1FZ2E

Methane monooxygenase hydroxylase, form ii mixed-valent generated by crystal soaking
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
total genus 61
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz2E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz2E02
1XVGE 1FZ8E 1MHYG 1FZ4E 1XVCE 1XMFE 1FZ6E 1MHZG 1FZ5E 1XVEE 1XU3E 1FZ9E 1FZ0E 1XU5E 1XVFE 1FZ2E 1XMGE 1FZIE 1FZHE 1MMOG 1XMHE 1FZ1E 1XVDE 1XVBE 1FYZE 1FZ7E 1MTYG 1FZ3E 4GAMC
chains in the Genus database with same CATH superfamily
1XL3C 4DTPA 4KHQA 4J2BA 4AKIA 4I9QA 2FW3A 4FK4A 1IH7A 4FK0A 1FPOA 1Q9YA 1Q9XA 4DU4A 1JW2A 2E32A 4FJ8A 4JS4A 3SUQA 4AI6A 4FJKA 1XVEE 3C6OB 4M42A 3SCXA 2P1MB 3V7DB 4QNDA 4FJJA 1FZ0E 3L1NA 3LDSA 4KHYA 1XVFE 4M41A 4FJ7A 1CLQA 1MMOG 3NE6A 3KD1E 4QNCA 4KHWA 1NEXB 3SPZA 3TAFA 1XVBE 2DY4A 3NDKA 3LD8A 3QEXA 2HD0A 4RNGA 4JRQA 2B1EA 3RMDA 3TABA 3NHGA 4ADNA 3CQ8A 3SUNA 2B7MA 2P1PB 4EYWA 2ATQA 4DU3A 4FJ5A 4I9LA 3HGLA 4M45A 4FJNA 1MHYG 4EPHA 2P1NB 3UO2A 5IREA 2E31A 3SNNA 1XVCE 1XMFE 1MHZG 3SUOA 4I6JB 4FVMA 4X5MA 2OVQB 1FXXA 4DTOA 3QNOA 3HP9A 2OVPB 3CFRA 1FZ2E 4EP9A 4JS5A 1FZ1E 1XVDE 2FYOA 2B8IA 3N1BA 3L8BA 3QEVA 3QEWA 3OGKB 4ICGC 3E4YA 4DU1A 3CFOA 1FYZE 3SQ1A 1FZ7E 3C95A 4KHUA 2JHPA 3NGIA 4E3SA 2LF6A 4KHNA 4M3XA 4KHSA 3J27A 4AKGA 4M3YA 3MKSB 3TAEA 3L2OB 2OZMA 1IG9A 2PFVA 3J2PA 2YB5A 3WSOA 4E4BA 3RMCA 4M3RA 1XVGE 2JHCA 2VIXA 2P1OB 3HGKE 4X5NA 4ADOA 1P22A 3TJYA 4FJGA 4HCBA 3RWUA 3S9HA 4M3ZA 3TL8B 4DTUA 3RMBA 4HCCA 3E4WA 4JRPA 4M3WA 2P1QB 2DTUA 4RL5A 2RCUA 4M3UA 1WAJA 3SQ2A 3RMAA 1FZ9E 4FJHA 1XU5E 4J2EA 3UO3A 4FJXA 1XMGE 4J2AA 3C6PB 4RG8A 3BVOA 3KD5E 3NAEA 4FJLA 1FZ3E 3QESA 5IZ7A 3OGMB 4DTRA 2VJ5A 2JQTA 4DTNA 2P5GA 4KI4A 2JHAA 4GAMC 2LF3A 2DEBA 2VJ4A 4J2DA 3C94A 3HL8A 2JH8A 1FZ8E 2MMBA 3C6NB 1N1CA 2MZWB 2RKHA 2JPNA 2PFTA 1FZ4E 3L0MA 1FS1A 3QERA 3SI6A 1FZ6E 1FZ5E 2QXFA 4FJIA 4DTSA 1XU3E 2MW2A 5H37A 3SPYA 4M3TA 3SQ4A 3TAGA 3K2OA 4KI6A 3CFPA 5IBKB 2JH9A 2K5SA 3LZJA 3UIQA 1FZIE 1FZHE 1LDKE 1WAFA 1XMHE 3SQ0A 3NCIA 2H4TA 3QEPA 3QETA 3N1EA 4FK2A 3SVIA 4B08A 2P5OA 2OYQA 3LDBA 2OZSA 4IT5A 3QEIA 3SUPA 4DTMA 1MTYG 2OVRB 4FJMA 3SJJA 3QNNA 4AKHA 4DTXA 4DTJA 3OGLB 3LZIA 4FJ9A
chains in the Genus database with same CATH topology
