4BA5A

Crystal structure of omega-transaminase from chromobacterium violaceum
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
427
structure length
427
Chain Sequence
ARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNTFFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGDLPIPGMAHIEQPWWYKHGKDMTPDEFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGLIAGGDFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKRELFPDFGEIGTLCRDIFFRNNLIMRACGDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLKARGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AMINOTRANSFERASE
publication title Structural Studies with Pseudomonas and Chromobacterium [Omega]-Aminotransferases Provide Insights Into Their Differing Substrate Specificity.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transferase
total genus 163
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.6.1.18: Beta-alanine--pyruvate transaminase.
pdb deposition date 2012-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ba5A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ba5A01
2W8JA 3I4JA 1IJIA 1SPAA 3PDBB 3RBLA 4P7YA 4AH3A 4WP0A 2Z9VA 1X29A 2AY8A 2FNIA 1N31A 3NX3A 2WKAA 3BS8A 1AKBA 3P6KA 4PVFA 3TQXA 3USFA 3VK2A 3E2ZA 1ASLA 3AOVA 5EQCA 2W7DA 4F5IA 5M4DA 4Y0IA 5E4ZA 1WYVB 2JJEA 1AMQA 1LC7A 1PMOA 2YCNA 1CS1A 1TOJA 2DR1A 3MBBA 1LC5A 5DJ9A 5EUNA 4WBTA 4ADEA 1ZODA 4F5MA 3NYTA 2W8TA 1RV4A 1OHYA 2BHXA 1AJSB 3COGA 2YHKA 1P3WA 2ZY5A 3E9KA 1ASNA 2BKWA 2D65A 2GSAA 1DJ9A 4A0RA 2EZ1A 1ARHA 4O6ZA 2VI8A 2Z9WA 4U2HA 1C0NA 1CJ0A 3FQ8A 1GEXA 3GWPA 2OQXA 2QBTA 1KKJA 1M4NA 4QGRA 3ELEA 2TPLA 2VYCA 2G6WA 1ARGA 1I48A 2HORA 2O0RA 1LW5A 3E6GA 5G2QA 5AX8A 1JG8A 4W5KA 2BIGA 5I92A 2W8VA 3BWNA 3VK4A 1ASMA 3PIUA 4JF1A 1PMMA 1GD9A 4WYGA 1IAYA 2R5CA 4CVQA 4IYOA 1AICA 5EIGB 4FL0A 4IW7A 3NRAA 4MGRA 3FDBA 4RJ0A 3DR4A 3QHXA 3QM2A 4GE7A 4WB0A 1AHEA 1GC3A 3ATHA 2VGSA 1ARIA 2WK9A 3ZRRA 1CQ8A 1ECXA 1MAPA 2CANA 2C7TA 4J8LA 2BYLA 3FFRA 1M6SA 1QITA 2W8UA 4ADDA 2OGEA 3LG0A 3UE8A 2D7ZA 4IXZA 2CSTA 1W7LA 2GMSA 1IVRA 2JISA 5G2PA 5M46A 4PFFA 4A6RA 3NYSA 4ADBA 3CQ4A 5G4JA 3NUIA 2O1BA 3QN6A 4R8DA 4F5KA 4JEWA 1GEWA 2W8WA 3DZZA 4OYTA 4CXQA 4WXBA 1AHYA 2GB3A 2JJHA 1BJOB 3B1CA 5EUEA 3KGXA 1BKGA 3OP7A 4W91A 4IXSA 4LC3A 2VMXA 4A00A 4K2MA 4AZKA 1M7YA 2AY9A 3WKSA 1GCKA 3ZZJA 4MY5A 2E7UA 3F9TA 3AEMA 4AZJA 4RJYA 4E3RA 3NU8A 4CBRA 5M49A 3BV0A 1TASA 4EMYA 3CQ5A 1GC2A 3L44A 3W1IA 3TCMA 1M32A 2BIEA 3DXVA 2ZP7A 2V1PA 3MKJA 2CTZA 1D7SA 1H1CA 3AEMC 3PD6A 4W8IA 3JWBA 1KKPA 3WGBA 2X5FA 5BJ3A 3B46A 2PO3A 4Q75A 1JF9A 2Z67A 1UKJA 2CJHA 1BQDA 4XJMA 4GE4A 1AKAA 3ELPA 3H7FA 1VEFA 2BWOA 2DKJA 4B98A 3FSLA 4GE9A 2PB0A 4JEXA 3PPLA 1WYVA 1DJEA 3DC1A 3EZSA 2BI3A 3AENB 3A2BA 1SVVA 3ZRPA 5LHAA 1OATA 3JZLA 4JE5D 1WKGA 4RLGA 1D7VA 4JE5A 4A6UA 1AJSA 1I29A 2VGTA 5DB5A 5HDMA 3R4TA 2OATA 3EI7A 3KKIA 4DGTA 2AY5A 3H14A 3FZ7A 3FFHA 2Z1ZA 1B5OA 1TOKA 1MDZA 4KAMA 4ZSWA 1C7NA 1SZUA 1CL1A 2BYJA 1ASCA 3NUBA 4WYCA 3DRDA 3AV7A 5BJ4A 3FZ8A 3BWOA 3FZ6A 5D5SA 1M0QA 2FYFA 5J8QA 1IBJA 4ITGA 2VIAA 3G8MA 5M4BA 4MKKA 4WYFA 3TFUA 2W7HA 4ATQA 2W7IA 1AY8A 3K28A 4W1VA 1SF2A 2Z20A 3CBFA 1SZSA 2QA3A 4ITXA 4WYDA 4CBSA 2YRIA 4RITA 3E2YA 1J32A 4RM1A 3WCNA 2VMTA 2AY6A 4EB7A 1B9IA 3QPGA 5EIGA 4EB5A 1PG8A 4IX8A 3BCBA 2W7FA 1OXOA 3EI6A 1EJIA 3FD0A 1I41A 5C6UA 1TOEA 4JEVA 4R2NA 4MQPA 3AATA 1D7UA 1WKHA 2W7GA 4ZDLA 3PGYA 1W3UA 3VK3A 2GMUA 3D6KA 4WXFA 2VMSA 2X3LA 3G7QA 3LV2A 1AY5A 1EG5A 3FCRA 2ZY2A 4DQ6A 5DJ1A 1ASGA 3MADA 4ZSYA 4Y0HA 3N5MA 3GETA 3WLXA 2WK8A 4OBVA 1E5EA 2JJGA 1OXPA 3FVSA 4XEWA 3LWSA 4UHMA 4E3QA 4PIWA 2O7CA 2YRRA 3B1DA 3HBXA 2BI9A 1BJOA 1TOIA 1KMKA 3LVJA 1ZC9A 1GC4A 3JW9A 4LNMA 3F0HA 2CY8A 4XJPA 1YNUA 2Z1YA 4MQRA 2HZPA 4E77A 4R5ZA 2AEUA 4EFFA 7AATA 1X2AA 4IXOA 4JF0A 4A0HA 4XQ2A 4HF8A 4F5FA 1BQAA 3HL2A 1DJUA 4P3MA 2CJGA 1O61A 2D7YA 2VMQA 1N2TA 3I16A 2PB2A 3PDXA 2ZSMA 1BW0A 1ASEA 1YJSA 2VGZA 3PAAA 1OHVA 3JU7A 2ZY4A 1AKCA 4ZWVA 3QI6A 2CFBA 4A0FA 2ORDA 4A0GA 4TMRA 4DBCA 9AATA 3FRKA 3DU4A 4AOAA 2QLRA 1YJZA 1C7OA 4Q31A 2AY4A 1G7WA 2FQ6A 5G0AA 1CQ6A 2W7KA 4F5GA 2HP1A 3AENA 1AIBA 3G0TA 2HUUA 3NTJA 3AELA 2XH1A 1BJ4A 4PFNA 4OCAA 2FM1A 4A6TA 3PA9A 4ZM4A 1AX4A 4BA4A 2BIAA 1YAAA 1D2FA 4OTLA 1TOGA 4EU1A 3VAXA 1C7GA 1AHGA 4TN4A 1SFFA 4U1TA 2YCPA 1MAQA 3A8UX 3PJ0A 4ZLVA 5FT6A 3HVYA 3RI6A 1AIAA 1ZOBA 1ASDA 2QB3A 4WYEA 2AEVA 3BC8A 1YIYA 4WYAA 4CXRA 1BS0A 1RVUA 3AEPA 4LW4A 1G4VA 5FT4A 4R5FA 4N0WA 1D7RA 3K40A 4XJOA 2FNUA 1CZEA 3PDBA 4W1WA 2E7JA 3JWAA 3FVUA 4TV7A 4UQVA 3CAIA 1FG3A 2CJDA 3ACZA 4OC9A 4AO4A 2JJFA 4K2IA 3WY7A 1YOOA 3ZRQA 2V0YA 1LC8A 3LVLB 4K2BA 1ASFA 4BA5A 1IUGA 4WLHA 3NYUA 3NNKA 5G09A 2Z61A 4M2KA 5F9SA 3DYDA 1MLZA 2EO5A 3EIBA 2VMZA 3A9YA 3MAFB 3TATA 3E77A 4LW2A 4Q6RA 2QMAA 3AEJA 1Z7DA 2RFVA 1MLYA 3Q8NA 1DTYA 2CH1A 4HVKA 1CQ7A 1AMRA 3QBOA 3CQ6A 4ISYA 3RBFA 1V2DA 1V2FA 1KL1A 2F8JA 3MEBA 1QIRA 2VGVA 4LNLA 3FQAA 3AEJC 1LW4A 1J04A 3N75A 1V72A 2C44A 3EIAA 1ASAA 2YCTA 3IHJA 3F6TA 1BT4A 3EUCA 2W7LA 3MC6C 1AHXA 3QGUA 3VOMA 3VP6A 2VIBA 4GRXA 4JEZA 3LVKA 2D64A 2ZYJA 8AATA 3KE3A 4L0OA 1XI9A 3T32A 1IX8A 2DGLA 1VP4A 1AJRA 4AO9A 1S08A 4LNJA 2EPJA 1MDXA 2VGUA 5DX5A 2VI9A 2R5EA 1UU2A 1AAMA 1GEYA 1M0NA 1TATA 1WSTA 3ASBA 4M2JA 2JG2A 3HLMA 1ARTA 2AATA 1QGNA 1WYUB 3WKRA 1TPLA 1AMAA 1YIZA 2BWNA 3HMUA 4F5HA 3UWCA 1KMJA 4GSAA 4WXGA 2AY7A 1M0OA 3RCHB 5K8BA 4J5UA 3I5TA 1MDOA 1IAXA 2X5DA 2DOUA 5JAYA 1IX7A 4KYOA 2ZC0A 2CINA 2Q7WA 3A9ZA 4GDYA 4N0BA 1B5PA 4XK1A 3EI8A 5E5IA 3II0A 4WD2A 5EUDA 2VLHA 2YKUA 1N8PA 3NU7A 2YKXA 2OGAA 2EH6A 3ZZKA 4ZASA 2D61A 3AEOA 2DKBA 3BCAA 1B9HA 1XEYA 1WYTB 2HOZA 2ZY3A 2AY2A 2HUFA 1TARA 5EAAA 3IF2A 3R9AA 1AAWA 2Z9XA 2X8UA 2ZSLA 1QISA 3GZDA 4KXKA 1GC0A 1M0PA 3RUYA 3BB8A 3LY1A 2YKVA 4M2MA 4OBUA 5G4IA 3HDOA 1ELUA 1W7NA 2VMVA 1W23A 3B8XA 1MGVA 2OKKA 1QJ5A 4I8AA 2HOYA 4RIZA 4ZDPA 3ISLA 3FTBA 3HT4A 3GZDC 3FVXA 3GZCA 4XJLA 2VLFA 4BHDA 2BWPA 2QB2A 2OKJA 2VMYA 4H51A 4ADCA 1UU1A 3E2ZB 1I43A 2VMRA 2DGKA 