A;  1TOJ A;  2VGU A;  2HUF A;  2EH6 A;  2HOY A;  4H51 A;  1YNU A;  4RKD A;  4J5U A;  3B8X A;  1GC3 A;  3GSB A;  5M46 A;  1AY8 A;  1TOK A;  3I4J A;  1W7M A;  2VMU A;  4RJY A;  3RCH B;  4WYF A;  3MAF B;  4AZK A;  2FQ6 A;  3QPG A;  5M49 A;  3VK4 A;  4R2N A;  4IXZ A;  4K2M A;  1FG7 A;  1WKG A;  4MKK A;  4WB0 A;  4RAE A;  1MGV A;  5F8V A;  3USF A;  2R0T A;  2EGY A;  3NU8 A;  2QBT A;  2EPJ A;  3TAT A;  1RVU A;  4IYO A;  3DXV A;  5G2Q A;  1ART A;  1UU0 A;  3WGB A;  4F5J A;  5FT8 A;  4ZWV A;  1EJI A;  5HHY A;  1O4S A;  1MDZ A;  5M4D A;  4XAU A;  3FFH A;  4WXF A;  1SVV A;  4EB7 A;  2BHX A;  1LW4 A;  2CY8 A;  5EFS A;  1GEY A;  3PD6 A;  3PIU A;  3AAT A;  2R5C A;  3ZZJ A;  2AY7 A;  1AHF A;  3TCM A;  4LNJ A;  3ZRR A;  3FDD A;  1J32 A;  1I48 A;  1C0N A;  1IAY A;  1ECX A;  1ASE A;  2DKJ A;  4BA4 A;  2BKW A;  3EIA A;  2BWP A;  4WD2 A;  5E3K A;  1KMJ A;  3FSL A;  1ASM A;  4UHO A;  2C44 A;  3PAA A;  2E7I A;  1GEX A;  1UU1 A;  1W7L A;  4A72 A;  2WK8 A;  2JJE A;  5G09 A;  3JWB A;  4A0G A;  4W91 A;  1AMS A;  2G6W A;  3EI9 A;  3EI6 A;  3CQ6 A;  5DJ1 A;  2VGV A;  1CQ7 A;  2Z1Y A;  3GBX A;  2V0Y A;  1I29 A;  3PDB A;  4BQ0 A;  2BWN A;  4PFF A;  2Z9U A;  1OXO A;  2OGE A;  3A2B A;  2ZP7 A;  2EZ2 A;  4AO4 A;  1QIT A;  1QJ3 A;  3QBO A;  2QMA A;  3PPL A;  4UHN A;  4Q31 A;  3RCH A;  1IJI A;  4Y0I A;  3GET A;  5EUD A;  3DRD A;  1D7R A;  3WY7 A;  3RQ1 A;  2YRR A;  1IUG A;  5G4J A;  3E2F A;  1KKJ A;  1P3W A;  2CH2 A;  1SFF A;  4P3M A;  1B8G A;  4JEY A;  3CAI A;  1CL2 A;  4MQQ A;  4OC9 A;  3DOD A;  4PIW A;  4WYD A;  3N0L A;  1O61 A;  1LS3 A;  1Y4I A;  3N75 A;  4EB5 A;  4ZDP A;  1TAR A;  1IBJ A;  3BCB A;  2D5Y A;  3CQ5 A;  3A9Y A;  3EI5 A;  2AY6 A;  3AEJ C;  4KAM A;  2GQN A;  4M2K A;  4CVQ A;  1G4V A;  1YJZ A;  2QB3 A;  2WK7 A;  3NYT A;  3JTX A;  4ZDL A;  2W7M A;  4E1O A;  4CXQ A;  5EUN A;  1BKG A;  2AAT A;  2R5C B;  3F6T A;  3E9K A;  3ELP A;  4K2B A;  4XJO A;  2ZY5 A;  1LC7 A;  1AKB A;  4U2H A;  2VMT A;  2BI3 A;  2ZY3 A;  1RVY A;  3NYU A;  2W7G A;  3G8M A;  2C7T A;  5FT4 A;  2OAT A;  7AAT A;  2AY4 A;  1DGD A;  4Q75 A;  3I5T A;  1BJO B;  4W1X A;  3CBF A;  1CQ6 A;  4Q6R A;  2ZY4 A;  3ASA A;  3ELE A;  4UHM A;  2BIA A;  1MLY A;  2VMP A;  4B98 A;  1YOO A;  4DGT A;  1V2E A;  3BC8 A;  2BI9 A;  4OMA A;  1ZC9 A;  5EAA A;  1AHG A;  2ORD A;  4JF0 A;  1M0Q A;  2Z9W A;  1YIY A;  5DX5 A;  3B1E A;  1SZU A;  2ZYJ A;  4LNM A;  3AOW A;  4CBS A;  1AHY A;  1ASB A;  3MEB A;  3GZD A;  2E54 A;  1X28 A;  1KL2 A;  3AEP A;  1PFF A;  3PGY A;  1WKH A;  2XH1 A;  5JAY A;  3L44 A;  5EQC A;  3LVM A;  1V2F A;  2RFV A;  4ZLV A;  2BI1 A;  1M32 A;  1N8P A;  1DFO A;  3KGX A;  4L0O A;  3ZRQ A;  1ARI A;  2FNI A;  5BJ3 A;  1GCK A;  1EG5 A;  4A00 A;  2O0R A;  2ZSL A;  5TF5 A;  4ZAH A;  1BJW A;  3VK3 A;  4JEV A;  1XI9 A;  3E2Z A;  1G7W A;  3ISL A;  1KMK A;  1ELU A;  2VI9 A;  1YIZ A;  2HOZ A;  1W7N A;  2DR1 A;  2Z1Z A;  1O62 A;  3AEO A;  3GZC A;  3BN1 A;  3EI8 A;  3FCR A;  3E77 A;  4ZSW A;  1T3I A;  3AOV A;  4OYT A;  3P1T A;  1G7X A;  1WYT B;  2V1P A;  2VLF A;  1DGE A;  1AMQ A;  2CH1 A;  5G0A A;  1EQB A;  1MAQ A;  1ORD A;  2D63 A;  3UE8 A;  3WLX A;  1RV4 A;  1JG8 A;  1Z3Z A;  4BMK A;  1WYU A;  5EAV A;  1QIR A;  1CZE A;  2BWO A;  4HF8 A;  4NOG A;  3OKS A;  1BJO A;  1AAW A;  4BA5 A;  1S0A A;  3MAF A;  4ATQ A;  3PDX A;  2D7Y A;  2F8J A;  2VYC A;  3NNK A;  2VMR A;  2D65 A;  2AY1 A;  1LKC A;  1TOI A;  1YAA A;  4WB0 B;  1KKP A;  4JF1 A;  4WLJ A;  1B5P A;  4U1T A;  4M2J A;  1AHE A;  1JS3 A;  1S09 A;  5C6U A;  5K8B A;  3JWA A;  1BS0 A;  4GE4 A;  4MQP A;  4F5F A;  1SPA A;  2AY2 A;  1IAX A;  3TFU A;  2HZP A;  3FQ7 A;  4OTL A;  1OHW A;  3A9X A;  2YCP A;  4F4E A;  1AKC A;  2YOB A;  3K7Y A;  4XJM A;  1ARH A;  1ASN A;  2CJG A;  2BIG A;  1ZOB A;  4ITX A;  4MSO A;  1AIA A;  1IX7 A;  1AY5 A;  5G4I A;  2VIB A;  2W7K A;  2YCN A;  4WP0 A;  3RBF A;  1E5E A;  8AAT A;  4DQ6 A;  3NTJ A;  1B4X A;  3VK2 A;  2Z61 A;  1LC8 A;  1H0C A;  3QI6 A;  3ECD A;  1N31 A;  2AY3 A;  1DKA A;  2VGW A;  1ASA A;  1JF9 A;  1C7G A;  2GMU A;  1GC2 A;  3QGU A;  4GSA A;  5AX8 A;  4ZDO A;  3LV2 A;  4WBT A;  4A6U A;  3BB8 A;  1GDE A;  4W1W A;  1IVR A;  4LW2 A;  3K40 A;  1WYT A;  4A6T A;  1OXP A;  2Z9V A;  1UU2 A;  2HP1 A;  4E77 A;  2BIE A;  5HDM A;  3P6K A;  3R9A A;  2AY9 A;  1WYU B;  2FM1 A;  2YKX A;  4MY5 A;  2W7F A;  4Y0H A;  3NRA A;  4WYA A;  3AEN B;  2X5F A;  3UWC A;  1N2T A;  2ZC0 A;  1TAS A;  3L8A A;  3DXW A;  1E5F A;  1ARS A;  3LY1 A;  4LNL A;  3DYD A;  1DTY A;  1JS6 A;  1X2A A;  1QJ5 A;  5EIG B;  5D5S A;  1I41 A;  3COG A;  4I8A A;  2WK9 A;  5HXX A;  2FNU A;  3BCA A;  3GZD C;  4W1V A;  4A0F A;  2VMY A;  3AEJ A;  3AEM A;  1D7U A;  3RBL A;  2CJH A;  1AKA A;  1D7V A;  3AV7 A;  4OCA A;  1BW0 A;  4EU1 A;  1ZOD A;  2CTZ A;  2W7H A;  2PB2 A;  3N5M A;  4K2I A;  4AZJ A;  3EZS A;  3FVS A;  4JEZ A;  4IXO A;  1S07 A;  3QN6 A;  5FT5 A;  3RUY A;  4CXR A;  1O69 A;  1CZC A;  3TFT A;  1ARG A;  1KL1 A;  4R8D A;  4W8I A;  3PJ0 A;  2JGT A;  2W8T A;  1V72 A;  2VMX A;  4ADD A;  3WGC A;  4A0H A;  1C7N A;  3B1C A;  2X8U A;  1B9H A;  2FYF A;  2YKU A;  2CST A;  2VGS A;  1GD9 A;  3FVU A;  2JJG A;  3BCX A;  3BS8 A;  1B5O A;  2CIN A;  5M4B A;  3DU4 A;  1FC4 A;  1D7S A;  1OHV A;  2FN6 A;  2VMZ A;  3DZZ A;  9AAT A;  1AIB A;  4FL0 A;  4PFN A;  3ASB A;  3AEN A;  4XEW A;  4F5I A;  2CFB A;  1OHY A;  2BI2 A;  2YKY A;  5BJ4 A;  1M0N A;  1I43 A;  2HUI A; 
