1FZ7E

Methane monooxygenase hydroxylase, form iii soaked in 0.9 m ethanol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title X-ray crystal structure of alcohol products bound at the active site of soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
total genus 63
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz7E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz7E02
1FZ4E 4GAMC 1FZ6E 1XMHE 1FZ0E 1MTYG 1FYZE 1XU3E 1XVBE 1FZ2E 1XMFE 1XVGE 1FZ1E 1XMGE 1FZ5E 1XVFE 1FZ9E 1MHYG 1FZ3E 1FZIE 1MMOG 1FZ8E 1XVEE 1FZ7E 1XVDE 1XVCE 1FZHE 1MHZG 1XU5E
chains in the Genus database with same CATH superfamily
3L1NA 1NEXB 2JQTA 4FJ8A 4JS4A 2E31A 4DTRA 4JRQA 3L8BA 2YB5A 2MZWB 4M3TA 3E4YA 3NCIA 4J2EA 4M3WA 1LDKE 2RKHA 3TAGA 3RMBA 4RG8A 2OYQA 4AKIA 1FYZE 2FW3A 4EPHA 1XU3E 3UO3A 2DY4A 3RWUA 3C6PB 1FZ2E 1XMFE 2HD0A 2VJ5A 3HP9A 2OVRB 3OGKB 2VIXA 4DTSA 3SUQA 1XMGE 3L2OB 1FXXA 3N1BA 4RL5A 2VJ4A 3HGKE 4FJKA 4M41A 4EYWA 3TJYA 1Q9YA 4DTNA 1XL3C 1MHYG 2PFVA 4KHWA 3OGMB 2JH8A 2LF3A 3QNOA 4HCBA 3SJJA 1XVDE 4FK0A 3LZJA 2FYOA 4JS5A 2H4TA 3C95A 3QEIA 2P5GA 4J2BA 4DTXA 2DEBA 4FJLA 4DTUA 2B7MA 1FS1A 2OZSA 4M3ZA 1P22A 3LDSA 2PFTA 3V7DB 4DU1A 2P1PB 4M3RA 3NGIA 1FZ4E 3SI6A 1FZ6E 1WAJA 3C6OB 3SPYA 4FJJA 3LDBA 5IREA 3SQ4A 4KI4A 3J27A 2P1OB 2QXFA 3QEWA 3SQ2A 3QEPA 3NDKA 4ADNA 1FZ1E 1FPOA 4I9LA 1WAFA 3QEXA 1IG9A 1FZ5E 4M3XA 3S9HA 2ATQA 3QESA 1XVFE 3CQ8A 3SQ1A 3SPZA 1FZIE 2JHPA 1MMOG 2RCUA 3HGLA 3J2PA 3TL8B 5IBKB 2LF6A 3SUNA 4E3SA 4DU4A 4DU3A 1MHZG 3HL8A 3RMCA 4ICGC 4B08A 3BVOA 3LZIA 3QNNA 4AKGA 1IH7A 4GAMC 2B8IA 1XMHE 4QNCA 3QERA 3QETA 3CFOA 4DTMA 4KHUA 3TABA 3SUOA 1XVBE 3WSOA 2DTUA 4FJGA 3MKSB 4FVMA 4E4BA 3CFRA 4I9QA 2P1MB 2P1QB 4AI6A 3NE6A 4FJMA 3C6NB 4M3UA 4FJXA 4EP9A 4FJIA 4FK2A 1JW2A 4KI6A 2P5OA 4RNGA 1FZ3E 4M42A 2OVPB 3UIQA 4J2DA 3RMDA 1FZ7E 4DTOA 4M3YA 2MMBA 4JRPA 4FJ7A 2B1EA 2JHAA 1XU5E 4I6JB 4ADOA 4DTPA 4FJHA 4FK4A 3QEVA 2JH9A 2E32A 3OGLB 2K5SA 3TAEA 4IT5A 5H37A 1Q9XA 2JHCA 3SVIA 1FZ0E 4KHSA 1MTYG 4KHQA 4HCCA 3NHGA 4QNDA 3C94A 2OVQB 3SNNA 1XVGE 3L0MA 3TAFA 2MW2A 3SCXA 3KD1E 4KHYA 3N1EA 4FJ9A 4FJ5A 4J2AA 3NAEA 1N1CA 3RMAA 4X5NA 3KD5E 4KHNA 1FZ9E 2OZMA 2JPNA 3SQ0A 4DTJA 4M45A 2P1NB 1FZ8E 1XVEE 3E4WA 4X5MA 1CLQA 3CFPA 1XVCE 3LD8A 3UO2A 3SUPA 3K2OA 1FZHE 5IZ7A 4FJNA 4AKHA
