1FYZE

Methane monooxygenase hydroxylase, form ii reduced by soaking
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 62
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fyzE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fyzE02
1XVBE 1MTYG 1XMFE 1XMGE 1FZ6E 1XVGE 1FZ7E 1FZ4E 4GAMC 1XVEE 1FZ8E 1MHZG 1FZ9E 1XU5E 1MMOG 1FZ5E 1FZHE 1XVFE 1MHYG 1XVDE 1FZ3E 1FYZE 1XMHE 1FZ1E 1FZ0E 1XU3E 1XVCE 1FZIE 1FZ2E
chains in the Genus database with same CATH superfamily
2K5SA 2OVPB 2PFVA 2VJ5A 3SVIA 3UO3A 1XVBE 3V7DB 3CQ8A 3RMAA 4FJXA 3LD8A 3TABA 1IH7A 4DU3A 1XMFE 1FZ6E 4HCCA 1FZ7E 2RKHA 2P1OB 4J2EA 3K2OA 4X5MA 3TL8B 3NAEA 2PFTA 1N1CA 4GAMC 1XL3C 3HP9A 4RG8A 3C6PB 3NHGA 3TAFA 4KI4A 1WAJA 4JRQA 1WAFA 2P1PB 4RNGA 4I9QA 4FK0A 3L2OB 4KHUA 2RCUA 2B1EA 3L0MA 4KHWA 2OZMA 5IZ7A 1FZ5E 3QEPA 4M45A 1FXXA 2ATQA 1Q9XA 1XVDE 4M3RA 4KHNA 4DU4A 4DTXA 3SQ0A 2JHCA 4FJMA 2JHPA 2OVQB 3QEIA 4FJJA 1FZ1E 4X5NA 4AI6A 4FJ5A 3QESA 2QXFA 4DTSA 3NCIA 3RWUA 4FJIA 2P1MB 2OZSA 3KD1E 4AKGA 2JH8A 1FZ4E 2H4TA 3SQ4A 3E4WA 5IBKB 3LZIA 2MW2A 4DTOA 2E32A 1MHZG 2MMBA 3LDSA 4DU1A 4FK4A 3SUQA 4FK2A 3SI6A 3E4YA 2FYOA 4M3YA 3C94A 5IREA 3SNNA 3RMDA 2JQTA 1MHYG 3CFRA 4JS4A 1FYZE 3HGKE 4FJNA 4M41A 2DTUA 1LDKE 1XMHE 3OGLB 2P5GA 4DTRA 3LDBA 3SJJA 4KHSA 2FW3A 2DY4A 3TAEA 2VIXA 3TJYA 4J2DA 3QEWA 1NEXB 2LF3A 2MZWB 4M3ZA 3RMCA 1Q9YA 4KHQA 1MTYG 3KD5E 2B7MA 3L1NA 4E3SA 3QERA 3RMBA 3QEXA 4FJ7A 1IG9A 1CLQA 3SQ2A 3QEVA 4DTMA 3UIQA 4I9LA 3NDKA 3SQ1A 4AKIA 1XVEE 3NGIA 2B8IA 1FZ8E 3N1EA 3HL8A 1P22A 4M3UA 4DTUA 4FJ8A 2YB5A 1FZ9E 3SPYA 4DTJA 2E31A 2OVRB 4QNDA 3SPZA 1FZHE 1XVFE 4M3WA 3MKSB 4J2AA 4M3TA 4KHYA 2P1NB 4FVMA 3S9HA 4FJLA 4IT5A 1FZ0E 1FZIE 4ADOA 2LF6A 4EPHA 4RL5A 4ICGC 4E4BA 3UO2A 4JRPA 2JPNA 4KI6A 3QNOA 1FS1A 3QNNA 5H37A 1XMGE 1XVGE 2DEBA 3CFOA 3HGLA 3C6OB 4J2BA 4EYWA 4FJGA 3LZJA 2JH9A 4JS5A 4AKHA 2JHAA 1JW2A 3J27A 2VJ4A 3N1BA 3CFPA 3J2PA 4HCBA 1XU5E 3C6NB 4ADNA 4B08A 4EP9A 3L8BA 1FPOA 3SUPA 4FJKA 4M3XA 4QNCA 3SUOA 3TAGA 2OYQA 1MMOG 3OGKB 4M42A 3SUNA 3BVOA 3NE6A 4DTPA 1FZ3E 2HD0A 4I6JB 2P5OA 4FJHA 4FJ9A 3C95A 3SCXA 3WSOA 1XU3E 4DTNA 1XVCE 3OGMB 3QETA 1FZ2E 2P1QB
chains in the Genus database with same CATH topology