3NDNA 3DXWA 2VGWA 3DR7A 1DGDA 3BWNC 2CH2A 4NOGA 1S06A 3RQ1A 1QZ9A 3M5UA 1O69A 1VJOA 1ARSA 2BI2A 1H0CA 2AY1A 3FQ7A 3EZ1A 4BMKA 1E5FA 3WCOA 2BI5A 2AY3A 1RV3A 2E7IA 3MAFA 3N0LA 2E54A 5EAVA 2HOXA 5LH9A 1V2EA 1B4XA 2D5YA 2W7EA 1AHFA 1JS3A 1BJNA 2FN6A 2W7JA 3EI5A 4IY7A 1BJWA 1O4SA 2EZ2A 2VMUA 5E3KA 2W7MA 4BQ0A 4OT8A 3KGWA 3FKDA 4UHNA 4RKCA 1T3IA 5D95A 3WGCA 4ZM3A 4ZAHA 1W7MA 1LKCA 1CL2A 2BI1A 4MQQA 4B9BA 2WK7A 4F5LA 2YKYA 1AMSA 2D66A 3JTXA 2VMWA 2NMPA 3E2FA 2R5CB 4IYOB 3AOWA 1YJYA 5HHYA 1LS3A 1EQBA 1AY4A 1G4XA 3A9XA 4Y0DA 1ASBA 2VMPA 4A72A 4WB0B 4JEYA 1FG7A 4F5JA 1CZCA 1GBNA 3UAKA 5IWQA 1GDEA 4ZDOA 4MKJA 1U08A 2R0TA 3DODA 3P1TA 1DFOA 2C0RA 3BN1A 3W1HA 4MSOA 1B8GA 1DGEA 3TFTA 1UU0A 1WYUA 4OMAA 5HXXA 2HUIA 2CB1A 3GSBA 3K7YA 2D63A 3FDDA 3RCHA 2R2NA 2VMOA 1S09A 2DGMA 4UOYA 3W1JA 4WLJA 3GR9A 2VMNA 1IX6A 5FT8A 2Z9UA 3MC6A 3EI9A 2XBNA 3GBXA 1X28A 1PFFA 2ZJGA 1C4KA 1ORDA 2EGYA 3BCXA 1C9CA 4FFCA 5F8VA 1FC4A 4Q76A 1ELQA 2HP2A 1JS6A 4RAEA 4XAUA 5EFSA 3WX9A 1DKAA 1WYTA 2JGTA 1X0MA 3OKSA 2GQNA 3ASAA 1G7XA 1S0AA 1LK9A 4GEBA 4ZWMA 4RKDA 1KL2A 3WZFA 4F4EA 1Y4IA 4E1OA 2YOBA 3GJUA 2C81A 5FT5A 1RVYA 3PD6B 1S07A 3HQTA 1Z3ZA 3MAUA 1OHWA 3ECDA 4UHOA 3L8AA 4W1XA 5TF5A 4ATPA 3LVMA 1QJ3A 1SZKA 2ZUKA 3B1EA 1O62A
chains in the Genus database with same CATH superfamily
2W8JA 3I4JA 1IJIA 1SPAA 3PDBB 3RBLA 4P7YA 4AH3A 4WP0A 2Z9VA 1X29A 2AY8A 2FNIA 1N31A 3NX3A 2WKAA 3BS8A 1AKBA 3P6KA 4PVFA 3TQXA 3USFA 3VK2A 3E2ZA 1ASLA 3AOVA 5EQCA 2W7DA 4F5IA 5M4DA 4Y0IA 5E4ZA 1WYVB 2JJEA 1AMQA 1LC7A 1PMOA 2YCNA 1CS1A 1TOJA 2DR1A 3MBBA 1LC5A 5DJ9A 5EUNA 4WBTA 4ADEA 1ZODA 4F5MA 3NYTA 2W8TA 1RV4A 1OHYA 2BHXA 1AJSB 3COGA 2YHKA 1P3WA 2ZY5A 3E9KA 1ASNA 2BKWA 2D65A 2GSAA 1DJ9A 4A0RA 3N7NA 2EZ1A 1ARHA 4O6ZA 2VI8A 2Z9WA 4U2HA 1C0NA 1CJ0A 3FQ8A 1GEXA 3GWPA 2OQXA 2QBTA 1KKJA 1M4NA 4QGRA 3ELEA 2TPLA 2VYCA 2G6WA 1ARGA 1I48A 2HORA 2O0RA 1LW5A 3E6GA 5G2QA 5AX8A 1JG8A 4W5KA 2BIGA 5I92A 2W8VA 3BWNA 3VK4A 1ASMA 3PIUA 4JF1A 1PMMA 1GD9A 4WYGA 1IAYA 2R5CA 4CVQA 3N4XA 4IYOA 1AICA 5EIGB 4FL0A 4IW7A 3NRAA 4MGRA 3FDBA 4RJ0A 3DR4A 3QHXA 3QM2A 4GE7A 4WB0A 1AHEA 1GC3A 3ATHA 2VGSA 1ARIA 2WK9A 3ZRRA 1CQ8A 1ECXA 1MAPA 2CANA 2C7TA 4J8LA 2BYLA 3FFRA 1M6SA 1QITA 2W8UA 4ADDA 2OGEA 3LG0A 3UE8A 2D7ZA 4IXZA 2CSTA 1W7LA 2GMSA 1IVRA 2JISA 5G2PA 5M46A 4PFFA 4A6RA 3NYSA 4ADBA 3CQ4A 2A1VA 5G4JA 3NUIA 2O1BA 3QN6A 4R8DA 4F5KA 4JEWA 1GEWA 2W8WA 3DZZA 4OYTA 4CXQA 4WXBA 1AHYA 2GB3A 2JJHA 1BJOB 3B1CA 5EUEA 3KGXA 1BKGA 3OP7A 4W91A 4IXSA 4LC3A 2VMXA 4A00A 4K2MA 4AZKA 1M7YA 2AY9A 3WKSA 1GCKA 3ZZJA 4MY5A 2E7UA 3F9TA 3AEMA 4AZJA 4RJYA 4E3RA 3NU8A 4CBRA 5M49A 3BV0A 1TASA 4EMYA 3CQ5A 1GC2A 3L44A 3W1IA 3TCMA 1M32A 2BIEA 3DXVA 2ZP7A 2V1PA 3MKJA 2CTZA 1D7SA 1H1CA 3AEMC 3PD6A 4W8IA 3JWBA 1KKPA 3WGBA 2X5FA 5BJ3A 3B46A 2PO3A 4Q75A 1JF9A 2Z67A 1UKJA 2CJHA 1BQDA 4XJMA 4GE4A 1AKAA 3ELPA 3H7FA 1VEFA 2BWOA 2DKJA 4B98A 3FSLA 4GE9A 2PB0A 4JEXA 3PPLA 1WYVA 1DJEA 3DC1A 3EZSA 2BI3A 3AENB 3A2BA 1SVVA 3ZRPA 5LHAA 1OATA 3JZLA 4JE5D 1WKGA 4RLGA 1D7VA 4JE5A 4A6UA 1AJSA 1I29A 2VGTA 4K05A 5DB5A 5HDMA 3R4TA 2OATA 3EI7A 3KKIA 4DGTA 2AY5A 3H14A 3FZ7A 3FFHA 2Z1ZA 3N4SA 1B5OA 1TOKA 1MDZA 4KAMA 4ZSWA 1C7NA 1SZUA 1CL1A 2BYJA 1ASCA 3NUBA 4WYCA 3DRDA 3AV7A 5BJ4A 3FZ8A 3BWOA 3FZ6A 5D5SA 1M0QA 2FYFA 5J8QA 1IBJA 4ITGA 2VIAA 3G8MA 5M4BA 4MKKA 4WYFA 3TFUA 2W7HA 4ATQA 2W7IA 1AY8A 3K28A 4W1VA 1SF2A 2Z20A 3CBFA 1SZSA 2QA3A 4ITXA 4WYDA 4CBSA 2YRIA 4RITA 3E2YA 1J32A 4RM1A 3WCNA 2VMTA 2AY6A 4EB7A 1B9IA 3QPGA 5EIGA 4EB5A 1PG8A 4IX8A 3BCBA 2W7FA 1OXOA 3EI6A 1EJIA 3FD0A 1I41A 5C6UA 2EYQA 1TOEA 4JEVA 4R2NA 4MQPA 3AATA 1D7UA 1WKHA 2W7GA 4ZDLA 3PGYA 1W3UA 3VK3A 2GMUA 3D6KA 4WXFA 2VMSA 2X3LA 3G7QA 3LV2A 1AY5A 1EG5A 3FCRA 2ZY2A 4DQ6A 5DJ1A 1ASGA 3MADA 4ZSYA 4Y0HA 3N5MA 3GETA 3WLXA 2WK8A 4OBVA 1E5EA 2JJGA 1OXPA 3FVSA 4XEWA 3LWSA 4UHMA 4E3QA 4PIWA 2O7CA 2YRRA 3B1DA 3HBXA 2BI9A 1BJOA 1TOIA 1KMKA 3LVJA 1ZC9A 1GC4A 3JW9A 4LNMA 3F0HA 2CY8A 4XJPA 1YNUA 2Z1YA 4MQRA 2HZPA 4E77A 4R5ZA 2AEUA 4EFFA 7AATA 1X2AA 2G7JA 4IXOA 4JF0A 4A0HA 4XQ2A 4HF8A 4F5FA 1BQAA 3HL2A 1DJUA 4P3MA 2CJGA 1O61A 2D7YA 2VMQA 1N2TA 3I16A 1KAFA 2PB2A 3PDXA 2ZSMA 1BW0A 1ASEA 1YJSA 2VGZA 3PAAA 1OHVA 3JU7A 2ZY4A 1AKCA 4ZWVA 3QI6A 2CFBA 4A0FA 2KFPA 2ORDA 4A0GA 4TMRA 4DBCA 9AATA 3FRKA 3DU4A 4AOAA 2QLRA 1YJZA 1C7OA 2WB6A 4Q31A 2AY4A 1G7WA 2FQ6A 5G0AA 1CQ6A 2W7KA 4F5GA 2HP1A 3AENA 1AIBA 3G0TA 2HUUA 3NTJA 3AELA 2XH1A 1BJ4A 4PFNA 4OCAA 2FM1A 4A6TA 3PA9A 4ZM4A 1AX4A 4BA4A 2BIAA 1YAAA 1D2FA 4OTLA 1TOGA 4EU1A 3VAXA 1C7GA 1AHGA 4TN4A 1SFFA 4U1TA 2YCPA 1MAQA 3A8UX 3PJ0A 4ZLVA 5FT6A 3HVYA 3RI6A 1AIAA 1ZOBA 1ASDA 2QB3A 4WYEA 2AEVA 3BC8A 1YIYA 4WYAA 4CXRA 1BS0A 1RVUA 3AEPA 4LW4A 1G4VA 5FT4A 4R5FA 4N0WA 1D7RA 3K40A 4XJOA 2FNUA 1CZEA 3PDBA 4W1WA 2E7JA 3JWAA 3FVUA 4TV7A 4UQVA 3CAIA 1FG3A 2CJDA 3ACZA 4OC9A 4AO4A 2JJFA 4K2IA 3WY7A 1YOOA 3ZRQA 2V0YA 1LC8A 3LVLB 4K2BA 1ASFA 4BA5A 1IUGA 4WLHA 3NYUA 3NNKA 5G09A 2Z61A 4M2KA 5F9SA 3DYDA 1MLZA 2EO5A 3EIBA 2VMZA 3A9YA 3MAFB 3TATA 3E77A 4LW2A 4Q6RA 2QMAA 3AEJA 1Z7DA 2RFVA 1MLYA 3Q8NA 1DTYA 2CH1A 4HVKA 1CQ7A 1AMRA 3QBOA 3CQ6A 4ISYA 3RBFA 1V2DA 1V2FA 1KL1A 2F8JA 3MEBA 1QIRA 2VGVA 4LNLA 3FQAA 3AEJC 1LW4A 1J04A 3N75A 1V72A 2C44A 3EIAA 1ASAA 2YCTA 3IHJA 3F6TA 1BT4A 3EUCA 2W7LA 3MC6C 1AHXA 3QGUA 3VOMA 3VP6A 2VIBA 4GRXA 4JEZA 3LVKA 2D64A 2ZYJA 8AATA 3KE3A 4L0OA 1XI9A 3T32A 1IX8A 2DGLA 1VP4A 1AJRA 4AO9A 1S08A 4LNJA 2EPJA 1MDXA 2VGUA 5DX5A 2VI9A 2R5EA 1UU2A 1AAMA 1GEYA 1M0NA 1TATA 1WSTA 3ASBA 4M2JA 2JG2A 3HLMA 1ARTA 2AATA 1QGNA 1WYUB 3WKRA 1TPLA 1AMAA 1YIZA 2BWNA 3HMUA 4F5HA 3UWCA 1KMJA 4GSAA 4WXGA 2AY7A 1M0OA 3RCHB 5K8BA 4J5UA 3I5TA 1MDOA 1IAXA 2X5DA 2DOUA 5JAYA 1IX7A 4KYOA 2ZC0A 2CINA 2Q7WA 3A9ZA 4GDYA 4N0BA 1B5PA 4XK1A 3EI8A 5E5IA 3II0A 3H9XA 4WD2A 5EUDA 2VLHA 2YKUA 1N8PA 3NU7A 2YKXA 2OGAA 2EH6A 3ZZKA 4ZASA 2D61A 3AEOA 2DKBA 3BCAA 1B9HA 1XEYA 1WYTB 2HOZA 2ZY3A 2AY2A 2HUFA 1TARA 5EAAA 3IF2A 3R9AA 1AAWA 2Z9XA 2X8UA 2ZSLA 1QISA 3GZDA 4KXKA 