1FZ7E

Methane monooxygenase hydroxylase, form iii soaked in 0.9 m ethanol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title X-ray crystal structure of alcohol products bound at the active site of soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz7E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz7E02
1FZ8E 1XMGE 1XVGE 1FZ2E 1XMHE 1XVDE 1FZ5E 1FZ3E 1FZ0E 1XVCE 1FZ1E 1XVEE 1FZIE 1XVBE 1FZ7E 1XU3E 1XVFE 1MTYG 1FZ4E 1XMFE 1MMOG 1FZ9E 1MHYG 1FZ6E 1XU5E 1MHZG 1FZHE 4GAMC 1FYZE
chains in the Genus database with same CATH superfamily
2P5OA 4ADOA 1FZ8E 3KD5E 1XMGE 4FJ7A 3NHGA 4KI4A 2VJ5A 1LDKE 4FJ8A 3SUOA 2P1MB 4M41A 4RL5A 1XVDE 4KHQA 4DTMA 2OYQA 3CFRA 2P1OB 3OGMB 3QEXA 3SQ4A 4DTOA 2P1NB 2JH8A 1IH7A 4E4BA 3SCXA 4QNDA 1FXXA 3SQ0A 3UIQA 3N1EA 4FJGA 4KHWA 2PFVA 3J2PA 1XMFE 4J2BA 3LDBA 3TAFA 2K5SA 2YB5A 4HCBA 1MMOG 4JS4A 3C6OB 3UO3A 3C6NB 2E31A 3L0MA 2DY4A 3MKSB 2HD0A 1FYZE 4KHUA 2E32A 2H4TA 4EPHA 3TAGA 1JW2A 1XVGE 1FZ2E 4QNCA 1XMHE 3QNNA 4JRQA 4ICGC 3C94A 3NCIA 4DU3A 3RMAA 2FYOA 3OGLB 3WSOA 3SUPA 4DTXA 4AKHA 4FJHA 2MW2A 3SJJA 4J2EA 4M3RA 3SUNA 4DTNA 2RCUA 2JHCA 3LD8A 2OZSA 4X5MA 3QETA 4FJNA 3OGKB 4M3XA 2ATQA 4RNGA 3TJYA 2JH9A 4I6JB 2B1EA 2OVRB 4FVMA 4FJLA 2B8IA 4E3SA 1FZ4E 4FK0A 1FS1A 1WAFA 2PFTA 4DTUA 2LF3A 2MMBA 3N1BA 3C95A 1Q9XA 1MHYG 1FZ6E 3C6PB 1CLQA 4M3UA 3LZIA 2LF6A 3HL8A 3SQ2A 3K2OA 1Q9YA 4I9QA 5IREA 4FK2A 3HGLA 2MZWB 4DU4A 2DTUA 2VJ4A 4EP9A 2P1PB 3E4WA 1FZ5E 4B08A 3RMCA 3L1NA 4FJJA 1NEXB 3L8BA 3KD1E 4M3TA 4AKGA 1P22A 1N1CA 4FJ5A 4M45A 3UO2A 4KI6A 3QEWA 1FZIE 1XVBE 3SUQA 1FZ7E 2JQTA 2VIXA 4EYWA 2OZMA 4FK4A 4AKIA 1XU3E 3J27A 5IBKB 3SI6A 4FJIA 4M3YA 1MTYG 3V7DB 3S9HA 4KHNA 3SNNA 2JPNA 3NE6A 3TAEA 3NDKA 4DTRA 4FJKA 4M3WA 3TL8B 3LZJA 1XU5E 3QESA 3SQ1A 4FJXA 3CFOA 4GAMC 2JHPA 2P5GA 3NGIA 2JHAA 4X5NA 3SVIA 1FPOA 4DTSA 4M42A 4KHYA 3TABA 2RKHA 4KHSA 3RMDA 4J2DA 4RG8A 4DU1A 4DTJA 4DTPA 2OVPB 4JRPA 4FJ9A 3L2OB 2DEBA 3QERA 1FZ3E 1FZ0E 3QEPA 3SPYA 3SPZA 4J2AA 4FJMA 4AI6A 4HCCA 1XVCE 4JS5A 3BVOA 5IZ7A 3RMBA 4M3ZA 1FZ1E 1XVEE 3CFPA 3QNOA 4ADNA 1WAJA 4IT5A 3LDSA 2P1QB 3NAEA 2QXFA 1XVFE 1XL3C 1FZ9E 3HP9A 3QEIA 2OVQB 1IG9A 3HGKE 1MHZG 1FZHE 2B7MA 3CQ8A 2FW3A 4I9LA 3QEVA 3E4YA 5H37A 3RWUA
chains in the Genus database with same CATH topology
