1MHZG

Methane monooxygenase hydroxylase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
167
structure length
167
Chain Sequence
AKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE HYDROXYLASE
publication title Crystal structure of the hydroxylase component of methane monooxygenase from Methylosinus trichosporium OB3b
pubmed rcsb
molecule tags Oxidoreductase
total genus 60
structure length 167
sequence length 167
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1996-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhzG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhzG02
1MMOG 1XMHE 1FZ1E 1FZHE 1XU5E 1XVEE 1MHZG 1FZ7E 4GAMC 1FZ3E 1FZ0E 1FZ6E 1XVFE 1FZ4E 1MTYG 1XVBE 1FZ2E 1XVGE 1FYZE 1XU3E 1FZ5E 1FZ9E 1FZ8E 1MHYG 1XVDE 1XMGE 1XVCE 1FZIE 1XMFE
chains in the Genus database with same CATH superfamily
4FK2A 3QNOA 4M3XA 1Q9XA 2VJ5A 4RG8A 1NEXB 4X5NA 2OZSA 4AI6A 4FK0A 3QERA 3OGLB 3TJYA 1XU5E 4HCBA 1XVEE 2MZWB 4DTMA 3QEVA 1FZ0E 4QNCA 3CFRA 4KHQA 2LF6A 1XVFE 1FZ4E 2P1QB 2B1EA 3LZIA 1MTYG 2JHAA 3RMAA 1XL3C 2JHCA 2OYQA 2LF3A 1WAFA 3KD5E 2MMBA 3UO2A 3SQ0A 3KD1E 4M41A 3SCXA 2JPNA 3HP9A 2OVPB 3QNNA 2P1NB 2RCUA 2E32A 3WSOA 1JW2A 3UO3A 3NHGA 1FZ9E 4DTRA 1MHYG 4DTOA 1XVCE 1XMGE 3RWUA 2P5GA 4KI6A 3RMBA 3E4WA 4KHYA 3V7DB 1IG9A 3SVIA 3HGKE 3N1EA 1FZ1E 1FZHE 4DTUA 3SQ4A 4I9QA 2K5SA 4RNGA 4JRPA 3TAFA 3L0MA 4I6JB 4IT5A 5H37A 4B08A 1Q9YA 4FJ5A 2JHPA 5IREA 4GAMC 4DTJA 1FPOA 4HCCA 4M3TA 4FJHA 4J2DA 3N1BA 3L8BA 3NCIA 3CFPA 3SI6A 1FZ2E 1IH7A 1XVGE 3SUPA 4M3ZA 2H4TA 2P1OB 3TAGA 1FYZE 3QEXA 3RMCA 4M3RA 1XU3E 2FW3A 2HD0A 2PFVA 1CLQA 4EP9A 4AKGA 2FYOA 2RKHA 2JH9A 2OVQB 4J2EA 2MW2A 4FJGA 3OGKB 2B7MA 4RL5A 2JQTA 2E31A 1FZ8E 4M3UA 3LDBA 3NDKA 3HL8A 1FZ6E 1FZIE 1XMFE 3L2OB 4M45A 5IBKB 3LDSA 4ADNA 1MMOG 3TAEA 2P1MB 1XMHE 2ATQA 3SUQA 2OZMA 4X5MA 4FJXA 4FJ7A 4ADOA 3C6OB 3SNNA 3J27A 2VJ4A 1FZ7E 4FK4A 2VIXA 3NGIA 3LZJA 1FZ3E 3K2OA 4KI4A 4AKIA 4JRQA 3SUNA 3C6NB 4I9LA 4ICGC 3C94A 3QESA 3LD8A 4M3YA 4DU1A 3TABA 4J2BA 4DTXA 4M3WA 4FJ9A 4M42A 1WAJA 4JS4A 4AKHA 4DU4A 3RMDA 1FZ5E 4FVMA 4FJIA 2JH8A 3SUOA 4EYWA 4KHSA 4FJLA 3QEIA 3QEWA 3UIQA 3SQ2A 3NAEA 4E4BA 3SPZA 3MKSB 4FJKA 3QETA 1FS1A 3QEPA 3C95A 3L1NA 5IZ7A 3CQ8A 2OVRB 4FJMA 1MHZG 2DTUA 4DU3A 2DY4A 3SQ1A 4DTPA 4FJNA 4KHUA 3NE6A 2B8IA 2QXFA 1N1CA 2P1PB 3C6PB 1XVBE 3HGLA 2PFTA 3BVOA 3CFOA 4DTNA 4KHNA 4E3SA 3OGMB 4DTSA 2DEBA 4FJ8A 2YB5A 4J2AA 4FJJA 4QNDA 4EPHA 3SPYA 3SJJA 3TL8B 1LDKE 1FXXA 1P22A 4JS5A 4KHWA 3S9HA 1XVDE 2P5OA 3J2PA 3E4YA
