1MHZG

Methane monooxygenase hydroxylase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
167
structure length
167
Chain Sequence
b'AKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE HYDROXYLASE
publication title Crystal structure of the hydroxylase component of methane monooxygenase from Methylosinus trichosporium OB3b
pubmed rcsb
molecule tags Oxidoreductase
total genus 60
structure length 167
sequence length 167
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1996-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhzG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhzG02
1FZ8E 1XMFE 1XVGE 1XVCE 1XMGE 1XVEE 1MHZG 1FZHE 1XVDE 1XU5E 1FYZE 1MMOG 1MHYG 1FZ0E 4GAMC 1FZ1E 1FZ5E 1FZ7E 1XU3E 1XMHE 1FZ6E 1FZ2E 1FZ4E 1FZ9E 1XVBE 1FZIE 1XVFE 1FZ3E 1MTYG
chains in the Genus database with same CATH superfamily
1FZ8E 2B1EA 1XVGE 3SNNA 3WSOA 1JW2A 3CFOA 2LF6A 4E3SA 2ATQA 1N1CA 4ADNA 3QETA 2OZMA 4EP9A 3OGMB 4FJLA 4QNCA 2P1OB 3L2OB 4IT5A 3CFPA 3LZIA 4DTUA 4JRQA 4DTMA 1IH7A 2HD0A 3SUPA 3KD1E 3CQ8A 3KD5E 2P1MB 4M3ZA 4FJMA 3BVOA 1FPOA 4DU1A 3SQ2A 4AKHA 4FJJA 4EPHA 4M41A 3RMCA 2OVRB 3QEIA 3S9HA 3OGKB 1FS1A 3C95A 5H37A 2E31A 2VJ4A 1FZ9E 3SUOA 3SQ0A 3C94A 1FZ3E 2MZWB 3TL8B 3NAEA 3K2OA 4J2EA 4FJ9A 4RG8A 1FXXA 3SQ4A 2P1QB 1XMGE 2JQTA 3RMDA 3SCXA 4KHUA 4J2DA 3LDBA 4M3XA 3RMAA 2OVPB 3UO2A 3HGKE 1XVDE 3TAGA 1WAJA 3TABA 4DTSA 3TJYA 4DTJA 3QERA 4QNDA 3SPYA 3L8BA 2JPNA 4X5NA 3TAFA 4M3UA 4M42A 2P1NB 1FZ1E 3NCIA 3SUQA 2JH9A 4JS4A 4JS5A 4AI6A 2B8IA 4B08A 4X5MA 4I6JB 4AKIA 3N1EA 4I9LA 2RKHA 3V7DB 3L0MA 1FZ2E 2JH8A 4M3WA 2FYOA 3HL8A 4JRPA 1XL3C 1FZIE 3HP9A 2MW2A 3C6PB 1Q9YA 2OVQB 2VJ5A 3SJJA 4M3RA 1XMFE 4FJ5A 1XVCE 2RCUA 4M45A 3RMBA 3QNNA 1MHZG 2PFVA 2VIXA 3E4WA 1FZHE 5IZ7A 3LDSA 3NGIA 1CLQA 1XU5E 2OZSA 4J2AA 1FYZE 3RWUA 3TAEA 4FJ8A 1FZ0E 3QESA 2QXFA 3UO3A 4GAMC 3QEXA 3QEPA 4FJHA 4I9QA 1FZ5E 3QEVA 4DTNA 1FZ7E 4DTXA 3NDKA 4FJKA 4FJ7A 3C6NB 2JHCA 3SVIA 1XU3E 3OGLB 1XMHE 1LDKE 4EYWA 4DTOA 2YB5A 4RNGA 2K5SA 2MMBA 4HCCA 3SUNA 2DTUA 1NEXB 2PFTA 1FZ6E 2P5GA 1FZ4E 4FK0A 4KHQA 2JHAA 4J2BA 2LF3A 3L1NA 4DU4A 3SPZA 4KHNA 4FVMA 1XVFE 4KI6A 5IREA 1MTYG 3NHGA 2DY4A 4AKGA 4FK2A 3LZJA 1P22A 2JHPA 1XVEE 3J2PA 3J27A 4RL5A 2P5OA 4M3YA 3LD8A 3NE6A 2DEBA 4ADOA 1MMOG 1MHYG 3HGLA 2P1PB 1WAFA 4E4BA 1Q9XA 4KHSA 2H4TA 2E32A 3UIQA 4KI4A 4M3TA 2OYQA 3SQ1A 4DTPA 4DTRA 3SI6A 5IBKB 1IG9A 2FW3A 3QNOA 4KHWA 4KHYA 2B7MA 4FJXA 3C6OB 4ICGC 3QEWA 4HCBA 4FK4A 3N1BA 3CFRA 3E4YA 4FJIA 4FJGA 1XVBE 4FJNA 4DU3A 3MKSB