2P5OA 4ADOA 1FZ8E 3KD5E 1XMGE 4FJ7A 3NHGA 4KI4A 2VJ5A 1LDKE 4FJ8A 3SUOA 2P1MB 4M41A 4RL5A 1XVDE 4KHQA 4DTMA 2OYQA 3CFRA 2P1OB 3OGMB 3QEXA 3SQ4A 4DTOA 2P1NB 2JH8A 1IH7A 4E4BA 3SCXA 4QNDA 1FXXA 3SQ0A 3UIQA 3N1EA 4FJGA 4KHWA 2PFVA 3J2PA 1XMFE 4J2BA 3LDBA 3TAFA 2YB5A 4HCBA 1MMOG 4JS4A 3C6OB 3C6NB 2E31A 3L0MA 2DY4A 3MKSB 2HD0A 1FYZE 4KHUA 2E32A 2H4TA 4EPHA 3TAGA 1XVGE 1FZ2E 4QNCA 1XMHE 3QNNA 4JRQA 3C94A 3NCIA 4DU3A 3RMAA 2FYOA 3OGLB 3WSOA 3SUPA 4DTXA 4AKHA 4FJHA 3SJJA 4J2EA 4M3RA 3SUNA 4DTNA 2RCUA 2JHCA 3LD8A 2OZSA 4X5MA 3QETA 4FJNA 3OGKB 4M3XA 2ATQA 4RNGA 3TJYA 2JH9A 4I6JB 2B1EA 2OVRB 4FVMA 4FJLA 2B8IA 4E3SA 1FZ4E 4FK0A 1FS1A 1WAFA 2PFTA 4DTUA 2LF3A 2MMBA 3N1BA 3C95A 1Q9XA 1MHYG 1FZ6E 3C6PB 1CLQA 4M3UA 3LZIA 2LF6A 3HL8A 3SQ2A 3K2OA 1Q9YA 4I9QA 5IREA 4FK2A 3HGLA 2MZWB 4DU4A 2DTUA 2VJ4A 4EP9A 2P1PB 3E4WA 1FZ5E 4B08A 3RMCA 3L1NA 4FJJA 1NEXB 3L8BA 3KD1E 4M3TA 4AKGA 1P22A 4KI6A 4FJ5A 4M45A 3QEWA 1FZIE 1XVBE 3SUQA 1FZ7E 2VIXA 4EYWA 2OZMA 4FK4A 4AKIA 1XU3E 3J27A 5IBKB 3SI6A 4FJIA 4M3YA 1MTYG 3V7DB 3S9HA 4KHNA 3SNNA 2JPNA 3NE6A 3TAEA 3NDKA 4DTRA 4FJKA 4M3WA 3TL8B 3LZJA 1XU5E 3QESA 3SQ1A 4FJXA 3CFOA 4GAMC 2JHPA 2P5GA 3NGIA 2JHAA 4X5NA 3SVIA 4DTSA 4M42A 4KHYA 3TABA 4KHSA 3RMDA 4J2DA 4RG8A 4DU1A 4DTJA 4DTPA 2OVPB 4JRPA 4FJ9A 3L2OB 2DEBA 3QERA 1FZ3E 1FZ0E 3QEPA 3SPYA 3SPZA 4J2AA 4FJMA 4AI6A 4HCCA 1XVCE 4JS5A 5IZ7A 3RMBA 4M3ZA 1FZ1E 1XVEE 3CFPA 3QNOA 4ADNA 1WAJA 3LDSA 2P1QB 3NAEA 2QXFA 1XVFE 1XL3C 1FZ9E 3HP9A 3QEIA 2OVQB 1IG9A 3HGKE 1MHZG 1FZHE 2B7MA 3CQ8A 2FW3A 4I9LA 3QEVA 3E4YA 5H37A 3RWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ8 E;  1XMG E;  1XVG E;  1FZ2 E;  1XMH E;  1XVD E;  1FZ5 E;  1FZ3 E;  1FZ0 E;  1XVC E;  1FZ1 E;  1XVE E;  1FZI E;  1XVB E;  1FZ7 E;  1XU3 E;  1XVF E;  1MTY G;  1FZ4 E;  1XMF E;  1MMO G;  1FZ9 E;  1MHY G;  1FZ6 E;  1XU5 E;  1MHZ G;  1FZH E;  4GAM C;  1FYZ E; 
#chains in the Genus database with same CATH topology
 2P5O A;  4ADO A;  1FZ8 E;  3KD5 E;  1XMG E;  4FJ7 A;  3NHG A;  4KI4 A;  2VJ5 A;  1LDK E;  4FJ8 A;  3SUO A;  2P1M B;  4M41 A;  4RL5 A;  1XVD E;  4KHQ A;  4DTM A;  2OYQ A;  3CFR A;  2P1O B;  3OGM B;  3QEX A;  3SQ4 A;  4DTO A;  2P1N B;  2JH8 A;  1IH7 A;  4E4B A;  3SCX A;  4QND A;  1FXX A;  3SQ0 A;  3UIQ A;  3N1E A;  4FJG A;  4KHW A;  2PFV