1FYZE

Methane monooxygenase hydroxylase, form ii reduced by soaking
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
total genus 62
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fyzE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fyzE02
1FZHE 1MTYG 1FZ4E 1MHZG 1FZ9E 1XMHE 1FZIE 1XVGE 1XVEE 1FZ0E 1FZ3E 1FYZE 1MHYG 1FZ8E 1FZ2E 4GAMC 1XVCE 1FZ1E 1XMGE 1FZ6E 1XVFE 1FZ7E 1XMFE 1XVDE 1XU3E 1MMOG 1XVBE 1FZ5E 1XU5E
chains in the Genus database with same CATH superfamily
2P5GA 3OGMB 3QEVA 3SPZA 3TJYA 3RMAA 3SNNA 3UIQA 2OVQB 4FJHA 4FK2A 3TAEA 3OGKB 2VJ4A 3RMDA 4FJJA 4FJLA 4KI4A 1XMHE 1FZIE 3NGIA 4DTMA 3N1EA 4DU4A 4M42A 1XL3C 2RCUA 4QNCA 4E4BA 3LZJA 3SUNA 1FS1A 2PFVA 2VIXA 2P1PB 4FJXA 4GAMC 2JHCA 1XMGE 2FYOA 5IZ7A 3C95A 4JRPA 4DTUA 1P22A 4HCCA 4I9QA 2DY4A 3QEXA 1MMOG 2PFTA 3SQ0A 3SJJA 3E4YA 3K2OA 4X5MA 2DTUA 4QNDA 2OZSA 3S9HA 3SUOA 4M45A 4M41A 4DU3A 4DTXA 3NAEA 3J2PA 1FPOA 4FK0A 2YB5A 3OGLB 2DEBA 4RG8A 2FW3A 2RKHA 3SQ1A 1XVEE 3TAFA 3QEPA 3QERA 2B7MA 1FYZE 4JS4A 4DTOA 4M3UA 3MKSB 3NCIA 4FJIA 1FZ8E 1FZ2E 1XVCE 2MMBA 2JQTA 2B8IA 3BVOA 3CFOA 3SI6A 1XVFE 1NEXB 4M3RA 3C6NB 1XMFE 1XU3E 2P1QB 2MZWB 3SCXA 5IREA 4FJNA 4AKGA 2B1EA 2P1NB 4M3ZA 1JW2A 4J2AA 1XU5E 2JHPA 4FJ8A 2K5SA 1IH7A 3C6OB 3TL8B 3TABA 4FJ5A 4ADNA 3L2OB 2P1OB 3RWUA 4FJ7A 2HD0A 2JHAA 4B08A 4RNGA 1MHZG 3UO3A 1FZ9E 3HGLA 3HL8A 3L1NA 3V7DB 3QESA 4EPHA 4M3WA 3CFPA 3TAGA 3HP9A 4DTSA 3SQ4A 1FZ3E 2OVRB 4KI6A 4AKIA 3C94A 3HGKE 1Q9XA 4FJMA 3C6PB 3SPYA 3KD1E 1FZ1E 5H37A 3RMBA 1WAJA 3RMCA 3L8BA 4HCBA 1FZ6E 1WAFA 4JRQA 3NE6A 3KD5E 4EYWA 4DU1A 3QNNA 1XVDE 4J2BA 4FK4A 2JH9A 2E31A 4X5NA 4KHYA 1XVBE 1FXXA 2VJ5A 1LDKE 2QXFA 4M3XA 2OYQA 4ADOA 3QEIA 4DTPA 5IBKB 4E3SA 4KHQA 4ICGC 4DTRA 3SUQA 4FJGA 4KHUA 1FZHE 4FJ9A 3SVIA 4DTNA 3QEWA 2P1MB 1MTYG 2LF6A 3LZIA 1IG9A 4AKHA 1FZ4E 3QNOA 2MW2A 1XVGE 3LDSA 4FVMA 2JPNA 4I9LA 4IT5A 4RL5A 4JS5A 2P5OA 3SUPA 4KHSA 4AI6A 1FZ0E 2JH8A 2OZMA 3N1BA 4FJKA 1N1CA 3QETA 1MHYG 3LD8A 4DTJA 3WSOA 4KHWA 2OVPB 4EP9A 3E4WA 4M3YA 4KHNA 3UO2A 3CFRA 1FZ7E 4I6JB 4M3TA 2H4TA 2LF3A 3LDBA 3CQ8A 4J2EA 2E32A 3NHGA 3L0MA 1FZ5E 4J2DA 3J27A 3NDKA 2ATQA 1CLQA 1Q9YA 3SQ2A
chains in the Genus database with same CATH topology