chains in the Genus database with same CATH topology
4FK2A 3QNOA 4M3XA 1Q9XA 2VJ5A 4RG8A 1NEXB 4X5NA 2OZSA 4AI6A 4FK0A 3QERA 3OGLB 3TJYA 1XU5E 4HCBA 1XVEE 2MZWB 4DTMA 3QEVA 1FZ0E 4QNCA 3CFRA 4KHQA 2LF6A 1XVFE 1FZ4E 2P1QB 2B1EA 3LZIA 1MTYG 2JHAA 3RMAA 1XL3C 2JHCA 2OYQA 2LF3A 1WAFA 3KD5E 2MMBA 3SQ0A 3KD1E 4M41A 3SCXA 2JPNA 3HP9A 2OVPB 3QNNA 2P1NB 2RCUA 2E32A 3WSOA 3NHGA 1FZ9E 4DTRA 1MHYG 4DTOA 1XVCE 1XMGE 3RWUA 2P5GA 4KI6A 3RMBA 3E4WA 4KHYA 3V7DB 1IG9A 3SVIA 3HGKE 3N1EA 1FZ1E 1FZHE 4DTUA 3SQ4A 4I9QA 4RNGA 4JRPA 3TAFA 3L0MA 4I6JB 5H37A 1Q9YA 4B08A 4FJ5A 2JHPA 5IREA 4GAMC 4DTJA 4HCCA 4M3TA 4FJHA 4J2DA 3N1BA 3L8BA 3NCIA 3CFPA 3SI6A 1FZ2E 1IH7A 1XVGE 3SUPA 4M3ZA 2H4TA 2P1OB 3TAGA 1FYZE 3QEXA 3RMCA 4M3RA 1XU3E 2FW3A 2HD0A 2PFVA 1CLQA 4EP9A 4AKGA 2FYOA 2JH9A 2OVQB 4J2EA 4FJGA 3OGKB 2B7MA 4RL5A 2E31A 1FZ8E 4M3UA 3LDBA 3NDKA 3HL8A 1FZ6E 1FZIE 1XMFE 3L2OB 4M45A 5IBKB 3LDSA 4ADNA 1MMOG 3TAEA 2P1MB 1XMHE 2ATQA 3SUQA 2OZMA 4X5MA 4FJXA 4FJ7A 4ADOA 3C6OB 3SNNA 3J27A 2VJ4A 1FZ7E 4FK4A 2VIXA 3NGIA 3LZJA 1FZ3E 3K2OA 4KI4A 4AKIA 4JRQA 3SUNA 3C6NB 4I9LA 3QESA 3C94A 3LD8A 4M3YA 4DU1A 3TABA 4J2BA 4DTXA 4M3WA 4FJ9A 4M42A 1WAJA 4JS4A 4AKHA 4DU4A 3RMDA 1FZ5E 4FVMA 4FJIA 2JH8A 3SUOA 4EYWA 4KHSA 4FJLA 3QEIA 3QEWA 3UIQA 3SQ2A 3NAEA 4E4BA 3SPZA 3MKSB 4FJKA 3QETA 1FS1A 3QEPA 3C95A 3L1NA 5IZ7A 3CQ8A 2OVRB 4FJMA 1MHZG 2DTUA 4DU3A 2DY4A 3SQ1A 4DTPA 4FJNA 4KHUA 3NE6A 2B8IA 2QXFA 2P1PB 3C6PB 1XVBE 3HGLA 2PFTA 3CFOA 4DTNA 4KHNA 4E3SA 3OGMB 4DTSA 2DEBA 4FJ8A 2YB5A 4J2AA 4FJJA 4QNDA 4EPHA 3SPYA 3SJJA 3TL8B 1LDKE 1FXXA 1P22A 4JS5A 4KHWA 3S9HA 1XVDE 2P5OA 3J2PA 3E4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMO G;  1XMH E;  1FZ1 E;  1FZH E;  1XU5 E;  1XVE E;  1MHZ G;  1FZ7 E;  4GAM C;  1FZ3 E;  1FZ0 E;  1FZ6 E;  1XVF E;  1FZ4 E;  1MTY G;  1XVB E;  1FZ2 E;  1XVG E;  1FYZ E;  1XU3 E;  1FZ5 E;  1FZ9 E;  1FZ8 E;  1MHY G;  1XVD E;  1XMG E;  1XVC E;  1FZI E;  1XMF E; 
#chains in the Genus database with same CATH topology
