1FYZE

Methane monooxygenase hydroxylase, form ii reduced by soaking
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
167
structure length
167
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 62
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fyzE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fyzE02
1FZ8E 1XMHE 1XVCE 1FZ1E 1MMOG 1MHYG 1MTYG 1FZHE 1XVDE 1XVGE 1FZ0E 1XVFE 1FZ7E 1FZ4E 1FYZE 1FZ5E 1FZ9E 1XMFE 1XVBE 1XU5E 1FZ6E 1FZIE 1MHZG 1XU3E 1XMGE 4GAMC 1XVEE 1FZ2E 1FZ3E
chains in the Genus database with same CATH superfamily
3SPZA 2JH8A 4I9QA 2JPNA 2K5SA 3N1EA 3TJYA 1FZ8E 3NHGA 1Q9XA 4FK4A 3LZIA 4DU3A 3RMAA 4M42A 2VIXA 3RMBA 4FJGA 2YB5A 2OZSA 4ICGC 3RMDA 3NDKA 4DTXA 4KHNA 2P1QB 2MZWB 3CFRA 1XVDE 3KD5E 3CFOA 1FPOA 1FXXA 3QEVA 1CLQA 4J2DA 3BVOA 3E4YA 4I6JB 4FJLA 1FZ5E 3HP9A 4RG8A 3SJJA 2DEBA 3SUOA 1WAJA 4AKGA 3C6PB 3UIQA 3TAGA 3LDBA 3QESA 2QXFA 2LF3A 1XMGE 4M45A 3SVIA 1IH7A 3UO3A 4B08A 4DTSA 4FJMA 2E31A 3SUNA 3SPYA 3V7DB 2ATQA 1XMHE 3SQ1A 2B1EA 2P1PB 4X5NA 5H37A 2PFTA 4ADOA 3WSOA 4JRQA 1IG9A 3SQ0A 4M3ZA 1FZHE 2VJ5A 4HCBA 4M3TA 4J2EA 3N1BA 3J27A 3SUQA 3SQ4A 4FJ9A 3TL8B 1FZ7E 3HL8A 3QEXA 3CQ8A 3QNOA 2P1NB 4E3SA 4J2AA 2DY4A 1JW2A 4DTUA 1FZ9E 4KI4A 4AI6A 2OVQB 4QNCA 1FZ6E 3QEIA 4FJHA 3K2OA 3QNNA 2JHCA 3MKSB 1XVEE 2JHAA 3KD1E 3OGMB 2P5GA 2RKHA 3J2PA 3QETA 3TABA 2OYQA 2PFVA 2FW3A 4M3WA 4AKIA 2MW2A 3L8BA 1Q9YA 4KHSA 4M3UA 3C94A 2H4TA 2E32A 4IT5A 4EP9A 3NE6A 4JS4A 3SI6A 4M3YA 1MMOG 4EYWA 2OVPB 3CFPA 3HGLA 4I9LA 3L2OB 4RL5A 4EPHA 4DU4A 3QEWA 4KHYA 2DTUA 4FJ7A 2LF6A 4DTNA 4KI6A 1XVGE 2JHPA 4FJJA 4FK0A 1WAFA 1FZ0E 4DU1A 4KHWA 4KHQA 1FYZE 2OVRB 3QERA 1NEXB 4JS5A 4FJIA 3QEPA 4E4BA 4JRPA 2HD0A 1XU5E 2P1MB 3HGKE 2P5OA 3RWUA 2B7MA 1FS1A 1MHZG 2MMBA 3LD8A 3LDSA 4DTPA 4AKHA 4FJ8A 1FZ3E 3UO2A 3C6NB 3L1NA 4X5MA 4FJKA 3S9HA 2OZMA 1P22A 1XVCE 1FZ1E 1N1CA 4DTOA 3OGLB 2JQTA 1MHYG 4FJNA 3TAFA 1MTYG 1LDKE 3NAEA 3TAEA 3RMCA 5IBKB 3C95A 4FJXA 3E4WA 5IZ7A 2JH9A 5IREA 4FVMA 2P1OB 3NCIA 1XVFE 4FJ5A 4J2BA 3SCXA 1FZ4E 4RNGA 4M3RA 3LZJA 2FYOA 4M41A 4KHUA 3SQ2A 1XMFE 4FK2A 1XL3C 4DTMA 3SUPA 1XVBE 2RCUA 3C6OB 1FZIE 3NGIA 3L0MA 4QNDA 3SNNA 2B8IA 1XU3E 4GAMC 2VJ4A 3OGKB 4DTRA 4DTJA 4ADNA 1FZ2E 4HCCA 4M3XA
chains in the Genus database with same CATH topology
