1FZ2E

Methane monooxygenase hydroxylase, form ii mixed-valent generated by crystal soaking
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz2E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz2E02
1XMHE 1MHZG 1XMFE 4GAMC 1FZ1E 1MTYG 1XVGE 1FZIE 1FZ5E 1XVFE 1FYZE 1FZ7E 1XVCE 1XVEE 1XVBE 1MHYG 1FZHE 1XU3E 1XVDE 1FZ3E 1FZ8E 1FZ4E 1FZ9E 1XU5E 1MMOG 1FZ0E 1XMGE 1FZ2E 1FZ6E
chains in the Genus database with same CATH superfamily
4JRQA 4I6JB 4DTUA 3N1EA 4FVMA 4GAMC 4RNGA 3SPZA 4AKGA 1XL3C 2FW3A 3LDBA 3RMBA 1MTYG 4J2DA 2E31A 4JS5A 1XVFE 2PFTA 3QERA 3TABA 4FJKA 4FJGA 1LDKE 3QEXA 4DTOA 3C6PB 3C6NB 2DEBA 4M41A 4DTSA 3NGIA 2LF3A 2P5GA 2DTUA 3L1NA 4ADNA 2JH9A 4M42A 4FJ5A 3TAFA 1FZ3E 4M3YA 3QETA 4KHYA 2JHCA 3N1BA 4EYWA 3L2OB 3NE6A 3SUOA 3RWUA 1FZ0E 4M3UA 2ATQA 4RG8A 4M3TA 4ADOA 4EPHA 3KD5E 3HGLA 2DY4A 1N1CA 3S9HA 2OZMA 4J2BA 2P1MB 5IZ7A 4FJMA 1XMFE 4X5MA 3OGLB 4QNCA 4FK2A 3HP9A 3KD1E 3J27A 3SQ0A 3SNNA 4I9LA 2JHAA 2MW2A 3SCXA 1FYZE 4X5NA 2OZSA 4KI4A 4RL5A 2K5SA 3QEPA 2FYOA 4DTRA 3HGKE 3SVIA 3SJJA 1Q9YA 1XVEE 1WAJA 3K2OA 2JHPA 2P1NB 3C94A 2HD0A 1XU3E 4ICGC 4KHUA 3SI6A 3BVOA 2P5OA 2JQTA 3WSOA 1Q9XA 3TJYA 1FS1A 2OVPB 5IBKB 4AKIA 2JPNA 1XMGE 2VJ4A 2B1EA 1FZ2E 3CFRA 4HCCA 2B8IA 4KI6A 1XMHE 4KHWA 4M45A 4DTMA 4EP9A 2RCUA 3SUNA 2MMBA 4HCBA 4KHSA 4DTXA 4M3WA 3J2PA 1XVGE 1FZIE 4FJLA 3L8BA 4AI6A 4DU4A 1WAFA 2P1OB 3QEIA 3NCIA 4J2EA 4M3XA 1XVBE 4KHQA 3OGMB 2VIXA 4FJXA 4I9QA 3TL8B 1IG9A 3SQ4A 1JW2A 1MHYG 2JH8A 3L0MA 2YB5A 2P1PB 1XVDE 4FJJA 3C95A 2LF6A 4E4BA 2PFVA 3UIQA 3CFPA 3E4WA 4E3SA 2B7MA 1FZ9E 3OGKB 3SQ2A 4FK0A 3QEVA 1FPOA 1MMOG 2OYQA 3SUQA 3C6OB 5H37A 4M3ZA 5IREA 1XVCE 1FZHE 1IH7A 2E32A 2QXFA 1FZ6E 3CQ8A 4FJ7A 2VJ5A 1MHZG 3V7DB 1FXXA 3SQ1A 4J2AA 4JS4A 4FJ9A 2RKHA 1FZ1E 4DTJA 1FZ5E 4B08A 3RMDA 3CFOA 4JRPA 3RMCA 3NDKA 4FJ8A 3QESA 3HL8A 4FJIA 3NAEA 4DTPA 4DU3A 4FK4A 2H4TA 3TAGA 2P1QB 3UO3A 4QNDA 4AKHA 4DTNA 3SUPA 2OVQB 2OVRB 1CLQA 3LZJA 3QNNA 3QEWA 4FJHA 1FZ8E 1FZ4E 3MKSB 3LDSA 4DU1A 3QNOA 3E4YA 3LD8A 1XU5E 3NHGA 3LZIA 3UO2A 4KHNA 1NEXB 4M3RA 1P22A 3TAEA 3RMAA 4FJNA 3SPYA 1FZ7E 2MZWB 4IT5A
chains in the Genus database with same CATH topology