3N4RA 1GC0A 1M0PA 3RUYA 3BB8A 3LY1A 2YKVA 4M2MA 4OBUA 5G4IA 3HDOA 1ELUA 1W7NA 2VMVA 1W23A 3B8XA 1MGVA 2OKKA 1QJ5A 4I8AA 2HOYA 4RIZA 4ZDPA 3ISLA 3FTBA 3HT4A 3GZDC 3FVXA 3GZCA 4XJLA 2VLFA 4BHDA 2BWPA 2QB2A 2OKJA 2VMYA 4H51A 4ADCA 1UU1A 3E2ZB 1I43A 2VMRA 2DGKA 3NDNA 3DXWA 2VGWA 3DR7A 1DGDA 3BWNC 2CH2A 4NOGA 1S06A 3RQ1A 1QZ9A 3M5UA 1O69A 4H63Q 1VJOA 1ARSA 2BI2A 1H0CA 2AY1A 3FQ7A 3EZ1A 4BMKA 1E5FA 3WCOA 2BI5A 2AY3A 1RV3A 2E7IA 3MAFA 3N0LA 2E54A 5EAVA 2HOXA 5LH9A 1V2EA 1B4XA 2D5YA 2W7EA 2QSRA 5KTBA 1AHFA 1JS3A 1BJNA 2FN6A 2W7JA 3EI5A 4IY7A 1BJWA 1O4SA 2EZ2A 2VMUA 5E3KA 2W7MA 4BQ0A 4OT8A 3KGWA 3FKDA 4UHNA 4RKCA 1T3IA 5D95A 3WGCA 4ZM3A 4ZAHA 1W7MA 1LKCA 1CL2A 2BI1A 4MQQA 4B9BA 2WK7A 4F5LA 2YKYA 1AMSA 2D66A 3JTXA 2VMWA 2NMPA 3E2FA 2R5CB 4IYOB 3AOWA 1YJYA 5HHYA 1LS3A 1EQBA 1AY4A 1G4XA 3A9XA 4Y0DA 1ASBA 2VMPA 4A72A 4WB0B 4JEYA 1FG7A 4F5JA 1CZCA 1GBNA 3UAKA 5IWQA 1GDEA 4ZDOA 4MKJA 1U08A 2R0TA 3DODA 3P1TA 1DFOA 2C0RA 3BN1A 3W1HA 4MSOA 1B8GA 1DGEA 3TFTA 1UU0A 1WYUA 4OMAA 5HXXA 2HUIA 2CB1A 2FKIA 3GSBA 3K7YA 2D63A 3FDDA 3RCHA 2R2NA 2VMOA 1S09A 2DGMA 4UOYA 3W1JA 4WLJA 3GR9A 2VMNA 1IX6A 5FT8A 2Z9UA 3MC6A 3EI9A 2XBNA 3GBXA 1X28A 1PFFA 2ZJGA 1C4KA 1ORDA 2EGYA 3BCXA 1C9CA 4FFCA 5F8VA 1FC4A 4Q76A 1ELQA 2HP2A 1JS6A 4RAEA 4XAUA 5EFSA 3WX9A 1DKAA 1WYTA 2JGTA 1X0MA 3OKSA 2GQNA 3ASAA 1G7XA 1S0AA 1LK9A 4GEBA 4ZWMA 4RKDA 1KL2A 3WZFA 4F4EA 1Y4IA 4E1OA 2YOBA 3GJUA 2C81A 5FT5A 1RVYA 3PD6B 1S07A 3HQTA 1Z3ZA 3MAUA 1OHWA 3ECDA 4UHOA 3L8AA 4W1XA 5TF5A 4ATPA 3LVMA 1QJ3A 1SZKA 2ZUKA 3B1EA 1O62A
chains in the Genus database with same CATH topology
2W8JA 3I4JA 1IJIA 1SPAA 3PDBB 3RBLA 4P7YA 4AH3A 4WP0A 2Z9VA 1X29A 2AY8A 2FNIA 1N31A 3NX3A 2WKAA 3BS8A 1AKBA 3P6KA 4PVFA 3TQXA 3USFA 3VK2A 3E2ZA 1ASLA 3AOVA 5EQCA 2W7DA 4F5IA 5M4DA 4Y0IA 5E4ZA 1WYVB 2JJEA 1AMQA 1LC7A 1PMOA 2YCNA 1CS1A 1TOJA 2DR1A 3MBBA 1LC5A 5DJ9A 5EUNA 4WBTA 4ADEA 1ZODA 4F5MA 3NYTA 2W8TA 1RV4A 1OHYA 2BHXA 1AJSB 3COGA 2YHKA 1P3WA 2ZY5A 3E9KA 1ASNA 2BKWA 2D65A 2GSAA 1DJ9A 4A0RA 3N7NA 2EZ1A 1ARHA 4O6ZA 2VI8A 2Z9WA 4U2HA 1C0NA 1CJ0A 3FQ8A 1GEXA 3GWPA 2OQXA 2QBTA 1KKJA 1M4NA 4QGRA 3ELEA 2TPLA 2VYCA 2G6WA 1ARGA 1I48A 2HORA 2O0RA 1LW5A 3E6GA 5G2QA 5AX8A 1JG8A 4W5KA 2BIGA 5I92A 2W8VA 3BWNA 3VK4A 1ASMA 3PIUA 4JF1A 1PMMA 1GD9A 4WYGA 1IAYA 2R5CA 4CVQA 3N4XA 4IYOA 1AICA 5EIGB 4FL0A 4IW7A 3NRAA 4MGRA 3FDBA 4RJ0A 3DR4A 3QHXA 3QM2A 4GE7A 4WB0A 1AHEA 1GC3A 3ATHA 2VGSA 1ARIA 2WK9A 3ZRRA 1CQ8A 1ECXA 1MAPA 2CANA 2C7TA 4J8LA 2BYLA 3FFRA 1M6SA 1QITA 2W8UA 4ADDA 2OGEA 3LG0A 3UE8A 2D7ZA 4IXZA 2CSTA 1W7LA 2GMSA 1IVRA 2JISA 5G2PA 5M46A 4PFFA 4A6RA 3NYSA 4ADBA 3CQ4A 2A1VA 5G4JA 3NUIA 2O1BA 3QN6A 4R8DA 4F5KA 4JEWA 1GEWA 2W8WA 3DZZA 4OYTA 4CXQA 4WXBA 1AHYA 2GB3A 2JJHA 1BJOB 3B1CA 5EUEA 3KGXA 1BKGA 3OP7A 4W91A 4IXSA 4LC3A 2VMXA 4A00A 4K2MA 4AZKA 1M7YA 2AY9A 3WKSA 1GCKA 3ZZJA 4MY5A 2E7UA 3F9TA 3AEMA 4AZJA 4RJYA 4E3RA 3NU8A 4CBRA 5M49A 3BV0A 1TASA 4EMYA 3CQ5A 1GC2A 3L44A 3W1IA 3TCMA 1M32A 2BIEA 3DXVA 2ZP7A 2V1PA 3MKJA 2CTZA 1D7SA 1H1CA 3AEMC 3PD6A 4W8IA 3JWBA 1KKPA 3WGBA 2X5FA 5BJ3A 3B46A 2PO3A 4Q75A 1JF9A 2Z67A 1UKJA 2CJHA 1BQDA 4XJMA 4GE4A 1AKAA 3ELPA 3H7FA 1VEFA 2BWOA 2DKJA 4B98A 3FSLA 4GE9A 2PB0A 4JEXA 3PPLA 1WYVA 1DJEA 3DC1A 3EZSA 2BI3A 3AENB 3A2BA 1SVVA 3ZRPA 5LHAA 1OATA 3JZLA 4JE5D 1WKGA 4RLGA 1D7VA 4JE5A 4A6UA 1AJSA 1I29A 2VGTA 4K05A 5DB5A 5HDMA 3R4TA 2OATA 3EI7A 3KKIA 4DGTA 2AY5A 3H14A 3FZ7A 3FFHA 2Z1ZA 3N4SA 1B5OA 1TOKA 1MDZA 4KAMA 4ZSWA 1C7NA 1SZUA 1CL1A 2BYJA 1ASCA 3NUBA 4WYCA 3DRDA 3AV7A 5BJ4A 3FZ8A 3BWOA 3FZ6A 5D5SA 1M0QA 2FYFA 5J8QA 1IBJA 4ITGA 2VIAA 3G8MA 5M4BA 4MKKA 4WYFA 3TFUA 2W7HA 4ATQA 2W7IA 1AY8A 3K28A 4W1VA 1SF2A 2Z20A 3CBFA 1SZSA 2QA3A 4ITXA 4WYDA 4CBSA 2YRIA 4RITA 3E2YA 1J32A 4RM1A 3WCNA 2VMTA 2AY6A 4EB7A 1B9IA 3QPGA 5EIGA 4EB5A 1PG8A 4IX8A 3BCBA 2W7FA 1OXOA 3EI6A 1EJIA 3FD0A 1I41A 5C6UA 2EYQA 1TOEA 4JEVA 4R2NA 4MQPA 3AATA 1D7UA 1WKHA 2W7GA 4ZDLA 3PGYA 1W3UA 3VK3A 2GMUA 3D6KA 4WXFA 2VMSA 2X3LA 3G7QA 3LV2A 1AY5A 1EG5A 3FCRA 2ZY2A 4DQ6A 5DJ1A 1ASGA 3MADA 4ZSYA 4Y0HA 3N5MA 3GETA 3WLXA 2WK8A 4OBVA 1E5EA 2JJGA 1OXPA 3FVSA 4XEWA 3LWSA 4UHMA 4E3QA 4PIWA 2O7CA 2YRRA 3B1DA 3HBXA 2BI9A 1BJOA 1TOIA 1KMKA 3LVJA 1ZC9A 1GC4A 3JW9A 4LNMA 3F0HA 2CY8A 4XJPA 1YNUA 2Z1YA 4MQRA 2HZPA 4E77A 4R5ZA 2AEUA 4EFFA 7AATA 1X2AA 2G7JA 4IXOA 4JF0A 4A0HA 4XQ2A 4HF8A 4F5FA 1BQAA 3HL2A 1DJUA 4P3MA 2CJGA 1O61A 2D7YA 2VMQA 1N2TA 3I16A 2PB2A 3PDXA 2ZSMA 1BW0A 1ASEA 1YJSA 2VGZA 3PAAA 1OHVA 3JU7A 2ZY4A 1AKCA 4ZWVA 3QI6A 2CFBA 4A0FA 2KFPA 2ORDA 4A0GA 4TMRA 4DBCA 9AATA 3FRKA 3DU4A 4AOAA 2QLRA 1YJZA 1C7OA 2WB6A 4Q31A 2AY4A 1G7WA 2FQ6A 5G0AA 1CQ6A 2W7KA 4F5GA 2HP1A 3AENA 1AIBA 3G0TA 2HUUA 3NTJA 3AELA 2XH1A 1BJ4A 4PFNA 4OCAA 2FM1A 4A6TA 3PA9A 4ZM4A 1AX4A 4BA4A 2BIAA 1YAAA 1D2FA 4OTLA 1TOGA 4EU1A 3VAXA 1C7GA 1AHGA 4TN4A 1SFFA 4U1TA 2YCPA 1MAQA 3A8UX 3PJ0A 4ZLVA 5FT6A 3HVYA 3RI6A 1AIAA 1ZOBA 1ASDA 2QB3A 4WYEA 2AEVA 3BC8A 1YIYA 4WYAA 4CXRA 1BS0A 1RVUA 3AEPA 4LW4A 1G4VA 5FT4A 4R5FA 4N0WA 1D7RA 3K40A 4XJOA 2FNUA 1CZEA 3PDBA 4W1WA 2E7JA 3JWAA 3FVUA 4TV7A 4UQVA 3CAIA 1FG3A 2CJDA 3ACZA 4OC9A 4AO4A 2JJFA 4K2IA 3WY7A 1YOOA 3ZRQA 2V0YA 1LC8A 3LVLB 4K2BA 1ASFA 4BA5A 1IUGA 4WLHA 3NYUA 3NNKA 5G09A 2Z61A 4M2KA 5F9SA 3DYDA 1MLZA 2EO5A 3EIBA 2VMZA 3A9YA 3MAFB 3TATA 3E77A 4LW2A 4Q6RA 2QMAA 3AEJA 1Z7DA 2RFVA 1MLYA 3Q8NA 1DTYA 2CH1A 4HVKA 1CQ7A 1AMRA 3QBOA 3CQ6A 4ISYA 3RBFA 1V2DA 1V2FA 1KL1A 2F8JA 3MEBA 1QIRA 2VGVA 4LNLA 3FQAA 3AEJC 1LW4A 1J04A 3N75A 1V72A 2C44A 3EIAA 1ASAA 2YCTA 3IHJA 3F6TA 1BT4A 3EUCA 2W7LA 3MC6C 1AHXA 3QGUA 3VOMA 3VP6A 2VIBA 4GRXA 4JEZA 3LVKA 2D64A 2ZYJA 8AATA 3KE3A 4L0OA 1XI9A 3T32A 1IX8A 2DGLA 1VP4A 1AJRA 4AO9A 1S08A 4LNJA 2EPJA 1MDXA 2VGUA 5DX5A 2VI9A 2R5EA 1UU2A 1AAMA 1GEYA 1M0NA 1TATA 1WSTA 3ASBA 4M2JA 2JG2A 3HLMA 1ARTA 2AATA 1QGNA 1WYUB 3WKRA 1TPLA 1AMAA 1YIZA 2BWNA 3HMUA 4F5HA 3UWCA 1KMJA 4GSAA 4WXGA 2AY7A 1M0OA 3RCHB 5K8BA 4J5UA 3I5TA 1MDOA 1IAXA 2X5DA 2DOUA 5JAYA 1IX7A 4KYOA 