1FZ7E

Methane monooxygenase hydroxylase, form iii soaked in 0.9 m ethanol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title X-ray crystal structure of alcohol products bound at the active site of soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz7E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz7E02
1MHYG 1XVGE 1MTYG 1XVDE 1FZ4E 1FZ6E 1XMGE 1MHZG 4GAMC 1FZ1E 1FZ3E 1FZ8E 1XU3E 1XVEE 1XMHE 1FZ9E 1FZIE 1XU5E 1XVCE 1XVFE 1FZ0E 1FZ5E 1FYZE 1XMFE 1XVBE 1MMOG 1FZHE 1FZ2E 1FZ7E
chains in the Genus database with same CATH superfamily
4FK2A 1Q9XA 3TAFA 2JQTA 3K2OA 2JH8A 3E4YA 4FJMA 1XVDE 4DTXA 4KHWA 4M3UA 2DY4A 2MZWB 4E4BA 2RKHA 4J2AA 1FZ6E 3KD1E 1XMGE 3OGLB 1IH7A 4JS4A 1XVEE 1FZ3E 1FZ8E 3LDSA 3SVIA 1XU5E 4J2EA 3C6NB 1N1CA 3CFOA 2PFVA 3QEVA 3SPZA 1XVCE 4I9QA 3LZIA 1P22A 2VJ5A 3LD8A 4KHYA 3SQ0A 4M3RA 4DU4A 2FYOA 3CFPA 4KI4A 2MMBA 3C95A 3UO2A 2H4TA 3LDBA 2E32A 3TABA 4FJNA 4AKHA 1FZHE 2DTUA 3SQ2A 2JHAA 4QNDA 3QETA 3QESA 4FJKA 2E31A 2K5SA 2MW2A 4ADNA 1MHYG 2B8IA 3CFRA 2P1OB 4FJJA 4KHNA 2JPNA 4RNGA 3C6OB 4DTPA 2ATQA 4FJLA 2LF6A 4ADOA 3SI6A 3SCXA 2P1NB 1FS1A 2P5GA 1LDKE 2JHCA 4RG8A 3QEPA 4FK0A 4JS5A 2OVQB 3SUNA 1FXXA 1NEXB 3E4WA 3QEWA 3L0MA 3HGLA 3J27A 4ICGC 3LZJA 3QNOA 1FZ0E 3SUQA 4HCCA 3SQ4A 1CLQA 3QERA 3UO3A 1FZ5E 2LF3A 2OVPB 4M3XA 1WAJA 1XL3C 4DTUA 2QXFA 3RMBA 4IT5A 4DTRA 3SPYA 2P5OA 1JW2A 3C94A 3SUPA 2OZMA 3SJJA 2OVRB 2PFTA 4KHSA 3NDKA 4FJ8A 4EYWA 4KI6A 1IG9A 4RL5A 4FJHA 4KHQA 2P1PB 3OGKB 4HCBA 4QNCA 3HGKE 1FZ4E 4DTNA 3N1BA 4DU3A 3RMDA 1FPOA 3QNNA 4FJ5A 3KD5E 2RCUA 3SQ1A 1FZIE 3OGMB 3BVOA 1XVFE 4M45A 4AKGA 4I9LA 3J2PA 2JH9A 5IREA 2VJ4A 4JRPA 2OYQA 3L1NA 3L2OB 5IBKB 3QEIA 3UIQA 4M3YA 4EP9A 3CQ8A 1XMFE 3SUOA 2HD0A 3S9HA 3RMCA 4KHUA 4J2BA 2VIXA 1FZ2E 1FZ7E 4FJIA 1Q9YA 3WSOA 2P1QB 4DTSA 3TAEA 4AI6A 3C6PB 3V7DB 4M3ZA 4AKIA 2JHPA 1XVGE 4JRQA 1MTYG 3NAEA 4DU1A 4J2DA 4FVMA 4M41A 3NHGA 2OZSA 4FJXA 1MHZG 4GAMC 3NCIA 4DTJA 1FZ1E 1XU3E 3QEXA 3SNNA 4FJ9A 1XMHE 1FZ9E 3NGIA 2YB5A 4M3WA 2FW3A 1WAFA 4DTOA 4FJGA 3HP9A 3TAGA 2DEBA 3RWUA 3TL8B 3RMAA 5IZ7A 4X5MA 1FYZE 4EPHA 2P1MB 1XVBE 3HL8A 1MMOG 3MKSB 5H37A 3TJYA 4E3SA 4M3TA 4B08A 4FK4A 4I6JB 4DTMA 2B1EA 3L8BA 4M42A 4X5NA 3NE6A 2B7MA 3N1EA 4FJ7A
chains in the Genus database with same CATH topology