2P5GA 3OGMB 3QEVA 3SPZA 3TJYA 3RMAA 3SNNA 3UIQA 2OVQB 4FJHA 4FK2A 3TAEA 3OGKB 2VJ4A 3RMDA 4FJJA 4FJLA 4KI4A 1XMHE 1FZIE 3NGIA 4DTMA 3N1EA 4DU4A 4M42A 1XL3C 2RCUA 4QNCA 4E4BA 3LZJA 3SUNA 1FS1A 2PFVA 2VIXA 2P1PB 4FJXA 4GAMC 2JHCA 1XMGE 2FYOA 5IZ7A 3C95A 4JRPA 4DTUA 1P22A 4HCCA 4I9QA 2DY4A 3QEXA 1MMOG 2PFTA 3SQ0A 3SJJA 3E4YA 3K2OA 4X5MA 2DTUA 4QNDA 2OZSA 3S9HA 3SUOA 4M45A 4M41A 4DU3A 4DTXA 3NAEA 3J2PA 4FK0A 2YB5A 3OGLB 2DEBA 4RG8A 2FW3A 3SQ1A 1XVEE 3TAFA 3QEPA 3QERA 2B7MA 1FYZE 4JS4A 4DTOA 4M3UA 3MKSB 3NCIA 4FJIA 1FZ8E 1FZ2E 1XVCE 2MMBA 2B8IA 3CFOA 3SI6A 1XVFE 1NEXB 4M3RA 3C6NB 1XMFE 1XU3E 2P1QB 2MZWB 3SCXA 5IREA 4FJNA 4AKGA 2B1EA 2P1NB 4M3ZA 4J2AA 1XU5E 2JHPA 4FJ8A 1IH7A 3C6OB 3TL8B 3TABA 4FJ5A 4ADNA 3L2OB 2P1OB 3RWUA 4FJ7A 2HD0A 2JHAA 4B08A 4RNGA 1MHZG 4M3WA 1FZ9E 3HGLA 3HL8A 3L1NA 3V7DB 3QESA 4EPHA 3CFPA 3TAGA 3HP9A 4DTSA 3SQ4A 1FZ3E 2OVRB 4KI6A 4AKIA 3C94A 3HGKE 1Q9XA 4FJMA 3C6PB 3SPYA 3KD1E 1FZ1E 5H37A 3RMBA 1WAJA 3RMCA 3L8BA 4HCBA 1FZ6E 1WAFA 4JRQA 3NE6A 3KD5E 4EYWA 4DU1A 3QNNA 1XVDE 4J2BA 4FK4A 2JH9A 2E31A 4X5NA 4KHYA 1XVBE 1FXXA 2VJ5A 1LDKE 2QXFA 4M3XA 2OYQA 4ADOA 3QEIA 4DTPA 5IBKB 4E3SA 4KHQA 4DTRA 3SUQA 4FJGA 4KHUA 1FZHE 4FJ9A 3SVIA 4DTNA 3QEWA 2P1MB 1MTYG 2LF6A 3LZIA 1IG9A 4AKHA 1FZ4E 3QNOA 1XVGE 3LDSA 4FVMA 2JPNA 4I9LA 4RL5A 4AI6A 4JS5A 2P5OA 3SUPA 4KHSA 1FZ0E 2JH8A 2OZMA 3N1BA 4FJKA 3QETA 1MHYG 3LD8A 4DTJA 3WSOA 4KHWA 2OVPB 4EP9A 3E4WA 4M3YA 4KHNA 3CFRA 1FZ7E 4I6JB 4M3TA 2H4TA 2LF3A 3LDBA 3CQ8A 4J2EA 2E32A 3NHGA 3L0MA 1FZ5E 4J2DA 3J27A 3NDKA 2ATQA 1CLQA 1Q9YA 3SQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZH E;  1MTY G;  1FZ4 E;  1MHZ G;  1FZ9 E;  1XMH E;  1FZI E;  1XVG E;  1XVE E;  1FZ0 E;  1FZ3 E;  1FYZ E;  1MHY G;  1FZ8 E;  1FZ2 E;  4GAM C;  1XVC E;  1FZ1 E;  1XMG E;  1FZ6 E;  1XVF E;  1FZ7 E;  1XMF E;  1XVD E;  1XU3 E;  1MMO G;  1XVB E;  1FZ5 E;  1XU5 E; 
#chains in the Genus database with same CATH topology
 2P5G A;  3OGM B;  3QEV A;  3SPZ A;  3TJY A;  3RMA A;  3SNN A;  3UIQ A;  2OVQ B;  4FJH A;  4FK2 A;  3TAE A;  3OGK B;  2VJ4 A;  3RMD A;  4FJJ A;  4FJL A;  4KI4 A;  1XMH E;  1FZI E;  3NGI A;  4DTM A;  3N1E A;  4DU4 A;  4M42 A;  1XL3 C;  2RCU A;  4QNC A;  4E4B A;  3LZJ A;  3SUN A;  1FS1 A;  2PFV A;  2VIX A;  2P1P B;  4FJX A;  4GAM C;  2JHC A;  1XMG E;  2FYO A;  5IZ7 A;  