chains in the Genus database with same CATH topology
3L1NA 1NEXB 4FJ8A 4JS4A 2E31A 4DTRA 4JRQA 3L8BA 2YB5A 2MZWB 4M3TA 3E4YA 3NCIA 4J2EA 4M3WA 1LDKE 3RMBA 3TAGA 4RG8A 2OYQA 4AKIA 1FYZE 2FW3A 4EPHA 1XU3E 2DY4A 3RWUA 3C6PB 1FZ2E 1XMFE 2HD0A 2VJ5A 3HP9A 2OVRB 3OGKB 2VIXA 4DTSA 3SUQA 1XMGE 3L2OB 1FXXA 3N1BA 4RL5A 2VJ4A 3HGKE 4FJKA 4M41A 4EYWA 3TJYA 1Q9YA 4DTNA 1XL3C 1MHYG 2PFVA 4KHWA 3OGMB 2JH8A 2LF3A 3QNOA 4HCBA 3SJJA 1XVDE 4FK0A 3LZJA 2FYOA 4JS5A 3C95A 2H4TA 3QEIA 2P5GA 4J2BA 4DTXA 2DEBA 4FJLA 4DTUA 2B7MA 1FS1A 2OZSA 4M3ZA 1P22A 3LDSA 2PFTA 3V7DB 4DU1A 2P1PB 4M3RA 3NGIA 1FZ4E 3SI6A 1FZ6E 1WAJA 3C6OB 3SPYA 4FJJA 3LDBA 5IREA 3SQ4A 4KI4A 3J27A 2P1OB 2QXFA 3QEWA 3SQ2A 3QEPA 3NDKA 4ADNA 1FZ1E 4I9LA 1WAFA 3QEXA 1IG9A 1FZ5E 4M3XA 3S9HA 2ATQA 3QESA 1XVFE 3CQ8A 3SQ1A 3SPZA 1FZIE 2JHPA 1MMOG 2RCUA 3HGLA 3J2PA 3TL8B 5IBKB 2LF6A 3SUNA 4E3SA 4DU4A 4DU3A 1MHZG 3HL8A 3RMCA 4B08A 3LZIA 3QNNA 4AKGA 1IH7A 4GAMC 2B8IA 1XMHE 4QNCA 3QERA 3QETA 3CFOA 4DTMA 4KHUA 3TABA 3SUOA 1XVBE 3WSOA 2DTUA 4FJGA 3MKSB 4FVMA 4E4BA 3CFRA 4I9QA 2P1MB 2P1QB 4AI6A 3NE6A 4FJMA 3C6NB 4M3UA 4FJXA 4EP9A 4FJIA 4FK2A 4KI6A 2P5OA 4RNGA 1FZ3E 4M42A 2OVPB 3UIQA 4J2DA 3RMDA 1FZ7E 4DTOA 4M3YA 2MMBA 4JRPA 4FJ7A 2B1EA 2JHAA 1XU5E 4I6JB 4ADOA 4DTPA 4FJHA 4FK4A 3QEVA 2JH9A 2E32A 3OGLB 3TAEA 1Q9XA 5H37A 2JHCA 3SVIA 1FZ0E 4KHSA 1MTYG 4KHQA 4HCCA 3NHGA 4QNDA 3C94A 2OVQB 3SNNA 1XVGE 3L0MA 3TAFA 3KD1E 3SCXA 4KHYA 3N1EA 4FJ9A 4FJ5A 4J2AA 3NAEA 3RMAA 4X5NA 3KD5E 4KHNA 1FZ9E 2OZMA 2JPNA 3SQ0A 4DTJA 4M45A 2P1NB 1FZ8E 1XVEE 3E4WA 4X5MA 1CLQA 3CFPA 1XVCE 3LD8A 4AKHA 3SUPA 3K2OA 1FZHE 5IZ7A 4FJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ4 E;  4GAM C;  1FZ6 E;  1XMH E;  1FZ0 E;  1MTY G;  1FYZ E;  1XU3 E;  1XVB E;  1FZ2 E;  1XMF E;  1XVG E;  1FZ1 E;  1XMG E;  1FZ5 E;  1XVF E;  1FZ9 E;  1MHY G;  1FZ3 E;  1FZI E;  1MMO G;  1FZ8 E;  1XVE E;  1FZ7 E;  1XVD E;  1XVC E;  1FZH E;  1MHZ G;  1XU5 E; 
#chains in the Genus database with same CATH topology