#chains in the Genus database with same CATH topology
 2AY8 A;  5EUE A;  4WYC A;  3MAD A;  3HBX A;  3A1I A;  1WYV A;  1Z7D A;  1LW5 A;  3AZE A;  2Y2I A;  1P3P C;  3LG0 A;  4PVF A;  4Z2M G;  4UUZ A;  3EIB A;  1ASF A;  2W8J A;  4F5M A;  1QGN A;  2VMW A;  3LEL D;  3H0R C;  5CPJ B;  4YM6 D;  3KE3 A;  4XUJ D;  1P3I B;  4IXS A;  2ARO C;  3AV2 A;  2CV5 D;  5I92 A;  1P3O C;  1AMR A;  3D6K A;  1BT4 A;  1W23 A;  5E5I A;  1KX4 C;  1CQ8 A;  2BYK B;  2GSA A;  3AL0 C;  1V2D A;  3II0 A;  3A9Z A;  4AH3 A;  3KWQ A;  1UKJ A;  3MGS B;  3EUC A;  3REL A;  4A6R A;  3EPK A;  4UOY A;  1EQZ C;  1OAT A;  2CB1 A;  5DNN C;  1AAM A;  3AFA D;  3MC6 A;  1AJS A;  3MGR C;  3AZK D;  3BWO A;  4ADE A;  1ASC A;  3FQA A;  3GR9 A;  1KX5 D;  4J8U C;  2Z20 A;  1D2F A;  4LC3 A;  3A8U X;  4R8P B;  4KUD A;  4HVK A;  4R8P D;  3JW9 A;  1TOG A;  4ADB A;  1GC4 A;  5AV5 B;  2WKA A;  3WA9 C;  1KX5 B;  5CHL B;  1BQA A;  3LEL C;  3AZG D;  1P3M B;  3BV0 A;  4GRX A;  2QLR A;  2XD5 A;  3NYS A;  3ACZ A;  1AOI B;  2HOR A;  4ZSY A;  1R4V A;  4CSR B;  4ZM4 A;  4EFF A;  2GB3 A;  2BYL A;  1TZY B;  3B6G B;  2NQB C;  3X1V D;  4RLG A;  5BNX B;  5G2P A;  2CAN A;  5B33 B;  3NX3 A;  5AVC B;  4ATP A;  3F0H A;  3FVX A;  2ZM5 A;  4EMY A;  2NZD A;  4ITG A;  3NUI A;  3DC1 A;  5B1M C;  4XUJ B;  1P3I D;  4KYO A;  3KSY A;  2PO3 A;  5AV8 B;  2ZJG A;  4HGA C;  2GMS A;  3AYW C;  5BO0 A;  2X5D A;  5FUG B;  4H51 A;  1M18 B;  3LJA A;  3MGQ B;  1AY8 A;  5B0Y C;  3KXB B;  4XZQ D;  1TOK A;  4ZUX D;  1W7M A;  3RCH B;  1FG7 A;  1P3A A;  4MKK A;  1MGV A;  5AV6 A;  2R0T A;  5B32 A;  2QBT A;  4F5J A;  5G2Q A;  2DQN C;  4NE3 A;  1ART A;  4H9P A;  1UU0 A;  5FT8 A;  1BH8 B;  5HHY A;  1ID3 A;  1MDZ A;  5KTB A;  2CY8 A;  5EFS A;  4H9Q B;  5BS7 A;  3PIU A;  3AAT A;  5CPJ A;  4LNJ A;  3ZRR A;  3AN2 C;  1M19 D;  4J8W C;  5GT0 B;  3REI D;  1ECX A;  1P3K C;  1ASE A;  5B0Z C;  5B24 C;  3EIA A;  3X1U A;  5E3K A;  1KMJ A;  4UHO A;  2J8P A;  2E7I A;  1GEX A;  3REJ C;  2JJE A;  1AMS A;  3NQJ A;  3WKJ A;  2DGM A;  1CQ7 A;  3AZI A;  3H9X A;  1P3O A;  2BWN A;  4PFF A;  4UPK A;  1OXO A;  2OKK A;  3A2B A;  2ZP7 A;  2EZ2 A;  1ZLA D;  3UTB B;  2QMA A;  4Q31 A;  3GET A;  3WY7 A;  1S32 A;  5G4J A;  2LY8 A;  4P3M A;  4MQQ A;  3DOD A;  4PIW A;  3AYW D;  3N0L A;  1LS3 A;  2ARO D;  3CQ5 A;  3VH6 A;  2AY6 A;  3AEJ C;  4KAM A;  2F2A C;  3N4R A;  4M2K A;  4CVQ A;  2WK7 A;  3JTX A;  3REK D;  1P3B B;  2ZY5 A;  1LC7 A;  2JIS A;  1RVY A;  5F99 D;  2PYO C;  5B1L D;  2RIQ A;  5GSU B;  1KX5 A;  4Q75 A;  3WKJ D;  3HVY A;  5GSU D;  5GXQ A;  1BJO B;  4W1X A;  4Q6R A;  1P3M A;  3ELE A;  1KX3 D;  5B2I B;  4DGT A;  2JSS A;  4KGC D;  4WU8 C;  2Z9W A;  5B40 C;  3B1E A;  5DX5 A;  3AZL B;  2ZYJ A;  3AZE C;  3AOW A;  4CBS A;  1AHY A;  5E5A A;  3MEB A;  5BNX A;  3AEP A;  3B6F C;  4X23 D;  3N4X A;  1M32 A;  5AV8 D;  1GCK A;  5BS7 C;  1P3A D;  4A00 A;  2O0R A;  2ZSL A;  1G7W A;  3UTA D;  1KMK A;  3GZC A;  3EI8 A;  3FCR A;  3E77 A;  2V1P A;  1DGE A;  1AMQ A;  2CH1 A;  1MAQ A;  1ORD A;  3WLX A;  4J8U D;  5FUG A;  1JG8 A;  1Z3Z A;  4BMK A;  3JZL A;  1CZE A;  3LJA B;  2A1V A;  4QLC C;  3OKS A;  1TZY D;  3REI B;  5BT1 C;  4KUD C;  4H9N B;  3NNK A;  2D65 A;  1TOI A;  4YS3 C;  1P3I C;  1JS3 A;  1BH8 A;  4WNN B;  2AY2 A;  4OTL A;  4WU9 B;  2YCP A;  2BG1 A;  3MGP A;  1AKC A;  2YOB A;  3K7Y A;  1H3O A;  2CJG A;  4ITX A;  1IX7 A;  2FKI A;  4Z66 B;  2YCN A;  3X1U B;  3WAA A;  3VK2 A;  1H0C A;  4GSA A;  3QGU A;  5AX8 A;  1GDE A;  1IVR A;  2Z9V A;  1P3O B;  5CPI C;  2HP1 A;  4E77 A;  3A6N B;  5AV9 B;  1WYU B;  2FM1 A;  4MY5 A;  2Y2P A;  4Y0H A;  3NRA A;  3KUY A;  3UWC A;  3WTP C;  5CPI A;  1KU5 A;  3L8A A;  1ARS A;  4J8V C;  1X2A A;  1M19 C;  4NE5 A;  3COG A;  1P3O D;  5KDM A;  1P3P A;  3B0D B;  1PMM A;  2CJH A;  3AZH C;  1AKA A;  1BW0 A;  2PB2 A;  3N5M A;  3LEL B;  4Z5T A;  3MGQ C;  4IXO A;  3QN6 A;  1P3M D;  1O69 A;  3WTP D;  1ZLA B;  4R8D A;  1BH9 A;  3PJ0 A;  5AVB B;  5AV5 D;  2W8T A;  3WGC A;  5GT3 D;  4AWL B;  3REH D;  2FYF A;  