1MHZG

Methane monooxygenase hydroxylase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
167
structure length
167
Chain Sequence
AKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE HYDROXYLASE
publication title Crystal structure of the hydroxylase component of methane monooxygenase from Methylosinus trichosporium OB3b
pubmed rcsb
molecule tags Oxidoreductase
total genus 60
structure length 167
sequence length 167
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1996-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhzG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhzG02
1MHYG 1FZ7E 1XMFE 1FZ0E 1FZHE 1FZIE 1FZ8E 1FZ6E 1FZ5E 1FYZE 1XVCE 1XVDE 1MMOG 1MHZG 1XVEE 1XVGE 4GAMC 1XU3E 1XVBE 1XU5E 1XVFE 1FZ2E 1XMGE 1MTYG 1FZ4E 1FZ9E 1FZ1E 1XMHE 1FZ3E
chains in the Genus database with same CATH superfamily
3MKSB 4DTRA 1XMFE 4I6JB 3NDKA 3BVOA 1FZIE 3WSOA 4DTUA 1WAJA 4JS4A 1LDKE 1IH7A 3QEIA 2P1NB 3SNNA 4KHNA 2FYOA 2RCUA 2VJ4A 4M3WA 4JRQA 3RMBA 3TL8B 2P1MB 4FJMA 3HL8A 4J2AA 2B7MA 3KD5E 3C95A 3N1EA 4GAMC 4DU1A 1WAFA 2DY4A 4AKGA 2VIXA 4DTPA 1XU5E 1XVFE 1FZ2E 2LF3A 3C6NB 2P5GA 4J2BA 4FK2A 2JHAA 3C94A 3SVIA 4FJLA 4M3XA 2JQTA 3QESA 4M3TA 3OGLB 3TABA 2MZWB 4FJIA 3SI6A 1FZ3E 4HCCA 1CLQA 2MMBA 2JH8A 3CQ8A 4DTMA 2HD0A 2E32A 3UO2A 3N1BA 3LZJA 4KHWA 1FZ6E 3TAEA 3CFRA 3L8BA 1XL3C 1FYZE 4RNGA 4FJGA 3C6OB 2E31A 5IZ7A 1Q9XA 4E4BA 2MW2A 1XVEE 1XVGE 2YB5A 3RMAA 4DTXA 2JPNA 3SQ1A 5IBKB 4FK0A 1XVBE 2DEBA 4I9LA 1JW2A 2VJ5A 1FXXA 2B1EA 2JH9A 2P1OB 3SJJA 4M3ZA 2DTUA 4FJHA 1MTYG 4DU3A 4FJ7A 4ADOA 4KHQA 4QNDA 3QETA 4FJ8A 2OZMA 2OVQB 1XMHE 3SUQA 2B8IA 3L1NA 4FJKA 3C6PB 3TAGA 1MHYG 1FZ7E 3SQ0A 3UO3A 4KI4A 1FZHE 4RG8A 1FZ8E 4KHSA 4JS5A 4M3YA 2JHCA 3SUOA 4DTNA 3LDSA 3RMDA 1FZ5E 1XVCE 1FPOA 3NCIA 4QNCA 4M3RA 1MMOG 3LD8A 1MHZG 3UIQA 2JHPA 4M41A 4J2EA 4E3SA 4DTOA 3QEWA 1NEXB 2H4TA 2OVPB 3V7DB 3SPYA 3TJYA 3TAFA 4KHUA 4AKHA 3E4WA 4JRPA 2ATQA 3RWUA 4DU4A 3LDBA 3NAEA 3SPZA 2PFTA 1FZ9E 3SUNA 4I9QA 4KHYA 4J2DA 1FZ1E 2LF6A 2P1QB 4EP9A 4IT5A 3NE6A 4FK4A 4X5MA 3QNOA 4RL5A 3L2OB 2PFVA 4FJ5A 4DTSA 1FZ0E 3SUPA 3CFPA 4FJNA 4M45A 4EYWA 3NGIA 3QEXA 3SQ4A 2OVRB 2QXFA 3RMCA 3S9HA 3OGMB 1FS1A 2FW3A 2K5SA 3J2PA 2P1PB 1Q9YA 3CFOA 4FVMA 3QEVA 1IG9A 1N1CA 1XVDE 3NHGA 2RKHA 5IREA 3QERA 2P5OA 4FJXA 4ICGC 4KI6A 2OYQA 4M3UA 3J27A 1XU3E 3HGLA 3L0MA 4DTJA 4FJJA 3HP9A 3QEPA 4AKIA 5H37A 3SQ2A 4EPHA 4AI6A 1XMGE 3QNNA 3LZIA 3E4YA 4B08A 1P22A 3K2OA 1FZ4E 3OGKB 4ADNA 3SCXA 4FJ9A 3HGKE 4M42A 4X5NA 4HCBA 3KD1E 2OZSA