2OVPB 2VJ5A 2PFVA 3SVIA 3CQ8A 1XVBE 3V7DB 3RMAA 4FJXA 3LD8A 3TABA 1IH7A 4DU3A 1XMFE 1FZ6E 4HCCA 1FZ7E 2P1OB 4J2EA 3K2OA 4X5MA 3TL8B 3NAEA 2PFTA 4GAMC 3NHGA 1XL3C 3HP9A 4RG8A 3C6PB 3TAFA 4KI4A 1WAJA 4JRQA 1WAFA 2P1PB 4RNGA 4I9QA 4FK0A 3L2OB 4KHUA 2RCUA 2B1EA 3L0MA 4KHWA 2OZMA 5IZ7A 1FZ5E 3QEPA 4M45A 1FXXA 2ATQA 1Q9XA 1XVDE 4M3RA 4KHNA 4DU4A 4DTXA 3SQ0A 2JHCA 4FJMA 2JHPA 2OVQB 3QEIA 4FJJA 1FZ1E 4X5NA 4AI6A 4FJ5A 3QESA 2QXFA 4DTSA 3NCIA 3RWUA 4FJIA 2P1MB 2OZSA 3KD1E 4AKGA 2JH8A 1FZ4E 2H4TA 3SQ4A 3E4WA 5IBKB 3LZIA 4DTOA 2E32A 1MHZG 2MMBA 3LDSA 4DU1A 4FK4A 3SUQA 4FK2A 3SI6A 3E4YA 2FYOA 4M3YA 3C94A 5IREA 3SNNA 3RMDA 1MHYG 3CFRA 4JS4A 1FYZE 3HGKE 4FJNA 4M41A 2DTUA 1LDKE 1XMHE 3OGLB 2P5GA 4DTRA 3LDBA 3SJJA 4KHSA 2FW3A 2DY4A 3TAEA 2VIXA 3TJYA 4J2DA 3QEWA 1NEXB 2LF3A 2MZWB 4M3ZA 3RMCA 1Q9YA 4KHQA 1MTYG 3KD5E 2B7MA 3L1NA 4E3SA 3QERA 3RMBA 3QEXA 4FJ7A 1IG9A 1CLQA 3SQ2A 3QEVA 4DTMA 3UIQA 4I9LA 3NDKA 3SQ1A 4AKIA 1XVEE 3NGIA 2B8IA 1FZ8E 3N1EA 3HL8A 1P22A 4M3UA 4DTUA 4FJ8A 2YB5A 1FZ9E 3SPYA 4DTJA 2E31A 2OVRB 4QNDA 3SPZA 1FZHE 1XVFE 4M3WA 3MKSB 4J2AA 4M3TA 4KHYA 2P1NB 4FVMA 3S9HA 4FJLA 1FZ0E 1FZIE 4ADOA 2LF6A 4EPHA 4RL5A 4E4BA 4JRPA 2JPNA 4KI6A 3QNOA 1FS1A 3QNNA 5H37A 1XMGE 1XVGE 2DEBA 3CFOA 3HGLA 3C6OB 4J2BA 4EYWA 4FJGA 3LZJA 2JH9A 4JS5A 4AKHA 2JHAA 3J27A 2VJ4A 3N1BA 3CFPA 3J2PA 4HCBA 1XU5E 3C6NB 4ADNA 4B08A 4EP9A 3L8BA 3SUPA 4FJKA 4M3XA 4QNCA 3SUOA 3TAGA 2OYQA 1MMOG 3OGKB 4M42A 3SUNA 3NE6A 4DTPA 1FZ3E 2HD0A 4I6JB 2P5OA 4FJHA 4FJ9A 3C95A 3SCXA 3WSOA 1XU3E 4DTNA 1XVCE 3OGMB 3QETA 1FZ2E 2P1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVB E;  1MTY G;  1XMF E;  1XMG E;  1FZ6 E;  1XVG E;  1FZ7 E;  1FZ4 E;  4GAM C;  1XVE E;  1FZ8 E;  1MHZ G;  1FZ9 E;  1XU5 E;  1MMO G;  1FZ5 E;  1FZH E;  1XVF E;  1MHY G;  1XVD E;  1FZ3 E;  1FYZ E;  1XMH E;  1FZ1 E;  1FZ0 E;  1XU3 E;  1XVC E;  1FZI E;  1FZ2 E; 
#chains in the Genus database with same CATH topology
 2K5S A;  2OVP B;  2PFV A;  2VJ5 A;  3SVI A;  3UO3 A;  1XVB E;  3V7D B;  3CQ8 A;  3RMA A;  4FJX A;  3LD8 A;  3TAB A;  1IH7 A;  4DU3 A;  1XMF E;  1FZ6 E;  4HCC A;  1FZ7 E;  2RKH A;  2P1O B;  4J2E A;  3K2O A;  4X5M A;  3TL8 B;  3NAE A;  2PFT A;  1N1C A;  4GAM C;  1XL3 C;  3HP9 A;  4RG8 A;  3C6P B;  3NHG A;  3TAF A;  4KI4 A;  1WAJ A;  4JRQ A;  1WAF A;  2P1P B;  4RNG A;  4I9Q