 4FK2 A;  3QNO A;  4M3X A;  1Q9X A;  2VJ5 A;  4RG8 A;  1NEX B;  4X5N A;  2OZS A;  4AI6 A;  4FK0 A;  3QER A;  3OGL B;  3TJY A;  1XU5 E;  4HCB A;  1XVE E;  2MZW B;  4DTM A;  3QEV A;  1FZ0 E;  4QNC A;  3CFR A;  4KHQ A;  2LF6 A;  1XVF E;  1FZ4 E;  2P1Q B;  2B1E A;  3LZI A;  1MTY G;  2JHA A;  3RMA A;  1XL3 C;  2JHC A;  2OYQ A;  2LF3 A;  1WAF A;  3KD5 E;  2MMB A;  3UO2 A;  3SQ0 A;  3KD1 E;  4M41 A;  3SCX A;  2JPN A;  3HP9 A;  2OVP B;  3QNN A;  2P1N B;  2RCU A;  2E32 A;  3WSO A;  1JW2 A;  3UO3 A;  3NHG A;  1FZ9 E;  4DTR A;  1MHY G;  4DTO A;  1XVC E;  1XMG E;  3RWU A;  2P5G A;  4KI6 A;  3RMB A;  3E4W A;  4KHY A;  3V7D B;  1IG9 A;  3SVI A;  3HGK E;  3N1E A;  1FZ1 E;  1FZH E;  4DTU A;  3SQ4 A;  4I9Q A;  2K5S A;  4RNG A;  4JRP A;  3TAF A;  3L0M A;  4I6J B;  4IT5 A;  5H37 A;  4B08 A;  1Q9Y A;  4FJ5 A;  2JHP A;  5IRE A;  4GAM C;  4DTJ A;  1FPO A;  4HCC A;  4M3T A;  4FJH A;  4J2D A;  3N1B A;  3L8B A;  3NCI A;  3CFP A;  3SI6 A;  1FZ2 E;  1IH7 A;  1XVG E;  3SUP A;  4M3Z A;  2H4T A;  2P1O B;  3TAG A;  1FYZ E;  3QEX A;  3RMC A;  4M3R A;  1XU3 E;  2FW3 A;  2HD0 A;  2PFV A;  1CLQ A;  4EP9 A;  4AKG A;  2FYO A;  2RKH A;  2JH9 A;  2OVQ B;  4J2E A;  2MW2 A;  4FJG A;  3OGK B;  2B7M A;  4RL5 A;  2JQT A;  2E31 A;  1FZ8 E;  4M3U A;  3LDB A;  3NDK A;  3HL8 A;  1FZ6 E;  1FZI E;  1XMF E;  3L2O B;  4M45 A;  5IBK B;  3LDS A;  4ADN A;  1MMO G;  3TAE A;  2P1M B;  1XMH E;  2ATQ A;  3SUQ A;  2OZM A;  4X5M A;  4FJX A;  4FJ7 A;  4ADO A;  3C6O B;  3SNN A;  3J27 A;  2VJ4 A;  1FZ7 E;  4FK4 A;  2VIX A;  3NGI A;  3LZJ A;  1FZ3 E;  3K2O A;  4KI4 A;  4AKI A;  4JRQ A;  3SUN A;  3C6N B;  4I9L A;  4ICG C;  3C94 A;  3QES A;  3LD8 A;  4M3Y A;  4DU1 A;  3TAB A;  4J2B A;  4DTX A;  4M3W A;  4FJ9 A;  4M42 A;  1WAJ A;  4JS4 A;  4AKH A;  4DU4 A;  3RMD A;  1FZ5 E;  4FVM A;  4FJI A;  2JH8 A;  3SUO A;  4EYW A;  4KHS A;  4FJL A;  3QEI A;  3QEW A;  3UIQ A;  3SQ2 A;  3NAE A;  4E4B A;  3SPZ A;  3MKS B;  4FJK A;  3QET A;  1FS1 A;  3QEP A;  3C95 A;  3L1N A;  5IZ7 A;  3CQ8 A;  2OVR B;  4FJM A;  1MHZ G;  2DTU A;  4DU3 A;  2DY4 A;  3SQ1 A;  4DTP A;  4FJN A;  4KHU A;  3NE6 A;  2B8I A;  2QXF A;  1N1C A;  2P1P B;  3C6P B;  1XVB E;  3HGL A;  2PFT A;  3BVO A;  3CFO A;  4DTN A;  4KHN A;  4E3S A;  3OGM B;  4DTS A;  2DEB A;  4FJ8 A;  2YB5 A;  4J2A A;  4FJJ A;  4QND A;  4EPH A;  3SPY A;  3SJJ A;  3TL8 B;  1LDK E;  1FXX A;  1P22 A;  4JS5 A;  4KHW A;  3S9H A;  1XVD E;  2P5O A;  3J2P A;  3E4Y A; 
#chains in the Genus database with same CATH homology