4FK2A 1Q9XA 3TAFA 3K2OA 2JH8A 3E4YA 4FJMA 1XVDE 4DTXA 4KHWA 4M3UA 2DY4A 2MZWB 4E4BA 4J2AA 1FZ6E 3KD1E 1XMGE 3OGLB 1IH7A 4JS4A 1XVEE 1FZ3E 1FZ8E 3LDSA 3SVIA 1XU5E 4J2EA 3C6NB 4I9QA 3CFOA 2PFVA 3QEVA 3SPZA 1XVCE 3LZIA 1P22A 2VJ5A 3LD8A 4KHYA 3SQ0A 4M3RA 4DU4A 2FYOA 3CFPA 4KI4A 2MMBA 3C95A 2H4TA 3LDBA 2E32A 3TABA 4FJNA 4AKHA 1FZHE 2DTUA 3SQ2A 2JHAA 4QNDA 3QETA 3QESA 4FJKA 2E31A 4FJJA 4ADNA 1MHYG 2B8IA 3CFRA 2P1OB 4KHNA 2JPNA 4RNGA 3C6OB 4DTPA 2ATQA 4FJLA 2LF6A 4ADOA 3SI6A 3SCXA 2P1NB 1FS1A 2P5GA 1LDKE 2JHCA 4RG8A 3QEPA 4FK0A 4JS5A 2OVQB 3SUNA 1FXXA 1NEXB 3E4WA 3QEWA 3L0MA 3HGLA 3J27A 3LZJA 3QNOA 1FZ0E 3SUQA 4HCCA 3SQ4A 1CLQA 3QERA 1FZ5E 2LF3A 2OVPB 4M3XA 1WAJA 1XL3C 4DTUA 2QXFA 3RMBA 3SPYA 4DTRA 2P5OA 3C94A 3SUPA 2OZMA 3SJJA 2OVRB 2PFTA 4KHSA 3NDKA 4FJ8A 4EYWA 4KI6A 1IG9A 4RL5A 4FJHA 4KHQA 2P1PB 3OGKB 4HCBA 4QNCA 3HGKE 1FZ4E 4DTNA 3N1BA 4DU3A 3RMDA 3QNNA 4FJ5A 3KD5E 2RCUA 3SQ1A 1FZIE 3OGMB 4M45A 1XVFE 4AKGA 4I9LA 3J2PA 2JH9A 5IREA 2VJ4A 4JRPA 2OYQA 3L1NA 3L2OB 5IBKB 3QEIA 3UIQA 4M3YA 4EP9A 3CQ8A 1XMFE 3SUOA 2HD0A 3S9HA 3RMCA 4KHUA 4J2BA 2VIXA 1FZ2E 1FZ7E 4FJIA 1Q9YA 3WSOA 2P1QB 4DTSA 3TAEA 4AI6A 3C6PB 3V7DB 4M3ZA 4AKIA 2JHPA 1XVGE 4JRQA 1MTYG 3NAEA 4DU1A 4J2DA 4FVMA 4M41A 3NHGA 2OZSA 4FJXA 1MHZG 4GAMC 3NCIA 4DTJA 1FZ1E 1XU3E 3QEXA 3SNNA 4FJ9A 1XMHE 1FZ9E 3NGIA 2YB5A 4M3WA 2FW3A 1WAFA 4DTOA 4FJGA 3HP9A 3TAGA 2DEBA 3RWUA 3TL8B 3RMAA 5IZ7A 4X5MA 1FYZE 4EPHA 2P1MB 1XVBE 3HL8A 1MMOG 3MKSB 5H37A 3TJYA 4E3SA 4M3TA 4B08A 4FK4A 4I6JB 4DTMA 2B1EA 3L8BA 4M42A 4X5NA 3NE6A 2B7MA 3N1EA 4FJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHY G;  1XVG E;  1MTY G;  1XVD E;  1FZ4 E;  1FZ6 E;  1XMG E;  1MHZ G;  4GAM C;  1FZ1 E;  1FZ3 E;  1FZ8 E;  1XU3 E;  1XVE E;  1XMH E;  1FZ9 E;  1FZI E;  1XU5 E;  1XVC E;  1XVF E;  1FZ0 E;  1FZ5 E;  1FYZ E;  1XMF E;  1XVB E;  1MMO G;  1FZH E;  1FZ2 E;  1FZ7 E; 
#chains in the Genus database with same CATH topology
 4FK2 A;  1Q9X A;  3TAF A;  2JQT A;  3K2O A;  2JH8 A;  3E4Y A;  4FJM A;  1XVD E;  4DTX A;  4KHW A;  4M3U A;  2DY4 A;  2MZW B;  4E4B A;  2RKH A;  4J2A A;  1FZ6 E;  3KD1 E;  1XMG E;  3OGL B;  1IH7 A;  4JS4 A;  1XVE E;  1FZ3 E;  1FZ8 E;  3LDS A;  3SVI A;  1XU5 E;  4J2E A;  3C6N B;  1N1C A;  3CFO A;  2PFV A;  3QEV A;  3SPZ A;  1XVC E;  4I9Q