3SPZA 2JH8A 4I9QA 2JPNA 3N1EA 3TJYA 1FZ8E 3NHGA 1Q9XA 4FK4A 3LZIA 4DU3A 3RMAA 4M42A 2VIXA 3RMBA 4FJGA 2YB5A 2OZSA 3RMDA 3NDKA 4DTXA 4KHNA 2P1QB 2MZWB 3CFRA 1XVDE 3KD5E 3CFOA 1FXXA 3QEVA 1CLQA 4J2DA 4FJLA 3E4YA 4I6JB 1FZ5E 3HP9A 4RG8A 3SJJA 2DEBA 3SUOA 1WAJA 4AKGA 3C6PB 3UIQA 3TAGA 3LDBA 3QESA 2QXFA 2LF3A 1XMGE 4M45A 3SVIA 1IH7A 4B08A 4DTSA 4FJMA 2E31A 3SUNA 3SPYA 3V7DB 2ATQA 1XMHE 3SQ1A 2B1EA 2P1PB 4X5NA 5H37A 2PFTA 4ADOA 3WSOA 4JRQA 1IG9A 3SQ0A 4M3ZA 1FZHE 2VJ5A 4HCBA 4M3TA 4J2EA 3N1BA 3J27A 3SUQA 3SQ4A 4FJ9A 3TL8B 1FZ7E 3HL8A 3QEXA 3CQ8A 3QNOA 2P1NB 4E3SA 4J2AA 2DY4A 4DTUA 1FZ9E 4KI4A 4AI6A 2OVQB 4QNCA 1FZ6E 3QEIA 4FJHA 3K2OA 3QNNA 2JHCA 3MKSB 1XVEE 2JHAA 3KD1E 3OGMB 2P5GA 3J2PA 3QETA 3TABA 2OYQA 2PFVA 2FW3A 4M3WA 4AKIA 3L8BA 4KHSA 1Q9YA 4M3UA 3C94A 2H4TA 2E32A 4EP9A 3NE6A 3SI6A 4JS4A 4M3YA 1MMOG 4EYWA 2OVPB 3CFPA 3HGLA 4I9LA 3L2OB 4RL5A 4EPHA 4DU4A 3QEWA 4KHYA 2DTUA 4FJ7A 2LF6A 4DTNA 4KI6A 1XVGE 2JHPA 4FJJA 4FK0A 1WAFA 1FZ0E 4DU1A 4KHWA 4KHQA 1FYZE 2OVRB 3QERA 1NEXB 4JS5A 4FJIA 3QEPA 4E4BA 4JRPA 2HD0A 1XU5E 2P1MB 3HGKE 2P5OA 3RWUA 2B7MA 1FS1A 1MHZG 2MMBA 3LD8A 3LDSA 4DTPA 4AKHA 4FJ8A 1FZ3E 3C6NB 3L1NA 4X5MA 4FJKA 3S9HA 2OZMA 1P22A 1XVCE 1FZ1E 4DTOA 3OGLB 4FJNA 1MHYG 3TAFA 1MTYG 1LDKE 3NAEA 3TAEA 3RMCA 5IBKB 3C95A 4FJXA 3E4WA 5IZ7A 2JH9A 5IREA 4FVMA 2P1OB 3NCIA 1XVFE 4FJ5A 4J2BA 3SCXA 1FZ4E 4RNGA 4M3RA 3LZJA 2FYOA 4M41A 4KHUA 3SQ2A 1XMFE 4FK2A 1XL3C 4DTMA 3SUPA 1XVBE 2RCUA 3C6OB 1FZIE 3NGIA 3L0MA 4QNDA 3SNNA 2B8IA 1XU3E 4GAMC 2VJ4A 3OGKB 4DTRA 4DTJA 4ADNA 1FZ2E 4HCCA 4M3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ8 E;  1XMH E;  1XVC E;  1FZ1 E;  1MMO G;  1MHY G;  1MTY G;  1FZH E;  1XVD E;  1XVG E;  1FZ0 E;  1XVF E;  1FZ7 E;  1FZ4 E;  1FYZ E;  1FZ5 E;  1FZ9 E;  1XMF E;  1XVB E;  1XU5 E;  1FZ6 E;  1FZI E;  1MHZ G;  1XU3 E;  1XMG E;  4GAM C;  1XVE E;  1FZ2 E;  1FZ3 E; 
#chains in the Genus database with same CATH topology
 3SPZ A;  2JH8 A;  4I9Q A;  2JPN A;  2K5S A;  3N1E A;  3TJY A;  1FZ8 E;  3NHG A;  1Q9X A;  4FK4 A;  3LZI A;  4DU3 A;  3RMA A;  4M42 A;  2VIX A;  3RMB A;  4FJG A;  2YB5 A;  2OZS A;  4ICG C;  3RMD A;  3NDK A;  4DTX A;  4KHN A;  2P1Q B;  2MZW B;  3CFR A;  1XVD E;  3KD5 E;  3CFO A;  1FPO A;  1FXX A;  3QEV A;  1CLQ A;  4J2D A;  3BVO A;  3E4Y