chains in the Genus database with same CATH topology
3MKSB 4DTRA 1XMFE 4I6JB 3NDKA 1FZIE 3WSOA 4DTUA 1WAJA 4JS4A 1LDKE 1IH7A 3QEIA 2P1NB 3SNNA 4KHNA 2FYOA 2RCUA 2VJ4A 4M3WA 4JRQA 3RMBA 3TL8B 2P1MB 4FJMA 3HL8A 4J2AA 2B7MA 3KD5E 3C95A 3N1EA 4GAMC 4DU1A 1WAFA 2DY4A 4AKGA 2VIXA 4DTPA 1XU5E 1XVFE 3C6NB 1FZ2E 2LF3A 2P5GA 4J2BA 4FK2A 2JHAA 3C94A 3SVIA 4FJLA 4M3XA 3QESA 4M3TA 3OGLB 3TABA 2MZWB 4FJIA 3SI6A 1FZ3E 4HCCA 1CLQA 2MMBA 2JH8A 3CQ8A 4DTMA 2HD0A 2E32A 3N1BA 3LZJA 4KHWA 1FZ6E 3TAEA 3CFRA 3L8BA 1XL3C 1FYZE 4RNGA 4FJGA 3C6OB 2E31A 5IZ7A 1Q9XA 4E4BA 1XVEE 1XVGE 2YB5A 3RMAA 4DTXA 2JPNA 3SQ1A 5IBKB 4FK0A 1XVBE 2DEBA 4I9LA 2VJ5A 1FXXA 2B1EA 2JH9A 2P1OB 3SJJA 4M3ZA 2DTUA 4FJHA 1MTYG 4DU3A 4FJ7A 4ADOA 4KHQA 4QNDA 3QETA 4FJ8A 2OZMA 2OVQB 1XMHE 3SUQA 2B8IA 3L1NA 4FJKA 3C6PB 3TAGA 1MHYG 1FZ7E 3SQ0A 4KI4A 1FZHE 4RG8A 1FZ8E 4KHSA 4JS5A 4M3YA 2JHCA 3SUOA 4DTNA 3LDSA 3RMDA 1FZ5E 1XVCE 3NCIA 4QNCA 4M3RA 1MMOG 3LD8A 1MHZG 3UIQA 2JHPA 4M41A 4J2EA 4E3SA 4DTOA 3QEWA 1NEXB 2H4TA 2OVPB 3V7DB 3SPYA 3TJYA 3TAFA 4KHUA 4AKHA 3E4WA 4JRPA 2ATQA 3RWUA 4DU4A 3LDBA 3NAEA 3SPZA 2PFTA 1FZ9E 3SUNA 4I9QA 4KHYA 4J2DA 1FZ1E 2LF6A 2P1QB 4EP9A 3NE6A 4FK4A 4X5MA 3QNOA 4RL5A 3L2OB 2PFVA 4FJ5A 4DTSA 1FZ0E 3SUPA 3CFPA 4FJNA 4M45A 4EYWA 3NGIA 3QEXA 3SQ4A 2OVRB 2QXFA 3RMCA 3S9HA 3OGMB 1FS1A 2FW3A 3J2PA 1Q9YA 2P1PB 1IG9A 3CFOA 4FVMA 3QEVA 1XVDE 4FJXA 3NHGA 5IREA 3QERA 2P5OA 4KI6A 2OYQA 4M3UA 3J27A 1XU3E 3HGLA 3L0MA 4DTJA 4FJJA 3HP9A 3QEPA 4AKIA 5H37A 3SQ2A 4EPHA 4AI6A 1XMGE 3QNNA 3LZIA 3E4YA 4B08A 1P22A 3K2OA 1FZ4E 3OGKB 4ADNA 3SCXA 4FJ9A 3HGKE 4M42A 4X5NA 4HCBA 3KD1E 2OZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHY G;  1FZ7 E;  1XMF E;  1FZ0 E;  1FZH E;  1FZI E;  1FZ8 E;  1FZ6 E;  1FZ5 E;  1FYZ E;  1XVC E;  1XVD E;  1MMO G;  1MHZ G;  1XVE E;  1XVG E;  4GAM C;  1XU3 E;  1XVB E;  1XU5 E;  1XVF E;  1FZ2 E;  1XMG E;  1MTY G;  1FZ4 E;  1FZ9 E;  1FZ1 E;  1XMH E;  1FZ3 E; 
#chains in the Genus database with same CATH topology
