1MHZG

Methane monooxygenase hydroxylase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
167
structure length
167
Chain Sequence
AKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE HYDROXYLASE
publication title Crystal structure of the hydroxylase component of methane monooxygenase from Methylosinus trichosporium OB3b
pubmed rcsb
total genus 60
structure length 167
sequence length 167
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1996-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhzG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhzG02
1FZ8E 1MMOG 1MHYG 1XVFE 1XMFE 1FYZE 1FZHE 1MHZG 1FZ5E 1FZ2E 1XVBE 1FZ0E 1XVDE 1XMGE 1FZ7E 1FZ4E 1XVCE 4GAMC 1FZ3E 1FZIE 1XU3E 1XVGE 1XU5E 1MTYG 1FZ1E 1XMHE 1XVEE 1FZ9E 1FZ6E
chains in the Genus database with same CATH superfamily
4FJHA 4DTMA 3HP9A 3E4YA 2JPNA 1XVFE 3L0MA 5IBKB 2E32A 2HD0A 4I6JB 4FJ5A 4FK2A 4AKGA 1FYZE 1MHZG 2JHAA 4E4BA 4DU1A 2B8IA 2P1QB 3CFPA 1NEXB 2P1OB 3J2PA 4X5MA 3S9HA 4QNCA 4M3XA 1P22A 3SPZA 1XVDE 3TAGA 1FZ7E 4ICGC 1FZ4E 1XVCE 3LDSA 3QEPA 2P5OA 3KD1E 3RMBA 4FJ8A 3TAEA 3KD5E 3SUNA 4DTSA 3SQ0A 4FJLA 2DTUA 3UO2A 3RMDA 3L8BA 3OGKB 2MZWB 3CQ8A 3LDBA 2RKHA 1FZ8E 3C6NB 3SNNA 2PFVA 1FS1A 2H4TA 3MKSB 4DTXA 4I9LA 4ADNA 2JH9A 4RNGA 3OGLB 2OVQB 4JRQA 3TAFA 3RMAA 4FJIA 1LDKE 3L2OB 3LD8A 4J2DA 3TJYA 1WAFA 3SQ4A 3UO3A 2P5GA 3C94A 2OZSA 1N1CA 4HCCA 4AI6A 4DTNA 3SVIA 2QXFA 3NE6A 4HCBA 4M3TA 2PFTA 4J2AA 4M42A 2VIXA 4JS4A 2LF6A 4FJXA 4E3SA 2DEBA 1FXXA 4KI6A 4FK0A 3NAEA 4M3YA 1XU3E 2VJ4A 1XVEE 2MMBA 1FPOA 4FJMA 4M41A 1FZ9E 3QERA 4KHNA 4EPHA 4AKHA 1FZ6E 3HGKE 4FJ9A 4KHUA 4M3RA 3CFRA 4KHQA 1IG9A 3CFOA 2JHCA 3TL8B 3BVOA 4I9QA 1MHYG 3HL8A 4DTRA 4EP9A 3SUQA 3NHGA 4FJGA 2FYOA 3J27A 3QNOA 3QETA 2JH8A 4J2BA 1FZHE 1CLQA 2YB5A 2E31A 3QEIA 3SQ2A 3SUOA 5IZ7A 2K5SA 1Q9YA 2DY4A 1XL3C 2ATQA 3NCIA 1FZ0E 4JS5A 3SJJA 4KI4A 4DU3A 4AKIA 1XMGE 4FJJA 2OVRB 3SCXA 2LF3A 3NDKA 3QEWA 2RCUA 4M3ZA 1FZIE 3RMCA 3SPYA 1XVGE 4ADOA 1FZ1E 3QEXA 3WSOA 4FK4A 3SI6A 2P1PB 3RWUA 5H37A 4J2EA 3SQ1A 1FZ5E 4GAMC 3UIQA 3C6PB 1JW2A 2JHPA 4KHSA 4KHWA 4FJKA 3C95A 4FJ7A 2OYQA 1MMOG 4DTJA 3OGMB 4X5NA 2OVPB 2P1NB 2FW3A 3V7DB 4IT5A 4DU4A 1XMFE 4M3UA 3N1BA 2MW2A 3E4WA 2JQTA 3K2OA 3QESA 4M3WA 4M45A 1FZ2E 1XVBE 2VJ5A 3QNNA 2OZMA 1Q9XA 4B08A 4DTUA 4DTPA 5IREA 3LZIA 3QEVA 1WAJA 2B7MA 3C6OB 3HGLA 4QNDA 4RG8A 1FZ3E 2P1MB 3NGIA 3LZJA 1XU5E 3L1NA 1MTYG 1XMHE 4JRPA 4FJNA 3TABA 2B1EA 1IH7A 4FVMA 4RL5A 3SUPA 4EYWA 4KHYA 4DTOA 3N1EA