2YKU A;  2CST A;  3MGS A;  3EPH A;  2JJG A;  1M1A C;  1B5O A;  1FC4 A;  2FN6 A;  9AAT A;  4FL0 A;  4PFN A;  3ASB A;  3AEN A;  3A1K A;  2HUI A;  3FZ6 A;  1J04 A;  5JA4 A;  4XZQ A;  2W8U A;  2ZSM A;  5EIG A;  4G92 B;  1GBN A;  4LW4 A;  3AZK B;  3AN2 A;  2C0R A;  2F8N K;  3QM2 A;  3TU4 A;  1CL1 A;  1BJ4 A;  1S06 A;  3MVD C;  1H1C A;  5DNN A;  3BWN C;  2VGT A;  2VMN A;  1TOE A;  3WKS A;  2YCT A;  3P5J B;  3PD6 B;  3W99 D;  4WU8 A;  5DB5 A;  1YJY A;  1ELQ A;  1F66 C;  3WX9 A;  1AY4 A;  3WTP A;  3NU7 A;  3AV1 C;  1KX4 D;  3REK B;  4XQ2 A;  3WA9 A;  2ZUK A;  1GC0 A;  1S08 A;  3AEL A;  1ASL A;  3REI A;  3AZN C;  4RJ0 A;  3QHX A;  1PG8 A;  2C81 A;  4CSR A;  4Z66 C;  4E3R A;  1G4X A;  1KX4 B;  3VH5 W;  2YRI A;  3MNN C;  5AV8 C;  3B1D A;  4WNN A;  3X1S B;  4BHD A;  1TAT A;  3EI7 A;  4WU9 D;  2VQR A;  4CBR A;  1IX8 A;  3GJU A;  3ATH A;  4FFC A;  4MQR A;  5AVC D;  4W5K A;  3I16 A;  3UT9 A;  2VMS A;  2OQX A;  2VMQ A;  4R5F A;  2X3L A;  2Z9X A;  2IO5 B;  4IW7 A;  1M0P A;  3B6G C;  3AEM C;  4ISY A;  3AZN D;  3E2Y A;  4TN4 A;  1MAP A;  5B0Y A;  4MKJ A;  3VP6 A;  5CP6 B;  3AZL C;  4NE6 A;  3AV2 B;  1BJN A;  2DGK A;  4P7Y A;  2NMP A;  3LVJ A;  5E4Z A;  2ZY2 A;  3MAU A;  4WZS B;  3DR7 A;  3FRK A;  2QB2 A;  5CPI B;  1TPL A;  3C1C D;  3HL2 A;  3KKI A;  1EQZ D;  1QZ9 A;  3WKR A;  1F66 D;  3NUB A;  3F9T A;  3REL D;  3AZF D;  3WZF A;  5B32 B;  2FJ7 A;  3W97 B;  1SF2 A;  2RVQ D;  3C1C A;  2HP2 A;  5AY8 A;  2IO5 C;  4IY7 A;  2W7L A;  5B2J B;  2HUE B;  1AJS B;  5AY8 D;  3DR4 A;  4R5Z A;  5FT6 A;  4WXB A;  2XBN A;  2W7I A;  1AJR A;  3AZN A;  2KFP A;  1ID3 C;  1IX6 A;  3VAX A;  1ZLA A;  4YM6 A;  3REH A;  3AZG C;  1AX4 A;  3LVL B;  2W7E A;  4A0R A;  2HUF A;  2EH6 A;  3W1J A;  3NQU A;  2HOY A;  2NQB D;  4RKD A;  3UTB A;  1PMO A;  4J5U A;  1GC3 A;  3GSB A;  2YFW B;  3EG5 B;  3I4J A;  4WYF A;  3MAF B;  4ZUX B;  5M49 A;  3AV1 B;  5CPJ D;  1M18 D;  5F8V A;  4WB0 A;  1HQ3 B;  4RAE A;  5CPK A;  3USF A;  3NU8 A;  4IYO A;  3AFA A;  5BNV A;  1W2E A;  5DNN B;  4WXF A;  1SVV A;  2BHX A;  4YS3 B;  1LW4 A;  5GT3 B;  5AV6 D;  3V9R B;  3PD6 A;  1M1A D;  3FDD A;  1I48 A;  4XZQ C;  4WD2 A;  3REJ D;  3FSL A;  2C44 A;  5G09 A;  3JWB A;  4A0G A;  4W91 A;  3O62 B;  2G6W A;  4M6B A;  3VH6 T;  3GBX A;  1KX4 A;  5DNM D;  3AZL A;  1M18 A;  3N4S A;  1QIT A;  4AO4 A;  3MGQ A;  3PPL A;  3FZ8 A;  4UHN A;  3RCH A;  1IJI A;  2Y2H A;  3W99 C;  4Y0I A;  5EUD A;  1IUG A;  3E2F A;  1P3W A;  2CH2 A;  4YM6 C;  3IP4 C;  1O61 A;  1Y4I A;  3N75 A;  4NFT A;  4ZDP A;  1TAR A;  1IBJ A;  5B31 C;  2GQN A;  5B40 B;  5B33 C;  1G4V A;  1YJZ A;  3NYT A;  4K05 A;  4E1O A;  4JJN D;  4EO5 C;  4CXQ A;  5B0Y B;  3KXB C;  2AAT A;  4DRA A;  5EUN A;  5CP6 A;  4XJO A;  3W97 C;  3AZJ D;  1EQZ A;  3G8M A;  5FT4 A;  4QLC A;  7AAT A;  5B2I D;  1DGD A;  1KX3 B;  4H9R A;  2ZY4 A;  2BIA A;  3NQJ B;  1V2E A;  2UWX A;  4OMA A;  5EAA A;  1S32 D;  1AHG A;  3AZI B;  2Y2N A;  2ORD A;  3MGP C;  2FJ7 B;  4LNM A;  3REJ A;  3MGS D;  5GT0 C;  2HIO D;  5B2J C;  2E54 A;  1X28 A;  4CAY B;  1PFF A;  3PGY A;  2YFV B;  4Z5T C;  3L44 A;  4LD9 B;  5E5A D;  5F99 C;  1N8P A;  3KGX A;  1ARI A;  2FNI A;  3AZE B;  3C1C C;  4UUZ B;  1BJW A;  3VK3 A;  4YM6 B;  3WAA B;  1AOI D;  1ELU A;  1O62 A;  3AEO A;  3BN1 A;  1T3I A;  4OYT A;  1G7X A;  1WYT B;  1KX3 C;  2VLF A;  4WU8 D;  3W99 A;  1BFM A;  2D63 A;  3LZ1 B;  3REL C;  3MGS C;  5EAV A;  4NOG A;  3KUY C;  2YFW A;  3LZ1 D;  4BA5 A;  1S0A A;  1P3F D;  3KWQ B;  3PDX A;  2D7Y A;  3VH5 A;  1LKC A;  1YAA A;  4WB0 B;  1KKP A;  4JF1 A;  4U1T A;  2EYQ A;  4M2J A;  1S09 A;  3WAA C;  3X1T A;  1BS0 A;  5DNN D;  1P34 A;  3AZH A;  1F1E A;  1OHW A;  1ARH A;  1S32 C;  3LEL A;  3AV1 D;  4MSO A;  1AIA A;  2VIB A;  2HIO B;  1JFI B;  3AZF C;  3RBF A;  2Y2J A;  2FJ7 D;  3FQ7 A;  1N31 A;  4ZUX C;  2VGW A;  1DKA A;  2AY3 A;  2GMU A;  4Z5T D;  4ZDO A;  3BB8 A;  2AEV A;  4LW2 A;  3K40 A;  2F8N D;  3P6K A;  5AV5 A;  2W7F A;  3X1V A;  4WYA A;  3AEN B;  2ZC0 A;  3MVD A;  3DXW A;  4LNL A;  3DYD A;  1DTY A;  3W96 D;  1JS6 A;  1AOI A;  4H9N A;  3WTP E;  4I8A A;  4W1V A;  1D7U A;  3RBL A;  5B40 A;  3AV7 A;  5B31 B;  4OCA A;  4EU1 A;  3MGP B;  2CTZ A;  1M1A A;  3FVS A;  1S07 A;  3HT4 A;  1EQZ B;  4Z66 A;  1M19 B;  5CPK C;  3WA9 B;  3WAA D;  5JRG B;  1KX3 A;  3UTB C;  3VH5 T;  2VMX A;  2ARO A;  2PYO B;  5CP6 C;  2VGS A;  1GD9 A;  3BS8 A;  2F8N A;  2CIN A;  5M4B A;  1P3B C;  3REJ B;  5GXQ C;  2CFB A;  2BI2 A;  3X1S A;  1I43 A;  4CAY A;  2DGL A;  5B24 A;  3LWS A;  2W7D A;  3FQ8 A;  5AV6 B;  3H7F A;  5AVB D;  1WWS A;  3X1S D;  1U08 A;  4TMR A;  1BQD A;  1P3L C;  2O1B A;  3MNN B;  3W96 B;  3UTA C;  4J8U A;  4O6Z A;  4XJL A;  1DJE A;  2D7Z A;  1FG3 