2ZC0A 2CINA 2Q7WA 3A9ZA 4GDYA 4N0BA 1B5PA 4XK1A 3EI8A 5E5IA 3II0A 3H9XA 4WD2A 5EUDA 2VLHA 2YKUA 1N8PA 3NU7A 2YKXA 2OGAA 2EH6A 3ZZKA 4ZASA 2D61A 3AEOA 2DKBA 3BCAA 1B9HA 1XEYA 1WYTB 2HOZA 2ZY3A 2AY2A 2HUFA 1TARA 5EAAA 3IF2A 3R9AA 1AAWA 2Z9XA 2X8UA 2ZSLA 1QISA 3GZDA 4KXKA 3N4RA 1GC0A 1M0PA 3RUYA 3BB8A 3LY1A 2YKVA 4M2MA 4OBUA 5G4IA 3HDOA 1ELUA 1W7NA 2VMVA 1W23A 3B8XA 1MGVA 2OKKA 1QJ5A 4I8AA 2HOYA 4RIZA 4ZDPA 3ISLA 3FTBA 3HT4A 3GZDC 3FVXA 3GZCA 4XJLA 2VLFA 4BHDA 2BWPA 2QB2A 2OKJA 2VMYA 4H51A 4ADCA 1UU1A 3E2ZB 1I43A 2VMRA 2DGKA 3NDNA 3DXWA 2VGWA 3DR7A 1DGDA 3BWNC 2CH2A 4NOGA 1S06A 3RQ1A 1QZ9A 3M5UA 1O69A 4H63Q 1VJOA 1ARSA 2BI2A 1H0CA 2AY1A 3FQ7A 3EZ1A 4BMKA 1E5FA 3WCOA 2BI5A 2AY3A 1RV3A 2E7IA 3MAFA 3N0LA 2E54A 5EAVA 2HOXA 5LH9A 1V2EA 1B4XA 2D5YA 2W7EA 2QSRA 5KTBA 1AHFA 1JS3A 1BJNA 2FN6A 2W7JA 3EI5A 4IY7A 1BJWA 1O4SA 2EZ2A 2VMUA 5E3KA 2W7MA 4BQ0A 4OT8A 3KGWA 3FKDA 4UHNA 4RKCA 1T3IA 5D95A 3WGCA 4ZM3A 4ZAHA 1W7MA 1LKCA 1CL2A 2BI1A 4MQQA 4B9BA 2WK7A 4F5LA 2YKYA 1AMSA 2D66A 3JTXA 2VMWA 2NMPA 3E2FA 2R5CB 4IYOB 3AOWA 1YJYA 5HHYA 1LS3A 1EQBA 1AY4A 1G4XA 3A9XA 4Y0DA 1ASBA 2VMPA 4A72A 4WB0B 4JEYA 1FG7A 4F5JA 1CZCA 1GBNA 3UAKA 5IWQA 1GDEA 4ZDOA 4MKJA 1U08A 2R0TA 3DODA 3P1TA 1DFOA 2C0RA 3BN1A 3W1HA 4MSOA 1B8GA 1DGEA 3TFTA 1UU0A 1WYUA 4OMAA 5HXXA 2HUIA 2CB1A 2FKIA 3GSBA 3K7YA 2D63A 3FDDA 3RCHA 2R2NA 2VMOA 1S09A 2DGMA 4UOYA 3W1JA 4WLJA 3GR9A 2VMNA 1IX6A 5FT8A 2Z9UA 3MC6A 3EI9A 2XBNA 3GBXA 1X28A 1PFFA 2ZJGA 1C4KA 1ORDA 2EGYA 3BCXA 1C9CA 4FFCA 5F8VA 1FC4A 4Q76A 1ELQA 2HP2A 1JS6A 4RAEA 4XAUA 5EFSA 3WX9A 1DKAA 1WYTA 2JGTA 1X0MA 3OKSA 2GQNA 3ASAA 1G7XA 1S0AA 1LK9A 4GEBA 4ZWMA 4RKDA 1KL2A 3WZFA 4F4EA 1Y4IA 4E1OA 2YOBA 3GJUA 2C81A 5FT5A 1RVYA 3PD6B 1S07A 3HQTA 1Z3ZA 3MAUA 1OHWA 3ECDA 4UHOA 3L8AA 4W1XA 5TF5A 4ATPA 3LVMA 1QJ3A 1SZKA 2ZUKA 3B1EA 1O62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8J A;  3I4J A;  1IJI A;  1SPA A;  3PDB B;  3RBL A;  4P7Y A;  4AH3 A;  4WP0 A;  2Z9V A;  1X29 A;  2AY8 A;  2FNI A;  1N31 A;  3NX3 A;  2WKA A;  3BS8 A;  1AKB A;  3P6K A;  4PVF A;  3TQX A;  3USF A;  3VK2 A;  3E2Z A;  1ASL A;  3AOV A;  5EQC A;  2W7D A;  4F5I A;  5M4D A;  4Y0I A;  5E4Z A;  1WYV B;  2JJE A;  1AMQ A;  1LC7 A;  1PMO A;  2YCN A;  1CS1 A;  1TOJ A;  2DR1 A;  3MBB A;  1LC5 A;  5DJ9 A;  5EUN A;  4WBT A;  4ADE A;  1ZOD A;  4F5M A;  3NYT A;  2W8T A;  1RV4 A;  1OHY A;  2BHX A;  1AJS B;  3COG A;  2YHK A;  1P3W A;  2ZY5 A;  3E9K A;  1ASN A;  2BKW A;  2D65 A;  2GSA A;  1DJ9 A;  4A0R A;  2EZ1 A;  1ARH A;  4O6Z A;  2VI8 A;  2Z9W A;  4U2H A;  1C0N A;  1CJ0 A;  3FQ8 A;  1GEX A;  3GWP A;  2OQX A;  2QBT A;  1KKJ A;  1M4N A;  4QGR A;  3ELE A;  2TPL A;  2VYC A;  2G6W A;  1ARG A;  1I48 A;  2HOR A;  2O0R A;  1LW5 A;  3E6G A;  5G2Q A;  5AX8 A;  1JG8 A;  4W5K A;  2BIG A;  5I92 A;  2W8V A;  3BWN A;  3VK4 A;  1ASM A;  3PIU A;  4JF1 A;  1PMM A;  1GD9 A;  4WYG A;  1IAY A;  2R5C A;  4CVQ A;  4IYO A;  1AIC A;  5EIG B;  4FL0 A;  4IW7 A;  3NRA A;  4MGR A;  3FDB A;  4RJ0 A;  3DR4 A;  3QHX A;  3QM2 A;  4GE7 A;  4WB0 A;  1AHE A;  1GC3 A;  3ATH A;  2VGS A;  1ARI A;  2WK9 A;  3ZRR A;  1CQ8 A;  1ECX A;  1MAP A;  2CAN A;  2C7T A;  4J8L A;  2BYL A;  3FFR A;  1M6S A;  1QIT A;  2W8U A;  4ADD A;  2OGE A;  3LG0 A;  3UE8 A;  2D7Z A;  4IXZ A;  2CST A;  1W7L A;  2GMS A;  1IVR A;  2JIS A;  5G2P A;  5M46 A;  4PFF A;  4A6R A;  3NYS A;  4ADB A;  3CQ4 A;  5G4J A;  3NUI A;  2O1B A;  3QN6 A;  4R8D A;  4F5K A;  4JEW A;  1GEW A;  2W8W A;  3DZZ A;  4OYT A;  4CXQ A;  4WXB A;  1AHY A;  2GB3 A;  2JJH A;  1BJO B;  3B1C A;  5EUE A;  3KGX A;  1BKG A;  3OP7 A;  4W91 A;  4IXS A;  4LC3 A;  2VMX A;  4A00 A;  4K2M A;  4AZK A;  1M7Y A;  2AY9 A;  3WKS A;  1GCK A;  3ZZJ A;  4MY5 A;  2E7U A;  3F9T A;  3AEM A;  4AZJ A;  4RJY A;  4E3R A;  3NU8 A;  4CBR A;  5M49 A;  3BV0 A;  1TAS A;  4EMY A;  3CQ5 A;  1GC2 A;  3L44 A;  3W1I A;  3TCM A;  1M32 A;  2BIE A;  3DXV A;  2ZP7 A;  2V1P A;  3MKJ A;  2CTZ A;  1D7S A;  1H1C A;  3AEM C;  3PD6 A;  4W8I A;  3JWB A;  1KKP A;  3WGB A;  2X5F A;  5BJ3 A;  3B46 A;  2PO3 A;  4Q75 A;  1JF9 A;  2Z67 A;  1UKJ A;  2CJH A;  1BQD A;  4XJM A;  4GE4 A;  1AKA A;  3ELP A;  3H7F A;  1VEF A;  2BWO A;  2DKJ A;  4B98 A;  3FSL A;  4GE9 A;  2PB0 A;  4JEX A;  3PPL A;  1WYV A;  1DJE A;  3DC1 A;  3EZS A;  2BI3 A;  3AEN B;  3A2B A;  1SVV A;  3ZRP A;  5LHA A;  1OAT A;  3JZL A;  4JE5 D;  1WKG A;  4RLG A;  1D7V A;  4JE5 A;  4A6U A;  1AJS A;  1I29 A;  2VGT A;  5DB5 A;  5HDM A;  3R4T A;  2OAT A;  3EI7 A;  3KKI A;  4DGT A;  2AY5 A;  3H14 A;  3FZ7 A;  3FFH A;  2Z1Z A;  1B5O A;  1TOK A;  1MDZ A;  4KAM A;  4ZSW A;  1C7N A;  1SZU A;  1CL1 A;  2BYJ A;  1ASC A;  3NUB A;  4WYC A;  3DRD A;  3AV7 A;  5BJ4 A;  3FZ8 A;  3BWO A;  3FZ6 A;  5D5S A;  1M0Q A;  2FYF A;  5J8Q A;  1IBJ A;  4ITG A;  2VIA A;  3G8M A;  5M4B A;  4MKK A;  4WYF A;  3TFU A;  2W7H A;  4ATQ A;  2W7I A;  1AY8 A;  3K28 A;  4W1V A;  1SF2 A;  2Z20 A;  3CBF A;  1SZS A;  2QA3 A;  4ITX A;  4WYD A;  4CBS A;  2YRI A;  4RIT A;  3E2Y A;  1J32 A;  4RM1 A;  3WCN A;  2VMT A;  2AY6 A;  4EB7 A;  1B9I A;  3QPG A;  5EIG A;  4EB5 A;  1PG8 A;  4IX8 A;  3BCB A;  2W7F A;  1OXO A;  3EI6 A;  1EJI A;  3FD0 A;  1I41 A;  5C6U A;  1TOE A;  4JEV A;  4R2N A;  4MQP A;  3AAT A;  1D7U A;  1WKH A;  2W7G A;  4ZDL A;  3PGY A;  1W3U A;  3VK3 A;  2GMU A;  3D6K A;  4WXF A;  2VMS A;  2X3L A;  3G7Q A;  3LV2 A;  1AY5 A;  1EG5 A;  3FCR A;  2ZY2 A;  4DQ6 A;  5DJ1 A;  1ASG A;  3MAD A;  4ZSY A;  4Y0H A;  3N5M A;  3GET A;  3WLX A;  2WK8 A;  4OBV A;  1E5E A;  2JJG A;  1OXP A;  3FVS A;  4XEW A;  3LWS A;  4UHM A;  4E3Q A;  4PIW A;  2O7C A;  2YRR A;  3B1D A;  3HBX A;  2BI9 A;  1BJO A;  1TOI A;  1KMK A;  3LVJ A;  1ZC9 A;  1GC4 A;  3JW9 A;  4LNM A;  3F0H A;  2CY8 A;  4XJP A;  1YNU A;  2Z1Y A;  4MQR A;  2HZP A;  4E77 A;  4R5Z A;  2AEU A;  4EFF A;  7AAT A;  1X2A A;  4IXO A;  4JF0 A;  4A0H A;  4XQ2 A;  4HF8 A;  4F5F A;  1BQA A;  3HL2 A;  1DJU