chains in the Genus database with same CATH topology
4FJHA 4DTMA 3HP9A 3E4YA 2JPNA 1XVFE 3L0MA 5IBKB 2E32A 2HD0A 4I6JB 4FJ5A 4FK2A 4AKGA 1FYZE 1MHZG 2JHAA 4E4BA 4DU1A 2B8IA 2P1QB 3CFPA 1NEXB 2P1OB 3J2PA 4X5MA 3S9HA 4QNCA 4M3XA 1P22A 3SPZA 1XVDE 3TAGA 1FZ7E 1FZ4E 1XVCE 3LDSA 3QEPA 2P5OA 3KD1E 3RMBA 4FJ8A 3TAEA 3KD5E 3SUNA 4DTSA 3SQ0A 4FJLA 2DTUA 3RMDA 3L8BA 3OGKB 2MZWB 3CQ8A 3LDBA 3C6NB 1FZ8E 3SNNA 2PFVA 1FS1A 2H4TA 3MKSB 4DTXA 4I9LA 4ADNA 2JH9A 4RNGA 3OGLB 2OVQB 4JRQA 3TAFA 3RMAA 4FJIA 1LDKE 3L2OB 3LD8A 4J2DA 3TJYA 1WAFA 3SQ4A 2P5GA 3C94A 2OZSA 4AI6A 4HCCA 4DTNA 3SVIA 2QXFA 3NE6A 4HCBA 4M3TA 2PFTA 4J2AA 4M42A 2VIXA 4JS4A 2LF6A 4FJXA 4E3SA 2DEBA 1FXXA 4KI6A 4FK0A 3NAEA 4M3YA 1XU3E 2VJ4A 1XVEE 2MMBA 4FJMA 4M41A 1FZ9E 3QERA 4KHNA 4EPHA 4AKHA 1FZ6E 3HGKE 4FJ9A 4KHUA 4M3RA 3CFRA 4KHQA 1IG9A 3CFOA 2JHCA 3TL8B 4I9QA 1MHYG 3HL8A 4DTRA 4EP9A 3SUQA 3NHGA 4FJGA 2FYOA 3J27A 3QNOA 3QETA 2JH8A 4J2BA 1FZHE 1CLQA 2YB5A 2E31A 3QEIA 3SQ2A 3SUOA 5IZ7A 1Q9YA 2DY4A 1XL3C 2ATQA 3NCIA 1FZ0E 4JS5A 3SJJA 4KI4A 4DU3A 4AKIA 1XMGE 4FJJA 2OVRB 3SCXA 2LF3A 3NDKA 3QEWA 2RCUA 4M3ZA 1FZIE 3RMCA 3SPYA 1XVGE 4ADOA 1FZ1E 3QEXA 3WSOA 4FK4A 3SI6A 2P1PB 3RWUA 5H37A 4J2EA 3SQ1A 1FZ5E 4GAMC 3UIQA 3C6PB 2JHPA 4KHSA 4KHWA 4FJKA 3C95A 4FJ7A 2OYQA 1MMOG 4DTJA 3OGMB 4X5NA 2OVPB 2P1NB 2FW3A 3V7DB 4DU4A 1XMFE 4M3UA 3N1BA 3E4WA 3K2OA 3QESA 4M3WA 4M45A 1FZ2E 1XVBE 2VJ5A 3QNNA 2OZMA 1Q9XA 4B08A 4DTUA 4DTPA 5IREA 3LZIA 3QEVA 1WAJA 2B7MA 3C6OB 3HGLA 4QNDA 4RG8A 1FZ3E 2P1MB 3NGIA 3LZJA 1XU5E 3L1NA 1MTYG 1XMHE 4JRPA 4FJNA 3TABA 2B1EA 1IH7A 4FVMA 4RL5A 3SUPA 4EYWA 4KHYA 4DTOA 3N1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ8 E;  1MMO G;  1MHY G;  1XVF E;  1XMF E;  1FYZ E;  1FZH E;  1MHZ G;  1FZ5 E;  1FZ2 E;  1XVB E;  1FZ0 E;  1XVD E;  1XMG E;  1FZ7 E;  1FZ4 E;  1XVC E;  4GAM C;  1FZ3 E;  1FZI E;  1XU3 E;  1XVG E;  1XU5 E;  1MTY G;  1FZ1 E;  1XMH E;  1XVE E;  1FZ9 E;  1FZ6 E; 
#chains in the Genus database with same CATH topology