chains in the Genus database with same CATH topology
1FZ8E 2B1EA 1XVGE 3SNNA 3WSOA 3CFOA 2LF6A 4E3SA 2ATQA 2OZMA 4ADNA 3QETA 4EP9A 3OGMB 4FJLA 4QNCA 2P1OB 3L2OB 3CFPA 3LZIA 4DTUA 4JRQA 4DTMA 1IH7A 2HD0A 3SUPA 3KD1E 3CQ8A 3KD5E 2P1MB 4M3ZA 4FJMA 4DU1A 3SQ2A 4AKHA 4FJJA 4EPHA 4M41A 3RMCA 2OVRB 3QEIA 3S9HA 3OGKB 1FS1A 3C95A 5H37A 2E31A 2VJ4A 1FZ9E 3SUOA 3SQ0A 3C94A 1FZ3E 2MZWB 3TL8B 3NAEA 3K2OA 4J2EA 4FJ9A 4RG8A 1FXXA 3SQ4A 2P1QB 1XMGE 3RMDA 3SCXA 4KHUA 4J2DA 3LDBA 4M3XA 3RMAA 2OVPB 3HGKE 1XVDE 3TAGA 1WAJA 3TABA 4DTSA 3TJYA 4DTJA 3QERA 4QNDA 3SPYA 3L8BA 2JPNA 4X5NA 3TAFA 4M3UA 4M42A 2P1NB 1FZ1E 3NCIA 3SUQA 2JH9A 4JS4A 4JS5A 4AI6A 2B8IA 4B08A 4X5MA 4I6JB 4AKIA 3N1EA 4I9LA 3V7DB 3L0MA 1FZ2E 2JH8A 4M3WA 2FYOA 3HL8A 4JRPA 1XL3C 1FZIE 3HP9A 3C6PB 1Q9YA 2OVQB 2VJ5A 3SJJA 4M3RA 1XMFE 4FJ5A 1XVCE 2RCUA 4M45A 3RMBA 3QNNA 1MHZG 2PFVA 2VIXA 3E4WA 1FZHE 5IZ7A 3LDSA 3NGIA 1CLQA 1XU5E 2OZSA 4J2AA 1FYZE 3RWUA 3TAEA 4FJ8A 1FZ0E 3QESA 2QXFA 4GAMC 3QEXA 3QEPA 4FJHA 4I9QA 1FZ5E 3QEVA 4DTNA 1FZ7E 4DTXA 3NDKA 4FJKA 4FJ7A 3C6NB 2JHCA 3SVIA 1XU3E 3OGLB 1XMHE 1LDKE 4EYWA 4DTOA 2YB5A 4RNGA 4HCCA 2MMBA 2DTUA 3SUNA 1NEXB 2PFTA 1FZ6E 2P5GA 1FZ4E 4FK0A 4KHQA 2JHAA 4J2BA 2LF3A 3L1NA 4DU4A 3SPZA 4KHNA 4FVMA 1XVFE 4KI6A 5IREA 1MTYG 3NHGA 2DY4A 4AKGA 4FK2A 3LZJA 1P22A 2JHPA 1XVEE 3J2PA 3J27A 4RL5A 2P5OA 4M3YA 3LD8A 3NE6A 2DEBA 4ADOA 1MMOG 1MHYG 3HGLA 2P1PB 1WAFA 4E4BA 1Q9XA 4KHSA 2H4TA 2E32A 3UIQA 4KI4A 4M3TA 2OYQA 3SQ1A 4DTPA 4DTRA 3SI6A 5IBKB 1IG9A 2FW3A 3QNOA 4KHWA 4KHYA 2B7MA 4FJXA 3C6OB 3QEWA 4HCBA 4FK4A 3N1BA 3CFRA 3E4YA 4FJIA 4FJGA 1XVBE 4FJNA 4DU3A 3MKSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ8 E;  1XMF E;  1XVG E;  1XVC E;  1XMG E;  1XVE E;  1MHZ G;  1FZH E;  1XVD E;  1XU5 E;  1FYZ E;  1MMO G;  1MHY G;  1FZ0 E;  4GAM C;  1FZ1 E;  1FZ5 E;  1FZ7 E;  1XU3 E;  1XMH E;  1FZ6 E;  1FZ2 E;  1FZ4 E;  1FZ9 E;  1XVB E;  1FZI E;  1XVF E;  1FZ3 E;  1MTY G; 
#chains in the Genus database with same CATH topology
