1MHZG

Methane monooxygenase hydroxylase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
167
structure length
167
Chain Sequence
AKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hydroxylase component of methane monooxygenase from Methylosinus trichosporium OB3b
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE HYDROXYLASE
total genus 60
structure length 167
sequence length 167
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1996-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhzG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhzG02
1XMGE 1XVDE 1FYZE 1FZ2E 1XMFE 1MHZG 1MHYG 1FZ9E 1XU3E 1FZ3E 1FZ8E 4GAMC 1FZ1E 1XMHE 1XVEE 1FZ4E 1MTYG 1FZ0E 1XVCE 1FZHE 1FZIE 1XVFE 1FZ5E 1XVBE 1XU5E 1XVGE 1FZ7E 1MMOG 1FZ6E
chains in the Genus database with same CATH superfamily
1XVDE 3QEVA 2DY4A 4FJ7A 2MW2A 3NE6A 2B1EA 3HL8A 4EP9A 3QEPA 3SQ1A 3UO3A 4DU1A 1FS1A 3LD8A 4DTJA 1FZ3E 3KD1E 4ADOA 4FJ8A 4DTXA 3HP9A 3QEWA 3RMBA 4FJ5A 3SI6A 1FXXA 4JS4A 3QETA 2B8IA 3TAFA 1FZ0E 4RNGA 3TABA 1CLQA 4HCBA 3C95A 4DU4A 1FZIE 2OVPB 4J2BA 4JRPA 4M42A 3V7DB 1WAFA 3SQ2A 4M45A 3J27A 4I9LA 4RG8A 3RMCA 1MMOG 4J2AA 4AKGA 2P1OB 3BVOA 2VIXA 3L8BA 4M3UA 4KHUA 4FJ9A 1XL3C 2DEBA 2HD0A 3C6OB 4KI4A 3SVIA 2FW3A 3TAGA 1MHZG 2K5SA 1FZ9E 3NDKA 3SUPA 4KHQA 4M3XA 2P1MB 3UO2A 4AKIA 4E4BA 3N1BA 4B08A 1FZ4E 4X5NA 3NAEA 4DTMA 4M3RA 3RMAA 3MKSB 4KI6A 5H37A 4DTRA 1FZHE 4FJHA 4J2DA 4FJGA 2VJ4A 2QXFA 1NEXB 3CFRA 2LF6A 1XU5E 1IH7A 2JPNA 3SUQA 4ICGC 2P1NB 1FZ6E 4X5MA 3SJJA 2JQTA 2RKHA 2JHPA 2LF3A 3E4WA 4DTSA 2ATQA 4KHNA 4AKHA 2MZWB 4ADNA 2FYOA 2OZMA 3C94A 4FJNA 4FK0A 4M3YA 3LZIA 3HGLA 1FZ2E 5IREA 3C6PB 1XMFE 3CFPA 1MHYG 1XU3E 4I6JB 3SCXA 2P5GA 4KHWA 4M3ZA 2JH9A 3RMDA 1FZ8E 3NCIA 1LDKE 4GAMC 4FJXA 4EPHA 1P22A 4QNCA 5IZ7A 3KD5E 3L1NA 3WSOA 4RL5A 3SUOA 4FJMA 2E31A 1XVCE 2E32A 4J2EA 4M41A 2JH8A 3TJYA 1XVFE 2VJ5A 3S9HA 1FZ5E 2P1QB 3SNNA 2RCUA 1Q9XA 4FK4A 2P5OA 3RWUA 3K2OA 4DTUA 4M3TA 3QERA 1N1CA 3L0MA 1WAJA 3QEXA 4FJKA 4DU3A 4KHYA 3SPYA 2YB5A 3QNOA 4QNDA 3C6NB 3TAEA 3QEIA 2DTUA 2JHAA 3SPZA 1XMGE 1JW2A 3SQ4A 4FK2A 4DTPA 4I9QA 1FYZE 3LDBA 4JS5A 4AI6A 3HGKE 3QESA 3LZJA 3UIQA 4DTOA 4KHSA 3E4YA 1Q9YA 2H4TA 2PFTA 1IG9A 4FJLA 1FZ1E 1XMHE 2JHCA 2OVQB 1XVEE 3NHGA 4M3WA 1MTYG 3J2PA 4E3SA 4EYWA 4IT5A 4FJIA 3NGIA 3LDSA 4JRQA 1FPOA 3OGKB 3QNNA 4FVMA 2OVRB 1XVBE 3CFOA 3OGMB 4FJJA 1XVGE 3N1EA 3OGLB 3TL8B 1FZ7E 2OZSA 4HCCA 2B7MA 2MMBA 3CQ8A 3SUNA 4DTNA 3L2OB 2OYQA 2PFVA 2P1PB 3SQ0A 5IBKB