4JRQA 4I6JB 4DTUA 3N1EA 4FVMA 4GAMC 4RNGA 3SPZA 4AKGA 1XL3C 2FW3A 3LDBA 3RMBA 1MTYG 4J2DA 2E31A 4JS5A 1XVFE 2PFTA 3QERA 3TABA 4FJKA 4FJGA 1LDKE 3QEXA 4DTOA 3C6PB 3C6NB 2DEBA 4M41A 4DTSA 3NGIA 2LF3A 2P5GA 2DTUA 3L1NA 4ADNA 2JH9A 4M42A 4FJ5A 3TAFA 1FZ3E 4M3YA 3QETA 4KHYA 2JHCA 3N1BA 4EYWA 3L2OB 3NE6A 3SUOA 3RWUA 1FZ0E 4M3UA 2ATQA 4RG8A 4M3TA 4ADOA 4EPHA 3KD5E 3HGLA 2DY4A 3S9HA 2OZMA 4J2BA 2P1MB 5IZ7A 4FJMA 1XMFE 4X5MA 3OGLB 4QNCA 4FK2A 3HP9A 3KD1E 3J27A 3SQ0A 3SNNA 4I9LA 2JHAA 3SCXA 1FYZE 4X5NA 2OZSA 4KI4A 4RL5A 3SJJA 3QEPA 2FYOA 4DTRA 3HGKE 3SVIA 1Q9YA 1XVEE 1WAJA 3K2OA 2JHPA 2P1NB 3C94A 2HD0A 1XU3E 4KHUA 3SI6A 2P5OA 3WSOA 1Q9XA 3TJYA 1FS1A 2OVPB 5IBKB 4AKIA 2JPNA 1XMGE 2VJ4A 2B1EA 1FZ2E 3CFRA 4HCCA 2B8IA 4KI6A 1XMHE 4KHWA 4M45A 4DTMA 4EP9A 2RCUA 3SUNA 2MMBA 4HCBA 4KHSA 4DTXA 4M3WA 3J2PA 1XVGE 1FZIE 4FJLA 3L8BA 4AI6A 4DU4A 1WAFA 2P1OB 3QEIA 3NCIA 4J2EA 4M3XA 1XVBE 4KHQA 3OGMB 2VIXA 4FJXA 4I9QA 3TL8B 1IG9A 3SQ4A 1MHYG 2JH8A 3L0MA 2YB5A 2P1PB 1XVDE 4FJJA 3C95A 2LF6A 4E4BA 2PFVA 3UIQA 3CFPA 3E4WA 4E3SA 2B7MA 1FZ9E 3OGKB 3SQ2A 4FK0A 3QEVA 1MMOG 2OYQA 3SUQA 3C6OB 5H37A 4M3ZA 5IREA 1XVCE 1FZHE 1IH7A 2QXFA 1FZ6E 2E32A 3CQ8A 4FJ7A 2VJ5A 1MHZG 3V7DB 1FXXA 3SQ1A 4J2AA 4JS4A 4FJ9A 1FZ1E 4DTJA 1FZ5E 4B08A 3RMDA 3CFOA 4JRPA 3RMCA 3NDKA 4FJ8A 3QESA 3HL8A 4FJIA 3NAEA 4DTPA 4DU3A 4FK4A 2H4TA 3TAGA 2P1QB 4QNDA 4AKHA 4DTNA 3SUPA 2OVQB 2OVRB 1CLQA 3LZJA 3QNNA 3QEWA 4FJHA 1FZ8E 1FZ4E 3MKSB 3LDSA 4DU1A 3QNOA 3E4YA 3LD8A 1XU5E 3NHGA 3LZIA 4KHNA 1NEXB 4M3RA 1P22A 3TAEA 3RMAA 4FJNA 3SPYA 1FZ7E 2MZWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMH E;  1MHZ G;  1XMF E;  4GAM C;  1FZ1 E;  1MTY G;  1XVG E;  1FZI E;  1FZ5 E;  1XVF E;  1FYZ E;  1FZ7 E;  1XVC E;  1XVE E;  1XVB E;  1MHY G;  1FZH E;  1XU3 E;  1XVD E;  1FZ3 E;  1FZ8 E;  1FZ4 E;  1FZ9 E;  1XU5 E;  1MMO G;  1FZ0 E;  1XMG E;  1FZ2 E;  1FZ6 E; 
#chains in the Genus database with same CATH topology
 4JRQ A;  4I6J B;  4DTU A;  3N1E A;  4FVM A;  4GAM C;  4RNG A;  3SPZ A;  4AKG A;  1XL3 C;  2FW3 A;  3LDB A;  3RMB A;  1MTY G;  4J2D A;  2E31 A;  4JS5 A;  1XVF E;  2PFT A;  3QER A;  3TAB A;  4FJK A;  4FJG A;  1LDK E;  3QEX A;  4DTO A;  3C6P B;  3C6N B;  2DEB A;  4M41 A;  4DTS A;  3NGI A;  2LF3 A;  2P5G A;  2DTU A;  3L1N A;  4ADN A;  2JH9 A;  4M42 A;  4FJ5 A;  3TAF A;  1FZ3 E;  4M3Y A;  3QET