1XL3C 4DTPA 4KHQA 4J2BA 4AKIA 4I9QA 2FW3A 4FK4A 1IH7A 4FK0A 1Q9YA 1Q9XA 4DU4A 4AI6A 2E32A 4FJ8A 4JS4A 3SUQA 4FJKA 1XVEE 3C6OB 4M42A 3SCXA 2P1MB 3V7DB 4QNDA 4FJJA 1FZ0E 3L1NA 3LDSA 4KHYA 1XVFE 4M41A 4FJ7A 1CLQA 1MMOG 3NE6A 3KD1E 4QNCA 4KHWA 1NEXB 3SPZA 3TAFA 1XVBE 2DY4A 3NDKA 3LD8A 3QEXA 2HD0A 4RNGA 4JRQA 2B1EA 3RMDA 3TABA 3NHGA 4ADNA 3CQ8A 3SUNA 2B7MA 2P1PB 4EYWA 2ATQA 4DU3A 4FJ5A 4I9LA 3HGLA 4M45A 4FJNA 1MHYG 4EPHA 2P1NB 5IREA 2E31A 3SNNA 1XVCE 1XMFE 1MHZG 3SUOA 4I6JB 4FVMA 4X5MA 2OVQB 1FXXA 4DTOA 3QNOA 3HP9A 2OVPB 3CFRA 1FZ2E 4EP9A 4JS5A 1FZ1E 1XVDE 2FYOA 2B8IA 3N1BA 3L8BA 3QEVA 3QEWA 3OGKB 3SQ1A 3E4YA 4DU1A 3CFOA 1FYZE 4KHUA 1FZ7E 3C95A 2JHPA 3NGIA 4E3SA 2LF6A 4KHNA 4M3XA 4KHSA 3J27A 4AKGA 4M3YA 3MKSB 3TAEA 3L2OB 2OZMA 1IG9A 2PFVA 3J2PA 2YB5A 3WSOA 4E4BA 3RMCA 4M3RA 1XVGE 2JHCA 2VIXA 2P1OB 3HGKE 4X5NA 4ADOA 1P22A 3TJYA 4FJGA 4HCBA 3RWUA 3S9HA 4M3ZA 3TL8B 4DTUA 3RMBA 4HCCA 3E4WA 4JRPA 4M3WA 2P1QB 2DTUA 4RL5A 2RCUA 4M3UA 1WAJA 3SQ2A 3RMAA 1FZ9E 4FJHA 1XU5E 4J2EA 4FJXA 1XMGE 4J2AA 3C6PB 4RG8A 3KD5E 3NAEA 4FJLA 1FZ3E 3QESA 5IZ7A 3OGMB 4DTRA 2VJ5A 4DTNA 2P5GA 4KI4A 2JHAA 4GAMC 2LF3A 2DEBA 2VJ4A 4J2DA 3C94A 3HL8A 2JH8A 1FZ8E 2MMBA 3C6NB 2MZWB 2PFTA 2JPNA 3QERA 1FZ4E 3L0MA 1FS1A 3SI6A 1FZ6E 1FZ5E 2QXFA 4FJIA 4DTSA 1XU3E 5H37A 4M3TA 3SPYA 3SQ4A 3TAGA 3K2OA 4KI6A 3CFPA 5IBKB 2JH9A 3UIQA 3LZJA 1FZIE 1FZHE 1LDKE 1WAFA 1XMHE 3SQ0A 3NCIA 2H4TA 3QEPA 3QETA 3N1EA 4FK2A 3SVIA 4B08A 2P5OA 2OYQA 3LDBA 2OZSA 3SUPA 3QEIA 4DTMA 1MTYG 2OVRB 4FJMA 3SJJA 3QNNA 4AKHA 4DTXA 4DTJA 3OGLB 3LZIA 4FJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVG E;  1FZ8 E;  1MHY G;  1FZ4 E;  1XVC E;  1XMF E;  1FZ6 E;  1MHZ G;  1FZ5 E;  1XVE E;  1XU3 E;  1FZ9 E;  1FZ0 E;  1XU5 E;  1XVF E;  1FZ2 E;  1XMG E;  1FZI E;  1FZH E;  1MMO G;  1XMH E;  1FZ1 E;  1XVD E;  1XVB E;  1FYZ E;  1FZ7 E;  1MTY G;  1FZ3 E;  4GAM C; 
#chains in the Genus database with same CATH topology
 1XL3 C;  4DTP A;  4KHQ A;  4J2B A;  4AKI A;  4I9Q A;  2FW3 A;  4FK4 A;  1IH7 A;  4FK0 A;  1FPO A;  1Q9Y A;  1Q9X A;  4DU4 A;  1JW2 A;  2E32 A;  4FJ8 A;  4JS4 A;  3SUQ A;  4AI6 A;  4FJK A;  1XVE E;  3C6O B;  4M42 A;  3SCX A;  2P1M B;  3V7D B;  4QND A;  4FJJ A;  1FZ0 E;  3L1N A;  3LDS A;  4KHY A;  1XVF E;  4M41 A;  4FJ7 A;  1CLQ A;  1MMO G;  3NE6 A;  3KD1 E;  