A;  4FK0 A;  3L2O B;  4KHU A;  2RCU A;  2B1E A;  3L0M A;  4KHW A;  2OZM A;  5IZ7 A;  1FZ5 E;  3QEP A;  4M45 A;  1FXX A;  2ATQ A;  1Q9X A;  1XVD E;  4M3R A;  4KHN A;  4DU4 A;  4DTX A;  3SQ0 A;  2JHC A;  4FJM A;  2JHP A;  2OVQ B;  3QEI A;  4FJJ A;  1FZ1 E;  4X5N A;  4AI6 A;  4FJ5 A;  3QES A;  2QXF A;  4DTS A;  3NCI A;  3RWU A;  4FJI A;  2P1M B;  2OZS A;  3KD1 E;  4AKG A;  2JH8 A;  1FZ4 E;  2H4T A;  3SQ4 A;  3E4W A;  5IBK B;  3LZI A;  2MW2 A;  4DTO A;  2E32 A;  1MHZ G;  2MMB A;  3LDS A;  4DU1 A;  4FK4 A;  3SUQ A;  4FK2 A;  3SI6 A;  3E4Y A;  2FYO A;  4M3Y A;  3C94 A;  5IRE A;  3SNN A;  3RMD A;  2JQT A;  1MHY G;  3CFR A;  4JS4 A;  1FYZ E;  3HGK E;  4FJN A;  4M41 A;  2DTU A;  1LDK E;  1XMH E;  3OGL B;  2P5G A;  4DTR A;  3LDB A;  3SJJ A;  4KHS A;  2FW3 A;  2DY4 A;  3TAE A;  2VIX A;  3TJY A;  4J2D A;  3QEW A;  1NEX B;  2LF3 A;  2MZW B;  4M3Z A;  3RMC A;  1Q9Y A;  4KHQ A;  1MTY G;  3KD5 E;  2B7M A;  3L1N A;  4E3S A;  3QER A;  3RMB A;  3QEX A;  4FJ7 A;  1IG9 A;  1CLQ A;  3SQ2 A;  3QEV A;  4DTM A;  3UIQ A;  4I9L A;  3NDK A;  3SQ1 A;  4AKI A;  1XVE E;  3NGI A;  2B8I A;  1FZ8 E;  3N1E A;  3HL8 A;  1P22 A;  4M3U A;  4DTU A;  4FJ8 A;  2YB5 A;  1FZ9 E;  3SPY A;  4DTJ A;  2E31 A;  2OVR B;  4QND A;  3SPZ A;  1FZH E;  1XVF E;  4M3W A;  3MKS B;  4J2A A;  4M3T A;  4KHY A;  2P1N B;  4FVM A;  3S9H A;  4FJL A;  4IT5 A;  1FZ0 E;  1FZI E;  4ADO A;  2LF6 A;  4EPH A;  4RL5 A;  4ICG C;  4E4B A;  3UO2 A;  4JRP A;  2JPN A;  4KI6 A;  3QNO A;  1FS1 A;  3QNN A;  5H37 A;  1XMG E;  1XVG E;  2DEB A;  3CFO A;  3HGL A;  3C6O B;  4J2B A;  4EYW A;  4FJG A;  3LZJ A;  2JH9 A;  4JS5 A;  4AKH A;  2JHA A;  1JW2 A;  3J27 A;  2VJ4 A;  3N1B A;  3CFP A;  3J2P A;  4HCB A;  1XU5 E;  3C6N B;  4ADN A;  4B08 A;  4EP9 A;  3L8B A;  1FPO A;  3SUP A;  4FJK A;  4M3X A;  4QNC A;  3SUO A;  3TAG A;  2OYQ A;  1MMO G;  3OGK B;  4M42 A;  3SUN A;  3BVO A;  3NE6 A;  4DTP A;  1FZ3 E;  2HD0 A;  4I6J B;  2P5O A;  4FJH A;  4FJ9 A;  3C95 A;  3SCX A;  3WSO A;  1XU3 E;  4DTN A;  1XVC E;  3OGM B;  3QET A;  1FZ2 E;  2P1Q B; 
#chains in the Genus database with same CATH homology