A;  4KHY A;  2JHC A;  3N1B A;  4EYW A;  3L2O B;  3NE6 A;  3SUO A;  3RWU A;  1FZ0 E;  4M3U A;  2ATQ A;  4RG8 A;  4M3T A;  4ADO A;  4EPH A;  3KD5 E;  3HGL A;  2DY4 A;  1N1C A;  3S9H A;  2OZM A;  4J2B A;  2P1M B;  5IZ7 A;  4FJM A;  1XMF E;  4X5M A;  3OGL B;  4QNC A;  4FK2 A;  3HP9 A;  3KD1 E;  3J27 A;  3SQ0 A;  3SNN A;  4I9L A;  2JHA A;  2MW2 A;  3SCX A;  1FYZ E;  4X5N A;  2OZS A;  4KI4 A;  4RL5 A;  2K5S A;  3QEP A;  2FYO A;  4DTR A;  3HGK E;  3SVI A;  3SJJ A;  1Q9Y A;  1XVE E;  1WAJ A;  3K2O A;  2JHP A;  2P1N B;  3C94 A;  2HD0 A;  1XU3 E;  4ICG C;  4KHU A;  3SI6 A;  3BVO A;  2P5O A;  2JQT A;  3WSO A;  1Q9X A;  3TJY A;  1FS1 A;  2OVP B;  5IBK B;  4AKI A;  2JPN A;  1XMG E;  2VJ4 A;  2B1E A;  1FZ2 E;  3CFR A;  4HCC A;  2B8I A;  4KI6 A;  1XMH E;  4KHW A;  4M45 A;  4DTM A;  4EP9 A;  2RCU A;  3SUN A;  2MMB A;  4HCB A;  4KHS A;  4DTX A;  4M3W A;  3J2P A;  1XVG E;  1FZI E;  4FJL A;  3L8B A;  4AI6 A;  4DU4 A;  1WAF A;  2P1O B;  3QEI A;  3NCI A;  4J2E A;  4M3X A;  1XVB E;  4KHQ A;  3OGM B;  2VIX A;  4FJX A;  4I9Q A;  3TL8 B;  1IG9 A;  3SQ4 A;  1JW2 A;  1MHY G;  2JH8 A;  3L0M A;  2YB5 A;  2P1P B;  1XVD E;  4FJJ A;  3C95 A;  2LF6 A;  4E4B A;  2PFV A;  3UIQ A;  3CFP A;  3E4W A;  4E3S A;  2B7M A;  1FZ9 E;  3OGK B;  3SQ2 A;  4FK0 A;  3QEV A;  1FPO A;  1MMO G;  2OYQ A;  3SUQ A;  3C6O B;  5H37 A;  4M3Z A;  5IRE A;  1XVC E;  1FZH E;  1IH7 A;  2E32 A;  2QXF A;  1FZ6 E;  3CQ8 A;  4FJ7 A;  2VJ5 A;  1MHZ G;  3V7D B;  1FXX A;  3SQ1 A;  4J2A A;  4JS4 A;  4FJ9 A;  2RKH A;  1FZ1 E;  4DTJ A;  1FZ5 E;  4B08 A;  3RMD A;  3CFO A;  4JRP A;  3RMC A;  3NDK A;  4FJ8 A;  3QES A;  3HL8 A;  4FJI A;  3NAE A;  4DTP A;  4DU3 A;  4FK4 A;  2H4T A;  3TAG A;  2P1Q B;  3UO3 A;  4QND A;  4AKH A;  4DTN A;  3SUP A;  2OVQ B;  2OVR B;  1CLQ A;  3LZJ A;  3QNN A;  3QEW A;  4FJH A;  1FZ8 E;  1FZ4 E;  3MKS B;  3LDS A;  4DU1 A;  3QNO A;  3E4Y A;  3LD8 A;  1XU5 E;  3NHG A;  3LZI A;  3UO2 A;  4KHN A;  1NEX B;  4M3R A;  1P22 A;  3TAE A;  3RMA A;  4FJN A;  3SPY A;  1FZ7 E;  2MZW B;  4IT5 A; 
#chains in the Genus database with same CATH homology