A;  4F5L A;  2TPL A;  4WLH A;  2DOU A;  3W1H A;  3FTB A;  4Q76 A;  1DJU A;  5B40 D;  1LK9 A;  5B0Z B;  2NZD C;  3VOM A;  2E7U A;  2EZ1 A;  2D61 A;  2G5H C;  3W97 A;  1M0O A;  1P3L B;  4B9B A;  3FDB A;  2PB0 A;  4DBC A;  3MGR D;  5AV6 C;  3AZK C;  2DKB A;  1Z2C B;  5DNM B;  3KGW A;  2D66 A;  1TAF A;  4X23 A;  1M6S A;  4F5G A;  3FD0 A;  3MC6 C;  1ASD A;  2NQB A;  2R5E A;  3MGR A;  3M5U A;  3OP7 A;  1VP4 A;  1CJ0 A;  4JEX A;  2EO5 A;  3HLM A;  2NZD D;  1P3B A;  1B9I A;  3IHJ A;  4AOA A;  1MDO A;  2HOX A;  3HMU A;  2VMO A;  3EZ1 A;  3REK A;  5CPI D;  1ZLA C;  2VIA A;  1X29 A;  3G7Q A;  5B1L A;  4IX8 A;  4ZUX A;  1P3K A;  1ASG A;  2AY5 A;  3AYW A;  5B2I A;  2Q7W A;  1C9C A;  5CPK B;  5IWQ A;  4XJP A;  2JG2 A;  4UQV A;  4ZAS A;  4GEB A;  5E5A B;  4WYG A;  4Y0D A;  3R45 A;  1M4N A;  1MLZ A;  4ZM3 A;  3AZM A;  2YHK A;  5F99 A;  5DNM C;  1P3M C;  2CV5 B;  4F5K A;  2JE5 A;  5JRG A;  4M2M A;  4GE7 A;  4XK1 A;  3FKD A;  3WCO A;  2PYO A;  3HQT A;  3O62 A;  3X1T D;  2F8N B;  3ZZK A;  4KHA A;  1TOJ A;  2Y2O A;  3B8X A;  5M46 A;  2VMU A;  4RJY A;  5B0Y D;  3N7N A;  4AZK A;  2FQ6 A;  5B24 B;  4IXZ A;  3B6F D;  1HTA A;  2EPJ A;  4RM1 A;  3TAT A;  3C1C B;  1EJI A;  1O4S A;  3EPL A;  3B6F A;  4XAU A;  5M4D A;  3FFH A;  4EB7 A;  1B6W A;  4J8X C;  1P34 C;  4WU9 A;  2R5C A;  3ZZJ A;  2AY7 A;  1AHF A;  5CP6 D;  1C0N A;  1IAY A;  3AZN B;  4BA4 A;  4QLC B;  3KWQ D;  3LJA D;  5B0Z A;  5BT1 D;  3EI9 A;  3EI6 A;  5DJ1 A;  1U35 B;  5B1L C;  1I29 A;  3PDB A;  3REL B;  2OGE A;  3WKJ C;  5AVB C;  3QBO A;  4OBU A;  1Q9C A;  5DNM A;  3RQ1 A;  4J8V D;  2YRR A;  1KKJ A;  3X1T C;  2YFV A;  3AV1 A;  4KGC C;  4X23 B;  5B1M A;  3AZE D;  3TU4 D;  4EB5 A;  3AN2 D;  5BNV B;  2QB3 A;  4LD9 C;  4ZDL A;  4KUD B;  2W7M A;  3W98 B;  4KGC B;  3E9K A;  3ELP A;  4K2B A;  1P3F A;  4J8L A;  4U2H A;  3W99 B;  2Y2G A;  4AWL C;  4E45 A;  3AZI C;  5GSU C;  2OAT A;  2AY4 A;  3CBF A;  5B1L B;  5AVB A;  3ASA A;  4UHM A;  1MLY A;  4B98 A;  3BC8 A;  1ZC9 A;  4J8X A;  1M0Q A;  1YIY A;  1TZY A;  3X1U D;  3B6G A;  3R45 B;  3GZD A;  5B33 A;  1KL2 A;  5JA4 B;  5E5A C;  3AZM B;  1WKH A;  2XH1 A;  5JAY A;  1V2F A;  3LZ0 D;  2BI1 A;  4L0O A;  3UT9 D;  3ZRQ A;  2FFF B;  2HIO A;  1JFI A;  1EG5 A;  5TF5 A;  1ID3 D;  1P3A C;  4JEV A;  1XI9 A;  3E2Z A;  3ISL A;  2Z1Z A;  2HOZ A;  1W7N A;  2DR1 A;  5AV8 A;  1KX5 C;  4ZSW A;  3AOV A;  2Y2Q A;  3UE8 A;  3AV2 C;  1RV4 A;  1QIR A;  2BWO A;  4HF8 A;  3X1V B;  3KXB A;  4LD9 D;  3W98 C;  1P3G B;  3AZJ A;  2VMR A;  4JJN A;  3AZG B;  3AZI D;  1AHE A;  5C6U A;  5K8B A;  1ID3 B;  3JWA A;  4GE4 A;  4F5F A;  1IAX A;  3TFU A;  2G5I C;  2HZP A;  4H9Q A;  4F4E A;  4H9O A;  2HUE C;  4XJM A;  5GT0 A;  3REI C;  4WP0 A;  1E5E A;  8AAT A;  4DQ6 A;  2BYM A;  4DQY B;  1B4X A;  2Z61 A;  1LC8 A;  1ASA A;  1GC2 A;  5G49 A;  3LZ1 C;  3LV2 A;  4W1W A;  1WYT A;  4A6T A;  1M18 C;  3LZ1 A;  2BIE A;  1P3L D;  1N2T A;  4HGA B;  5JRG C;  1E5F A;  3LY1 A;  3UTA A;  5D5S A;  5B1M B;  1I41 A;  5AV9 D;  1P3G D;  2OKJ A;  5HXX A;  4A0F A;  4EO5 B;  5B31 G;  5B32 G;  5AY8 B;  3B6G D;  3AZH B;  3W96 A;  4J8U B;  5B2J A;  1ZOD A;  1P3P D;  3W97 D;  3WCN A;  4JEZ A;  5FT5 A;  3C1B C;  3UTB D;  1KL1 A;  5AV5 C;  4W8I A;  3REH B;  1V72 A;  4A0H A;  1C7N A;  2X8U A;  1B9H A;  1P34 D;  3A6N C;  4XUJ C;  2W8S A;  1OHV A;  1D7S A;  1HQ3 D;  1P3L A;  2VMZ A;  3DZZ A;  4QLC D;  4XEW A;  1OHY A;  5GT0 D;  1T3U A;  1M0N A;  5BJ4 A;  2D64 A;  2Y2M A;  1TAF B;  5AY8 C;  5CPJ C;  1AHX A;  1HQ3 A;  2QA3 A;  2NQB B;  1SZS A;  2BYJ A;  1WST A;  1ULY A;  4H63 Q;  1DJ9 A;  4IYO B;  3AFA B;  5B32 C;  4WYE A;  3RI6 A;  4E3Q A;  3E2Z B;  4YS3 A;  3E6G A;  1AOI C;  1LC5 A;  1WWI A;  1SZK A;  2VI8 A;  3FFR A;  1AIC A;  3HDO A;  1P3B D;  3O62 C;  1VJO A;  2VMV A;  2E7J A;  1M19 A;  3R4T A;  3AZM D;  3K28 A;  1RV3 A;  5B2J D;  1AMA A;  2ARO B;  1P3K B;  2JJF A;  4GDY A;  4AO9 A;  3AYW B;  2HUU A;  2W8W A;  4R8P C;  4F5H A;  3T32 A;  3AZG A;  1QIS A;  2JJH A;  4Z66 D;  4RKC A;  5B32 D;  1F66 B;  1CS1 A;  4N0W A;  3BWN A;  4ADC A;  1GEW A;  4H9O B;  1H3O B;  4DRB A;  3PA9 A;  2VLH A;  1WYV B;  2RVQ C;  4ZBJ B;  1MDX A;  5F99 B;  5AVC C;  1XEY A;  2W7J A;  3H0M C;  3AV2 D;  2CV5 A;  5F9S A;  2VGZ A;  4XUJ A;  3B46 A;  2BI5 A;  3Q8N A;  3W98 D;  4WXG A;  5G49 B;  4H9S A;  4Z2M H;  1P3I A;  1M7Y A;  2R2N A;  3ZRP A;  3MKJ A;  2YKV A;  2PYO D;  3CQ4 A;  1C7O A;  4KXK A;  3C1B B;  2L5A A;  2CJD A;  2O7C A;  2W8V A;  3MBB A;  3UTA B;  4JEW A;  3H0L C;  1N1J B;  5C3I C;  5KDM B;  1P3P B;  3TQX A;  4H9P B;  4ZWM A;  2HIO C;  3LZ0 B;  5J8Q A;  4GE9 A;  3AZH D;  3NDN A;  4LD9 A;  1W3U A;  1C4K A;  3B0D C;  2OGA A;  3B0B A;  3AZL D;  3MGR B;  4E44 