A;  3J2P A;  1XMF E;  4J2B A;  3LDB A;  3TAF A;  2K5S A;  2YB5 A;  4HCB A;  1MMO G;  4JS4 A;  3C6O B;  3UO3 A;  3C6N B;  2E31 A;  3L0M A;  2DY4 A;  3MKS B;  2HD0 A;  1FYZ E;  4KHU A;  2E32 A;  2H4T A;  4EPH A;  3TAG A;  1JW2 A;  1XVG E;  1FZ2 E;  4QNC A;  1XMH E;  3QNN A;  4JRQ A;  4ICG C;  3C94 A;  3NCI A;  4DU3 A;  3RMA A;  2FYO A;  3OGL B;  3WSO A;  3SUP A;  4DTX A;  4AKH A;  4FJH A;  2MW2 A;  3SJJ A;  4J2E A;  4M3R A;  3SUN A;  4DTN A;  2RCU A;  2JHC A;  3LD8 A;  2OZS A;  4X5M A;  3QET A;  4FJN A;  3OGK B;  4M3X A;  2ATQ A;  4RNG A;  3TJY A;  2JH9 A;  4I6J B;  2B1E A;  2OVR B;  4FVM A;  4FJL A;  2B8I A;  4E3S A;  1FZ4 E;  4FK0 A;  1FS1 A;  1WAF A;  2PFT A;  4DTU A;  2LF3 A;  2MMB A;  3N1B A;  3C95 A;  1Q9X A;  1MHY G;  1FZ6 E;  3C6P B;  1CLQ A;  4M3U A;  3LZI A;  2LF6 A;  3HL8 A;  3SQ2 A;  3K2O A;  1Q9Y A;  4I9Q A;  5IRE A;  4FK2 A;  3HGL A;  2MZW B;  4DU4 A;  2DTU A;  2VJ4 A;  4EP9 A;  2P1P B;  3E4W A;  1FZ5 E;  4B08 A;  3RMC A;  3L1N A;  4FJJ A;  1NEX B;  3L8B A;  3KD1 E;  4M3T A;  4AKG A;  1P22 A;  1N1C A;  4FJ5 A;  4M45 A;  3UO2 A;  4KI6 A;  3QEW A;  1FZI E;  1XVB E;  3SUQ A;  1FZ7 E;  2JQT A;  2VIX A;  4EYW A;  2OZM A;  4FK4 A;  4AKI A;  1XU3 E;  3J27 A;  5IBK B;  3SI6 A;  4FJI A;  4M3Y A;  1MTY G;  3V7D B;  3S9H A;  4KHN A;  3SNN A;  2JPN A;  3NE6 A;  3TAE A;  3NDK A;  4DTR A;  4FJK A;  4M3W A;  3TL8 B;  3LZJ A;  1XU5 E;  3QES A;  3SQ1 A;  4FJX A;  3CFO A;  4GAM C;  2JHP A;  2P5G A;  3NGI A;  2JHA A;  4X5N A;  3SVI A;  1FPO A;  4DTS A;  4M42 A;  4KHY A;  3TAB A;  2RKH A;  4KHS A;  3RMD A;  4J2D A;  4RG8 A;  4DU1 A;  4DTJ A;  4DTP A;  2OVP B;  4JRP A;  4FJ9 A;  3L2O B;  2DEB A;  3QER A;  1FZ3 E;  1FZ0 E;  3QEP A;  3SPY A;  3SPZ A;  4J2A A;  4FJM A;  4AI6 A;  4HCC A;  1XVC E;  4JS5 A;  3BVO A;  5IZ7 A;  3RMB A;  4M3Z A;  1FZ1 E;  1XVE E;  3CFP A;  3QNO A;  4ADN A;  1WAJ A;  4IT5 A;  3LDS A;  2P1Q B;  3NAE A;  2QXF A;  1XVF E;  1XL3 C;  1FZ9 E;  3HP9 A;  3QEI A;  2OVQ B;  1IG9 A;  3HGK E;  1MHZ G;  1FZH E;  2B7M A;  3CQ8 A;  2FW3 A;  4I9L A;  3QEV A;  3E4Y A;  5H37 A;  3RWU A; 
#chains in the Genus database with same CATH homology