chains in the Genus database with same CATH topology
1XVDE 3QEVA 2DY4A 4FJ7A 3NE6A 3SQ1A 2B1EA 3HL8A 4EP9A 3QEPA 4DU1A 1FS1A 3LD8A 4DTJA 1FZ3E 3KD1E 4ADOA 4FJ8A 4DTXA 3HP9A 3QEWA 3RMBA 4FJ5A 3SI6A 1FXXA 4JS4A 3QETA 2B8IA 3TAFA 1FZ0E 4RNGA 3TABA 1CLQA 4HCBA 3C95A 4DU4A 1FZIE 2OVPB 4J2BA 4JRPA 4M42A 3V7DB 1WAFA 3SQ2A 4M45A 3J27A 4I9LA 4RG8A 3RMCA 1MMOG 4J2AA 4AKGA 2P1OB 2VIXA 3L8BA 4M3UA 4KHUA 4FJ9A 1XL3C 2DEBA 2HD0A 3C6OB 4KI4A 3SVIA 2FW3A 3TAGA 1MHZG 3NDKA 1FZ9E 3SUPA 4KHQA 4M3XA 2P1MB 4AKIA 4E4BA 3N1BA 4B08A 1FZ4E 4X5NA 3NAEA 4DTMA 4M3RA 3RMAA 3MKSB 4KI6A 5H37A 4DTRA 1FZHE 4FJHA 4J2DA 4FJGA 2VJ4A 2QXFA 1NEXB 3CFRA 2LF6A 1XU5E 1IH7A 2JPNA 3SUQA 2P1NB 1FZ6E 4X5MA 3SJJA 2JHPA 2LF3A 3E4WA 4DTSA 2ATQA 4KHNA 4AKHA 2MZWB 4ADNA 2FYOA 2OZMA 3C94A 4FJNA 4FK0A 4M3YA 3LZIA 3HGLA 1FZ2E 5IREA 3C6PB 1XMFE 3CFPA 1MHYG 1XU3E 4I6JB 3SCXA 2P5GA 4KHWA 4M3ZA 2JH9A 3RMDA 1FZ8E 3NCIA 1LDKE 4GAMC 4FJXA 4EPHA 1P22A 4QNCA 5IZ7A 3KD5E 3L1NA 3WSOA 4RL5A 3SUOA 4FJMA 2E31A 1XVCE 2E32A 4J2EA 4M41A 2JH8A 3TJYA 1XVFE 2VJ5A 3S9HA 1FZ5E 2P1QB 3SNNA 2RCUA 1Q9XA 4FK4A 2P5OA 3RWUA 3K2OA 4DTUA 4M3TA 3QERA 3L0MA 1WAJA 3QEXA 4FJKA 4DU3A 4KHYA 3SPYA 2YB5A 3QNOA 4QNDA 3C6NB 3TAEA 3QEIA 2DTUA 2JHAA 3SPZA 1XMGE 3SQ4A 4FK2A 4DTPA 4I9QA 1FYZE 3LDBA 4JS5A 4AI6A 3HGKE 3QESA 3LZJA 3UIQA 4DTOA 4KHSA 3E4YA 1Q9YA 2H4TA 2PFTA 1IG9A 4FJLA 1FZ1E 1XMHE 2JHCA 2OVQB 1XVEE 3NHGA 4M3WA 1MTYG 3J2PA 4E3SA 4EYWA 4FJIA 3NGIA 3LDSA 4JRQA 3OGKB 3QNNA 4FVMA 2OVRB 1XVBE 3CFOA 3OGMB 4FJJA 1XVGE 3N1EA 3OGLB 3TL8B 1FZ7E 2OZSA 4HCCA 2B7MA 2MMBA 3CQ8A 3SUNA 4DTNA 3L2OB 2OYQA 2PFVA 2P1PB 3SQ0A 5IBKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMG E;  1XVD E;  1FYZ E;  1FZ2 E;  1XMF E;  1MHZ G;  1MHY G;  1FZ9 E;  1XU3 E;  1FZ3 E;  1FZ8 E;  4GAM C;  1FZ1 E;  1XMH E;  1XVE E;  1FZ4 E;  1MTY G;  1FZ0 E;  1XVC E;  1FZH E;  1FZI E;  1XVF E;  1FZ5 E;  1XVB E;  1XU5 E;  1XVG E;  1FZ7 E;  1MMO G;  1FZ6 E; 
#chains in the Genus database with same CATH topology
