1FZ2E

Methane monooxygenase hydroxylase, form ii mixed-valent generated by crystal soaking
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 61
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz2E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz2E02
1FZHE 1XMGE 1MHZG 1XMFE 1XVDE 1FZ1E 1XU3E 1FZ9E 1FZ6E 1FZIE 1FZ0E 1MMOG 1XVBE 1FYZE 4GAMC 1XVFE 1FZ4E 1FZ5E 1FZ8E 1FZ3E 1XVCE 1XVEE 1XU5E 1MTYG 1MHYG 1XVGE 1XMHE 1FZ7E 1FZ2E
chains in the Genus database with same CATH superfamily
1FZHE 3E4WA 4FVMA 1P22A 4IT5A 3L2OB 2P5OA 4DTJA 3L0MA 2B8IA 4M42A 2H4TA 2JHAA 3SUNA 4FK0A 2MW2A 3K2OA 1FZ6E 3N1BA 5IREA 1NEXB 2P1MB 2B1EA 4DTPA 2OZSA 4J2EA 4FJ8A 5IZ7A 4B08A 3HP9A 3QETA 4JS4A 3QNNA 2P1PB 4KHQA 3SUOA 3TJYA 4FJHA 1XVBE 1FYZE 1Q9YA 3S9HA 2MMBA 1FZ3E 2P1QB 3TAFA 4HCBA 4KI6A 4KHWA 3QERA 3SUPA 1MHYG 2FYOA 3LD8A 3QEVA 4KHYA 4X5MA 4I9QA 4FJLA 3SQ2A 4FJMA 1FZ2E 3RMCA 1XMGE 1CLQA 1XMFE 4DU3A 2OYQA 4FJ9A 1WAFA 4FJ5A 3C95A 4M3TA 2JHCA 3CFOA 3L8BA 3UO3A 1WAJA 3BVOA 4DTOA 2DY4A 1FZIE 3WSOA 4EYWA 2P5GA 3L1NA 3NDKA 4JRQA 3QESA 2DEBA 2OVPB 2HD0A 2JPNA 4M45A 4EPHA 3NGIA 3V7DB 3RMBA 4HCCA 3SPYA 4J2DA 4KI4A 3HL8A 1FZ4E 2E31A 3RMDA 4FK2A 4J2AA 1FPOA 3C6PB 3OGLB 4RG8A 3J27A 2PFVA 4DTMA 4FJGA 1N1CA 3SQ1A 4KHUA 1XMHE 3KD5E 3TABA 4I9LA 2P1NB 4QNDA 1Q9XA 2OZMA 4M3WA 4FK4A 3TL8B 1IH7A 1FS1A 1MHZG 1XVDE 3HGLA 4FJIA 2P1OB 4AKIA 2OVQB 3CFPA 3E4YA 3QEPA 1FZ1E 3SPZA 2OVRB 2B7MA 3QEIA 1XL3C 3CFRA 4ADOA 3SQ4A 4AKGA 3LDSA 2RCUA 3N1EA 4M41A 4M3ZA 3UO2A 3KD1E 4JRPA 3UIQA 1MMOG 2MZWB 4E4BA 4M3XA 2FW3A 4GAMC 3NAEA 2RKHA 1IG9A 2QXFA 2JHPA 4ICGC 3SVIA 5H37A 3NHGA 3SUQA 4KHNA 4QNCA 2PFTA 1XU5E 1MTYG 3LDBA 4AI6A 3LZIA 3TAEA 4EP9A 3CQ8A 1FXXA 4FJJA 3OGKB 2JH9A 2K5SA 4JS5A 2DTUA 3MKSB 3RWUA 4FJ7A 4AKHA 3C6OB 3SNNA 4ADNA 4I6JB 1LDKE 3NE6A 3LZJA 4E3SA 4KHSA 3OGMB 4FJXA 1JW2A 3SCXA 4M3RA 1XU3E 2JQTA 3SI6A 4DU4A 2LF3A 1FZ9E 2JH8A 2LF6A 3TAGA 4DTRA 3RMAA 1FZ0E 3C94A 3NCIA 4DTXA 4X5NA 3C6NB 3J2PA 2VIXA 1XVFE 1FZ5E 2ATQA 1FZ8E 4RL5A 5IBKB 3SJJA 1XVCE 1XVEE 4M3UA 2YB5A 4DU1A 4DTSA 3QNOA 1XVGE 2VJ4A 2VJ5A 3QEWA 4FJKA 3HGKE 4FJNA 4M3YA 3SQ0A 4RNGA 1FZ7E 3QEXA 4DTUA 4DTNA 4J2BA 2E32A
chains in the Genus database with same CATH topology