 2P5O A;  4ADO A;  1FZ8 E;  3KD5 E;  1XMG E;  4FJ7 A;  3NHG A;  4KI4 A;  2VJ5 A;  1LDK E;  4FJ8 A;  3SUO A;  2P1M B;  4M41 A;  4RL5 A;  1XVD E;  4KHQ A;  4DTM A;  2OYQ A;  3CFR A;  2P1O B;  3OGM B;  3QEX A;  3SQ4 A;  4DTO A;  2P1N B;  2JH8 A;  1IH7 A;  4E4B A;  3SCX A;  4QND A;  1FXX A;  3SQ0 A;  3UIQ A;  3N1E A;  4FJG A;  4KHW A;  2PFV A;  3J2P A;  1XMF E;  4J2B A;  3LDB A;  3TAF A;  2YB5 A;  4HCB A;  1MMO G;  4JS4 A;  3C6O B;  3C6N B;  2E31 A;  3L0M A;  2DY4 A;  3MKS B;  2HD0 A;  1FYZ E;  4KHU A;  2E32 A;  2H4T A;  4EPH A;  3TAG A;  1XVG E;  1FZ2 E;  4QNC A;  1XMH E;  3QNN A;  4JRQ A;  3C94 A;  3NCI A;  4DU3 A;  3RMA A;  2FYO A;  3OGL B;  3WSO A;  3SUP A;  4DTX A;  4AKH A;  4FJH A;  3SJJ A;  4J2E A;  4M3R A;  3SUN A;  4DTN A;  2RCU A;  2JHC A;  3LD8 A;  2OZS A;  4X5M A;  3QET A;  4FJN A;  3OGK B;  4M3X A;  2ATQ A;  4RNG A;  3TJY A;  2JH9 A;  4I6J B;  2B1E A;  2OVR B;  4FVM A;  4FJL A;  2B8I A;  4E3S A;  1FZ4 E;  4FK0 A;  1FS1 A;  1WAF A;  2PFT A;  4DTU A;  2LF3 A;  2MMB A;  3N1B A;  3C95 A;  1Q9X A;  1MHY G;  1FZ6 E;  3C6P B;  1CLQ A;  4M3U A;  3LZI A;  2LF6 A;  3HL8 A;  3SQ2 A;  3K2O A;  1Q9Y A;  4I9Q A;  5IRE A;  4FK2 A;  3HGL A;  2MZW B;  4DU4 A;  2DTU A;  2VJ4 A;  4EP9 A;  2P1P B;  3E4W A;  1FZ5 E;  4B08 A;  3RMC A;  3L1N A;  4FJJ A;  1NEX B;  3L8B A;  3KD1 E;  4M3T A;  4AKG A;  1P22 A;  4KI6 A;  4FJ5 A;  4M45 A;  3QEW A;  1FZI E;  1XVB E;  3SUQ A;  1FZ7 E;  2VIX A;  4EYW A;  2OZM A;  4FK4 A;  4AKI A;  1XU3 E;  3J27 A;  5IBK B;  3SI6 A;  4FJI A;  4M3Y A;  1MTY G;  3V7D B;  3S9H A;  4KHN A;  3SNN A;  2JPN A;  3NE6 A;  3TAE A;  3NDK A;  4DTR A;  4FJK A;  4M3W A;  3TL8 B;  3LZJ A;  1XU5 E;  3QES A;  3SQ1 A;  4FJX A;  3CFO A;  4GAM C;  2JHP A;  2P5G A;  3NGI A;  2JHA A;  4X5N A;  3SVI A;  4DTS A;  4M42 A;  4KHY A;  3TAB A;  4KHS A;  3RMD A;  4J2D A;  4RG8 A;  4DU1 A;  4DTJ A;  4DTP A;  2OVP B;  4JRP A;  4FJ9 A;  3L2O B;  2DEB A;  3QER A;  1FZ3 E;  1FZ0 E;  3QEP A;  3SPY A;  3SPZ A;  4J2A A;  4FJM A;  4AI6 A;  4HCC A;  1XVC E;  4JS5 A;  5IZ7 A;  3RMB A;  4M3Z A;  1FZ1 E;  1XVE E;  3CFP A;  3QNO A;  4ADN A;  1WAJ A;  3LDS A;  2P1Q B;  3NAE A;  2QXF A;  1XVF E;  1XL3 C;  1FZ9 E;  3HP9 A;  3QEI A;  2OVQ B;  1IG9 A;  3HGK E;  1MHZ G;  1FZH E;  2B7M A;  3CQ8 A;  2FW3 A;  4I9L A;  3QEV A;  3E4Y A;  5H37 A;  3RWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...