 1XVD E;  3QEV A;  2DY4 A;  4FJ7 A;  2MW2 A;  3NE6 A;  2B1E A;  3HL8 A;  4EP9 A;  3QEP A;  3SQ1 A;  3UO3 A;  4DU1 A;  1FS1 A;  3LD8 A;  4DTJ A;  1FZ3 E;  3KD1 E;  4ADO A;  4FJ8 A;  4DTX A;  3HP9 A;  3QEW A;  3RMB A;  4FJ5 A;  3SI6 A;  1FXX A;  4JS4 A;  3QET A;  2B8I A;  3TAF A;  1FZ0 E;  4RNG A;  3TAB A;  1CLQ A;  4HCB A;  3C95 A;  4DU4 A;  1FZI E;  2OVP B;  4J2B A;  4JRP A;  4M42 A;  3V7D B;  1WAF A;  3SQ2 A;  4M45 A;  3J27 A;  4I9L A;  4RG8 A;  3RMC A;  1MMO G;  4J2A A;  4AKG A;  2P1O B;  3BVO A;  2VIX A;  3L8B A;  4M3U A;  4KHU A;  4FJ9 A;  1XL3 C;  2DEB A;  2HD0 A;  3C6O B;  4KI4 A;  3SVI A;  2FW3 A;  3TAG A;  1MHZ G;  2K5S A;  1FZ9 E;  3NDK A;  3SUP A;  4KHQ A;  4M3X A;  2P1M B;  3UO2 A;  4AKI A;  4E4B A;  3N1B A;  4B08 A;  1FZ4 E;  4X5N A;  3NAE A;  4DTM A;  4M3R A;  3RMA A;  3MKS B;  4KI6 A;  5H37 A;  4DTR A;  1FZH E;  4FJH A;  4J2D A;  4FJG A;  2VJ4 A;  2QXF A;  1NEX B;  3CFR A;  2LF6 A;  1XU5 E;  1IH7 A;  2JPN A;  3SUQ A;  4ICG C;  2P1N B;  1FZ6 E;  4X5M A;  3SJJ A;  2JQT A;  2RKH A;  2JHP A;  2LF3 A;  3E4W A;  4DTS A;  2ATQ A;  4KHN A;  4AKH A;  2MZW B;  4ADN A;  2FYO A;  2OZM A;  3C94 A;  4FJN A;  4FK0 A;  4M3Y A;  3LZI A;  3HGL A;  1FZ2 E;  5IRE A;  3C6P B;  1XMF E;  3CFP A;  1MHY G;  1XU3 E;  4I6J B;  3SCX A;  2P5G A;  4KHW A;  4M3Z A;  2JH9 A;  3RMD A;  1FZ8 E;  3NCI A;  1LDK E;  4GAM C;  4FJX A;  4EPH A;  1P22 A;  4QNC A;  5IZ7 A;  3KD5 E;  3L1N A;  3WSO A;  4RL5 A;  3SUO A;  4FJM A;  2E31 A;  1XVC E;  2E32 A;  4J2E A;  4M41 A;  2JH8 A;  3TJY A;  1XVF E;  2VJ5 A;  3S9H A;  1FZ5 E;  2P1Q B;  3SNN A;  2RCU A;  1Q9X A;  4FK4 A;  2P5O A;  3RWU A;  3K2O A;  4DTU A;  4M3T A;  3QER A;  1N1C A;  3L0M A;  1WAJ A;  3QEX A;  4FJK A;  4DU3 A;  4KHY A;  3SPY A;  2YB5 A;  3QNO A;  4QND A;  3C6N B;  3TAE A;  3QEI A;  2DTU A;  2JHA A;  3SPZ A;  1XMG E;  1JW2 A;  3SQ4 A;  4FK2 A;  4DTP A;  4I9Q A;  1FYZ E;  3LDB A;  4JS5 A;  4AI6 A;  3HGK E;  3QES A;  3LZJ A;  3UIQ A;  4DTO A;  4KHS A;  3E4Y A;  1Q9Y A;  2H4T A;  2PFT A;  1IG9 A;  4FJL A;  1FZ1 E;  1XMH E;  2JHC A;  2OVQ B;  1XVE E;  3NHG A;  4M3W A;  1MTY G;  3J2P A;  4E3S A;  4EYW A;  4IT5 A;  4FJI A;  3NGI A;  3LDS A;  4JRQ A;  1FPO A;  3OGK B;  3QNN A;  4FVM A;  2OVR B;  1XVB E;  3CFO A;  3OGM B;  4FJJ A;  1XVG E;  3N1E A;  3OGL B;  3TL8 B;  1FZ7 E;  2OZS A;  4HCC A;  2B7M A;  2MMB A;  3CQ8 A;  3SUN A;  4DTN A;  3L2O B;  2OYQ A;  2PFV A;  2P1P B;  3SQ0 A;  5IBK B; 
#chains in the Genus database with same CATH homology