1FZHE 3E4WA 4FVMA 1P22A 3L2OB 2P5OA 4DTJA 3L0MA 2B8IA 4M42A 2H4TA 2JHAA 3SUNA 4FK0A 3K2OA 1FZ6E 3N1BA 5IREA 1NEXB 2P1MB 2B1EA 4DTPA 2OZSA 4J2EA 4FJ8A 5IZ7A 4B08A 3HP9A 3QETA 4JS4A 3QNNA 2P1PB 4KHQA 3SUOA 3TJYA 4FJHA 1XVBE 1FYZE 1Q9YA 3S9HA 2MMBA 1FZ3E 2P1QB 3TAFA 4HCBA 4KI6A 4KHWA 3QERA 3SUPA 1MHYG 2FYOA 3LD8A 3QEVA 4KHYA 4X5MA 4I9QA 4FJLA 3SQ2A 4FJMA 1FZ2E 3RMCA 1XMGE 1CLQA 1XMFE 4DU3A 2OYQA 4FJ9A 1WAFA 4FJ5A 3C95A 4M3TA 2JHCA 3CFOA 3L8BA 1WAJA 4DTOA 2DY4A 1FZIE 3WSOA 4EYWA 2P5GA 3L1NA 3NDKA 4JRQA 3QESA 2DEBA 2OVPB 2HD0A 2JPNA 4M45A 4EPHA 3NGIA 3V7DB 3RMBA 4HCCA 3SPYA 4J2DA 4KI4A 3HL8A 1FZ4E 2E31A 3RMDA 4FK2A 4J2AA 3C6PB 3OGLB 4RG8A 3J27A 2PFVA 4DTMA 4FJGA 3SQ1A 4KHUA 1XMHE 3KD5E 3TABA 4I9LA 2P1NB 4QNDA 1Q9XA 2OZMA 4M3WA 4FK4A 3TL8B 1IH7A 1FS1A 1MHZG 1XVDE 3HGLA 4FJIA 2P1OB 4AKIA 2OVQB 3CFPA 3E4YA 3QEPA 1FZ1E 3SPZA 2OVRB 2B7MA 3QEIA 1XL3C 3CFRA 4ADOA 3SQ4A 4AKGA 3LDSA 2RCUA 3N1EA 4M41A 4M3ZA 3KD1E 4JRPA 3UIQA 1MMOG 2MZWB 4E4BA 4M3XA 2FW3A 4GAMC 3NAEA 1IG9A 2QXFA 2JHPA 3SVIA 3NHGA 5H37A 3SUQA 4KHNA 4QNCA 2PFTA 1XU5E 1MTYG 3LDBA 4AI6A 3LZIA 3TAEA 4EP9A 3CQ8A 1FXXA 4FJJA 3OGKB 2JH9A 4JS5A 2DTUA 3MKSB 3RWUA 4FJ7A 4AKHA 3C6OB 3SNNA 4ADNA 4I6JB 1LDKE 3NE6A 3LZJA 4E3SA 4KHSA 3OGMB 4FJXA 3SCXA 4M3RA 1XU3E 3SI6A 4DU4A 2LF3A 1FZ9E 2JH8A 2LF6A 3TAGA 4DTRA 3RMAA 1FZ0E 3C94A 3NCIA 4DTXA 4X5NA 3C6NB 3J2PA 2VIXA 1XVFE 1FZ5E 2ATQA 1FZ8E 4RL5A 5IBKB 3SJJA 1XVCE 1XVEE 4M3UA 2YB5A 4DU1A 4DTSA 3QNOA 1XVGE 2VJ4A 2VJ5A 3QEWA 4FJKA 3HGKE 4FJNA 4M3YA 3SQ0A 4RNGA 1FZ7E 3QEXA 4DTUA 4DTNA 4J2BA 2E32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZH E;  1XMG E;  1MHZ G;  1XMF E;  1XVD E;  1FZ1 E;  1XU3 E;  1FZ9 E;  1FZ6 E;  1FZI E;  1FZ0 E;  1MMO G;  1XVB E;  1FYZ E;  4GAM C;  1XVF E;  1FZ4 E;  1FZ5 E;  1FZ8 E;  1FZ3 E;  1XVC E;  1XVE E;  1XU5 E;  1MTY G;  1MHY G;  1XVG E;  1XMH E;  1FZ7 E;  1FZ2 E; 
#chains in the Genus database with same CATH topology
 1FZH E;  3E4W A;  4FVM A;  1P22 A;  4IT5 A;  3L2O B;  2P5O A;  4DTJ A;  3L0M A;  2B8I A;  4M42 A;  2H4T A;  2JHA A;  3SUN A;  4FK0 A;  2MW2 A;  3K2O A;  1FZ6 E;  3N1B A;  5IRE A;  1NEX B;  2P1M B;  2B1E A;  4DTP A;  2OZS A;  4J2E A;  4FJ8 A;  5IZ7 A;  4B08 A;  3HP9 A;  3QET A;  4JS4 A;  3QNN A;  2P1P B;  4KHQ A;  3SUO A;  3TJY A;  4FJH A;  1XVB E;  1FYZ E;  1Q9Y