3C95 A;  4JRP A;  4DTU A;  1P22 A;  4HCC A;  4I9Q A;  2DY4 A;  3QEX A;  1MMO G;  2PFT A;  3SQ0 A;  3SJJ A;  3E4Y A;  3K2O A;  4X5M A;  2DTU A;  4QND A;  2OZS A;  3S9H A;  3SUO A;  4M45 A;  4M41 A;  4DU3 A;  4DTX A;  3NAE A;  3J2P A;  1FPO A;  4FK0 A;  2YB5 A;  3OGL B;  2DEB A;  4RG8 A;  2FW3 A;  2RKH A;  3SQ1 A;  1XVE E;  3TAF A;  3QEP A;  3QER A;  2B7M A;  1FYZ E;  4JS4 A;  4DTO A;  4M3U A;  3MKS B;  3NCI A;  4FJI A;  1FZ8 E;  1FZ2 E;  1XVC E;  2MMB A;  2JQT A;  2B8I A;  3BVO A;  3CFO A;  3SI6 A;  1XVF E;  1NEX B;  4M3R A;  3C6N B;  1XMF E;  1XU3 E;  2P1Q B;  2MZW B;  3SCX A;  5IRE A;  4FJN A;  4AKG A;  2B1E A;  2P1N B;  4M3Z A;  1JW2 A;  4J2A A;  1XU5 E;  2JHP A;  4FJ8 A;  2K5S A;  1IH7 A;  3C6O B;  3TL8 B;  3TAB A;  4FJ5 A;  4ADN A;  3L2O B;  2P1O B;  3RWU A;  4FJ7 A;  2HD0 A;  2JHA A;  4B08 A;  4RNG A;  1MHZ G;  3UO3 A;  1FZ9 E;  3HGL A;  3HL8 A;  3L1N A;  3V7D B;  3QES A;  4EPH A;  4M3W A;  3CFP A;  3TAG A;  3HP9 A;  4DTS A;  3SQ4 A;  1FZ3 E;  2OVR B;  4KI6 A;  4AKI A;  3C94 A;  3HGK E;  1Q9X A;  4FJM A;  3C6P B;  3SPY A;  3KD1 E;  1FZ1 E;  5H37 A;  3RMB A;  1WAJ A;  3RMC A;  3L8B A;  4HCB A;  1FZ6 E;  1WAF A;  4JRQ A;  3NE6 A;  3KD5 E;  4EYW A;  4DU1 A;  3QNN A;  1XVD E;  4J2B A;  4FK4 A;  2JH9 A;  2E31 A;  4X5N A;  4KHY A;  1XVB E;  1FXX A;  2VJ5 A;  1LDK E;  2QXF A;  4M3X A;  2OYQ A;  4ADO A;  3QEI A;  4DTP A;  5IBK B;  4E3S A;  4KHQ A;  4ICG C;  4DTR A;  3SUQ A;  4FJG A;  4KHU A;  1FZH E;  4FJ9 A;  3SVI A;  4DTN A;  3QEW A;  2P1M B;  1MTY G;  2LF6 A;  3LZI A;  1IG9 A;  4AKH A;  1FZ4 E;  3QNO A;  2MW2 A;  1XVG E;  3LDS A;  4FVM A;  2JPN A;  4I9L A;  4IT5 A;  4RL5 A;  4JS5 A;  2P5O A;  3SUP A;  4KHS A;  4AI6 A;  1FZ0 E;  2JH8 A;  2OZM A;  3N1B A;  4FJK A;  1N1C A;  3QET A;  1MHY G;  3LD8 A;  4DTJ A;  3WSO A;  4KHW A;  2OVP B;  4EP9 A;  3E4W A;  4M3Y A;  4KHN A;  3UO2 A;  3CFR A;  1FZ7 E;  4I6J B;  4M3T A;  2H4T A;  2LF3 A;  3LDB A;  3CQ8 A;  4J2E A;  2E32 A;  3NHG A;  3L0M A;  1FZ5 E;  4J2D A;  3J27 A;  3NDK A;  2ATQ A;  1CLQ A;  1Q9Y A;  3SQ2 A; 
#chains in the Genus database with same CATH homology