 2OVP B;  2VJ5 A;  2PFV A;  3SVI A;  3CQ8 A;  1XVB E;  3V7D B;  3RMA A;  4FJX A;  3LD8 A;  3TAB A;  1IH7 A;  4DU3 A;  1XMF E;  1FZ6 E;  4HCC A;  1FZ7 E;  2P1O B;  4J2E A;  3K2O A;  4X5M A;  3TL8 B;  3NAE A;  2PFT A;  4GAM C;  3NHG A;  1XL3 C;  3HP9 A;  4RG8 A;  3C6P B;  3TAF A;  4KI4 A;  1WAJ A;  4JRQ A;  1WAF A;  2P1P B;  4RNG A;  4I9Q A;  4FK0 A;  3L2O B;  4KHU A;  2RCU A;  2B1E A;  3L0M A;  4KHW A;  2OZM A;  5IZ7 A;  1FZ5 E;  3QEP A;  4M45 A;  1FXX A;  2ATQ A;  1Q9X A;  1XVD E;  4M3R A;  4KHN A;  4DU4 A;  4DTX A;  3SQ0 A;  2JHC A;  4FJM A;  2JHP A;  2OVQ B;  3QEI A;  4FJJ A;  1FZ1 E;  4X5N A;  4AI6 A;  4FJ5 A;  3QES A;  2QXF A;  4DTS A;  3NCI A;  3RWU A;  4FJI A;  2P1M B;  2OZS A;  3KD1 E;  4AKG A;  2JH8 A;  1FZ4 E;  2H4T A;  3SQ4 A;  3E4W A;  5IBK B;  3LZI A;  4DTO A;  2E32 A;  1MHZ G;  2MMB A;  3LDS A;  4DU1 A;  4FK4 A;  3SUQ A;  4FK2 A;  3SI6 A;  3E4Y A;  2FYO A;  4M3Y A;  3C94 A;  5IRE A;  3SNN A;  3RMD A;  1MHY G;  3CFR A;  4JS4 A;  1FYZ E;  3HGK E;  4FJN A;  4M41 A;  2DTU A;  1LDK E;  1XMH E;  3OGL B;  2P5G A;  4DTR A;  3LDB A;  3SJJ A;  4KHS A;  2FW3 A;  2DY4 A;  3TAE A;  2VIX A;  3TJY A;  4J2D A;  3QEW A;  1NEX B;  2LF3 A;  2MZW B;  4M3Z A;  3RMC A;  1Q9Y A;  4KHQ A;  1MTY G;  3KD5 E;  2B7M A;  3L1N A;  4E3S A;  3QER A;  3RMB A;  3QEX A;  4FJ7 A;  1IG9 A;  1CLQ A;  3SQ2 A;  3QEV A;  4DTM A;  3UIQ A;  4I9L A;  3NDK A;  3SQ1 A;  4AKI A;  1XVE E;  3NGI A;  2B8I A;  1FZ8 E;  3N1E A;  3HL8 A;  1P22 A;  4M3U A;  4DTU A;  4FJ8 A;  2YB5 A;  1FZ9 E;  3SPY A;  4DTJ A;  2E31 A;  2OVR B;  4QND A;  3SPZ A;  1FZH E;  1XVF E;  4M3W A;  3MKS B;  4J2A A;  4M3T A;  4KHY A;  2P1N B;  4FVM A;  3S9H A;  4FJL A;  1FZ0 E;  1FZI E;  4ADO A;  2LF6 A;  4EPH A;  4RL5 A;  4E4B A;  4JRP A;  2JPN A;  4KI6 A;  3QNO A;  1FS1 A;  3QNN A;  5H37 A;  1XMG E;  1XVG E;  2DEB A;  3CFO A;  3HGL A;  3C6O B;  4J2B A;  4EYW A;  4FJG A;  3LZJ A;  2JH9 A;  4JS5 A;  4AKH A;  2JHA A;  3J27 A;  2VJ4 A;  3N1B A;  3CFP A;  3J2P A;  4HCB A;  1XU5 E;  3C6N B;  4ADN A;  4B08 A;  4EP9 A;  3L8B A;  3SUP A;  4FJK A;  4M3X A;  4QNC A;  3SUO A;  3TAG A;  2OYQ A;  1MMO G;  3OGK B;  4M42 A;  3SUN A;  3NE6 A;  4DTP A;  1FZ3 E;  2HD0 A;  4I6J B;  2P5O A;  4FJH A;  4FJ9 A;  3C95 A;  3SCX A;  3WSO A;  1XU3 E;  4DTN A;  1XVC E;  3OGM B;  3QET A;  1FZ2 E;  2P1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...