A;  3S9H A;  2MMB A;  1FZ3 E;  2P1Q B;  3TAF A;  4HCB A;  4KI6 A;  4KHW A;  3QER A;  3SUP A;  1MHY G;  2FYO A;  3LD8 A;  3QEV A;  4KHY A;  4X5M A;  4I9Q A;  4FJL A;  3SQ2 A;  4FJM A;  1FZ2 E;  3RMC A;  1XMG E;  1CLQ A;  1XMF E;  4DU3 A;  2OYQ A;  4FJ9 A;  1WAF A;  4FJ5 A;  3C95 A;  4M3T A;  2JHC A;  3CFO A;  3L8B A;  3UO3 A;  1WAJ A;  3BVO A;  4DTO A;  2DY4 A;  1FZI E;  3WSO A;  4EYW A;  2P5G A;  3L1N A;  3NDK A;  4JRQ A;  3QES A;  2DEB A;  2OVP B;  2HD0 A;  2JPN A;  4M45 A;  4EPH A;  3NGI A;  3V7D B;  3RMB A;  4HCC A;  3SPY A;  4J2D A;  4KI4 A;  3HL8 A;  1FZ4 E;  2E31 A;  3RMD A;  4FK2 A;  4J2A A;  1FPO A;  3C6P B;  3OGL B;  4RG8 A;  3J27 A;  2PFV A;  4DTM A;  4FJG A;  1N1C A;  3SQ1 A;  4KHU A;  1XMH E;  3KD5 E;  3TAB A;  4I9L A;  2P1N B;  4QND A;  1Q9X A;  2OZM A;  4M3W A;  4FK4 A;  3TL8 B;  1IH7 A;  1FS1 A;  1MHZ G;  1XVD E;  3HGL A;  4FJI A;  2P1O B;  4AKI A;  2OVQ B;  3CFP A;  3E4Y A;  3QEP A;  1FZ1 E;  3SPZ A;  2OVR B;  2B7M A;  3QEI A;  1XL3 C;  3CFR A;  4ADO A;  3SQ4 A;  4AKG A;  3LDS A;  2RCU A;  3N1E A;  4M41 A;  4M3Z A;  3UO2 A;  3KD1 E;  4JRP A;  3UIQ A;  1MMO G;  2MZW B;  4E4B A;  4M3X A;  2FW3 A;  4GAM C;  3NAE A;  2RKH A;  1IG9 A;  2QXF A;  2JHP A;  4ICG C;  3SVI A;  5H37 A;  3NHG A;  3SUQ A;  4KHN A;  4QNC A;  2PFT A;  1XU5 E;  1MTY G;  3LDB A;  4AI6 A;  3LZI A;  3TAE A;  4EP9 A;  3CQ8 A;  1FXX A;  4FJJ A;  3OGK B;  2JH9 A;  2K5S A;  4JS5 A;  2DTU A;  3MKS B;  3RWU A;  4FJ7 A;  4AKH A;  3C6O B;  3SNN A;  4ADN A;  4I6J B;  1LDK E;  3NE6 A;  3LZJ A;  4E3S A;  4KHS A;  3OGM B;  4FJX A;  1JW2 A;  3SCX A;  4M3R A;  1XU3 E;  2JQT A;  3SI6 A;  4DU4 A;  2LF3 A;  1FZ9 E;  2JH8 A;  2LF6 A;  3TAG A;  4DTR A;  3RMA A;  1FZ0 E;  3C94 A;  3NCI A;  4DTX A;  4X5N A;  3C6N B;  3J2P A;  2VIX A;  1XVF E;  1FZ5 E;  2ATQ A;  1FZ8 E;  4RL5 A;  5IBK B;  3SJJ A;  1XVC E;  1XVE E;  4M3U A;  2YB5 A;  4DU1 A;  4DTS A;  3QNO A;  1XVG E;  2VJ4 A;  2VJ5 A;  3QEW A;  4FJK A;  3HGK E;  4FJN A;  4M3Y A;  3SQ0 A;  4RNG A;  1FZ7 E;  3QEX A;  4DTU A;  4DTN A;  4J2B A;  2E32 A; 
#chains in the Genus database with same CATH homology