 3L1N A;  1NEX B;  2JQT A;  4FJ8 A;  4JS4 A;  2E31 A;  4DTR A;  4JRQ A;  3L8B A;  2YB5 A;  2MZW B;  4M3T A;  3E4Y A;  3NCI A;  4J2E A;  4M3W A;  1LDK E;  2RKH A;  3TAG A;  3RMB A;  4RG8 A;  2OYQ A;  4AKI A;  1FYZ E;  2FW3 A;  4EPH A;  1XU3 E;  3UO3 A;  2DY4 A;  3RWU A;  3C6P B;  1FZ2 E;  1XMF E;  2HD0 A;  2VJ5 A;  3HP9 A;  2OVR B;  3OGK B;  2VIX A;  4DTS A;  3SUQ A;  1XMG E;  3L2O B;  1FXX A;  3N1B A;  4RL5 A;  2VJ4 A;  3HGK E;  4FJK A;  4M41 A;  4EYW A;  3TJY A;  1Q9Y A;  4DTN A;  1XL3 C;  1MHY G;  2PFV A;  4KHW A;  3OGM B;  2JH8 A;  2LF3 A;  3QNO A;  4HCB A;  3SJJ A;  1XVD E;  4FK0 A;  3LZJ A;  2FYO A;  4JS5 A;  2H4T A;  3C95 A;  3QEI A;  2P5G A;  4J2B A;  4DTX A;  2DEB A;  4FJL A;  4DTU A;  2B7M A;  1FS1 A;  2OZS A;  4M3Z A;  1P22 A;  3LDS A;  2PFT A;  3V7D B;  4DU1 A;  2P1P B;  4M3R A;  3NGI A;  1FZ4 E;  3SI6 A;  1FZ6 E;  1WAJ A;  3C6O B;  3SPY A;  4FJJ A;  3LDB A;  5IRE A;  3SQ4 A;  4KI4 A;  3J27 A;  2P1O B;  2QXF A;  3QEW A;  3SQ2 A;  3QEP A;  3NDK A;  4ADN A;  1FZ1 E;  1FPO A;  4I9L A;  1WAF A;  3QEX A;  1IG9 A;  1FZ5 E;  4M3X A;  3S9H A;  2ATQ A;  3QES A;  1XVF E;  3CQ8 A;  3SQ1 A;  3SPZ A;  1FZI E;  2JHP A;  1MMO G;  2RCU A;  3HGL A;  3J2P A;  3TL8 B;  5IBK B;  2LF6 A;  3SUN A;  4E3S A;  4DU4 A;  4DU3 A;  1MHZ G;  3HL8 A;  3RMC A;  4ICG C;  4B08 A;  3BVO A;  3LZI A;  3QNN A;  4AKG A;  1IH7 A;  4GAM C;  2B8I A;  1XMH E;  4QNC A;  3QER A;  3QET A;  3CFO A;  4DTM A;  4KHU A;  3TAB A;  3SUO A;  1XVB E;  3WSO A;  2DTU A;  4FJG A;  3MKS B;  4FVM A;  4E4B A;  3CFR A;  4I9Q A;  2P1M B;  2P1Q B;  4AI6 A;  3NE6 A;  4FJM A;  3C6N B;  4M3U A;  4FJX A;  4EP9 A;  4FJI A;  4FK2 A;  1JW2 A;  4KI6 A;  2P5O A;  4RNG A;  1FZ3 E;  4M42 A;  2OVP B;  3UIQ A;  4J2D A;  3RMD A;  1FZ7 E;  4DTO A;  4M3Y A;  2MMB A;  4JRP A;  4FJ7 A;  2B1E A;  2JHA A;  1XU5 E;  4I6J B;  4ADO A;  4DTP A;  4FJH A;  4FK4 A;  3QEV A;  2JH9 A;  2E32 A;  3OGL B;  2K5S A;  3TAE A;  4IT5 A;  5H37 A;  1Q9X A;  2JHC A;  3SVI A;  1FZ0 E;  4KHS A;  1MTY G;  4KHQ A;  4HCC A;  3NHG A;  4QND A;  3C94 A;  2OVQ B;  3SNN A;  1XVG E;  3L0M A;  3TAF A;  2MW2 A;  3SCX A;  3KD1 E;  4KHY A;  3N1E A;  4FJ9 A;  4FJ5 A;  4J2A A;  3NAE A;  1N1C A;  3RMA A;  4X5N A;  3KD5 E;  4KHN A;  1FZ9 E;  2OZM A;  2JPN A;  3SQ0 A;  4DTJ A;  4M45 A;  2P1N B;  1FZ8 E;  1XVE E;  3E4W A;  4X5M A;  1CLQ A;  3CFP A;  1XVC E;  3LD8 A;  3UO2 A;  3SUP A;  3K2O A;  1FZH E;  5IZ7 A;  4FJN A;  4AKH A; 
#chains in the Genus database with same CATH homology