4QNC A;  4KHW A;  1NEX B;  3SPZ A;  3TAF A;  1XVB E;  2DY4 A;  3NDK A;  3LD8 A;  3QEX A;  2HD0 A;  4RNG A;  4JRQ A;  2B1E A;  3RMD A;  3TAB A;  3NHG A;  4ADN A;  3CQ8 A;  3SUN A;  2B7M A;  2P1P B;  4EYW A;  2ATQ A;  4DU3 A;  4FJ5 A;  4I9L A;  3HGL A;  4M45 A;  4FJN A;  1MHY G;  4EPH A;  2P1N B;  3UO2 A;  5IRE A;  2E31 A;  3SNN A;  1XVC E;  1XMF E;  1MHZ G;  3SUO A;  4I6J B;  4FVM A;  4X5M A;  2OVQ B;  1FXX A;  4DTO A;  3QNO A;  3HP9 A;  2OVP B;  3CFR A;  1FZ2 E;  4EP9 A;  4JS5 A;  1FZ1 E;  1XVD E;  2FYO A;  2B8I A;  3N1B A;  3L8B A;  3QEV A;  3QEW A;  3OGK B;  4ICG C;  3E4Y A;  4DU1 A;  3CFO A;  1FYZ E;  3SQ1 A;  1FZ7 E;  3C95 A;  4KHU A;  2JHP A;  3NGI A;  4E3S A;  2LF6 A;  4KHN A;  4M3X A;  4KHS A;  3J27 A;  4AKG A;  4M3Y A;  3MKS B;  3TAE A;  3L2O B;  2OZM A;  1IG9 A;  2PFV A;  3J2P A;  2YB5 A;  3WSO A;  4E4B A;  3RMC A;  4M3R A;  1XVG E;  2JHC A;  2VIX A;  2P1O B;  3HGK E;  4X5N A;  4ADO A;  1P22 A;  3TJY A;  4FJG A;  4HCB A;  3RWU A;  3S9H A;  4M3Z A;  3TL8 B;  4DTU A;  3RMB A;  4HCC A;  3E4W A;  4JRP A;  4M3W A;  2P1Q B;  2DTU A;  4RL5 A;  2RCU A;  4M3U A;  1WAJ A;  3SQ2 A;  3RMA A;  1FZ9 E;  4FJH A;  1XU5 E;  4J2E A;  3UO3 A;  4FJX A;  1XMG E;  4J2A A;  3C6P B;  4RG8 A;  3BVO A;  3KD5 E;  3NAE A;  4FJL A;  1FZ3 E;  3QES A;  5IZ7 A;  3OGM B;  4DTR A;  2VJ5 A;  2JQT A;  4DTN A;  2P5G A;  4KI4 A;  2JHA A;  4GAM C;  2LF3 A;  2DEB A;  2VJ4 A;  4J2D A;  3C94 A;  3HL8 A;  2JH8 A;  1FZ8 E;  2MMB A;  3C6N B;  1N1C A;  2MZW B;  2RKH A;  2JPN A;  2PFT A;  1FZ4 E;  3L0M A;  1FS1 A;  3QER A;  3SI6 A;  1FZ6 E;  1FZ5 E;  2QXF A;  4FJI A;  4DTS A;  1XU3 E;  2MW2 A;  5H37 A;  3SPY A;  4M3T A;  3SQ4 A;  3TAG A;  3K2O A;  4KI6 A;  3CFP A;  5IBK B;  2JH9 A;  2K5S A;  3LZJ A;  3UIQ A;  1FZI E;  1FZH E;  1LDK E;  1WAF A;  1XMH E;  3SQ0 A;  3NCI A;  2H4T A;  3QEP A;  3QET A;  3N1E A;  4FK2 A;  3SVI A;  4B08 A;  2P5O A;  2OYQ A;  3LDB A;  2OZS A;  4IT5 A;  3QEI A;  3SUP A;  4DTM A;  1MTY G;  2OVR B;  4FJM A;  3SJJ A;  3QNN A;  4AKH A;  4DTX A;  4DTJ A;  3OGL B;  3LZI A;  4FJ9 A; 
#chains in the Genus database with same CATH homology