A;  1BH9 B;  4R8P A;  4QGR A;  3UAK A;  4OT8 A;  5D95 A;  1VEF A;  3LVK A;  3WKJ B;  3REH C;  4OBV A;  1YJS A;  5B0Z D;  3PDB B;  5AV9 C;  1X0M A;  5DJ9 A;  2VGU A;  4J8W D;  1YNU A;  3X1U C;  5B24 D;  4G91 B;  3AZF A;  1S32 B;  3QPG A;  4XZQ B;  4KUD D;  3VK4 A;  4R2N A;  4K2M A;  1WKG A;  2EGY A;  3AN2 B;  1RVU A;  3TU4 B;  3DXV A;  1KAF A;  3MNN D;  3WGB A;  4ZWV A;  3X1S C;  3X1T B;  2CWE A;  1P34 B;  3AFA C;  4J8V B;  1GEY A;  5AVC A;  4KGC A;  3TCM A;  3WTP B;  4WV4 B;  1HQ3 C;  1J32 A;  2NZD B;  2DKJ A;  3X1V C;  2BKW A;  2BWP A;  3LJA C;  3KUY D;  1ASM A;  3PAA A;  5GXQ B;  1UU1 A;  1W7L A;  4A72 A;  2WK8 A;  1P3F C;  3REK C;  3CQ6 A;  2VGV A;  2Z1Y A;  2V0Y A;  5BO0 B;  3B0C W;  4BQ0 A;  2Z9U A;  4H9S C;  1QJ3 A;  3WA9 D;  5B1M D;  1F66 A;  3DRD A;  3MVD B;  2Y2L A;  1D7R A;  4WU9 C;  1SFF A;  1B8G A;  4JEY A;  3MGP D;  4G92 C;  3CAI A;  1CL2 A;  3O62 D;  4OC9 A;  1P3A B;  4WYD A;  3A6N D;  5B31 D;  3UT9 B;  3BCB A;  2D5Y A;  3A9Y A;  3EI5 A;  3GWP A;  3B6F B;  2FJ7 C;  3KWQ C;  5B31 A;  2JCH A;  4G91 C;  4X23 C;  1BKG A;  2R5C B;  3F6T A;  1M1A B;  5C3I B;  1AKB A;  2VMT A;  2BI3 A;  2ZY3 A;  3NYU A;  2W7G A;  2C7T A;  3C1B A;  3I5T A;  1CQ6 A;  4WJ3 C;  2DF4 C;  1P3G A;  2VMP A;  1YOO A;  3AZJ B;  1N1J A;  2BI9 A;  1U35 A;  4JF0 A;  1SZU A;  3LZ0 A;  1ASB A;  4J8W B;  3VH6 W;  3AZM C;  3B0C T;  3LZ0 C;  5EQC A;  3LVM A;  4JJN C;  2RFV A;  4ZLV A;  1DFO A;  2QSR A;  4ZBJ C;  5BJ3 A;  3MVD D;  5CPK D;  4ZAH A;  2BYM B;  3MNN A;  2VI9 A;  1YIZ A;  5B2I C;  3W98 A;  2Y2K A;  3P1T A;  1P3F B;  1P3G C;  5G0A A;  1EQB A;  3NQU B;  3A6N A;  1WYU A;  1U35 C;  5GXQ D;  5GSU A;  2BYK A;  3KUY B;  1BJO A;  1AAW A;  3AZF B;  3MAF A;  4ATQ A;  2F8J A;  2VYC A;  2AY1 A;  3W1I A;  4J8X B;  4WLJ A;  1B5P A;  3UT9 C;  3C1B D;  4YS3 D;  4MQP A;  1SPA A;  3W96 C;  5GT3 A;  3V9R A;  4J8V A;  3A9X A;  4RIZ A;  2AEU A;  1ASN A;  2BIG A;  1ZOB A;  4Z5T B;  1AY5 A;  5G4I A;  2W7K A;  3EPJ A;  2XD1 A;  3NTJ A;  3QI6 A;  3ECD A;  1JF9 A;  1C7G A;  3KXB D;  4WBT A;  4A6U A;  3MGQ D;  1PZR A;  3AZJ C;  1OXP A;  4RIT A;  1UU2 A;  5HDM A;  3R9A A;  2AY9 A;  2YKX A;  2X5F A;  1TAS A;  4J8X D;  2G7J A;  1QJ5 A;  5GT3 C;  2WB6 A;  5EIG B;  1P3K D;  4JJN B;  2WK9 A;  2CV5 C;  3AZK A;  3G0T A;  2FNU A;  3BCA A;  3GZD C;  3TU4 C;  2VMY A;  3AEJ A;  1U35 D;  3AEM A;  1TZY C;  5B33 D;  1D7V A;  4WU8 B;  2W7H A;  3FZ7 A;  4K2I A;  4AZJ A;  3EZS A;  2F8N G;  3RUY A;  4CXR A;  3KFU G;  1CZC A;  3TFT A;  1ARG A;  1B67 A;  4H9R B;  2JGT A;  4ADD A;  3B1C A;  3FVU A;  5JRG D;  3BCX A;  4KHA B;  3DU4 A;  5AV9 A;  1AIB A;  4F5I A;  4J8W A;  2YKY A;  2F8N H;  1A7W A; 
#chains in the Genus database with same CATH homology
 2AY8 A;  5EUE A;  4WYC A;  3MAD A;  3HBX A;  3A1I A;  1WYV A;  1Z7D A;  1LW5 A;  3AZE A;  2Y2I A;  1P3P C;  3LG0 A;  4PVF A;  4Z2M G;  4UUZ A;  3EIB A;  1ASF A;  2W8J A;  4F5M A;  1QGN A;  2VMW A;  3LEL D;  3H0R C;  5CPJ B;  4YM6 D;  3KE3 A;  4XUJ D;  1P3I B;  4IXS A;  2ARO C;  3AV2 A;  2CV5 D;  5I92 A;  1P3O C;  1AMR A;  3D6K A;  1BT4 A;  1W23 A;  5E5I A;  1KX4 C;  1CQ8 A;  2BYK B;  2GSA A;  3AL0 C;  1V2D A;  3II0 A;  3A9Z A;  4AH3 A;  3KWQ A;  1UKJ A;  3MGS B;  3EUC A;  3REL A;  4A6R A;  3EPK A;  4UOY A;  1EQZ C;  1OAT A;  2CB1 A;  5DNN C;  1AAM A;  3AFA D;  3MC6 A;  1AJS A;  3MGR C;  3AZK D;  3BWO A;  4ADE A;  1ASC A;  3FQA A;  3GR9 A;  1KX5 D;  4J8U C;  2Z20 A;  1D2F A;  4LC3 A;  3A8U X;  4R8P B;  4KUD A;  4HVK A;  4R8P D;  3JW9 A;  1TOG A;  4ADB A;  1GC4 A;  5AV5 B;  2WKA A;  3WA9 C;  1KX5 B;  5CHL B;  1BQA A;  3LEL C;  3AZG D;  1P3M B;  3BV0 A;  4GRX A;  2QLR A;  2XD5 A;  3NYS A;  3ACZ A;  1AOI B;  2HOR A;  4ZSY A;  1R4V A;  4CSR B;  4ZM4 A;  4EFF A;  2GB3 A;  2BYL A;  1TZY B;  3B6G B;  2NQB C;  3X1V D;  4RLG A;  5BNX B;  5G2P A;  2CAN A;  5B33 B;  3NX3 A;  5AVC B;  4ATP A;  3F0H A;  3FVX A;  2ZM5 A;  4EMY A;  2NZD A;  4ITG A;  3NUI A;  3DC1 A;  5B1M C;  4XUJ B;  1P3I D;  4KYO A;  3KSY A;  2PO3 A;  5AV8 B;  2ZJG A;  4HGA C;  2GMS A;  3AYW C;  5BO0 A;  2X5D A;  5FUG B;  4H51 A;  1M18 B;  3LJA A;  3MGQ B;  1AY8 A;  5B0Y C;  3KXB B;  4XZQ D;  1TOK A;  4ZUX D;  1W7M A;  3RCH B;  1FG7 A;  1P3A A;  4MKK A;  1MGV A;  5AV6 A;  2R0T A;  5B32 A;  2QBT A;  4F5J A;  5G2Q A;  2DQN C;  4NE3 A;  1ART A;  4H9P A;  1UU0 A;  5FT8 A;  1BH8 B;  5HHY A;  1ID3 A;  1MDZ A;  5KTB A;  2CY8 A;  5EFS A;  4H9Q B;  5BS7 A;  3PIU A;  3AAT A;  5CPJ A;  4LNJ A;  3ZRR A;  3AN2 C;  1M19 D;  4J8W C;  5GT0 B;  3REI D;  1ECX A;  1P3K C;  1ASE A;  5B0Z C;  5B24 C;  3EIA A;  3X1U A;  5E3K A;  1KMJ A;  4UHO A;  2J8P A;  2E7I A;  1GEX A;  3REJ C;  2JJE A;  1AMS A;  3NQJ A;  3WKJ A;  2DGM A;  