A;  4P3M A;  2CJG A;  1O61 A;  2D7Y A;  2VMQ A;  1N2T A;  3I16 A;  2PB2 A;  3PDX A;  2ZSM A;  1BW0 A;  1ASE A;  1YJS A;  2VGZ A;  3PAA A;  1OHV A;  3JU7 A;  2ZY4 A;  1AKC A;  4ZWV A;  3QI6 A;  2CFB A;  4A0F A;  2ORD A;  4A0G A;  4TMR A;  4DBC A;  9AAT A;  3FRK A;  3DU4 A;  4AOA A;  2QLR A;  1YJZ A;  1C7O A;  4Q31 A;  2AY4 A;  1G7W A;  2FQ6 A;  5G0A A;  1CQ6 A;  2W7K A;  4F5G A;  2HP1 A;  3AEN A;  1AIB A;  3G0T A;  2HUU A;  3NTJ A;  3AEL A;  2XH1 A;  1BJ4 A;  4PFN A;  4OCA A;  2FM1 A;  4A6T A;  3PA9 A;  4ZM4 A;  1AX4 A;  4BA4 A;  2BIA A;  1YAA A;  1D2F A;  4OTL A;  1TOG A;  4EU1 A;  3VAX A;  1C7G A;  1AHG A;  4TN4 A;  1SFF A;  4U1T A;  2YCP A;  1MAQ A;  3A8U X;  3PJ0 A;  4ZLV A;  5FT6 A;  3HVY A;  3RI6 A;  1AIA A;  1ZOB A;  1ASD A;  2QB3 A;  4WYE A;  2AEV A;  3BC8 A;  1YIY A;  4WYA A;  4CXR A;  1BS0 A;  1RVU A;  3AEP A;  4LW4 A;  1G4V A;  5FT4 A;  4R5F A;  4N0W A;  1D7R A;  3K40 A;  4XJO A;  2FNU A;  1CZE A;  3PDB A;  4W1W A;  2E7J A;  3JWA A;  3FVU A;  4TV7 A;  4UQV A;  3CAI A;  1FG3 A;  2CJD A;  3ACZ A;  4OC9 A;  4AO4 A;  2JJF A;  4K2I A;  3WY7 A;  1YOO A;  3ZRQ A;  2V0Y A;  1LC8 A;  3LVL B;  4K2B A;  1ASF A;  4BA5 A;  1IUG A;  4WLH A;  3NYU A;  3NNK A;  5G09 A;  2Z61 A;  4M2K A;  5F9S A;  3DYD A;  1MLZ A;  2EO5 A;  3EIB A;  2VMZ A;  3A9Y A;  3MAF B;  3TAT A;  3E77 A;  4LW2 A;  4Q6R A;  2QMA A;  3AEJ A;  1Z7D A;  2RFV A;  1MLY A;  3Q8N A;  1DTY A;  2CH1 A;  4HVK A;  1CQ7 A;  1AMR A;  3QBO A;  3CQ6 A;  4ISY A;  3RBF A;  1V2D A;  1V2F A;  1KL1 A;  2F8J A;  3MEB A;  1QIR A;  2VGV A;  4LNL A;  3FQA A;  3AEJ C;  1LW4 A;  1J04 A;  3N75 A;  1V72 A;  2C44 A;  3EIA A;  1ASA A;  2YCT A;  3IHJ A;  3F6T A;  1BT4 A;  3EUC A;  2W7L A;  3MC6 C;  1AHX A;  3QGU A;  3VOM A;  3VP6 A;  2VIB A;  4GRX A;  4JEZ A;  3LVK A;  2D64 A;  2ZYJ A;  8AAT A;  3KE3 A;  4L0O A;  1XI9 A;  3T32 A;  1IX8 A;  2DGL A;  1VP4 A;  1AJR A;  4AO9 A;  1S08 A;  4LNJ A;  2EPJ A;  1MDX A;  2VGU A;  5DX5 A;  2VI9 A;  2R5E A;  1UU2 A;  1AAM A;  1GEY A;  1M0N A;  1TAT A;  1WST A;  3ASB A;  4M2J A;  2JG2 A;  3HLM A;  1ART A;  2AAT A;  1QGN A;  1WYU B;  3WKR A;  1TPL A;  1AMA A;  1YIZ A;  2BWN A;  3HMU A;  4F5H A;  3UWC A;  1KMJ A;  4GSA A;  4WXG A;  2AY7 A;  1M0O A;  3RCH B;  5K8B A;  4J5U A;  3I5T A;  1MDO A;  1IAX A;  2X5D A;  2DOU A;  5JAY A;  1IX7 A;  4KYO A;  2ZC0 A;  2CIN A;  2Q7W A;  3A9Z A;  4GDY A;  4N0B A;  1B5P A;  4XK1 A;  3EI8 A;  5E5I A;  3II0 A;  4WD2 A;  5EUD A;  2VLH A;  2YKU A;  1N8P A;  3NU7 A;  2YKX A;  2OGA A;  2EH6 A;  3ZZK A;  4ZAS A;  2D61 A;  3AEO A;  2DKB A;  3BCA A;  1B9H A;  1XEY A;  1WYT B;  2HOZ A;  2ZY3 A;  2AY2 A;  2HUF A;  1TAR A;  5EAA A;  3IF2 A;  3R9A A;  1AAW A;  2Z9X A;  2X8U A;  2ZSL A;  1QIS A;  3GZD A;  4KXK A;  1GC0 A;  1M0P A;  3RUY A;  3BB8 A;  3LY1 A;  2YKV A;  4M2M A;  4OBU A;  5G4I A;  3HDO A;  1ELU A;  1W7N A;  2VMV A;  1W23 A;  3B8X A;  1MGV A;  2OKK A;  1QJ5 A;  4I8A A;  2HOY A;  4RIZ A;  4ZDP A;  3ISL A;  3FTB A;  3HT4 A;  3GZD C;  3FVX A;  3GZC A;  4XJL A;  2VLF A;  4BHD A;  2BWP A;  2QB2 A;  2OKJ A;  2VMY A;  4H51 A;  4ADC A;  1UU1 A;  3E2Z B;  1I43 A;  2VMR A;  2DGK A;  3NDN A;  3DXW A;  2VGW A;  3DR7 A;  1DGD A;  3BWN C;  2CH2 A;  4NOG A;  1S06 A;  3RQ1 A;  1QZ9 A;  3M5U A;  1O69 A;  1VJO A;  1ARS A;  2BI2 A;  1H0C A;  2AY1 A;  3FQ7 A;  3EZ1 A;  4BMK A;  1E5F A;  3WCO A;  2BI5 A;  2AY3 A;  1RV3 A;  2E7I A;  3MAF A;  3N0L A;  2E54 A;  5EAV A;  2HOX A;  5LH9 A;  1V2E A;  1B4X A;  2D5Y A;  2W7E A;  1AHF A;  1JS3 A;  1BJN A;  2FN6 A;  2W7J A;  3EI5 A;  4IY7 A;  1BJW A;  1O4S A;  2EZ2 A;  2VMU A;  5E3K A;  2W7M A;  4BQ0 A;  4OT8 A;  3KGW A;  3FKD A;  4UHN A;  4RKC A;  1T3I A;  5D95 A;  3WGC A;  4ZM3 A;  4ZAH A;  1W7M A;  1LKC A;  1CL2 A;  2BI1 A;  4MQQ A;  4B9B A;  2WK7 A;  4F5L A;  2YKY A;  1AMS A;  2D66 A;  3JTX A;  2VMW A;  2NMP A;  3E2F A;  2R5C B;  4IYO B;  3AOW A;  1YJY A;  5HHY A;  1LS3 A;  1EQB A;  1AY4 A;  1G4X A;  3A9X A;  4Y0D A;  1ASB A;  2VMP A;  4A72 A;  4WB0 B;  4JEY A;  1FG7 A;  4F5J A;  1CZC A;  1GBN A;  3UAK A;  5IWQ A;  1GDE A;  4ZDO A;  4MKJ A;  1U08 A;  2R0T A;  3DOD A;  3P1T A;  1DFO A;  2C0R A;  3BN1 A;  3W1H A;  4MSO A;  1B8G A;  1DGE A;  3TFT A;  1UU0 A;  1WYU A;  4OMA A;  5HXX A;  2HUI A;  2CB1 A;  3GSB A;  3K7Y A;  2D63 A;  3FDD A;  3RCH A;  2R2N A;  2VMO A;  1S09 A;  2DGM A;  4UOY A;  3W1J A;  4WLJ A;  3GR9 A;  2VMN A;  1IX6 A;  5FT8 A;  2Z9U A;  3MC6 A;  3EI9 A;  2XBN A;  3GBX A;  1X28 A;  1PFF A;  2ZJG A;  1C4K A;  1ORD A;  2EGY A;  3BCX A;  1C9C A;  4FFC A;  5F8V A;  1FC4 A;  4Q76 A;  1ELQ A;  2HP2 A;  1JS6 A;  4RAE A;  4XAU A;  5EFS A;  3WX9 A;  1DKA A;  1WYT A;  2JGT A;  1X0M A;  3OKS A;  2GQN A;  3ASA A;  1G7X A;  1S0A A;  1LK9 A;  4GEB A;  4ZWM A;  4RKD A;  1KL2 A;  3WZF A;  4F4E A;  1Y4I A;  4E1O A;  2YOB A;  3GJU A;  2C81 A;  5FT5 A;  1RVY A;  3PD6 B;  1S07 A;  3HQT A;  1Z3Z A;  3MAU A;  1OHW A;  3ECD A;  4UHO A;  3L8A A;  4W1X A;  5TF5 A;  4ATP A;  3LVM A;  1QJ3 A;  1SZK A;  2ZUK A;  3B1E A;  1O62 A; 
#chains in the Genus database with same CATH topology