 3L1N A;  1NEX B;  4FJ8 A;  4JS4 A;  2E31 A;  4DTR A;  4JRQ A;  3L8B A;  2YB5 A;  2MZW B;  4M3T A;  3E4Y A;  3NCI A;  4J2E A;  4M3W A;  1LDK E;  3RMB A;  3TAG A;  4RG8 A;  2OYQ A;  4AKI A;  1FYZ E;  2FW3 A;  4EPH A;  1XU3 E;  2DY4 A;  3RWU A;  3C6P B;  1FZ2 E;  1XMF E;  2HD0 A;  2VJ5 A;  3HP9 A;  2OVR B;  3OGK B;  2VIX A;  4DTS A;  3SUQ A;  1XMG E;  3L2O B;  1FXX A;  3N1B A;  4RL5 A;  2VJ4 A;  3HGK E;  4FJK A;  4M41 A;  4EYW A;  3TJY A;  1Q9Y A;  4DTN A;  1XL3 C;  1MHY G;  2PFV A;  4KHW A;  3OGM B;  2JH8 A;  2LF3 A;  3QNO A;  4HCB A;  3SJJ A;  1XVD E;  4FK0 A;  3LZJ A;  2FYO A;  4JS5 A;  3C95 A;  2H4T A;  3QEI A;  2P5G A;  4J2B A;  4DTX A;  2DEB A;  4FJL A;  4DTU A;  2B7M A;  1FS1 A;  2OZS A;  4M3Z A;  1P22 A;  3LDS A;  2PFT A;  3V7D B;  4DU1 A;  2P1P B;  4M3R A;  3NGI A;  1FZ4 E;  3SI6 A;  1FZ6 E;  1WAJ A;  3C6O B;  3SPY A;  4FJJ A;  3LDB A;  5IRE A;  3SQ4 A;  4KI4 A;  3J27 A;  2P1O B;  2QXF A;  3QEW A;  3SQ2 A;  3QEP A;  3NDK A;  4ADN A;  1FZ1 E;  4I9L A;  1WAF A;  3QEX A;  1IG9 A;  1FZ5 E;  4M3X A;  3S9H A;  2ATQ A;  3QES A;  1XVF E;  3CQ8 A;  3SQ1 A;  3SPZ A;  1FZI E;  2JHP A;  1MMO G;  2RCU A;  3HGL A;  3J2P A;  3TL8 B;  5IBK B;  2LF6 A;  3SUN A;  4E3S A;  4DU4 A;  4DU3 A;  1MHZ G;  3HL8 A;  3RMC A;  4B08 A;  3LZI A;  3QNN A;  4AKG A;  1IH7 A;  4GAM C;  2B8I A;  1XMH E;  4QNC A;  3QER A;  3QET A;  3CFO A;  4DTM A;  4KHU A;  3TAB A;  3SUO A;  1XVB E;  3WSO A;  2DTU A;  4FJG A;  3MKS B;  4FVM A;  4E4B A;  3CFR A;  4I9Q A;  2P1M B;  2P1Q B;  4AI6 A;  3NE6 A;  4FJM A;  3C6N B;  4M3U A;  4FJX A;  4EP9 A;  4FJI A;  4FK2 A;  4KI6 A;  2P5O A;  4RNG A;  1FZ3 E;  4M42 A;  2OVP B;  3UIQ A;  4J2D A;  3RMD A;  1FZ7 E;  4DTO A;  4M3Y A;  2MMB A;  4JRP A;  4FJ7 A;  2B1E A;  2JHA A;  1XU5 E;  4I6J B;  4ADO A;  4DTP A;  4FJH A;  4FK4 A;  3QEV A;  2JH9 A;  2E32 A;  3OGL B;  3TAE A;  1Q9X A;  5H37 A;  2JHC A;  3SVI A;  1FZ0 E;  4KHS A;  1MTY G;  4KHQ A;  4HCC A;  3NHG A;  4QND A;  3C94 A;  2OVQ B;  3SNN A;  1XVG E;  3L0M A;  3TAF A;  3KD1 E;  3SCX A;  4KHY A;  3N1E A;  4FJ9 A;  4FJ5 A;  4J2A A;  3NAE A;  3RMA A;  4X5N A;  3KD5 E;  4KHN A;  1FZ9 E;  2OZM A;  2JPN A;  3SQ0 A;  4DTJ A;  4M45 A;  2P1N B;  1FZ8 E;  1XVE E;  3E4W A;  4X5M A;  1CLQ A;  3CFP A;  1XVC E;  3LD8 A;  4AKH A;  3SUP A;  3K2O A;  1FZH E;  5IZ7 A;  4FJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...