1CQ7 A;  3AZI A;  3H9X A;  1P3O A;  2BWN A;  4PFF A;  4UPK A;  1OXO A;  2OKK A;  3A2B A;  2ZP7 A;  2EZ2 A;  1ZLA D;  3UTB B;  2QMA A;  4Q31 A;  3GET A;  3WY7 A;  1S32 A;  5G4J A;  2LY8 A;  4P3M A;  4MQQ A;  3DOD A;  4PIW A;  3AYW D;  3N0L A;  1LS3 A;  2ARO D;  3CQ5 A;  3VH6 A;  2AY6 A;  3AEJ C;  4KAM A;  2F2A C;  3N4R A;  4M2K A;  4CVQ A;  2WK7 A;  3JTX A;  3REK D;  1P3B B;  2ZY5 A;  1LC7 A;  2JIS A;  1RVY A;  5F99 D;  2PYO C;  5B1L D;  2RIQ A;  5GSU B;  1KX5 A;  4Q75 A;  3WKJ D;  3HVY A;  5GSU D;  5GXQ A;  1BJO B;  4W1X A;  4Q6R A;  1P3M A;  3ELE A;  1KX3 D;  5B2I B;  4DGT A;  2JSS A;  4KGC D;  4WU8 C;  2Z9W A;  5B40 C;  3B1E A;  5DX5 A;  3AZL B;  2ZYJ A;  3AZE C;  3AOW A;  4CBS A;  1AHY A;  5E5A A;  3MEB A;  5BNX A;  3AEP A;  3B6F C;  4X23 D;  3N4X A;  1M32 A;  5AV8 D;  1GCK A;  5BS7 C;  1P3A D;  4A00 A;  2O0R A;  2ZSL A;  1G7W A;  3UTA D;  1KMK A;  3GZC A;  3EI8 A;  3FCR A;  3E77 A;  2V1P A;  1DGE A;  1AMQ A;  2CH1 A;  1MAQ A;  1ORD A;  3WLX A;  4J8U D;  5FUG A;  1JG8 A;  1Z3Z A;  4BMK A;  3JZL A;  1CZE A;  3LJA B;  2A1V A;  4QLC C;  3OKS A;  1TZY D;  3REI B;  5BT1 C;  4KUD C;  4H9N B;  3NNK A;  2D65 A;  1TOI A;  4YS3 C;  1P3I C;  1JS3 A;  1BH8 A;  4WNN B;  2AY2 A;  4OTL A;  4WU9 B;  2YCP A;  2BG1 A;  3MGP A;  1AKC A;  2YOB A;  3K7Y A;  1H3O A;  2CJG A;  4ITX A;  1IX7 A;  2FKI A;  4Z66 B;  2YCN A;  3X1U B;  3WAA A;  3VK2 A;  1H0C A;  4GSA A;  3QGU A;  5AX8 A;  1GDE A;  1IVR A;  2Z9V A;  1P3O B;  5CPI C;  2HP1 A;  4E77 A;  3A6N B;  5AV9 B;  1WYU B;  2FM1 A;  4MY5 A;  2Y2P A;  4Y0H A;  3NRA A;  3KUY A;  3UWC A;  3WTP C;  5CPI A;  1KU5 A;  3L8A A;  1ARS A;  4J8V C;  1X2A A;  1M19 C;  4NE5 A;  3COG A;  1P3O D;  5KDM A;  1P3P A;  3B0D B;  1PMM A;  2CJH A;  3AZH C;  1AKA A;  1BW0 A;  2PB2 A;  3N5M A;  3LEL B;  4Z5T A;  3MGQ C;  4IXO A;  3QN6 A;  1P3M D;  1O69 A;  3WTP D;  1ZLA B;  4R8D A;  1BH9 A;  3PJ0 A;  5AVB B;  5AV5 D;  2W8T A;  3WGC A;  5GT3 D;  4AWL B;  3REH D;  2FYF A;  2YKU A;  2CST A;  3MGS A;  3EPH A;  2JJG A;  1M1A C;  1B5O A;  1FC4 A;  2FN6 A;  9AAT A;  4FL0 A;  4PFN A;  3ASB A;  3AEN A;  3A1K A;  2HUI A;  3FZ6 A;  1J04 A;  5JA4 A;  4XZQ A;  2W8U A;  2ZSM A;  5EIG A;  4G92 B;  1GBN A;  4LW4 A;  3AZK B;  3AN2 A;  2C0R A;  2F8N K;  3QM2 A;  3TU4 A;  1CL1 A;  1BJ4 A;  1S06 A;  3MVD C;  1H1C A;  5DNN A;  3BWN C;  2VGT A;  2VMN A;  1TOE A;  3WKS A;  2YCT A;  3P5J B;  3PD6 B;  3W99 D;  4WU8 A;  5DB5 A;  1YJY A;  1ELQ A;  1F66 C;  3WX9 A;  1AY4 A;  3WTP A;  3NU7 A;  3AV1 C;  1KX4 D;  3REK B;  4XQ2 A;  3WA9 A;  2ZUK A;  1GC0 A;  1S08 A;  3AEL A;  1ASL A;  3REI A;  3AZN C;  4RJ0 A;  3QHX A;  1PG8 A;  2C81 A;  4CSR A;  4Z66 C;  4E3R A;  1G4X A;  1KX4 B;  3VH5 W;  2YRI A;  3MNN C;  5AV8 C;  3B1D A;  4WNN A;  3X1S B;  4BHD A;  1TAT A;  3EI7 A;  4WU9 D;  2VQR A;  4CBR A;  1IX8 A;  3GJU A;  3ATH A;  4FFC A;  4MQR A;  5AVC D;  4W5K A;  3I16 A;  3UT9 A;  2VMS A;  2OQX A;  2VMQ A;  4R5F A;  2X3L A;  2Z9X A;  2IO5 B;  4IW7 A;  1M0P A;  3B6G C;  3AEM C;  4ISY A;  3AZN D;  3E2Y A;  4TN4 A;  1MAP A;  5B0Y A;  4MKJ A;  3VP6 A;  5CP6 B;  3AZL C;  4NE6 A;  3AV2 B;  1BJN A;  2DGK A;  4P7Y A;  2NMP A;  3LVJ A;  5E4Z A;  2ZY2 A;  3MAU A;  4WZS B;  3DR7 A;  3FRK A;  2QB2 A;  5CPI B;  1TPL A;  3C1C D;  3HL2 A;  3KKI A;  1EQZ D;  1QZ9 A;  3WKR A;  1F66 D;  3NUB A;  3F9T A;  3REL D;  3AZF D;  3WZF A;  5B32 B;  2FJ7 A;  3W97 B;  1SF2 A;  2RVQ D;  3C1C A;  2HP2 A;  5AY8 A;  2IO5 C;  4IY7 A;  2W7L A;  5B2J B;  2HUE B;  1AJS B;  5AY8 D;  3DR4 A;  4R5Z A;  5FT6 A;  4WXB A;  2XBN A;  2W7I A;  1AJR A;  3AZN A;  2KFP A;  1ID3 C;  1IX6 A;  3VAX A;  1ZLA A;  4YM6 A;  3REH A;  3AZG C;  1AX4 A;  3LVL B;  2W7E A;  4A0R A;  2HUF A;  2EH6 A;  3W1J A;  3NQU A;  2HOY A;  2NQB D;  4RKD A;  3UTB A;  1PMO A;  4J5U A;  1GC3 A;  3GSB A;  2YFW B;  3EG5 B;  3I4J A;  4WYF A;  3MAF B;  4ZUX B;  5M49 A;  3AV1 B;  5CPJ D;  1M18 D;  5F8V A;  4WB0 A;  1HQ3 B;  4RAE A;  5CPK A;  3USF A;  3NU8 A;  4IYO A;  3AFA A;  5BNV A;  1W2E A;  5DNN B;  4WXF A;  1SVV A;  2BHX A;  4YS3 B;  1LW4 A;  5GT3 B;  5AV6 D;  3V9R B;  3PD6 A;  1M1A D;  3FDD A;  1I48 A;  4XZQ C;  4WD2 A;  3REJ D;  3FSL A;  2C44 A;  5G09 A;  3JWB A;  4A0G A;  4W91 A;  3O62 B;  2G6W A;  4M6B A;  3VH6 T;  3GBX A;  1KX4 A;  5DNM D;  3AZL A;  1M18 A;  3N4S A;  1QIT A;  4AO4 A;  3MGQ A;  3PPL A;  3FZ8 A;  4UHN A;  3RCH A;  1IJI A;  2Y2H A;  3W99 C;  4Y0I A;  5EUD A;  1IUG A;  3E2F A;  1P3W A;  2CH2 A;  4YM6 C;  3IP4 C;  1O61 A;  1Y4I A;  3N75 A;  4NFT A;  4ZDP A;  1TAR A;  1IBJ A;  5B31 C;  2GQN A;  5B40 B;  5B33 C;  1G4V A;  1YJZ A;  3NYT A;  4K05 A;  4E1O A;  4JJN D;  4EO5 C;  4CXQ A;  5B0Y B;  3KXB C;  2AAT A;  4DRA A;  5EUN A;  5CP6 A;  