 4FJH A;  4DTM A;  3HP9 A;  3E4Y A;  2JPN A;  1XVF E;  3L0M A;  5IBK B;  2E32 A;  2HD0 A;  4I6J B;  4FJ5 A;  4FK2 A;  4AKG A;  1FYZ E;  1MHZ G;  2JHA A;  4E4B A;  4DU1 A;  2B8I A;  2P1Q B;  3CFP A;  1NEX B;  2P1O B;  3J2P A;  4X5M A;  3S9H A;  4QNC A;  4M3X A;  1P22 A;  3SPZ A;  1XVD E;  3TAG A;  1FZ7 E;  4ICG C;  1FZ4 E;  1XVC E;  3LDS A;  3QEP A;  2P5O A;  3KD1 E;  3RMB A;  4FJ8 A;  3TAE A;  3KD5 E;  3SUN A;  4DTS A;  3SQ0 A;  4FJL A;  2DTU A;  3UO2 A;  3RMD A;  3L8B A;  3OGK B;  2MZW B;  3CQ8 A;  3LDB A;  2RKH A;  1FZ8 E;  3C6N B;  3SNN A;  2PFV A;  1FS1 A;  2H4T A;  3MKS B;  4DTX A;  4I9L A;  4ADN A;  2JH9 A;  4RNG A;  3OGL B;  2OVQ B;  4JRQ A;  3TAF A;  3RMA A;  4FJI A;  1LDK E;  3L2O B;  3LD8 A;  4J2D A;  3TJY A;  1WAF A;  3SQ4 A;  3UO3 A;  2P5G A;  3C94 A;  2OZS A;  1N1C A;  4HCC A;  4AI6 A;  4DTN A;  3SVI A;  2QXF A;  3NE6 A;  4HCB A;  4M3T A;  2PFT A;  4J2A A;  4M42 A;  2VIX A;  4JS4 A;  2LF6 A;  4FJX A;  4E3S A;  2DEB A;  1FXX A;  4KI6 A;  4FK0 A;  3NAE A;  4M3Y A;  1XU3 E;  2VJ4 A;  1XVE E;  2MMB A;  1FPO A;  4FJM A;  4M41 A;  1FZ9 E;  3QER A;  4KHN A;  4EPH A;  4AKH A;  1FZ6 E;  3HGK E;  4FJ9 A;  4KHU A;  4M3R A;  3CFR A;  4KHQ A;  1IG9 A;  3CFO A;  2JHC A;  3TL8 B;  3BVO A;  4I9Q A;  1MHY G;  3HL8 A;  4DTR A;  4EP9 A;  3SUQ A;  3NHG A;  4FJG A;  2FYO A;  3J27 A;  3QNO A;  3QET A;  2JH8 A;  4J2B A;  1FZH E;  1CLQ A;  2YB5 A;  2E31 A;  3QEI A;  3SQ2 A;  3SUO A;  5IZ7 A;  2K5S A;  1Q9Y A;  2DY4 A;  1XL3 C;  2ATQ A;  3NCI A;  1FZ0 E;  4JS5 A;  3SJJ A;  4KI4 A;  4DU3 A;  4AKI A;  1XMG E;  4FJJ A;  2OVR B;  3SCX A;  2LF3 A;  3NDK A;  3QEW A;  2RCU A;  4M3Z A;  1FZI E;  3RMC A;  3SPY A;  1XVG E;  4ADO A;  1FZ1 E;  3QEX A;  3WSO A;  4FK4 A;  3SI6 A;  2P1P B;  3RWU A;  5H37 A;  4J2E A;  3SQ1 A;  1FZ5 E;  4GAM C;  3UIQ A;  3C6P B;  1JW2 A;  2JHP A;  4KHS A;  4KHW A;  4FJK A;  3C95 A;  4FJ7 A;  2OYQ A;  1MMO G;  4DTJ A;  3OGM B;  4X5N A;  2OVP B;  2P1N B;  2FW3 A;  3V7D B;  4IT5 A;  4DU4 A;  1XMF E;  4M3U A;  3N1B A;  2MW2 A;  3E4W A;  2JQT A;  3K2O A;  3QES A;  4M3W A;  4M45 A;  1FZ2 E;  1XVB E;  2VJ5 A;  3QNN A;  2OZM A;  1Q9X A;  4B08 A;  4DTU A;  4DTP A;  5IRE A;  3LZI A;  3QEV A;  1WAJ A;  2B7M A;  3C6O B;  3HGL A;  4QND A;  4RG8 A;  1FZ3 E;  2P1M B;  3NGI A;  3LZJ A;  1XU5 E;  3L1N A;  1MTY G;  1XMH E;  4JRP A;  4FJN A;  3TAB A;  2B1E A;  1IH7 A;  4FVM A;  4RL5 A;  3SUP A;  4EYW A;  4KHY A;  4DTO A;  3N1E A; 
#chains in the Genus database with same CATH homology