 3MKS B;  4DTR A;  1XMF E;  4I6J B;  3NDK A;  3BVO A;  1FZI E;  3WSO A;  4DTU A;  1WAJ A;  4JS4 A;  1LDK E;  1IH7 A;  3QEI A;  2P1N B;  3SNN A;  4KHN A;  2FYO A;  2RCU A;  2VJ4 A;  4M3W A;  4JRQ A;  3RMB A;  3TL8 B;  2P1M B;  4FJM A;  3HL8 A;  4J2A A;  2B7M A;  3KD5 E;  3C95 A;  3N1E A;  4GAM C;  4DU1 A;  1WAF A;  2DY4 A;  4AKG A;  2VIX A;  4DTP A;  1XU5 E;  1XVF E;  1FZ2 E;  2LF3 A;  3C6N B;  2P5G A;  4J2B A;  4FK2 A;  2JHA A;  3C94 A;  3SVI A;  4FJL A;  4M3X A;  2JQT A;  3QES A;  4M3T A;  3OGL B;  3TAB A;  2MZW B;  4FJI A;  3SI6 A;  1FZ3 E;  4HCC A;  1CLQ A;  2MMB A;  2JH8 A;  3CQ8 A;  4DTM A;  2HD0 A;  2E32 A;  3UO2 A;  3N1B A;  3LZJ A;  4KHW A;  1FZ6 E;  3TAE A;  3CFR A;  3L8B A;  1XL3 C;  1FYZ E;  4RNG A;  4FJG A;  3C6O B;  2E31 A;  5IZ7 A;  1Q9X A;  4E4B A;  2MW2 A;  1XVE E;  1XVG E;  2YB5 A;  3RMA A;  4DTX A;  2JPN A;  3SQ1 A;  5IBK B;  4FK0 A;  1XVB E;  2DEB A;  4I9L A;  1JW2 A;  2VJ5 A;  1FXX A;  2B1E A;  2JH9 A;  2P1O B;  3SJJ A;  4M3Z A;  2DTU A;  4FJH A;  1MTY G;  4DU3 A;  4FJ7 A;  4ADO A;  4KHQ A;  4QND A;  3QET A;  4FJ8 A;  2OZM A;  2OVQ B;  1XMH E;  3SUQ A;  2B8I A;  3L1N A;  4FJK A;  3C6P B;  3TAG A;  1MHY G;  1FZ7 E;  3SQ0 A;  3UO3 A;  4KI4 A;  1FZH E;  4RG8 A;  1FZ8 E;  4KHS A;  4JS5 A;  4M3Y A;  2JHC A;  3SUO A;  4DTN A;  3LDS A;  3RMD A;  1FZ5 E;  1XVC E;  1FPO A;  3NCI A;  4QNC A;  4M3R A;  1MMO G;  3LD8 A;  1MHZ G;  3UIQ A;  2JHP A;  4M41 A;  4J2E A;  4E3S A;  4DTO A;  3QEW A;  1NEX B;  2H4T A;  2OVP B;  3V7D B;  3SPY A;  3TJY A;  3TAF A;  4KHU A;  4AKH A;  3E4W A;  4JRP A;  2ATQ A;  3RWU A;  4DU4 A;  3LDB A;  3NAE A;  3SPZ A;  2PFT A;  1FZ9 E;  3SUN A;  4I9Q A;  4KHY A;  4J2D A;  1FZ1 E;  2LF6 A;  2P1Q B;  4EP9 A;  4IT5 A;  3NE6 A;  4FK4 A;  4X5M A;  3QNO A;  4RL5 A;  3L2O B;  2PFV A;  4FJ5 A;  4DTS A;  1FZ0 E;  3SUP A;  3CFP A;  4FJN A;  4M45 A;  4EYW A;  3NGI A;  3QEX A;  3SQ4 A;  2OVR B;  2QXF A;  3RMC A;  3S9H A;  3OGM B;  1FS1 A;  2FW3 A;  2K5S A;  3J2P A;  2P1P B;  1Q9Y A;  3CFO A;  4FVM A;  3QEV A;  1IG9 A;  1N1C A;  1XVD E;  3NHG A;  2RKH A;  5IRE A;  3QER A;  2P5O A;  4FJX A;  4ICG C;  4KI6 A;  2OYQ A;  4M3U A;  3J27 A;  1XU3 E;  3HGL A;  3L0M A;  4DTJ A;  4FJJ A;  3HP9 A;  3QEP A;  4AKI A;  5H37 A;  3SQ2 A;  4EPH A;  4AI6 A;  1XMG E;  3QNN A;  3LZI A;  3E4Y A;  4B08 A;  1P22 A;  3K2O A;  1FZ4 E;  3OGK B;  4ADN A;  3SCX A;  4FJ9 A;  3HGK E;  4M42 A;  4X5N A;  4HCB A;  3KD1 E;  2OZS A; 
#chains in the Genus database with same CATH homology