A;  3LZI A;  1P22 A;  2VJ5 A;  3LD8 A;  4KHY A;  3SQ0 A;  4M3R A;  4DU4 A;  2FYO A;  3CFP A;  4KI4 A;  2MMB A;  3C95 A;  3UO2 A;  2H4T A;  3LDB A;  2E32 A;  3TAB A;  4FJN A;  4AKH A;  1FZH E;  2DTU A;  3SQ2 A;  2JHA A;  4QND A;  3QET A;  3QES A;  4FJK A;  2E31 A;  2K5S A;  2MW2 A;  4ADN A;  1MHY G;  2B8I A;  3CFR A;  2P1O B;  4FJJ A;  4KHN A;  2JPN A;  4RNG A;  3C6O B;  4DTP A;  2ATQ A;  4FJL A;  2LF6 A;  4ADO A;  3SI6 A;  3SCX A;  2P1N B;  1FS1 A;  2P5G A;  1LDK E;  2JHC A;  4RG8 A;  3QEP A;  4FK0 A;  4JS5 A;  2OVQ B;  3SUN A;  1FXX A;  1NEX B;  3E4W A;  3QEW A;  3L0M A;  3HGL A;  3J27 A;  4ICG C;  3LZJ A;  3QNO A;  1FZ0 E;  3SUQ A;  4HCC A;  3SQ4 A;  1CLQ A;  3QER A;  3UO3 A;  1FZ5 E;  2LF3 A;  2OVP B;  4M3X A;  1WAJ A;  1XL3 C;  4DTU A;  2QXF A;  3RMB A;  4IT5 A;  4DTR A;  3SPY A;  2P5O A;  1JW2 A;  3C94 A;  3SUP A;  2OZM A;  3SJJ A;  2OVR B;  2PFT A;  4KHS A;  3NDK A;  4FJ8 A;  4EYW A;  4KI6 A;  1IG9 A;  4RL5 A;  4FJH A;  4KHQ A;  2P1P B;  3OGK B;  4HCB A;  4QNC A;  3HGK E;  1FZ4 E;  4DTN A;  3N1B A;  4DU3 A;  3RMD A;  1FPO A;  3QNN A;  4FJ5 A;  3KD5 E;  2RCU A;  3SQ1 A;  1FZI E;  3OGM B;  3BVO A;  1XVF E;  4M45 A;  4AKG A;  4I9L A;  3J2P A;  2JH9 A;  5IRE A;  2VJ4 A;  4JRP A;  2OYQ A;  3L1N A;  3L2O B;  5IBK B;  3QEI A;  3UIQ A;  4M3Y A;  4EP9 A;  3CQ8 A;  1XMF E;  3SUO A;  2HD0 A;  3S9H A;  3RMC A;  4KHU A;  4J2B A;  2VIX A;  1FZ2 E;  1FZ7 E;  4FJI A;  1Q9Y A;  3WSO A;  2P1Q B;  4DTS A;  3TAE A;  4AI6 A;  3C6P B;  3V7D B;  4M3Z A;  4AKI A;  2JHP A;  1XVG E;  4JRQ A;  1MTY G;  3NAE A;  4DU1 A;  4J2D A;  4FVM A;  4M41 A;  3NHG A;  2OZS A;  4FJX A;  1MHZ G;  4GAM C;  3NCI A;  4DTJ A;  1FZ1 E;  1XU3 E;  3QEX A;  3SNN A;  4FJ9 A;  1XMH E;  1FZ9 E;  3NGI A;  2YB5 A;  4M3W A;  2FW3 A;  1WAF A;  4DTO A;  4FJG A;  3HP9 A;  3TAG A;  2DEB A;  3RWU A;  3TL8 B;  3RMA A;  5IZ7 A;  4X5M A;  1FYZ E;  4EPH A;  2P1M B;  1XVB E;  3HL8 A;  1MMO G;  3MKS B;  5H37 A;  3TJY A;  4E3S A;  4M3T A;  4B08 A;  4FK4 A;  4I6J B;  4DTM A;  2B1E A;  3L8B A;  4M42 A;  4X5N A;  3NE6 A;  2B7M A;  3N1E A;  4FJ7 A; 
#chains in the Genus database with same CATH homology