 1FZH E;  3E4W A;  4FVM A;  1P22 A;  3L2O B;  2P5O A;  4DTJ A;  3L0M A;  2B8I A;  4M42 A;  2H4T A;  2JHA A;  3SUN A;  4FK0 A;  3K2O A;  1FZ6 E;  3N1B A;  5IRE A;  1NEX B;  2P1M B;  2B1E A;  4DTP A;  2OZS A;  4J2E A;  4FJ8 A;  5IZ7 A;  4B08 A;  3HP9 A;  3QET A;  4JS4 A;  3QNN A;  2P1P B;  4KHQ A;  3SUO A;  3TJY A;  4FJH A;  1XVB E;  1FYZ E;  1Q9Y A;  3S9H A;  2MMB A;  1FZ3 E;  2P1Q B;  3TAF A;  4HCB A;  4KI6 A;  4KHW A;  3QER A;  3SUP A;  1MHY G;  2FYO A;  3LD8 A;  3QEV A;  4KHY A;  4X5M A;  4I9Q A;  4FJL A;  3SQ2 A;  4FJM A;  1FZ2 E;  3RMC A;  1XMG E;  1CLQ A;  1XMF E;  4DU3 A;  2OYQ A;  4FJ9 A;  1WAF A;  4FJ5 A;  3C95 A;  4M3T A;  2JHC A;  3CFO A;  3L8B A;  1WAJ A;  4DTO A;  2DY4 A;  1FZI E;  3WSO A;  4EYW A;  2P5G A;  3L1N A;  3NDK A;  4JRQ A;  3QES A;  2DEB A;  2OVP B;  2HD0 A;  2JPN A;  4M45 A;  4EPH A;  3NGI A;  3V7D B;  3RMB A;  4HCC A;  3SPY A;  4J2D A;  4KI4 A;  3HL8 A;  1FZ4 E;  2E31 A;  3RMD A;  4FK2 A;  4J2A A;  3C6P B;  3OGL B;  4RG8 A;  3J27 A;  2PFV A;  4DTM A;  4FJG A;  3SQ1 A;  4KHU A;  1XMH E;  3KD5 E;  3TAB A;  4I9L A;  2P1N B;  4QND A;  1Q9X A;  2OZM A;  4M3W A;  4FK4 A;  3TL8 B;  1IH7 A;  1FS1 A;  1MHZ G;  1XVD E;  3HGL A;  4FJI A;  2P1O B;  4AKI A;  2OVQ B;  3CFP A;  3E4Y A;  3QEP A;  1FZ1 E;  3SPZ A;  2OVR B;  2B7M A;  3QEI A;  1XL3 C;  3CFR A;  4ADO A;  3SQ4 A;  4AKG A;  3LDS A;  2RCU A;  3N1E A;  4M41 A;  4M3Z A;  3KD1 E;  4JRP A;  3UIQ A;  1MMO G;  2MZW B;  4E4B A;  4M3X A;  2FW3 A;  4GAM C;  3NAE A;  1IG9 A;  2QXF A;  2JHP A;  3SVI A;  3NHG A;  5H37 A;  3SUQ A;  4KHN A;  4QNC A;  2PFT A;  1XU5 E;  1MTY G;  3LDB A;  4AI6 A;  3LZI A;  3TAE A;  4EP9 A;  3CQ8 A;  1FXX A;  4FJJ A;  3OGK B;  2JH9 A;  4JS5 A;  2DTU A;  3MKS B;  3RWU A;  4FJ7 A;  4AKH A;  3C6O B;  3SNN A;  4ADN A;  4I6J B;  1LDK E;  3NE6 A;  3LZJ A;  4E3S A;  4KHS A;  3OGM B;  4FJX A;  3SCX A;  4M3R A;  1XU3 E;  3SI6 A;  4DU4 A;  2LF3 A;  1FZ9 E;  2JH8 A;  2LF6 A;  3TAG A;  4DTR A;  3RMA A;  1FZ0 E;  3C94 A;  3NCI A;  4DTX A;  4X5N A;  3C6N B;  3J2P A;  2VIX A;  1XVF E;  1FZ5 E;  2ATQ A;  1FZ8 E;  4RL5 A;  5IBK B;  3SJJ A;  1XVC E;  1XVE E;  4M3U A;  2YB5 A;  4DU1 A;  4DTS A;  3QNO A;  1XVG E;  2VJ4 A;  2VJ5 A;  3QEW A;  4FJK A;  3HGK E;  4FJN A;  4M3Y A;  3SQ0 A;  4RNG A;  1FZ7 E;  3QEX A;  4DTU A;  4DTN A;  4J2B A;  2E32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...