 3MKS B;  4DTR A;  1XMF E;  4I6J B;  3NDK A;  1FZI E;  3WSO A;  4DTU A;  1WAJ A;  4JS4 A;  1LDK E;  1IH7 A;  3QEI A;  2P1N B;  3SNN A;  4KHN A;  2FYO A;  2RCU A;  2VJ4 A;  4M3W A;  4JRQ A;  3RMB A;  3TL8 B;  2P1M B;  4FJM A;  3HL8 A;  4J2A A;  2B7M A;  3KD5 E;  3C95 A;  3N1E A;  4GAM C;  4DU1 A;  1WAF A;  2DY4 A;  4AKG A;  2VIX A;  4DTP A;  1XU5 E;  1XVF E;  3C6N B;  1FZ2 E;  2LF3 A;  2P5G A;  4J2B A;  4FK2 A;  2JHA A;  3C94 A;  3SVI A;  4FJL A;  4M3X A;  3QES A;  4M3T A;  3OGL B;  3TAB A;  2MZW B;  4FJI A;  3SI6 A;  1FZ3 E;  4HCC A;  1CLQ A;  2MMB A;  2JH8 A;  3CQ8 A;  4DTM A;  2HD0 A;  2E32 A;  3N1B A;  3LZJ A;  4KHW A;  1FZ6 E;  3TAE A;  3CFR A;  3L8B A;  1XL3 C;  1FYZ E;  4RNG A;  4FJG A;  3C6O B;  2E31 A;  5IZ7 A;  1Q9X A;  4E4B A;  1XVE E;  1XVG E;  2YB5 A;  3RMA A;  4DTX A;  2JPN A;  3SQ1 A;  5IBK B;  4FK0 A;  1XVB E;  2DEB A;  4I9L A;  2VJ5 A;  1FXX A;  2B1E A;  2JH9 A;  2P1O B;  3SJJ A;  4M3Z A;  2DTU A;  4FJH A;  1MTY G;  4DU3 A;  4FJ7 A;  4ADO A;  4KHQ A;  4QND A;  3QET A;  4FJ8 A;  2OZM A;  2OVQ B;  1XMH E;  3SUQ A;  2B8I A;  3L1N A;  4FJK A;  3C6P B;  3TAG A;  1MHY G;  1FZ7 E;  3SQ0 A;  4KI4 A;  1FZH E;  4RG8 A;  1FZ8 E;  4KHS A;  4JS5 A;  4M3Y A;  2JHC A;  3SUO A;  4DTN A;  3LDS A;  3RMD A;  1FZ5 E;  1XVC E;  3NCI A;  4QNC A;  4M3R A;  1MMO G;  3LD8 A;  1MHZ G;  3UIQ A;  2JHP A;  4M41 A;  4J2E A;  4E3S A;  4DTO A;  3QEW A;  1NEX B;  2H4T A;  2OVP B;  3V7D B;  3SPY A;  3TJY A;  3TAF A;  4KHU A;  4AKH A;  3E4W A;  4JRP A;  2ATQ A;  3RWU A;  4DU4 A;  3LDB A;  3NAE A;  3SPZ A;  2PFT A;  1FZ9 E;  3SUN A;  4I9Q A;  4KHY A;  4J2D A;  1FZ1 E;  2LF6 A;  2P1Q B;  4EP9 A;  3NE6 A;  4FK4 A;  4X5M A;  3QNO A;  4RL5 A;  3L2O B;  2PFV A;  4FJ5 A;  4DTS A;  1FZ0 E;  3SUP A;  3CFP A;  4FJN A;  4M45 A;  4EYW A;  3NGI A;  3QEX A;  3SQ4 A;  2OVR B;  2QXF A;  3RMC A;  3S9H A;  3OGM B;  1FS1 A;  2FW3 A;  3J2P A;  1Q9Y A;  2P1P B;  1IG9 A;  3CFO A;  4FVM A;  3QEV A;  1XVD E;  4FJX A;  3NHG A;  5IRE A;  3QER A;  2P5O A;  4KI6 A;  2OYQ A;  4M3U A;  3J27 A;  1XU3 E;  3HGL A;  3L0M A;  4DTJ A;  4FJJ A;  3HP9 A;  3QEP A;  4AKI A;  5H37 A;  3SQ2 A;  4EPH A;  4AI6 A;  1XMG E;  3QNN A;  3LZI A;  3E4Y A;  4B08 A;  1P22 A;  3K2O A;  1FZ4 E;  3OGK B;  4ADN A;  3SCX A;  4FJ9 A;  3HGK E;  4M42 A;  4X5N A;  4HCB A;  3KD1 E;  2OZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...