 1XVD E;  3QEV A;  2DY4 A;  4FJ7 A;  3NE6 A;  3SQ1 A;  2B1E A;  3HL8 A;  4EP9 A;  3QEP A;  4DU1 A;  1FS1 A;  3LD8 A;  4DTJ A;  1FZ3 E;  3KD1 E;  4ADO A;  4FJ8 A;  4DTX A;  3HP9 A;  3QEW A;  3RMB A;  4FJ5 A;  3SI6 A;  1FXX A;  4JS4 A;  3QET A;  2B8I A;  3TAF A;  1FZ0 E;  4RNG A;  3TAB A;  1CLQ A;  4HCB A;  3C95 A;  4DU4 A;  1FZI E;  2OVP B;  4J2B A;  4JRP A;  4M42 A;  3V7D B;  1WAF A;  3SQ2 A;  4M45 A;  3J27 A;  4I9L A;  4RG8 A;  3RMC A;  1MMO G;  4J2A A;  4AKG A;  2P1O B;  2VIX A;  3L8B A;  4M3U A;  4KHU A;  4FJ9 A;  1XL3 C;  2DEB A;  2HD0 A;  3C6O B;  4KI4 A;  3SVI A;  2FW3 A;  3TAG A;  1MHZ G;  3NDK A;  1FZ9 E;  3SUP A;  4KHQ A;  4M3X A;  2P1M B;  4AKI A;  4E4B A;  3N1B A;  4B08 A;  1FZ4 E;  4X5N A;  3NAE A;  4DTM A;  4M3R A;  3RMA A;  3MKS B;  4KI6 A;  5H37 A;  4DTR A;  1FZH E;  4FJH A;  4J2D A;  4FJG A;  2VJ4 A;  2QXF A;  1NEX B;  3CFR A;  2LF6 A;  1XU5 E;  1IH7 A;  2JPN A;  3SUQ A;  2P1N B;  1FZ6 E;  4X5M A;  3SJJ A;  2JHP A;  2LF3 A;  3E4W A;  4DTS A;  2ATQ A;  4KHN A;  4AKH A;  2MZW B;  4ADN A;  2FYO A;  2OZM A;  3C94 A;  4FJN A;  4FK0 A;  4M3Y A;  3LZI A;  3HGL A;  1FZ2 E;  5IRE A;  3C6P B;  1XMF E;  3CFP A;  1MHY G;  1XU3 E;  4I6J B;  3SCX A;  2P5G A;  4KHW A;  4M3Z A;  2JH9 A;  3RMD A;  1FZ8 E;  3NCI A;  1LDK E;  4GAM C;  4FJX A;  4EPH A;  1P22 A;  4QNC A;  5IZ7 A;  3KD5 E;  3L1N A;  3WSO A;  4RL5 A;  3SUO A;  4FJM A;  2E31 A;  1XVC E;  2E32 A;  4J2E A;  4M41 A;  2JH8 A;  3TJY A;  1XVF E;  2VJ5 A;  3S9H A;  1FZ5 E;  2P1Q B;  3SNN A;  2RCU A;  1Q9X A;  4FK4 A;  2P5O A;  3RWU A;  3K2O A;  4DTU A;  4M3T A;  3QER A;  3L0M A;  1WAJ A;  3QEX A;  4FJK A;  4DU3 A;  4KHY A;  3SPY A;  2YB5 A;  3QNO A;  4QND A;  3C6N B;  3TAE A;  3QEI A;  2DTU A;  2JHA A;  3SPZ A;  1XMG E;  3SQ4 A;  4FK2 A;  4DTP A;  4I9Q A;  1FYZ E;  3LDB A;  4JS5 A;  4AI6 A;  3HGK E;  3QES A;  3LZJ A;  3UIQ A;  4DTO A;  4KHS A;  3E4Y A;  1Q9Y A;  2H4T A;  2PFT A;  1IG9 A;  4FJL A;  1FZ1 E;  1XMH E;  2JHC A;  2OVQ B;  1XVE E;  3NHG A;  4M3W A;  1MTY G;  3J2P A;  4E3S A;  4EYW A;  4FJI A;  3NGI A;  3LDS A;  4JRQ A;  3OGK B;  3QNN A;  4FVM A;  2OVR B;  1XVB E;  3CFO A;  3OGM B;  4FJJ A;  1XVG E;  3N1E A;  3OGL B;  3TL8 B;  1FZ7 E;  2OZS A;  4HCC A;  2B7M A;  2MMB A;  3CQ8 A;  3SUN A;  4DTN A;  3L2O B;  2OYQ A;  2PFV A;  2P1P B;  3SQ0 A;  5IBK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...