 1FZ8 E;  2B1E A;  1XVG E;  3SNN A;  3WSO A;  1JW2 A;  3CFO A;  2LF6 A;  4E3S A;  2ATQ A;  1N1C A;  4ADN A;  3QET A;  2OZM A;  4EP9 A;  3OGM B;  4FJL A;  4QNC A;  2P1O B;  3L2O B;  4IT5 A;  3CFP A;  3LZI A;  4DTU A;  4JRQ A;  4DTM A;  1IH7 A;  2HD0 A;  3SUP A;  3KD1 E;  3CQ8 A;  3KD5 E;  2P1M B;  4M3Z A;  4FJM A;  3BVO A;  1FPO A;  4DU1 A;  3SQ2 A;  4AKH A;  4FJJ A;  4EPH A;  4M41 A;  3RMC A;  2OVR B;  3QEI A;  3S9H A;  3OGK B;  1FS1 A;  3C95 A;  5H37 A;  2E31 A;  2VJ4 A;  1FZ9 E;  3SUO A;  3SQ0 A;  3C94 A;  1FZ3 E;  2MZW B;  3TL8 B;  3NAE A;  3K2O A;  4J2E A;  4FJ9 A;  4RG8 A;  1FXX A;  3SQ4 A;  2P1Q B;  1XMG E;  2JQT A;  3RMD A;  3SCX A;  4KHU A;  4J2D A;  3LDB A;  4M3X A;  3RMA A;  2OVP B;  3UO2 A;  3HGK E;  1XVD E;  3TAG A;  1WAJ A;  3TAB A;  4DTS A;  3TJY A;  4DTJ A;  3QER A;  4QND A;  3SPY A;  3L8B A;  2JPN A;  4X5N A;  3TAF A;  4M3U A;  4M42 A;  2P1N B;  1FZ1 E;  3NCI A;  3SUQ A;  2JH9 A;  4JS4 A;  4JS5 A;  4AI6 A;  2B8I A;  4B08 A;  4X5M A;  4I6J B;  4AKI A;  3N1E A;  4I9L A;  2RKH A;  3V7D B;  3L0M A;  1FZ2 E;  2JH8 A;  4M3W A;  2FYO A;  3HL8 A;  4JRP A;  1XL3 C;  1FZI E;  3HP9 A;  2MW2 A;  3C6P B;  1Q9Y A;  2OVQ B;  2VJ5 A;  3SJJ A;  4M3R A;  1XMF E;  4FJ5 A;  1XVC E;  2RCU A;  4M45 A;  3RMB A;  3QNN A;  1MHZ G;  2PFV A;  2VIX A;  3E4W A;  1FZH E;  5IZ7 A;  3LDS A;  3NGI A;  1CLQ A;  1XU5 E;  2OZS A;  4J2A A;  1FYZ E;  3RWU A;  3TAE A;  4FJ8 A;  1FZ0 E;  3QES A;  2QXF A;  3UO3 A;  4GAM C;  3QEX A;  3QEP A;  4FJH A;  4I9Q A;  1FZ5 E;  3QEV A;  4DTN A;  1FZ7 E;  4DTX A;  3NDK A;  4FJK A;  4FJ7 A;  3C6N B;  2JHC A;  3SVI A;  1XU3 E;  3OGL B;  1XMH E;  1LDK E;  4EYW A;  4DTO A;  2YB5 A;  4RNG A;  2K5S A;  2MMB A;  4HCC A;  3SUN A;  2DTU A;  1NEX B;  2PFT A;  1FZ6 E;  2P5G A;  1FZ4 E;  4FK0 A;  4KHQ A;  2JHA A;  4J2B A;  2LF3 A;  3L1N A;  4DU4 A;  3SPZ A;  4KHN A;  4FVM A;  1XVF E;  4KI6 A;  5IRE A;  1MTY G;  3NHG A;  2DY4 A;  4AKG A;  4FK2 A;  3LZJ A;  1P22 A;  2JHP A;  1XVE E;  3J2P A;  3J27 A;  4RL5 A;  2P5O A;  4M3Y A;  3LD8 A;  3NE6 A;  2DEB A;  4ADO A;  1MMO G;  1MHY G;  3HGL A;  2P1P B;  1WAF A;  4E4B A;  1Q9X A;  4KHS A;  2H4T A;  2E32 A;  3UIQ A;  4KI4 A;  4M3T A;  2OYQ A;  3SQ1 A;  4DTP A;  4DTR A;  3SI6 A;  5IBK B;  1IG9 A;  2FW3 A;  3QNO A;  4KHW A;  4KHY A;  2B7M A;  4FJX A;  3C6O B;  4ICG C;  3QEW A;  4HCB A;  4FK4 A;  3N1B A;  3CFR A;  3E4Y A;  4FJI A;  4FJG A;  1XVB E;  4FJN A;  4DU3 A;  3MKS B; 
#chains in the Genus database with same CATH homology