 4FJH A;  4DTM A;  3HP9 A;  3E4Y A;  2JPN A;  1XVF E;  3L0M A;  5IBK B;  2E32 A;  2HD0 A;  4I6J B;  4FJ5 A;  4FK2 A;  4AKG A;  1FYZ E;  1MHZ G;  2JHA A;  4E4B A;  4DU1 A;  2B8I A;  2P1Q B;  3CFP A;  1NEX B;  2P1O B;  3J2P A;  4X5M A;  3S9H A;  4QNC A;  4M3X A;  1P22 A;  3SPZ A;  1XVD E;  3TAG A;  1FZ7 E;  1FZ4 E;  1XVC E;  3LDS A;  3QEP A;  2P5O A;  3KD1 E;  3RMB A;  4FJ8 A;  3TAE A;  3KD5 E;  3SUN A;  4DTS A;  3SQ0 A;  4FJL A;  2DTU A;  3RMD A;  3L8B A;  3OGK B;  2MZW B;  3CQ8 A;  3LDB A;  3C6N B;  1FZ8 E;  3SNN A;  2PFV A;  1FS1 A;  2H4T A;  3MKS B;  4DTX A;  4I9L A;  4ADN A;  2JH9 A;  4RNG A;  3OGL B;  2OVQ B;  4JRQ A;  3TAF A;  3RMA A;  4FJI A;  1LDK E;  3L2O B;  3LD8 A;  4J2D A;  3TJY A;  1WAF A;  3SQ4 A;  2P5G A;  3C94 A;  2OZS A;  4AI6 A;  4HCC A;  4DTN A;  3SVI A;  2QXF A;  3NE6 A;  4HCB A;  4M3T A;  2PFT A;  4J2A A;  4M42 A;  2VIX A;  4JS4 A;  2LF6 A;  4FJX A;  4E3S A;  2DEB A;  1FXX A;  4KI6 A;  4FK0 A;  3NAE A;  4M3Y A;  1XU3 E;  2VJ4 A;  1XVE E;  2MMB A;  4FJM A;  4M41 A;  1FZ9 E;  3QER A;  4KHN A;  4EPH A;  4AKH A;  1FZ6 E;  3HGK E;  4FJ9 A;  4KHU A;  4M3R A;  3CFR A;  4KHQ A;  1IG9 A;  3CFO A;  2JHC A;  3TL8 B;  4I9Q A;  1MHY G;  3HL8 A;  4DTR A;  4EP9 A;  3SUQ A;  3NHG A;  4FJG A;  2FYO A;  3J27 A;  3QNO A;  3QET A;  2JH8 A;  4J2B A;  1FZH E;  1CLQ A;  2YB5 A;  2E31 A;  3QEI A;  3SQ2 A;  3SUO A;  5IZ7 A;  1Q9Y A;  2DY4 A;  1XL3 C;  2ATQ A;  3NCI A;  1FZ0 E;  4JS5 A;  3SJJ A;  4KI4 A;  4DU3 A;  4AKI A;  1XMG E;  4FJJ A;  2OVR B;  3SCX A;  2LF3 A;  3NDK A;  3QEW A;  2RCU A;  4M3Z A;  1FZI E;  3RMC A;  3SPY A;  1XVG E;  4ADO A;  1FZ1 E;  3QEX A;  3WSO A;  4FK4 A;  3SI6 A;  2P1P B;  3RWU A;  5H37 A;  4J2E A;  3SQ1 A;  1FZ5 E;  4GAM C;  3UIQ A;  3C6P B;  2JHP A;  4KHS A;  4KHW A;  4FJK A;  3C95 A;  4FJ7 A;  2OYQ A;  1MMO G;  4DTJ A;  3OGM B;  4X5N A;  2OVP B;  2P1N B;  2FW3 A;  3V7D B;  4DU4 A;  1XMF E;  4M3U A;  3N1B A;  3E4W A;  3K2O A;  3QES A;  4M3W A;  4M45 A;  1FZ2 E;  1XVB E;  2VJ5 A;  3QNN A;  2OZM A;  1Q9X A;  4B08 A;  4DTU A;  4DTP A;  5IRE A;  3LZI A;  3QEV A;  1WAJ A;  2B7M A;  3C6O B;  3HGL A;  4QND A;  4RG8 A;  1FZ3 E;  2P1M B;  3NGI A;  3LZJ A;  1XU5 E;  3L1N A;  1MTY G;  1XMH E;  4JRP A;  4FJN A;  3TAB A;  2B1E A;  1IH7 A;  4FVM A;  4RL5 A;  3SUP A;  4EYW A;  4KHY A;  4DTO A;  3N1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...