4XJO A;  3W97 C;  3AZJ D;  1EQZ A;  3G8M A;  5FT4 A;  4QLC A;  7AAT A;  5B2I D;  1DGD A;  1KX3 B;  4H9R A;  2ZY4 A;  2BIA A;  3NQJ B;  1V2E A;  2UWX A;  4OMA A;  5EAA A;  1S32 D;  1AHG A;  3AZI B;  2Y2N A;  2ORD A;  3MGP C;  2FJ7 B;  4LNM A;  3REJ A;  3MGS D;  5GT0 C;  2HIO D;  5B2J C;  2E54 A;  1X28 A;  4CAY B;  1PFF A;  3PGY A;  2YFV B;  4Z5T C;  3L44 A;  4LD9 B;  5E5A D;  5F99 C;  1N8P A;  3KGX A;  1ARI A;  2FNI A;  3AZE B;  3C1C C;  4UUZ B;  1BJW A;  3VK3 A;  4YM6 B;  3WAA B;  1AOI D;  1ELU A;  1O62 A;  3AEO A;  3BN1 A;  1T3I A;  4OYT A;  1G7X A;  1WYT B;  1KX3 C;  2VLF A;  4WU8 D;  3W99 A;  1BFM A;  2D63 A;  3LZ1 B;  3REL C;  3MGS C;  5EAV A;  4NOG A;  3KUY C;  2YFW A;  3LZ1 D;  4BA5 A;  1S0A A;  1P3F D;  3KWQ B;  3PDX A;  2D7Y A;  3VH5 A;  1LKC A;  1YAA A;  4WB0 B;  1KKP A;  4JF1 A;  4U1T A;  2EYQ A;  4M2J A;  1S09 A;  3WAA C;  3X1T A;  1BS0 A;  5DNN D;  1P34 A;  3AZH A;  1F1E A;  1OHW A;  1ARH A;  1S32 C;  3LEL A;  3AV1 D;  4MSO A;  1AIA A;  2VIB A;  2HIO B;  1JFI B;  3AZF C;  3RBF A;  2Y2J A;  2FJ7 D;  3FQ7 A;  1N31 A;  4ZUX C;  2VGW A;  1DKA A;  2AY3 A;  2GMU A;  4Z5T D;  4ZDO A;  3BB8 A;  2AEV A;  4LW2 A;  3K40 A;  2F8N D;  3P6K A;  5AV5 A;  2W7F A;  3X1V A;  4WYA A;  3AEN B;  2ZC0 A;  3MVD A;  3DXW A;  4LNL A;  3DYD A;  1DTY A;  3W96 D;  1JS6 A;  1AOI A;  4H9N A;  3WTP E;  4I8A A;  4W1V A;  1D7U A;  3RBL A;  5B40 A;  3AV7 A;  5B31 B;  4OCA A;  4EU1 A;  3MGP B;  2CTZ A;  1M1A A;  3FVS A;  1S07 A;  3HT4 A;  1EQZ B;  4Z66 A;  1M19 B;  5CPK C;  3WA9 B;  3WAA D;  5JRG B;  1KX3 A;  3UTB C;  3VH5 T;  2VMX A;  2ARO A;  2PYO B;  5CP6 C;  2VGS A;  1GD9 A;  3BS8 A;  2F8N A;  2CIN A;  5M4B A;  1P3B C;  3REJ B;  5GXQ C;  2CFB A;  2BI2 A;  3X1S A;  1I43 A;  4CAY A;  2DGL A;  5B24 A;  3LWS A;  2W7D A;  3FQ8 A;  5AV6 B;  3H7F A;  5AVB D;  1WWS A;  3X1S D;  1U08 A;  4TMR A;  1BQD A;  1P3L C;  2O1B A;  3MNN B;  3W96 B;  3UTA C;  4J8U A;  4O6Z A;  4XJL A;  1DJE A;  2D7Z A;  1FG3 A;  4F5L A;  2TPL A;  4WLH A;  2DOU A;  3W1H A;  3FTB A;  4Q76 A;  1DJU A;  5B40 D;  1LK9 A;  5B0Z B;  2NZD C;  3VOM A;  2E7U A;  2EZ1 A;  2D61 A;  2G5H C;  3W97 A;  1M0O A;  1P3L B;  4B9B A;  3FDB A;  2PB0 A;  4DBC A;  3MGR D;  5AV6 C;  3AZK C;  2DKB A;  1Z2C B;  5DNM B;  3KGW A;  2D66 A;  1TAF A;  4X23 A;  1M6S A;  4F5G A;  3FD0 A;  3MC6 C;  1ASD A;  2NQB A;  2R5E A;  3MGR A;  3M5U A;  3OP7 A;  1VP4 A;  1CJ0 A;  4JEX A;  2EO5 A;  3HLM A;  2NZD D;  1P3B A;  1B9I A;  3IHJ A;  4AOA A;  1MDO A;  2HOX A;  3HMU A;  2VMO A;  3EZ1 A;  3REK A;  5CPI D;  1ZLA C;  2VIA A;  1X29 A;  3G7Q A;  5B1L A;  4IX8 A;  4ZUX A;  1P3K A;  1ASG A;  2AY5 A;  3AYW A;  5B2I A;  2Q7W A;  1C9C A;  5CPK B;  5IWQ A;  4XJP A;  2JG2 A;  4UQV A;  4ZAS A;  4GEB A;  5E5A B;  4WYG A;  4Y0D A;  3R45 A;  1M4N A;  1MLZ A;  4ZM3 A;  3AZM A;  2YHK A;  5F99 A;  5DNM C;  1P3M C;  2CV5 B;  4F5K A;  2JE5 A;  5JRG A;  4M2M A;  4GE7 A;  4XK1 A;  3FKD A;  3WCO A;  2PYO A;  3HQT A;  3O62 A;  3X1T D;  2F8N B;  3ZZK A;  4KHA A;  1TOJ A;  2Y2O A;  3B8X A;  5M46 A;  2VMU A;  4RJY A;  5B0Y D;  3N7N A;  4AZK A;  2FQ6 A;  5B24 B;  4IXZ A;  3B6F D;  1HTA A;  2EPJ A;  4RM1 A;  3TAT A;  3C1C B;  1EJI A;  1O4S A;  3EPL A;  3B6F A;  4XAU A;  5M4D A;  3FFH A;  4EB7 A;  1B6W A;  4J8X C;  1P34 C;  4WU9 A;  2R5C A;  3ZZJ A;  2AY7 A;  1AHF A;  5CP6 D;  1C0N A;  1IAY A;  3AZN B;  4BA4 A;  4QLC B;  3KWQ D;  3LJA D;  5B0Z A;  5BT1 D;  3EI9 A;  3EI6 A;  5DJ1 A;  1U35 B;  5B1L C;  1I29 A;  3PDB A;  3REL B;  2OGE A;  3WKJ C;  5AVB C;  3QBO A;  4OBU A;  1Q9C A;  5DNM A;  3RQ1 A;  4J8V D;  2YRR A;  1KKJ A;  3X1T C;  2YFV A;  3AV1 A;  4KGC C;  4X23 B;  5B1M A;  3AZE D;  3TU4 D;  4EB5 A;  3AN2 D;  5BNV B;  2QB3 A;  4LD9 C;  4ZDL A;  4KUD B;  2W7M A;  3W98 B;  4KGC B;  3E9K A;  3ELP A;  4K2B A;  1P3F A;  4J8L A;  4U2H A;  3W99 B;  2Y2G A;  4AWL C;  4E45 A;  3AZI C;  5GSU C;  2OAT A;  2AY4 A;  3CBF A;  5B1L B;  5AVB A;  3ASA A;  4UHM A;  1MLY A;  4B98 A;  3BC8 A;  1ZC9 A;  4J8X A;  1M0Q A;  1YIY A;  1TZY A;  3X1U D;  3B6G A;  3R45 B;  3GZD A;  5B33 A;  1KL2 A;  5JA4 B;  5E5A C;  3AZM B;  1WKH A;  2XH1 A;  5JAY A;  1V2F A;  3LZ0 D;  2BI1 A;  4L0O A;  3UT9 D;  3ZRQ A;  2FFF B;  2HIO A;  1JFI A;  1EG5 A;  5TF5 A;  1ID3 D;  1P3A C;  4JEV A;  1XI9 A;  3E2Z A;  3ISL A;  2Z1Z A;  2HOZ A;  1W7N A;  2DR1 A;  5AV8 A;  1KX5 C;  4ZSW A;  3AOV A;  2Y2Q A;  3UE8 A;  3AV2 C;  1RV4 A;  1QIR A;  2BWO A;  4HF8 A;  3X1V B;  3KXB A;  4LD9 D;  3W98 C;  1P3G B;  3AZJ A;  2VMR A;  4JJN A;  3AZG B;  3AZI D;  1AHE A;  5C6U A;  5K8B A;  1ID3 B;  3JWA A;  4GE4 A;  4F5F A;  1IAX A;  3TFU A;  2G5I C;  2HZP A;  4H9Q A;  4F4E A;  4H9O A;  2HUE C;  4XJM A;  5GT0 A;  3REI C;  4WP0 