 4FK2 A;  1Q9X A;  3TAF A;  3K2O A;  2JH8 A;  3E4Y A;  4FJM A;  1XVD E;  4DTX A;  4KHW A;  4M3U A;  2DY4 A;  2MZW B;  4E4B A;  4J2A A;  1FZ6 E;  3KD1 E;  1XMG E;  3OGL B;  1IH7 A;  4JS4 A;  1XVE E;  1FZ3 E;  1FZ8 E;  3LDS A;  3SVI A;  1XU5 E;  4J2E A;  3C6N B;  4I9Q A;  3CFO A;  2PFV A;  3QEV A;  3SPZ A;  1XVC E;  3LZI A;  1P22 A;  2VJ5 A;  3LD8 A;  4KHY A;  3SQ0 A;  4M3R A;  4DU4 A;  2FYO A;  3CFP A;  4KI4 A;  2MMB A;  3C95 A;  2H4T A;  3LDB A;  2E32 A;  3TAB A;  4FJN A;  4AKH A;  1FZH E;  2DTU A;  3SQ2 A;  2JHA A;  4QND A;  3QET A;  3QES A;  4FJK A;  2E31 A;  4FJJ A;  4ADN A;  1MHY G;  2B8I A;  3CFR A;  2P1O B;  4KHN A;  2JPN A;  4RNG A;  3C6O B;  4DTP A;  2ATQ A;  4FJL A;  2LF6 A;  4ADO A;  3SI6 A;  3SCX A;  2P1N B;  1FS1 A;  2P5G A;  1LDK E;  2JHC A;  4RG8 A;  3QEP A;  4FK0 A;  4JS5 A;  2OVQ B;  3SUN A;  1FXX A;  1NEX B;  3E4W A;  3QEW A;  3L0M A;  3HGL A;  3J27 A;  3LZJ A;  3QNO A;  1FZ0 E;  3SUQ A;  4HCC A;  3SQ4 A;  1CLQ A;  3QER A;  1FZ5 E;  2LF3 A;  2OVP B;  4M3X A;  1WAJ A;  1XL3 C;  4DTU A;  2QXF A;  3RMB A;  3SPY A;  4DTR A;  2P5O A;  3C94 A;  3SUP A;  2OZM A;  3SJJ A;  2OVR B;  2PFT A;  4KHS A;  3NDK A;  4FJ8 A;  4EYW A;  4KI6 A;  1IG9 A;  4RL5 A;  4FJH A;  4KHQ A;  2P1P B;  3OGK B;  4HCB A;  4QNC A;  3HGK E;  1FZ4 E;  4DTN A;  3N1B A;  4DU3 A;  3RMD A;  3QNN A;  4FJ5 A;  3KD5 E;  2RCU A;  3SQ1 A;  1FZI E;  3OGM B;  4M45 A;  1XVF E;  4AKG A;  4I9L A;  3J2P A;  2JH9 A;  5IRE A;  2VJ4 A;  4JRP A;  2OYQ A;  3L1N A;  3L2O B;  5IBK B;  3QEI A;  3UIQ A;  4M3Y A;  4EP9 A;  3CQ8 A;  1XMF E;  3SUO A;  2HD0 A;  3S9H A;  3RMC A;  4KHU A;  4J2B A;  2VIX A;  1FZ2 E;  1FZ7 E;  4FJI A;  1Q9Y A;  3WSO A;  2P1Q B;  4DTS A;  3TAE A;  4AI6 A;  3C6P B;  3V7D B;  4M3Z A;  4AKI A;  2JHP A;  1XVG E;  4JRQ A;  1MTY G;  3NAE A;  4DU1 A;  4J2D A;  4FVM A;  4M41 A;  3NHG A;  2OZS A;  4FJX A;  1MHZ G;  4GAM C;  3NCI A;  4DTJ A;  1FZ1 E;  1XU3 E;  3QEX A;  3SNN A;  4FJ9 A;  1XMH E;  1FZ9 E;  3NGI A;  2YB5 A;  4M3W A;  2FW3 A;  1WAF A;  4DTO A;  4FJG A;  3HP9 A;  3TAG A;  2DEB A;  3RWU A;  3TL8 B;  3RMA A;  5IZ7 A;  4X5M A;  1FYZ E;  4EPH A;  2P1M B;  1XVB E;  3HL8 A;  1MMO G;  3MKS B;  5H37 A;  3TJY A;  4E3S A;  4M3T A;  4B08 A;  4FK4 A;  4I6J B;  4DTM A;  2B1E A;  3L8B A;  4M42 A;  4X5N A;  3NE6 A;  2B7M A;  3N1E A;  4FJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...