 1FZ8 E;  2B1E A;  1XVG E;  3SNN A;  3WSO A;  3CFO A;  2LF6 A;  4E3S A;  2ATQ A;  2OZM A;  4ADN A;  3QET A;  4EP9 A;  3OGM B;  4FJL A;  4QNC A;  2P1O B;  3L2O B;  3CFP A;  3LZI A;  4DTU A;  4JRQ A;  4DTM A;  1IH7 A;  2HD0 A;  3SUP A;  3KD1 E;  3CQ8 A;  3KD5 E;  2P1M B;  4M3Z A;  4FJM A;  4DU1 A;  3SQ2 A;  4AKH A;  4FJJ A;  4EPH A;  4M41 A;  3RMC A;  2OVR B;  3QEI A;  3S9H A;  3OGK B;  1FS1 A;  3C95 A;  5H37 A;  2E31 A;  2VJ4 A;  1FZ9 E;  3SUO A;  3SQ0 A;  3C94 A;  1FZ3 E;  2MZW B;  3TL8 B;  3NAE A;  3K2O A;  4J2E A;  4FJ9 A;  4RG8 A;  1FXX A;  3SQ4 A;  2P1Q B;  1XMG E;  3RMD A;  3SCX A;  4KHU A;  4J2D A;  3LDB A;  4M3X A;  3RMA A;  2OVP B;  3HGK E;  1XVD E;  3TAG A;  1WAJ A;  3TAB A;  4DTS A;  3TJY A;  4DTJ A;  3QER A;  4QND A;  3SPY A;  3L8B A;  2JPN A;  4X5N A;  3TAF A;  4M3U A;  4M42 A;  2P1N B;  1FZ1 E;  3NCI A;  3SUQ A;  2JH9 A;  4JS4 A;  4JS5 A;  4AI6 A;  2B8I A;  4B08 A;  4X5M A;  4I6J B;  4AKI A;  3N1E A;  4I9L A;  3V7D B;  3L0M A;  1FZ2 E;  2JH8 A;  4M3W A;  2FYO A;  3HL8 A;  4JRP A;  1XL3 C;  1FZI E;  3HP9 A;  3C6P B;  1Q9Y A;  2OVQ B;  2VJ5 A;  3SJJ A;  4M3R A;  1XMF E;  4FJ5 A;  1XVC E;  2RCU A;  4M45 A;  3RMB A;  3QNN A;  1MHZ G;  2PFV A;  2VIX A;  3E4W A;  1FZH E;  5IZ7 A;  3LDS A;  3NGI A;  1CLQ A;  1XU5 E;  2OZS A;  4J2A A;  1FYZ E;  3RWU A;  3TAE A;  4FJ8 A;  1FZ0 E;  3QES A;  2QXF A;  4GAM C;  3QEX A;  3QEP A;  4FJH A;  4I9Q A;  1FZ5 E;  3QEV A;  4DTN A;  1FZ7 E;  4DTX A;  3NDK A;  4FJK A;  4FJ7 A;  3C6N B;  2JHC A;  3SVI A;  1XU3 E;  3OGL B;  1XMH E;  1LDK E;  4EYW A;  4DTO A;  2YB5 A;  4RNG A;  4HCC A;  2MMB A;  2DTU A;  3SUN A;  1NEX B;  2PFT A;  1FZ6 E;  2P5G A;  1FZ4 E;  4FK0 A;  4KHQ A;  2JHA A;  4J2B A;  2LF3 A;  3L1N A;  4DU4 A;  3SPZ A;  4KHN A;  4FVM A;  1XVF E;  4KI6 A;  5IRE A;  1MTY G;  3NHG A;  2DY4 A;  4AKG A;  4FK2 A;  3LZJ A;  1P22 A;  2JHP A;  1XVE E;  3J2P A;  3J27 A;  4RL5 A;  2P5O A;  4M3Y A;  3LD8 A;  3NE6 A;  2DEB A;  4ADO A;  1MMO G;  1MHY G;  3HGL A;  2P1P B;  1WAF A;  4E4B A;  1Q9X A;  4KHS A;  2H4T A;  2E32 A;  3UIQ A;  4KI4 A;  4M3T A;  2OYQ A;  3SQ1 A;  4DTP A;  4DTR A;  3SI6 A;  5IBK B;  1IG9 A;  2FW3 A;  3QNO A;  4KHW A;  4KHY A;  2B7M A;  4FJX A;  3C6O B;  3QEW A;  4HCB A;  4FK4 A;  3N1B A;  3CFR A;  3E4Y A;  4FJI A;  4FJG A;  1XVB E;  4FJN A;  4DU3 A;  3MKS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...