A;  1E5E A;  8AAT A;  4DQ6 A;  2BYM A;  4DQY B;  1B4X A;  2Z61 A;  1LC8 A;  1ASA A;  1GC2 A;  5G49 A;  3LZ1 C;  3LV2 A;  4W1W A;  1WYT A;  4A6T A;  1M18 C;  3LZ1 A;  2BIE A;  1P3L D;  1N2T A;  4HGA B;  5JRG C;  1E5F A;  3LY1 A;  3UTA A;  5D5S A;  5B1M B;  1I41 A;  5AV9 D;  1P3G D;  2OKJ A;  5HXX A;  4A0F A;  4EO5 B;  5B31 G;  5B32 G;  5AY8 B;  3B6G D;  3AZH B;  3W96 A;  4J8U B;  5B2J A;  1ZOD A;  1P3P D;  3W97 D;  3WCN A;  4JEZ A;  5FT5 A;  3C1B C;  3UTB D;  1KL1 A;  5AV5 C;  4W8I A;  3REH B;  1V72 A;  4A0H A;  1C7N A;  2X8U A;  1B9H A;  1P34 D;  3A6N C;  4XUJ C;  2W8S A;  1OHV A;  1D7S A;  1HQ3 D;  1P3L A;  2VMZ A;  3DZZ A;  4QLC D;  4XEW A;  1OHY A;  5GT0 D;  1T3U A;  1M0N A;  5BJ4 A;  2D64 A;  2Y2M A;  1TAF B;  5AY8 C;  5CPJ C;  1AHX A;  1HQ3 A;  2QA3 A;  2NQB B;  1SZS A;  2BYJ A;  1WST A;  1ULY A;  4H63 Q;  1DJ9 A;  4IYO B;  3AFA B;  5B32 C;  4WYE A;  3RI6 A;  4E3Q A;  3E2Z B;  4YS3 A;  3E6G A;  1AOI C;  1LC5 A;  1WWI A;  1SZK A;  2VI8 A;  3FFR A;  1AIC A;  3HDO A;  1P3B D;  3O62 C;  1VJO A;  2VMV A;  2E7J A;  1M19 A;  3R4T A;  3AZM D;  3K28 A;  1RV3 A;  5B2J D;  1AMA A;  2ARO B;  1P3K B;  2JJF A;  4GDY A;  4AO9 A;  3AYW B;  2HUU A;  2W8W A;  4R8P C;  4F5H A;  3T32 A;  3AZG A;  1QIS A;  2JJH A;  4Z66 D;  4RKC A;  5B32 D;  1F66 B;  1CS1 A;  4N0W A;  3BWN A;  4ADC A;  1GEW A;  4H9O B;  1H3O B;  4DRB A;  3PA9 A;  2VLH A;  1WYV B;  2RVQ C;  4ZBJ B;  1MDX A;  5F99 B;  5AVC C;  1XEY A;  2W7J A;  3H0M C;  3AV2 D;  2CV5 A;  5F9S A;  2VGZ A;  4XUJ A;  3B46 A;  2BI5 A;  3Q8N A;  3W98 D;  4WXG A;  5G49 B;  4H9S A;  4Z2M H;  1P3I A;  1M7Y A;  2R2N A;  3ZRP A;  3MKJ A;  2YKV A;  2PYO D;  3CQ4 A;  1C7O A;  4KXK A;  3C1B B;  2L5A A;  2CJD A;  2O7C A;  2W8V A;  3MBB A;  3UTA B;  4JEW A;  3H0L C;  1N1J B;  5C3I C;  5KDM B;  1P3P B;  3TQX A;  4H9P B;  4ZWM A;  2HIO C;  3LZ0 B;  5J8Q A;  4GE9 A;  3AZH D;  3NDN A;  4LD9 A;  1W3U A;  1C4K A;  3B0D C;  2OGA A;  3B0B A;  3AZL D;  3MGR B;  4E44 A;  1BH9 B;  4R8P A;  4QGR A;  3UAK A;  4OT8 A;  5D95 A;  1VEF A;  3LVK A;  3WKJ B;  3REH C;  4OBV A;  1YJS A;  5B0Z D;  3PDB B;  5AV9 C;  1X0M A;  5DJ9 A;  2VGU A;  4J8W D;  1YNU A;  3X1U C;  5B24 D;  4G91 B;  3AZF A;  1S32 B;  3QPG A;  4XZQ B;  4KUD D;  3VK4 A;  4R2N A;  4K2M A;  1WKG A;  2EGY A;  3AN2 B;  1RVU A;  3TU4 B;  3DXV A;  3MNN D;  3WGB A;  4ZWV A;  3X1S C;  3X1T B;  2CWE A;  1P34 B;  3AFA C;  4J8V B;  1GEY A;  5AVC A;  4KGC A;  3TCM A;  3WTP B;  4WV4 B;  1HQ3 C;  1J32 A;  2NZD B;  2DKJ A;  3X1V C;  2BKW A;  2BWP A;  3LJA C;  3KUY D;  1ASM A;  3PAA A;  5GXQ B;  1UU1 A;  1W7L A;  4A72 A;  2WK8 A;  1P3F C;  3REK C;  3CQ6 A;  2VGV A;  2Z1Y A;  2V0Y A;  5BO0 B;  3B0C W;  4BQ0 A;  2Z9U A;  4H9S C;  1QJ3 A;  3WA9 D;  5B1M D;  1F66 A;  3DRD A;  3MVD B;  2Y2L A;  1D7R A;  4WU9 C;  1SFF A;  1B8G A;  4JEY A;  3MGP D;  4G92 C;  3CAI A;  1CL2 A;  3O62 D;  4OC9 A;  1P3A B;  4WYD A;  3A6N D;  5B31 D;  3UT9 B;  3BCB A;  2D5Y A;  3A9Y A;  3EI5 A;  3GWP A;  3B6F B;  2FJ7 C;  3KWQ C;  5B31 A;  2JCH A;  4G91 C;  4X23 C;  1BKG A;  2R5C B;  3F6T A;  1M1A B;  5C3I B;  1AKB A;  2VMT A;  2BI3 A;  2ZY3 A;  3NYU A;  2W7G A;  2C7T A;  3C1B A;  3I5T A;  1CQ6 A;  4WJ3 C;  2DF4 C;  1P3G A;  2VMP A;  1YOO A;  3AZJ B;  1N1J A;  2BI9 A;  1U35 A;  4JF0 A;  1SZU A;  3LZ0 A;  1ASB A;  4J8W B;  3VH6 W;  3AZM C;  3B0C T;  3LZ0 C;  5EQC A;  3LVM A;  4JJN C;  2RFV A;  4ZLV A;  1DFO A;  2QSR A;  4ZBJ C;  5BJ3 A;  3MVD D;  5CPK D;  4ZAH A;  2BYM B;  3MNN A;  2VI9 A;  1YIZ A;  5B2I C;  3W98 A;  2Y2K A;  3P1T A;  1P3F B;  1P3G C;  5G0A A;  1EQB A;  3NQU B;  3A6N A;  1WYU A;  1U35 C;  5GXQ D;  5GSU A;  2BYK A;  3KUY B;  1BJO A;  1AAW A;  3AZF B;  3MAF A;  4ATQ A;  2F8J A;  2VYC A;  2AY1 A;  3W1I A;  4J8X B;  4WLJ A;  1B5P A;  3UT9 C;  3C1B D;  4YS3 D;  4MQP A;  1SPA A;  3W96 C;  5GT3 A;  3V9R A;  4J8V A;  3A9X A;  4RIZ A;  2AEU A;  1ASN A;  2BIG A;  1ZOB A;  4Z5T B;  1AY5 A;  5G4I A;  2W7K A;  3EPJ A;  2XD1 A;  3NTJ A;  3QI6 A;  3ECD A;  1JF9 A;  1C7G A;  3KXB D;  4WBT A;  4A6U A;  3MGQ D;  1PZR A;  3AZJ C;  1OXP A;  4RIT A;  1UU2 A;  5HDM A;  3R9A A;  2AY9 A;  2YKX A;  2X5F A;  1TAS A;  4J8X D;  2G7J A;  1QJ5 A;  5GT3 C;  2WB6 A;  5EIG B;  1P3K D;  4JJN B;  2WK9 A;  2CV5 C;  3AZK A;  3G0T A;  2FNU A;  3BCA A;  3GZD C;  3TU4 C;  2VMY A;  3AEJ A;  1U35 D;  3AEM A;  1TZY C;  5B33 D;  1D7V A;  4WU8 B;  2W7H A;  3FZ7 A;  4K2I A;  4AZJ A;  3EZS A;  2F8N G;  3RUY A;  4CXR A;  3KFU G;  1CZC A;  3TFT A;  1ARG A;  1B67 A;  4H9R B;  2JGT A;  4ADD A;  3B1C A;  3FVU A;  5JRG D;  3BCX A;  4KHA B;  3DU4 A;  5AV9 A;  1AIB A;  4F5I A;  4J8W A;  2YKY A;  2F8N H;  1A7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...