 1XL3 C;  4DTP A;  4KHQ A;  4J2B A;  4AKI A;  4I9Q A;  2FW3 A;  4FK4 A;  1IH7 A;  4FK0 A;  1Q9Y A;  1Q9X A;  4DU4 A;  4AI6 A;  2E32 A;  4FJ8 A;  4JS4 A;  3SUQ A;  4FJK A;  1XVE E;  3C6O B;  4M42 A;  3SCX A;  2P1M B;  3V7D B;  4QND A;  4FJJ A;  1FZ0 E;  3L1N A;  3LDS A;  4KHY A;  1XVF E;  4M41 A;  4FJ7 A;  1CLQ A;  1MMO G;  3NE6 A;  3KD1 E;  4QNC A;  4KHW A;  1NEX B;  3SPZ A;  3TAF A;  1XVB E;  2DY4 A;  3NDK A;  3LD8 A;  3QEX A;  2HD0 A;  4RNG A;  4JRQ A;  2B1E A;  3RMD A;  3TAB A;  3NHG A;  4ADN A;  3CQ8 A;  3SUN A;  2B7M A;  2P1P B;  4EYW A;  2ATQ A;  4DU3 A;  4FJ5 A;  4I9L A;  3HGL A;  4M45 A;  4FJN A;  1MHY G;  4EPH A;  2P1N B;  5IRE A;  2E31 A;  3SNN A;  1XVC E;  1XMF E;  1MHZ G;  3SUO A;  4I6J B;  4FVM A;  4X5M A;  2OVQ B;  1FXX A;  4DTO A;  3QNO A;  3HP9 A;  2OVP B;  3CFR A;  1FZ2 E;  4EP9 A;  4JS5 A;  1FZ1 E;  1XVD E;  2FYO A;  2B8I A;  3N1B A;  3L8B A;  3QEV A;  3QEW A;  3OGK B;  3SQ1 A;  3E4Y A;  4DU1 A;  3CFO A;  1FYZ E;  4KHU A;  1FZ7 E;  3C95 A;  2JHP A;  3NGI A;  4E3S A;  2LF6 A;  4KHN A;  4M3X A;  4KHS A;  3J27 A;  4AKG A;  4M3Y A;  3MKS B;  3TAE A;  3L2O B;  2OZM A;  1IG9 A;  2PFV A;  3J2P A;  2YB5 A;  3WSO A;  4E4B A;  3RMC A;  4M3R A;  1XVG E;  2JHC A;  2VIX A;  2P1O B;  3HGK E;  4X5N A;  4ADO A;  1P22 A;  3TJY A;  4FJG A;  4HCB A;  3RWU A;  3S9H A;  4M3Z A;  3TL8 B;  4DTU A;  3RMB A;  4HCC A;  3E4W A;  4JRP A;  4M3W A;  2P1Q B;  2DTU A;  4RL5 A;  2RCU A;  4M3U A;  1WAJ A;  3SQ2 A;  3RMA A;  1FZ9 E;  4FJH A;  1XU5 E;  4J2E A;  4FJX A;  1XMG E;  4J2A A;  3C6P B;  4RG8 A;  3KD5 E;  3NAE A;  4FJL A;  1FZ3 E;  3QES A;  5IZ7 A;  3OGM B;  4DTR A;  2VJ5 A;  4DTN A;  2P5G A;  4KI4 A;  2JHA A;  4GAM C;  2LF3 A;  2DEB A;  2VJ4 A;  4J2D A;  3C94 A;  3HL8 A;  2JH8 A;  1FZ8 E;  2MMB A;  3C6N B;  2MZW B;  2PFT A;  2JPN A;  3QER A;  1FZ4 E;  3L0M A;  1FS1 A;  3SI6 A;  1FZ6 E;  1FZ5 E;  2QXF A;  4FJI A;  4DTS A;  1XU3 E;  5H37 A;  4M3T A;  3SPY A;  3SQ4 A;  3TAG A;  3K2O A;  4KI6 A;  3CFP A;  5IBK B;  2JH9 A;  3UIQ A;  3LZJ A;  1FZI E;  1FZH E;  1LDK E;  1WAF A;  1XMH E;  3SQ0 A;  3NCI A;  2H4T A;  3QEP A;  3QET A;  3N1E A;  4FK2 A;  3SVI A;  4B08 A;  2P5O A;  2OYQ A;  3LDB A;  2OZS A;  3SUP A;  3QEI A;  4DTM A;  1MTY G;  2OVR B;  4FJM A;  3SJJ A;  3QNN A;  4AKH A;  4DTX A;  4DTJ A;  3OGL B;  3LZI A;  4FJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...