 2W8J A;  3I4J A;  1IJI A;  1SPA A;  3PDB B;  3RBL A;  4P7Y A;  4AH3 A;  4WP0 A;  2Z9V A;  1X29 A;  2AY8 A;  2FNI A;  1N31 A;  3NX3 A;  2WKA A;  3BS8 A;  1AKB A;  3P6K A;  4PVF A;  3TQX A;  3USF A;  3VK2 A;  3E2Z A;  1ASL A;  3AOV A;  5EQC A;  2W7D A;  4F5I A;  5M4D A;  4Y0I A;  5E4Z A;  1WYV B;  2JJE A;  1AMQ A;  1LC7 A;  1PMO A;  2YCN A;  1CS1 A;  1TOJ A;  2DR1 A;  3MBB A;  1LC5 A;  5DJ9 A;  5EUN A;  4WBT A;  4ADE A;  1ZOD A;  4F5M A;  3NYT A;  2W8T A;  1RV4 A;  1OHY A;  2BHX A;  1AJS B;  3COG A;  2YHK A;  1P3W A;  2ZY5 A;  3E9K A;  1ASN A;  2BKW A;  2D65 A;  2GSA A;  1DJ9 A;  4A0R A;  3N7N A;  2EZ1 A;  1ARH A;  4O6Z A;  2VI8 A;  2Z9W A;  4U2H A;  1C0N A;  1CJ0 A;  3FQ8 A;  1GEX A;  3GWP A;  2OQX A;  2QBT A;  1KKJ A;  1M4N A;  4QGR A;  3ELE A;  2TPL A;  2VYC A;  2G6W A;  1ARG A;  1I48 A;  2HOR A;  2O0R A;  1LW5 A;  3E6G A;  5G2Q A;  5AX8 A;  1JG8 A;  4W5K A;  2BIG A;  5I92 A;  2W8V A;  3BWN A;  3VK4 A;  1ASM A;  3PIU A;  4JF1 A;  1PMM A;  1GD9 A;  4WYG A;  1IAY A;  2R5C A;  4CVQ A;  3N4X A;  4IYO A;  1AIC A;  5EIG B;  4FL0 A;  4IW7 A;  3NRA A;  4MGR A;  3FDB A;  4RJ0 A;  3DR4 A;  3QHX A;  3QM2 A;  4GE7 A;  4WB0 A;  1AHE A;  1GC3 A;  3ATH A;  2VGS A;  1ARI A;  2WK9 A;  3ZRR A;  1CQ8 A;  1ECX A;  1MAP A;  2CAN A;  2C7T A;  4J8L A;  2BYL A;  3FFR A;  1M6S A;  1QIT A;  2W8U A;  4ADD A;  2OGE A;  3LG0 A;  3UE8 A;  2D7Z A;  4IXZ A;  2CST A;  1W7L A;  2GMS A;  1IVR A;  2JIS A;  5G2P A;  5M46 A;  4PFF A;  4A6R A;  3NYS A;  4ADB A;  3CQ4 A;  2A1V A;  5G4J A;  3NUI A;  2O1B A;  3QN6 A;  4R8D A;  4F5K A;  4JEW A;  1GEW A;  2W8W A;  3DZZ A;  4OYT A;  4CXQ A;  4WXB A;  1AHY A;  2GB3 A;  2JJH A;  1BJO B;  3B1C A;  5EUE A;  3KGX A;  1BKG A;  3OP7 A;  4W91 A;  4IXS A;  4LC3 A;  2VMX A;  4A00 A;  4K2M A;  4AZK A;  1M7Y A;  2AY9 A;  3WKS A;  1GCK A;  3ZZJ A;  4MY5 A;  2E7U A;  3F9T A;  3AEM A;  4AZJ A;  4RJY A;  4E3R A;  3NU8 A;  4CBR A;  5M49 A;  3BV0 A;  1TAS A;  4EMY A;  3CQ5 A;  1GC2 A;  3L44 A;  3W1I A;  3TCM A;  1M32 A;  2BIE A;  3DXV A;  2ZP7 A;  2V1P A;  3MKJ A;  2CTZ A;  1D7S A;  1H1C A;  3AEM C;  3PD6 A;  4W8I A;  3JWB A;  1KKP A;  3WGB A;  2X5F A;  5BJ3 A;  3B46 A;  2PO3 A;  4Q75 A;  1JF9 A;  2Z67 A;  1UKJ A;  2CJH A;  1BQD A;  4XJM A;  4GE4 A;  1AKA A;  3ELP A;  3H7F A;  1VEF A;  2BWO A;  2DKJ A;  4B98 A;  3FSL A;  4GE9 A;  2PB0 A;  4JEX A;  3PPL A;  1WYV A;  1DJE A;  3DC1 A;  3EZS A;  2BI3 A;  3AEN B;  3A2B A;  1SVV A;  3ZRP A;  5LHA A;  1OAT A;  3JZL A;  4JE5 D;  1WKG A;  4RLG A;  1D7V A;  4JE5 A;  4A6U A;  1AJS A;  1I29 A;  2VGT A;  4K05 A;  5DB5 A;  5HDM A;  3R4T A;  2OAT A;  3EI7 A;  3KKI A;  4DGT A;  2AY5 A;  3H14 A;  3FZ7 A;  3FFH A;  2Z1Z A;  3N4S A;  1B5O A;  1TOK A;  1MDZ A;  4KAM A;  4ZSW A;  1C7N A;  1SZU A;  1CL1 A;  2BYJ A;  1ASC A;  3NUB A;  4WYC A;  3DRD A;  3AV7 A;  5BJ4 A;  3FZ8 A;  3BWO A;  3FZ6 A;  5D5S A;  1M0Q A;  2FYF A;  5J8Q A;  1IBJ A;  4ITG A;  2VIA A;  3G8M A;  5M4B A;  4MKK A;  4WYF A;  3TFU A;  2W7H A;  4ATQ A;  2W7I A;  1AY8 A;  3K28 A;  4W1V A;  1SF2 A;  2Z20 A;  3CBF A;  1SZS A;  2QA3 A;  4ITX A;  4WYD A;  4CBS A;  2YRI A;  4RIT A;  3E2Y A;  1J32 A;  4RM1 A;  3WCN A;  2VMT A;  2AY6 A;  4EB7 A;  1B9I A;  3QPG A;  5EIG A;  4EB5 A;  1PG8 A;  4IX8 A;  3BCB A;  2W7F A;  1OXO A;  3EI6 A;  1EJI A;  3FD0 A;  1I41 A;  5C6U A;  2EYQ A;  1TOE A;  4JEV A;  4R2N A;  4MQP A;  3AAT A;  1D7U A;  1WKH A;  2W7G A;  4ZDL A;  3PGY A;  1W3U A;  3VK3 A;  2GMU A;  3D6K A;  4WXF A;  2VMS A;  2X3L A;  3G7Q A;  3LV2 A;  1AY5 A;  1EG5 A;  3FCR A;  2ZY2 A;  4DQ6 A;  5DJ1 A;  1ASG A;  3MAD A;  4ZSY A;  4Y0H A;  3N5M A;  3GET A;  3WLX A;  2WK8 A;  4OBV A;  1E5E A;  2JJG A;  1OXP A;  3FVS A;  4XEW A;  3LWS A;  4UHM A;  4E3Q A;  4PIW A;  2O7C A;  2YRR A;  3B1D A;  3HBX A;  2BI9 A;  1BJO A;  1TOI A;  1KMK A;  3LVJ A;  1ZC9 A;  1GC4 A;  3JW9 A;  4LNM A;  3F0H A;  2CY8 A;  4XJP A;  1YNU A;  2Z1Y A;  4MQR A;  2HZP A;  4E77 A;  4R5Z A;  2AEU A;  4EFF A;  7AAT A;  1X2A A;  2G7J A;  4IXO A;  4JF0 A;  4A0H A;  4XQ2 A;  4HF8 A;  4F5F A;  1BQA A;  3HL2 A;  1DJU A;  4P3M A;  2CJG A;  1O61 A;  2D7Y A;  2VMQ A;  1N2T A;  3I16 A;  1KAF A;  2PB2 A;  3PDX A;  2ZSM A;  1BW0 A;  1ASE A;  1YJS A;  2VGZ A;  3PAA A;  1OHV A;  3JU7 A;  2ZY4 A;  1AKC A;  4ZWV A;  3QI6 A;  2CFB A;  4A0F A;  2KFP A;  2ORD A;  4A0G A;  4TMR A;  4DBC A;  9AAT A;  3FRK A;  3DU4 A;  4AOA A;  2QLR A;  1YJZ A;  1C7O A;  2WB6 A;  4Q31 A;  2AY4 A;  1G7W A;  2FQ6 A;  5G0A A;  1CQ6 A;  2W7K A;  4F5G A;  2HP1 A;  3AEN A;  1AIB A;  3G0T A;  2HUU A;  3NTJ A;  3AEL A;  2XH1 A;  1BJ4 A;  4PFN A;  4OCA A;  2FM1 A;  4A6T A;  3PA9 A;  4ZM4 A;  1AX4 A;  4BA4 A;  2BIA A;  1YAA A;  1D2F A;  4OTL A;  1TOG A;  4EU1 A;  3VAX A;  1C7G A;  1AHG A;  4TN4 A;  1SFF A;  4U1T A;  2YCP A;  1MAQ A;  3A8U X;  3PJ0 A;  4ZLV A;  5FT6 A;  3HVY A;  3RI6 A;  1AIA A;  1ZOB A;  1ASD A;  2QB3 A;  4WYE A;  2AEV A;  3BC8 A;  1YIY A;  4WYA A;  4CXR A;  1BS0 A;  1RVU A;  3AEP A;  4LW4 A;  1G4V A;  5FT4 A;  4R5F A;  4N0W A;  1D7R A;  3K40 A;  4XJO A;  2FNU A;  1CZE A;  3PDB A;  4W1W A;  2E7J A;  3JWA A;  3FVU A;  4TV7 A;  4UQV A;  3CAI A;  1FG3 A;  2CJD A;  3ACZ A;  4OC9 A;  4AO4 A;  2JJF A;  4K2I A;  3WY7 A;  1YOO A;  3ZRQ A;  2V0Y A;  1LC8 A;  3LVL B;  4K2B A;  1ASF A;  4BA5 A;  1IUG A;  4WLH A;  3NYU A;  3NNK A;  5G09 A;  2Z61 A;  4M2K A;  5F9S A;  3DYD A;  1MLZ A;  2EO5 A;  3EIB A;  2VMZ A;  3A9Y A;  3MAF B;  3TAT A;  3E77 A;  4LW2 A;  4Q6R A;  2QMA A;  3AEJ A;  1Z7D A;  2RFV A;  1MLY A;  3Q8N A;  1DTY A;  2CH1 A;  4HVK A;  1CQ7 A;  1AMR A;  3QBO A;  3CQ6 A;  4ISY A;  3RBF A;  1V2D A;  1V2F A;  1KL1 A;  2F8J A;  3MEB A;  1QIR A;  2VGV A;  4LNL A;  3FQA A;  3AEJ C;  1LW4 A;  1J04 A;  3N75 A;  1V72 A;  2C44 A;  3EIA A;  1ASA A;  2YCT A;  3IHJ A;  3F6T A;  1BT4 A;  3EUC A;  2W7L A;  3MC6 C;  1AHX A;  3QGU A;  3VOM A;  3VP6 A;  2VIB A;  4GRX A;  4JEZ A;  3LVK A;  2D64 A;  2ZYJ A;  8AAT A;  3KE3 A;  4L0O A;  1XI9 A;  3T32 A;  1IX8 A;  2DGL A;  1VP4 A;  1AJR A;  4AO9 A;  1S08 A;  4LNJ A;  2EPJ A;  1MDX A;  2VGU A;  5DX5 A;  2VI9 A;  2R5E A;  1UU2 A;  1AAM A;  1GEY A;  1M0N A;  1TAT A;  1WST A;  3ASB A;  4M2J A;  2JG2 A;  3HLM A;  1ART A;  2AAT A;  1QGN A;  1WYU B;  3WKR A;  1TPL A;  1AMA A;  1YIZ A;  2BWN A;  3HMU A;  4F5H A;  3UWC A;  1KMJ A;  4GSA A;  4WXG A;  2AY7 A;  1M0O A;  3RCH B;  5K8B A;  4J5U A;  3I5T A;  1MDO A;  1IAX A;  2X5D A;  2DOU A;  5JAY A;  1IX7 A;  4KYO A;  2ZC0 A;  2CIN A;  2Q7W A;  3A9Z A;  4GDY A;  4N0B A;  1B5P A;  4XK1 A;  3EI8 A;  5E5I A;  3II0 A;  3H9X A;  4WD2 A;  5EUD A;  2VLH A;  2YKU A;  1N8P A;  3NU7 A;  2YKX A;  2OGA A;  2EH6 A;  3ZZK A;  4ZAS A;  2D61 A;  3AEO A;  2DKB A;  