A;  4I6J B;  4FJL A;  1FZ5 E;  3HP9 A;  4RG8 A;  3SJJ A;  2DEB A;  3SUO A;  1WAJ A;  4AKG A;  3C6P B;  3UIQ A;  3TAG A;  3LDB A;  3QES A;  2QXF A;  2LF3 A;  1XMG E;  4M45 A;  3SVI A;  1IH7 A;  3UO3 A;  4B08 A;  4DTS A;  4FJM A;  2E31 A;  3SUN A;  3SPY A;  3V7D B;  2ATQ A;  1XMH E;  3SQ1 A;  2B1E A;  2P1P B;  4X5N A;  5H37 A;  2PFT A;  4ADO A;  3WSO A;  4JRQ A;  1IG9 A;  3SQ0 A;  4M3Z A;  1FZH E;  2VJ5 A;  4HCB A;  4M3T A;  4J2E A;  3N1B A;  3J27 A;  3SUQ A;  3SQ4 A;  4FJ9 A;  3TL8 B;  1FZ7 E;  3HL8 A;  3QEX A;  3CQ8 A;  3QNO A;  2P1N B;  4E3S A;  4J2A A;  2DY4 A;  1JW2 A;  4DTU A;  1FZ9 E;  4KI4 A;  4AI6 A;  2OVQ B;  4QNC A;  1FZ6 E;  3QEI A;  4FJH A;  3K2O A;  3QNN A;  2JHC A;  3MKS B;  1XVE E;  2JHA A;  3KD1 E;  3OGM B;  2P5G A;  2RKH A;  3J2P A;  3QET A;  3TAB A;  2OYQ A;  2PFV A;  2FW3 A;  4M3W A;  4AKI A;  2MW2 A;  3L8B A;  1Q9Y A;  4KHS A;  4M3U A;  3C94 A;  2H4T A;  2E32 A;  4IT5 A;  4EP9 A;  3NE6 A;  4JS4 A;  3SI6 A;  4M3Y A;  1MMO G;  4EYW A;  2OVP B;  3CFP A;  3HGL A;  4I9L A;  3L2O B;  4RL5 A;  4EPH A;  4DU4 A;  3QEW A;  4KHY A;  2DTU A;  4FJ7 A;  2LF6 A;  4DTN A;  4KI6 A;  1XVG E;  2JHP A;  4FJJ A;  4FK0 A;  1WAF A;  1FZ0 E;  4DU1 A;  4KHW A;  4KHQ A;  1FYZ E;  2OVR B;  3QER A;  1NEX B;  4JS5 A;  4FJI A;  3QEP A;  4E4B A;  4JRP A;  2HD0 A;  1XU5 E;  2P1M B;  3HGK E;  2P5O A;  3RWU A;  2B7M A;  1FS1 A;  1MHZ G;  2MMB A;  3LD8 A;  3LDS A;  4DTP A;  4AKH A;  4FJ8 A;  1FZ3 E;  3UO2 A;  3C6N B;  3L1N A;  4X5M A;  4FJK A;  3S9H A;  2OZM A;  1P22 A;  1XVC E;  1FZ1 E;  1N1C A;  4DTO A;  3OGL B;  2JQT A;  1MHY G;  4FJN A;  3TAF A;  1MTY G;  1LDK E;  3NAE A;  3TAE A;  3RMC A;  5IBK B;  3C95 A;  4FJX A;  3E4W A;  5IZ7 A;  2JH9 A;  5IRE A;  4FVM A;  2P1O B;  3NCI A;  1XVF E;  4FJ5 A;  4J2B A;  3SCX A;  1FZ4 E;  4RNG A;  4M3R A;  3LZJ A;  2FYO A;  4M41 A;  4KHU A;  3SQ2 A;  1XMF E;  4FK2 A;  1XL3 C;  4DTM A;  3SUP A;  1XVB E;  2RCU A;  3C6O B;  1FZI E;  3NGI A;  3L0M A;  4QND A;  3SNN A;  2B8I A;  1XU3 E;  4GAM C;  2VJ4 A;  3OGK B;  4DTR A;  4DTJ A;  4ADN A;  1FZ2 E;  4HCC A;  4M3X A; 
#chains in the Genus database with same CATH homology