 4FK2 A;  3QNO A;  4M3X A;  1Q9X A;  2VJ5 A;  4RG8 A;  1NEX B;  4X5N A;  2OZS A;  4AI6 A;  4FK0 A;  3QER A;  3OGL B;  3TJY A;  1XU5 E;  4HCB A;  1XVE E;  2MZW B;  4DTM A;  3QEV A;  1FZ0 E;  4QNC A;  3CFR A;  4KHQ A;  2LF6 A;  1XVF E;  1FZ4 E;  2P1Q B;  2B1E A;  3LZI A;  1MTY G;  2JHA A;  3RMA A;  1XL3 C;  2JHC A;  2OYQ A;  2LF3 A;  1WAF A;  3KD5 E;  2MMB A;  3SQ0 A;  3KD1 E;  4M41 A;  3SCX A;  2JPN A;  3HP9 A;  2OVP B;  3QNN A;  2P1N B;  2RCU A;  2E32 A;  3WSO A;  3NHG A;  1FZ9 E;  4DTR A;  1MHY G;  4DTO A;  1XVC E;  1XMG E;  3RWU A;  2P5G A;  4KI6 A;  3RMB A;  3E4W A;  4KHY A;  3V7D B;  1IG9 A;  3SVI A;  3HGK E;  3N1E A;  1FZ1 E;  1FZH E;  4DTU A;  3SQ4 A;  4I9Q A;  4RNG A;  4JRP A;  3TAF A;  3L0M A;  4I6J B;  5H37 A;  1Q9Y A;  4B08 A;  4FJ5 A;  2JHP A;  5IRE A;  4GAM C;  4DTJ A;  4HCC A;  4M3T A;  4FJH A;  4J2D A;  3N1B A;  3L8B A;  3NCI A;  3CFP A;  3SI6 A;  1FZ2 E;  1IH7 A;  1XVG E;  3SUP A;  4M3Z A;  2H4T A;  2P1O B;  3TAG A;  1FYZ E;  3QEX A;  3RMC A;  4M3R A;  1XU3 E;  2FW3 A;  2HD0 A;  2PFV A;  1CLQ A;  4EP9 A;  4AKG A;  2FYO A;  2JH9 A;  2OVQ B;  4J2E A;  4FJG A;  3OGK B;  2B7M A;  4RL5 A;  2E31 A;  1FZ8 E;  4M3U A;  3LDB A;  3NDK A;  3HL8 A;  1FZ6 E;  1FZI E;  1XMF E;  3L2O B;  4M45 A;  5IBK B;  3LDS A;  4ADN A;  1MMO G;  3TAE A;  2P1M B;  1XMH E;  2ATQ A;  3SUQ A;  2OZM A;  4X5M A;  4FJX A;  4FJ7 A;  4ADO A;  3C6O B;  3SNN A;  3J27 A;  2VJ4 A;  1FZ7 E;  4FK4 A;  2VIX A;  3NGI A;  3LZJ A;  1FZ3 E;  3K2O A;  4KI4 A;  4AKI A;  4JRQ A;  3SUN A;  3C6N B;  4I9L A;  3QES A;  3C94 A;  3LD8 A;  4M3Y A;  4DU1 A;  3TAB A;  4J2B A;  4DTX A;  4M3W A;  4FJ9 A;  4M42 A;  1WAJ A;  4JS4 A;  4AKH A;  4DU4 A;  3RMD A;  1FZ5 E;  4FVM A;  4FJI A;  2JH8 A;  3SUO A;  4EYW A;  4KHS A;  4FJL A;  3QEI A;  3QEW A;  3UIQ A;  3SQ2 A;  3NAE A;  4E4B A;  3SPZ A;  3MKS B;  4FJK A;  3QET A;  1FS1 A;  3QEP A;  3C95 A;  3L1N A;  5IZ7 A;  3CQ8 A;  2OVR B;  4FJM A;  1MHZ G;  2DTU A;  4DU3 A;  2DY4 A;  3SQ1 A;  4DTP A;  4FJN A;  4KHU A;  3NE6 A;  2B8I A;  2QXF A;  2P1P B;  3C6P B;  1XVB E;  3HGL A;  2PFT A;  3CFO A;  4DTN A;  4KHN A;  4E3S A;  3OGM B;  4DTS A;  2DEB A;  4FJ8 A;  2YB5 A;  4J2A A;  4FJJ A;  4QND A;  4EPH A;  3SPY A;  3SJJ A;  3TL8 B;  1LDK E;  1FXX A;  1P22 A;  4JS5 A;  4KHW A;  3S9H A;  1XVD E;  2P5O A;  3J2P A;  3E4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...