3BCA A;  1B9H A;  1XEY A;  1WYT B;  2HOZ A;  2ZY3 A;  2AY2 A;  2HUF A;  1TAR A;  5EAA A;  3IF2 A;  3R9A A;  1AAW A;  2Z9X A;  2X8U A;  2ZSL A;  1QIS A;  3GZD A;  4KXK A;  3N4R A;  1GC0 A;  1M0P A;  3RUY A;  3BB8 A;  3LY1 A;  2YKV A;  4M2M A;  4OBU A;  5G4I A;  3HDO A;  1ELU A;  1W7N A;  2VMV A;  1W23 A;  3B8X A;  1MGV A;  2OKK A;  1QJ5 A;  4I8A A;  2HOY A;  4RIZ A;  4ZDP A;  3ISL A;  3FTB A;  3HT4 A;  3GZD C;  3FVX A;  3GZC A;  4XJL A;  2VLF A;  4BHD A;  2BWP A;  2QB2 A;  2OKJ A;  2VMY A;  4H51 A;  4ADC A;  1UU1 A;  3E2Z B;  1I43 A;  2VMR A;  2DGK A;  3NDN A;  3DXW A;  2VGW A;  3DR7 A;  1DGD A;  3BWN C;  2CH2 A;  4NOG A;  1S06 A;  3RQ1 A;  1QZ9 A;  3M5U A;  1O69 A;  4H63 Q;  1VJO A;  1ARS A;  2BI2 A;  1H0C A;  2AY1 A;  3FQ7 A;  3EZ1 A;  4BMK A;  1E5F A;  3WCO A;  2BI5 A;  2AY3 A;  1RV3 A;  2E7I A;  3MAF A;  3N0L A;  2E54 A;  5EAV A;  2HOX A;  5LH9 A;  1V2E A;  1B4X A;  2D5Y A;  2W7E A;  2QSR A;  5KTB A;  1AHF A;  1JS3 A;  1BJN A;  2FN6 A;  2W7J A;  3EI5 A;  4IY7 A;  1BJW A;  1O4S A;  2EZ2 A;  2VMU A;  5E3K A;  2W7M A;  4BQ0 A;  4OT8 A;  3KGW A;  3FKD A;  4UHN A;  4RKC A;  1T3I A;  5D95 A;  3WGC A;  4ZM3 A;  4ZAH A;  1W7M A;  1LKC A;  1CL2 A;  2BI1 A;  4MQQ A;  4B9B A;  2WK7 A;  4F5L A;  2YKY A;  1AMS A;  2D66 A;  3JTX A;  2VMW A;  2NMP A;  3E2F A;  2R5C B;  4IYO B;  3AOW A;  1YJY A;  5HHY A;  1LS3 A;  1EQB A;  1AY4 A;  1G4X A;  3A9X A;  4Y0D A;  1ASB A;  2VMP A;  4A72 A;  4WB0 B;  4JEY A;  1FG7 A;  4F5J A;  1CZC A;  1GBN A;  3UAK A;  5IWQ A;  1GDE A;  4ZDO A;  4MKJ A;  1U08 A;  2R0T A;  3DOD A;  3P1T A;  1DFO A;  2C0R A;  3BN1 A;  3W1H A;  4MSO A;  1B8G A;  1DGE A;  3TFT A;  1UU0 A;  1WYU A;  4OMA A;  5HXX A;  2HUI A;  2CB1 A;  2FKI A;  3GSB A;  3K7Y A;  2D63 A;  3FDD A;  3RCH A;  2R2N A;  2VMO A;  1S09 A;  2DGM A;  4UOY A;  3W1J A;  4WLJ A;  3GR9 A;  2VMN A;  1IX6 A;  5FT8 A;  2Z9U A;  3MC6 A;  3EI9 A;  2XBN A;  3GBX A;  1X28 A;  1PFF A;  2ZJG A;  1C4K A;  1ORD A;  2EGY A;  3BCX A;  1C9C A;  4FFC A;  5F8V A;  1FC4 A;  4Q76 A;  1ELQ A;  2HP2 A;  1JS6 A;  4RAE A;  4XAU A;  5EFS A;  3WX9 A;  1DKA A;  1WYT A;  2JGT A;  1X0M A;  3OKS A;  2GQN A;  3ASA A;  1G7X A;  1S0A A;  1LK9 A;  4GEB A;  4ZWM A;  4RKD A;  1KL2 A;  3WZF A;  4F4E A;  1Y4I A;  4E1O A;  2YOB A;  3GJU A;  2C81 A;  5FT5 A;  1RVY A;  3PD6 B;  1S07 A;  3HQT A;  1Z3Z A;  3MAU A;  1OHW A;  3ECD A;  4UHO A;  3L8A A;  4W1X A;  5TF5 A;  4ATP A;  3LVM A;  1QJ3 A;  1SZK A;  2ZUK A;  3B1E A;  1O62 A; 
#chains in the Genus database with same CATH homology
 2W8J A;  3I4J A;  1IJI A;  1SPA A;  3PDB B;  3RBL A;  4P7Y A;  4AH3 A;  4WP0 A;  2Z9V A;  1X29 A;  2AY8 A;  2FNI A;  1N31 A;  3NX3 A;  2WKA A;  3BS8 A;  1AKB A;  3P6K A;  4PVF A;  3TQX A;  3USF A;  3VK2 A;  3E2Z A;  1ASL A;  3AOV A;  5EQC A;  2W7D A;  4F5I A;  5M4D A;  4Y0I A;  5E4Z A;  1WYV B;  2JJE A;  1AMQ A;  1LC7 A;  1PMO A;  2YCN A;  1CS1 A;  1TOJ A;  2DR1 A;  3MBB A;  1LC5 A;  5DJ9 A;  5EUN A;  4WBT A;  4ADE A;  1ZOD A;  4F5M A;  3NYT A;  2W8T A;  1RV4 A;  1OHY A;  2BHX A;  1AJS B;  3COG A;  2YHK A;  1P3W A;  2ZY5 A;  3E9K A;  1ASN A;  2BKW A;  2D65 A;  2GSA A;  1DJ9 A;  4A0R A;  3N7N A;  2EZ1 A;  1ARH A;  4O6Z A;  2VI8 A;  2Z9W A;  4U2H A;  1C0N A;  1CJ0 A;  3FQ8 A;  1GEX A;  3GWP A;  2OQX A;  2QBT A;  1KKJ A;  1M4N A;  4QGR A;  3ELE A;  2TPL A;  2VYC A;  2G6W A;  1ARG A;  1I48 A;  2HOR A;  2O0R A;  1LW5 A;  3E6G A;  5G2Q A;  5AX8 A;  1JG8 A;  4W5K A;  2BIG A;  5I92 A;  2W8V A;  3BWN A;  3VK4 A;  1ASM A;  3PIU A;  4JF1 A;  1PMM A;  1GD9 A;  4WYG A;  1IAY A;  2R5C A;  4CVQ A;  3N4X A;  4IYO A;  1AIC A;  5EIG B;  4FL0 A;  4IW7 A;  3NRA A;  4MGR A;  3FDB A;  4RJ0 A;  3DR4 A;  3QHX A;  3QM2 A;  4GE7 A;  4WB0 A;  1AHE A;  1GC3 A;  3ATH A;  2VGS A;  1ARI A;  2WK9 A;  3ZRR A;  1CQ8 A;  1ECX A;  1MAP A;  2CAN A;  2C7T A;  4J8L A;  2BYL A;  3FFR A;  1M6S A;  1QIT A;  2W8U A;  4ADD A;  2OGE A;  3LG0 A;  3UE8 A;  2D7Z A;  4IXZ A;  2CST A;  1W7L A;  2GMS A;  1IVR A;  2JIS A;  5G2P A;  5M46 A;  4PFF A;  4A6R A;  3NYS A;  4ADB A;  3CQ4 A;  2A1V A;  5G4J A;  3NUI A;  2O1B A;  3QN6 A;  4R8D A;  4F5K A;  4JEW A;  1GEW A;  2W8W A;  3DZZ A;  4OYT A;  4CXQ A;  4WXB A;  1AHY A;  2GB3 A;  2JJH A;  1BJO B;  3B1C A;  5EUE A;  3KGX A;  1BKG A;  3OP7 A;  4W91 A;  4IXS A;  4LC3 A;  2VMX A;  4A00 A;  4K2M A;  4AZK A;  1M7Y A;  2AY9 A;  3WKS A;  1GCK A;  3ZZJ A;  4MY5 A;  2E7U A;  3F9T A;  3AEM A;  4AZJ A;  4RJY A;  4E3R A;  3NU8 A;  4CBR A;  5M49 A;  3BV0 A;  1TAS A;  4EMY A;  3CQ5 A;  1GC2 A;  3L44 A;  3W1I A;  3TCM A;  1M32 A;  2BIE A;  3DXV A;  2ZP7 A;  2V1P A;  3MKJ A;  2CTZ A;  1D7S A;  1H1C A;  3AEM C;  3PD6 A;  4W8I A;  3JWB A;  1KKP A;  3WGB A;  2X5F A;  5BJ3 A;  3B46 A;  2PO3 A;  4Q75 A;  1JF9 A;  2Z67 A;  1UKJ A;  2CJH A;  1BQD A;  4XJM A;  4GE4 A;  1AKA A;  3ELP A;  3H7F A;  1VEF A;  2BWO A;  2DKJ A;  4B98 A;  3FSL A;  4GE9 A;  2PB0 A;  4JEX A;  3PPL A;  1WYV A;  1DJE A;  3DC1 A;  3EZS A;  2BI3 A;  3AEN B;  3A2B A;  1SVV A;  3ZRP A;  5LHA A;  1OAT A;  3JZL A;  4JE5 D;  1WKG A;  4RLG A;  1D7V A;  4JE5 A;  4A6U A;  1AJS A;  1I29 A;  2VGT A;  4K05 A;  5DB5 A;  5HDM A;  3R4T A;  2OAT A;  3EI7 A;  3KKI A;  4DGT A;  2AY5 A;  3H14 A;  3FZ7 A;  3FFH A;  2Z1Z A;  3N4S A;  1B5O A;  1TOK A;  1MDZ A;  4KAM A;  4ZSW A;  1C7N A;  1SZU A;  1CL1 A;  2BYJ A;  1ASC A;  3NUB A;  4WYC A;  3DRD A;  3AV7 A;  5BJ4 A;  3FZ8 A;  3BWO A;  3FZ6 A;  5D5S A;  1M0Q A;  2FYF A;  5J8Q A;  1IBJ A;  4ITG A;  2VIA A;  3G8M A;  5M4B A;  4MKK A;  4WYF A;  3TFU A;  2W7H A;  4ATQ A;  2W7I A;  1AY8 A;  3K28 A;  4W1V A;  1SF2 A;  2Z20 A;  3CBF A;  1SZS A;  2QA3 A;  4ITX A;  4WYD A;  4CBS A;  2YRI A;  4RIT A;  3E2Y A;  1J32 A;  4RM1 A;  3WCN A;  2VMT A;  2AY6 A;  4EB7 A;  1B9I A;  3QPG A;  5EIG A;  4EB5 A;  1PG8 A;  4IX8 A;  3BCB A;  2W7F A;  1OXO A;  3EI6 A;  1EJI A;  3FD0 A;  1I41 A;  5C6U A;  2EYQ A;  