 3SPZ A;  2JH8 A;  4I9Q A;  2JPN A;  3N1E A;  3TJY A;  1FZ8 E;  3NHG A;  1Q9X A;  4FK4 A;  3LZI A;  4DU3 A;  3RMA A;  4M42 A;  2VIX A;  3RMB A;  4FJG A;  2YB5 A;  2OZS A;  3RMD A;  3NDK A;  4DTX A;  4KHN A;  2P1Q B;  2MZW B;  3CFR A;  1XVD E;  3KD5 E;  3CFO A;  1FXX A;  3QEV A;  1CLQ A;  4J2D A;  4FJL A;  3E4Y A;  4I6J B;  1FZ5 E;  3HP9 A;  4RG8 A;  3SJJ A;  2DEB A;  3SUO A;  1WAJ A;  4AKG A;  3C6P B;  3UIQ A;  3TAG A;  3LDB A;  3QES A;  2QXF A;  2LF3 A;  1XMG E;  4M45 A;  3SVI A;  1IH7 A;  4B08 A;  4DTS A;  4FJM A;  2E31 A;  3SUN A;  3SPY A;  3V7D B;  2ATQ A;  1XMH E;  3SQ1 A;  2B1E A;  2P1P B;  4X5N A;  5H37 A;  2PFT A;  4ADO A;  3WSO A;  4JRQ A;  1IG9 A;  3SQ0 A;  4M3Z A;  1FZH E;  2VJ5 A;  4HCB A;  4M3T A;  4J2E A;  3N1B A;  3J27 A;  3SUQ A;  3SQ4 A;  4FJ9 A;  3TL8 B;  1FZ7 E;  3HL8 A;  3QEX A;  3CQ8 A;  3QNO A;  2P1N B;  4E3S A;  4J2A A;  2DY4 A;  4DTU A;  1FZ9 E;  4KI4 A;  4AI6 A;  2OVQ B;  4QNC A;  1FZ6 E;  3QEI A;  4FJH A;  3K2O A;  3QNN A;  2JHC A;  3MKS B;  1XVE E;  2JHA A;  3KD1 E;  3OGM B;  2P5G A;  3J2P A;  3QET A;  3TAB A;  2OYQ A;  2PFV A;  2FW3 A;  4M3W A;  4AKI A;  3L8B A;  4KHS A;  1Q9Y A;  4M3U A;  3C94 A;  2H4T A;  2E32 A;  4EP9 A;  3NE6 A;  3SI6 A;  4JS4 A;  4M3Y A;  1MMO G;  4EYW A;  2OVP B;  3CFP A;  3HGL A;  4I9L A;  3L2O B;  4RL5 A;  4EPH A;  4DU4 A;  3QEW A;  4KHY A;  2DTU A;  4FJ7 A;  2LF6 A;  4DTN A;  4KI6 A;  1XVG E;  2JHP A;  4FJJ A;  4FK0 A;  1WAF A;  1FZ0 E;  4DU1 A;  4KHW A;  4KHQ A;  1FYZ E;  2OVR B;  3QER A;  1NEX B;  4JS5 A;  4FJI A;  3QEP A;  4E4B A;  4JRP A;  2HD0 A;  1XU5 E;  2P1M B;  3HGK E;  2P5O A;  3RWU A;  2B7M A;  1FS1 A;  1MHZ G;  2MMB A;  3LD8 A;  3LDS A;  4DTP A;  4AKH A;  4FJ8 A;  1FZ3 E;  3C6N B;  3L1N A;  4X5M A;  4FJK A;  3S9H A;  2OZM A;  1P22 A;  1XVC E;  1FZ1 E;  4DTO A;  3OGL B;  4FJN A;  1MHY G;  3TAF A;  1MTY G;  1LDK E;  3NAE A;  3TAE A;  3RMC A;  5IBK B;  3C95 A;  4FJX A;  3E4W A;  5IZ7 A;  2JH9 A;  5IRE A;  4FVM A;  2P1O B;  3NCI A;  1XVF E;  4FJ5 A;  4J2B A;  3SCX A;  1FZ4 E;  4RNG A;  4M3R A;  3LZJ A;  2FYO A;  4M41 A;  4KHU A;  3SQ2 A;  1XMF E;  4FK2 A;  1XL3 C;  4DTM A;  3SUP A;  1XVB E;  2RCU A;  3C6O B;  1FZI E;  3NGI A;  3L0M A;  4QND A;  3SNN A;  2B8I A;  1XU3 E;  4GAM C;  2VJ4 A;  3OGK B;  4DTR A;  4DTJ A;  4ADN A;  1FZ2 E;  4HCC A;  4M3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...