 4JRQ A;  4I6J B;  4DTU A;  3N1E A;  4FVM A;  4GAM C;  4RNG A;  3SPZ A;  4AKG A;  1XL3 C;  2FW3 A;  3LDB A;  3RMB A;  1MTY G;  4J2D A;  2E31 A;  4JS5 A;  1XVF E;  2PFT A;  3QER A;  3TAB A;  4FJK A;  4FJG A;  1LDK E;  3QEX A;  4DTO A;  3C6P B;  3C6N B;  2DEB A;  4M41 A;  4DTS A;  3NGI A;  2LF3 A;  2P5G A;  2DTU A;  3L1N A;  4ADN A;  2JH9 A;  4M42 A;  4FJ5 A;  3TAF A;  1FZ3 E;  4M3Y A;  3QET A;  4KHY A;  2JHC A;  3N1B A;  4EYW A;  3L2O B;  3NE6 A;  3SUO A;  3RWU A;  1FZ0 E;  4M3U A;  2ATQ A;  4RG8 A;  4M3T A;  4ADO A;  4EPH A;  3KD5 E;  3HGL A;  2DY4 A;  3S9H A;  2OZM A;  4J2B A;  2P1M B;  5IZ7 A;  4FJM A;  1XMF E;  4X5M A;  3OGL B;  4QNC A;  4FK2 A;  3HP9 A;  3KD1 E;  3J27 A;  3SQ0 A;  3SNN A;  4I9L A;  2JHA A;  3SCX A;  1FYZ E;  4X5N A;  2OZS A;  4KI4 A;  4RL5 A;  3SJJ A;  3QEP A;  2FYO A;  4DTR A;  3HGK E;  3SVI A;  1Q9Y A;  1XVE E;  1WAJ A;  3K2O A;  2JHP A;  2P1N B;  3C94 A;  2HD0 A;  1XU3 E;  4KHU A;  3SI6 A;  2P5O A;  3WSO A;  1Q9X A;  3TJY A;  1FS1 A;  2OVP B;  5IBK B;  4AKI A;  2JPN A;  1XMG E;  2VJ4 A;  2B1E A;  1FZ2 E;  3CFR A;  4HCC A;  2B8I A;  4KI6 A;  1XMH E;  4KHW A;  4M45 A;  4DTM A;  4EP9 A;  2RCU A;  3SUN A;  2MMB A;  4HCB A;  4KHS A;  4DTX A;  4M3W A;  3J2P A;  1XVG E;  1FZI E;  4FJL A;  3L8B A;  4AI6 A;  4DU4 A;  1WAF A;  2P1O B;  3QEI A;  3NCI A;  4J2E A;  4M3X A;  1XVB E;  4KHQ A;  3OGM B;  2VIX A;  4FJX A;  4I9Q A;  3TL8 B;  1IG9 A;  3SQ4 A;  1MHY G;  2JH8 A;  3L0M A;  2YB5 A;  2P1P B;  1XVD E;  4FJJ A;  3C95 A;  2LF6 A;  4E4B A;  2PFV A;  3UIQ A;  3CFP A;  3E4W A;  4E3S A;  2B7M A;  1FZ9 E;  3OGK B;  3SQ2 A;  4FK0 A;  3QEV A;  1MMO G;  2OYQ A;  3SUQ A;  3C6O B;  5H37 A;  4M3Z A;  5IRE A;  1XVC E;  1FZH E;  1IH7 A;  2QXF A;  1FZ6 E;  2E32 A;  3CQ8 A;  4FJ7 A;  2VJ5 A;  1MHZ G;  3V7D B;  1FXX A;  3SQ1 A;  4J2A A;  4JS4 A;  4FJ9 A;  1FZ1 E;  4DTJ A;  1FZ5 E;  4B08 A;  3RMD A;  3CFO A;  4JRP A;  3RMC A;  3NDK A;  4FJ8 A;  3QES A;  3HL8 A;  4FJI A;  3NAE A;  4DTP A;  4DU3 A;  4FK4 A;  2H4T A;  3TAG A;  2P1Q B;  4QND A;  4AKH A;  4DTN A;  3SUP A;  2OVQ B;  2OVR B;  1CLQ A;  3LZJ A;  3QNN A;  3QEW A;  4FJH A;  1FZ8 E;  1FZ4 E;  3MKS B;  3LDS A;  4DU1 A;  3QNO A;  3E4Y A;  3LD8 A;  1XU5 E;  3NHG A;  3LZI A;  4KHN A;  1NEX B;  4M3R A;  1P22 A;  3TAE A;  3RMA A;  4FJN A;  3SPY A;  1FZ7 E;  2MZW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...