1TOE A;  4JEV A;  4R2N A;  4MQP A;  3AAT A;  1D7U A;  1WKH A;  2W7G A;  4ZDL A;  3PGY A;  1W3U A;  3VK3 A;  2GMU A;  3D6K A;  4WXF A;  2VMS A;  2X3L A;  3G7Q A;  3LV2 A;  1AY5 A;  1EG5 A;  3FCR A;  2ZY2 A;  4DQ6 A;  5DJ1 A;  1ASG A;  3MAD A;  4ZSY A;  4Y0H A;  3N5M A;  3GET A;  3WLX A;  2WK8 A;  4OBV A;  1E5E A;  2JJG A;  1OXP A;  3FVS A;  4XEW A;  3LWS A;  4UHM A;  4E3Q A;  4PIW A;  2O7C A;  2YRR A;  3B1D A;  3HBX A;  2BI9 A;  1BJO A;  1TOI A;  1KMK A;  3LVJ A;  1ZC9 A;  1GC4 A;  3JW9 A;  4LNM A;  3F0H A;  2CY8 A;  4XJP A;  1YNU A;  2Z1Y A;  4MQR A;  2HZP A;  4E77 A;  4R5Z A;  2AEU A;  4EFF A;  7AAT A;  1X2A A;  2G7J A;  4IXO A;  4JF0 A;  4A0H A;  4XQ2 A;  4HF8 A;  4F5F A;  1BQA A;  3HL2 A;  1DJU A;  4P3M A;  2CJG A;  1O61 A;  2D7Y A;  2VMQ A;  1N2T A;  3I16 A;  2PB2 A;  3PDX A;  2ZSM A;  1BW0 A;  1ASE A;  1YJS A;  2VGZ A;  3PAA A;  1OHV A;  3JU7 A;  2ZY4 A;  1AKC A;  4ZWV A;  3QI6 A;  2CFB A;  4A0F A;  2KFP A;  2ORD A;  4A0G A;  4TMR A;  4DBC A;  9AAT A;  3FRK A;  3DU4 A;  4AOA A;  2QLR A;  1YJZ A;  1C7O A;  2WB6 A;  4Q31 A;  2AY4 A;  1G7W A;  2FQ6 A;  5G0A A;  1CQ6 A;  2W7K A;  4F5G A;  2HP1 A;  3AEN A;  1AIB A;  3G0T A;  2HUU A;  3NTJ A;  3AEL A;  2XH1 A;  1BJ4 A;  4PFN A;  4OCA A;  2FM1 A;  4A6T A;  3PA9 A;  4ZM4 A;  1AX4 A;  4BA4 A;  2BIA A;  1YAA A;  1D2F A;  4OTL A;  1TOG A;  4EU1 A;  3VAX A;  1C7G A;  1AHG A;  4TN4 A;  1SFF A;  4U1T A;  2YCP A;  1MAQ A;  3A8U X;  3PJ0 A;  4ZLV A;  5FT6 A;  3HVY A;  3RI6 A;  1AIA A;  1ZOB A;  1ASD A;  2QB3 A;  4WYE A;  2AEV A;  3BC8 A;  1YIY A;  4WYA A;  4CXR A;  1BS0 A;  1RVU A;  3AEP A;  4LW4 A;  1G4V A;  5FT4 A;  4R5F A;  4N0W A;  1D7R A;  3K40 A;  4XJO A;  2FNU A;  1CZE A;  3PDB A;  4W1W A;  2E7J A;  3JWA A;  3FVU A;  4TV7 A;  4UQV A;  3CAI A;  1FG3 A;  2CJD A;  3ACZ A;  4OC9 A;  4AO4 A;  2JJF A;  4K2I A;  3WY7 A;  1YOO A;  3ZRQ A;  2V0Y A;  1LC8 A;  3LVL B;  4K2B A;  1ASF A;  4BA5 A;  1IUG A;  4WLH A;  3NYU A;  3NNK A;  5G09 A;  2Z61 A;  4M2K A;  5F9S A;  3DYD A;  1MLZ A;  2EO5 A;  3EIB A;  2VMZ A;  3A9Y A;  3MAF B;  3TAT A;  3E77 A;  4LW2 A;  4Q6R A;  2QMA A;  3AEJ A;  1Z7D A;  2RFV A;  1MLY A;  3Q8N A;  1DTY A;  2CH1 A;  4HVK A;  1CQ7 A;  1AMR A;  3QBO A;  3CQ6 A;  4ISY A;  3RBF A;  1V2D A;  1V2F A;  1KL1 A;  2F8J A;  3MEB A;  1QIR A;  2VGV A;  4LNL A;  3FQA A;  3AEJ C;  1LW4 A;  1J04 A;  3N75 A;  1V72 A;  2C44 A;  3EIA A;  1ASA A;  2YCT A;  3IHJ A;  3F6T A;  1BT4 A;  3EUC A;  2W7L A;  3MC6 C;  1AHX A;  3QGU A;  3VOM A;  3VP6 A;  2VIB A;  4GRX A;  4JEZ A;  3LVK A;  2D64 A;  2ZYJ A;  8AAT A;  3KE3 A;  4L0O A;  1XI9 A;  3T32 A;  1IX8 A;  2DGL A;  1VP4 A;  1AJR A;  4AO9 A;  1S08 A;  4LNJ A;  2EPJ A;  1MDX A;  2VGU A;  5DX5 A;  2VI9 A;  2R5E A;  1UU2 A;  1AAM A;  1GEY A;  1M0N A;  1TAT A;  1WST A;  3ASB A;  4M2J A;  2JG2 A;  3HLM A;  1ART A;  2AAT A;  1QGN A;  1WYU B;  3WKR A;  1TPL A;  1AMA A;  1YIZ A;  2BWN A;  3HMU A;  4F5H A;  3UWC A;  1KMJ A;  4GSA A;  4WXG A;  2AY7 A;  1M0O A;  3RCH B;  5K8B A;  4J5U A;  3I5T A;  1MDO A;  1IAX A;  2X5D A;  2DOU A;  5JAY A;  1IX7 A;  4KYO A;  2ZC0 A;  2CIN A;  2Q7W A;  3A9Z A;  4GDY A;  4N0B A;  1B5P A;  4XK1 A;  3EI8 A;  5E5I A;  3II0 A;  3H9X A;  4WD2 A;  5EUD A;  2VLH A;  2YKU A;  1N8P A;  3NU7 A;  2YKX A;  2OGA A;  2EH6 A;  3ZZK A;  4ZAS A;  2D61 A;  3AEO A;  2DKB A;  3BCA A;  1B9H A;  1XEY A;  1WYT B;  2HOZ A;  2ZY3 A;  2AY2 A;  2HUF A;  1TAR A;  5EAA A;  3IF2 A;  3R9A A;  1AAW A;  2Z9X A;  2X8U A;  2ZSL A;  1QIS A;  3GZD A;  4KXK A;  3N4R A;  1GC0 A;  1M0P A;  3RUY A;  3BB8 A;  3LY1 A;  2YKV A;  4M2M A;  4OBU A;  5G4I A;  3HDO A;  1ELU A;  1W7N A;  2VMV A;  1W23 A;  3B8X A;  1MGV A;  2OKK A;  1QJ5 A;  4I8A A;  2HOY A;  4RIZ A;  4ZDP A;  3ISL A;  3FTB A;  3HT4 A;  3GZD C;  3FVX A;  3GZC A;  4XJL A;  2VLF A;  4BHD A;  2BWP A;  2QB2 A;  2OKJ A;  2VMY A;  4H51 A;  4ADC A;  1UU1 A;  3E2Z B;  1I43 A;  2VMR A;  2DGK A;  3NDN A;  3DXW A;  2VGW A;  3DR7 A;  1DGD A;  3BWN C;  2CH2 A;  4NOG A;  1S06 A;  3RQ1 A;  1QZ9 A;  3M5U A;  1O69 A;  4H63 Q;  1VJO A;  1ARS A;  2BI2 A;  1H0C A;  2AY1 A;  3FQ7 A;  3EZ1 A;  4BMK A;  1E5F A;  3WCO A;  2BI5 A;  2AY3 A;  1RV3 A;  2E7I A;  3MAF A;  3N0L A;  2E54 A;  5EAV A;  2HOX A;  5LH9 A;  1V2E A;  1B4X A;  2D5Y A;  2W7E A;  2QSR A;  5KTB A;  1AHF A;  1JS3 A;  1BJN A;  2FN6 A;  2W7J A;  3EI5 A;  4IY7 A;  1BJW A;  1O4S A;  2EZ2 A;  2VMU A;  5E3K A;  2W7M A;  4BQ0 A;  4OT8 A;  3KGW A;  3FKD A;  4UHN A;  4RKC A;  1T3I A;  5D95 A;  3WGC A;  4ZM3 A;  4ZAH A;  1W7M A;  1LKC A;  1CL2 A;  2BI1 A;  4MQQ A;  4B9B A;  2WK7 A;  4F5L A;  2YKY A;  1AMS A;  2D66 A;  3JTX A;  2VMW A;  2NMP A;  3E2F A;  2R5C B;  4IYO B;  3AOW A;  1YJY A;  5HHY A;  1LS3 A;  1EQB A;  1AY4 A;  1G4X A;  3A9X A;  4Y0D A;  1ASB A;  2VMP A;  4A72 A;  4WB0 B;  4JEY A;  1FG7 A;  4F5J A;  1CZC A;  1GBN A;  3UAK A;  5IWQ A;  1GDE A;  4ZDO A;  4MKJ A;  1U08 A;  2R0T A;  3DOD A;  3P1T A;  1DFO A;  2C0R A;  3BN1 A;  3W1H A;  4MSO A;  1B8G A;  1DGE A;  3TFT A;  1UU0 A;  1WYU A;  4OMA A;  5HXX A;  2HUI A;  2CB1 A;  2FKI A;  3GSB A;  3K7Y A;  2D63 A;  3FDD A;  3RCH A;  2R2N A;  2VMO A;  1S09 A;  2DGM A;  4UOY A;  3W1J A;  4WLJ A;  3GR9 A;  2VMN A;  1IX6 A;  5FT8 A;  2Z9U A;  3MC6 A;  3EI9 A;  2XBN A;  3GBX A;  1X28 A;  1PFF A;  2ZJG A;  1C4K A;  1ORD A;  2EGY A;  3BCX A;  1C9C A;  4FFC A;  5F8V A;  1FC4 A;  4Q76 A;  1ELQ A;  2HP2 A;  1JS6 A;  4RAE A;  4XAU A;  5EFS A;  3WX9 A;  1DKA A;  1WYT A;  2JGT A;  1X0M A;  3OKS A;  2GQN A;  3ASA A;  1G7X A;  1S0A A;  1LK9 A;  4GEB A;  4ZWM A;  4RKD A;  1KL2 A;  3WZF A;  4F4E A;  1Y4I A;  4E1O A;  2YOB A;  3GJU A;  2C81 A;  5FT5 A;  1RVY A;  3PD6 B;  1S07 A;  3HQT A;  1Z3Z A;  3MAU A;  1OHW A;  3ECD A;  4UHO A;  3L8A A;  4W1X A;  5TF5 A;  4ATP A;  3LVM A;  1QJ3 A;  1SZK A;  2ZUK A;  3B1E A;  1O62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...