 2P5G A;  3OGM B;  3QEV A;  3SPZ A;  3TJY A;  3RMA A;  3SNN A;  3UIQ A;  2OVQ B;  4FJH A;  4FK2 A;  3TAE A;  3OGK B;  2VJ4 A;  3RMD A;  4FJJ A;  4FJL A;  4KI4 A;  1XMH E;  1FZI E;  3NGI A;  4DTM A;  3N1E A;  4DU4 A;  4M42 A;  1XL3 C;  2RCU A;  4QNC A;  4E4B A;  3LZJ A;  3SUN A;  1FS1 A;  2PFV A;  2VIX A;  2P1P B;  4FJX A;  4GAM C;  2JHC A;  1XMG E;  2FYO A;  5IZ7 A;  3C95 A;  4JRP A;  4DTU A;  1P22 A;  4HCC A;  4I9Q A;  2DY4 A;  3QEX A;  1MMO G;  2PFT A;  3SQ0 A;  3SJJ A;  3E4Y A;  3K2O A;  4X5M A;  2DTU A;  4QND A;  2OZS A;  3S9H A;  3SUO A;  4M45 A;  4M41 A;  4DU3 A;  4DTX A;  3NAE A;  3J2P A;  4FK0 A;  2YB5 A;  3OGL B;  2DEB A;  4RG8 A;  2FW3 A;  3SQ1 A;  1XVE E;  3TAF A;  3QEP A;  3QER A;  2B7M A;  1FYZ E;  4JS4 A;  4DTO A;  4M3U A;  3MKS B;  3NCI A;  4FJI A;  1FZ8 E;  1FZ2 E;  1XVC E;  2MMB A;  2B8I A;  3CFO A;  3SI6 A;  1XVF E;  1NEX B;  4M3R A;  3C6N B;  1XMF E;  1XU3 E;  2P1Q B;  2MZW B;  3SCX A;  5IRE A;  4FJN A;  4AKG A;  2B1E A;  2P1N B;  4M3Z A;  4J2A A;  1XU5 E;  2JHP A;  4FJ8 A;  1IH7 A;  3C6O B;  3TL8 B;  3TAB A;  4FJ5 A;  4ADN A;  3L2O B;  2P1O B;  3RWU A;  4FJ7 A;  2HD0 A;  2JHA A;  4B08 A;  4RNG A;  1MHZ G;  4M3W A;  1FZ9 E;  3HGL A;  3HL8 A;  3L1N A;  3V7D B;  3QES A;  4EPH A;  3CFP A;  3TAG A;  3HP9 A;  4DTS A;  3SQ4 A;  1FZ3 E;  2OVR B;  4KI6 A;  4AKI A;  3C94 A;  3HGK E;  1Q9X A;  4FJM A;  3C6P B;  3SPY A;  3KD1 E;  1FZ1 E;  5H37 A;  3RMB A;  1WAJ A;  3RMC A;  3L8B A;  4HCB A;  1FZ6 E;  1WAF A;  4JRQ A;  3NE6 A;  3KD5 E;  4EYW A;  4DU1 A;  3QNN A;  1XVD E;  4J2B A;  4FK4 A;  2JH9 A;  2E31 A;  4X5N A;  4KHY A;  1XVB E;  1FXX A;  2VJ5 A;  1LDK E;  2QXF A;  4M3X A;  2OYQ A;  4ADO A;  3QEI A;  4DTP A;  5IBK B;  4E3S A;  4KHQ A;  4DTR A;  3SUQ A;  4FJG A;  4KHU A;  1FZH E;  4FJ9 A;  3SVI A;  4DTN A;  3QEW A;  2P1M B;  1MTY G;  2LF6 A;  3LZI A;  1IG9 A;  4AKH A;  1FZ4 E;  3QNO A;  1XVG E;  3LDS A;  4FVM A;  2JPN A;  4I9L A;  4RL5 A;  4AI6 A;  4JS5 A;  2P5O A;  3SUP A;  4KHS A;  1FZ0 E;  2JH8 A;  2OZM A;  3N1B A;  4FJK A;  3QET A;  1MHY G;  3LD8 A;  4DTJ A;  3WSO A;  4KHW A;  2OVP B;  4EP9 A;  3E4W A;  4M3Y A;  4KHN A;  3CFR A;  1FZ7 E;  4I6J B;  4M3T A;  2H4T A;  2LF3 A;  3LDB A;  3CQ8 A;  4J2E A;  2E32 A;  3NHG A;  3L0M A;  1FZ5 E;  4J2D A;  3J27 A;  3NDK A;  2ATQ A;  1CLQ A;  1Q9Y A;  3SQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...