1FZ1E

Methane monooxygenase hydroxylase, form iii oxidized
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz1E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz1E02
1MHYG 1FZ4E 1FZ0E 4GAMC 1FZ6E 1MHZG 1FZ3E 1FZ9E 1XVFE 1XU5E 1XVCE 1XVBE 1XU3E 1FZIE 1XMHE 1FYZE 1XVEE 1FZ1E 1MMOG 1FZHE 1XMGE 1XVDE 1FZ5E 1FZ8E 1XVGE 1MTYG 1FZ2E 1FZ7E 1XMFE
chains in the Genus database with same CATH superfamily
3C94A 4KHQA 4M3WA 1IG9A 3QEIA 2E32A 1MHZG 1FZ3E 3WSOA 1CLQA 1FZ9E 2DEBA 3HL8A 4I6JB 3KD5E 3KD1E 4B08A 4JS4A 2PFTA 3C6NB 4KHYA 2OVQB 2JHCA 4M3YA 3RMCA 3SQ0A 3N1EA 4KI6A 5H37A 1Q9YA 4FJ8A 4IT5A 3SQ1A 2MZWB 2B7MA 4KI4A 1N1CA 1FZHE 1XL3C 4EPHA 3QERA 4DTXA 2DTUA 3QEWA 2JQTA 2P1PB 3LDSA 3QEVA 2JPNA 1WAFA 4HCCA 2OVPB 4DU4A 4J2BA 2H4TA 4DTRA 1MTYG 3S9HA 1P22A 2OVRB 3E4WA 2YB5A 4JRPA 4J2AA 3UO3A 4FJXA 1MHYG 1FZ4E 2MW2A 4FVMA 5IBKB 3SUNA 1FZ6E 3C6OB 3HP9A 3LD8A 3NDKA 3QNOA 2LF3A 1FXXA 4DTPA 3SUQA 3SCXA 3SQ4A 4DTSA 4FJLA 4RNGA 2E31A 1FPOA 2QXFA 3NCIA 4M3XA 1XU3E 4FJ9A 4FJ7A 3SJJA 1FYZE 1XVEE 2OZMA 4EP9A 3QESA 1FZ1E 4JS5A 3J2PA 4HCBA 1Q9XA 4M42A 2HD0A 3LDBA 1XVDE 4DTUA 3N1BA 4ICGC 2RCUA 3V7DB 2P1NB 2PFVA 3UO2A 3TABA 4FJKA 3NAEA 3QNNA 4J2EA 4RL5A 2JH8A 3HGLA 4M3RA 4DTOA 4FK0A 2VJ5A 4DU3A 3LZIA 3SVIA 2FYOA 2P5OA 1XMFE 3TAEA 4I9LA 5IZ7A 3L8BA 1FZ0E 4KHSA 4EYWA 3E4YA 3CFRA 3TL8B 3K2OA 3OGLB 4QNDA 4FJHA 4JRQA 4M3ZA 3L1NA 4X5MA 4FJIA 2ATQA 1XVBE 3C6PB 1FZIE 1XMHE 1LDKE 3CFPA 3CQ8A 4DTNA 4KHNA 3J27A 2JHPA 4M41A 4KHWA 4I9QA 1MMOG 2B1EA 2OYQA 3OGKB 3SI6A 1XMGE 4FJ5A 3TAGA 4J2DA 2P1QB 2RKHA 3L0MA 4E3SA 4FJNA 3RMAA 3QETA 3NGIA 1WAJA 2JHAA 2FW3A 2LF6A 3OGMB 4FK4A 3MKSB 3RMDA 3HGKE 4X5NA 3TAFA 3SQ2A 2JH9A 3TJYA 2OZSA 4DTMA 4FJGA 4AKHA 4DU1A 3SNNA 4FK2A 3CFOA 4E4BA 4GAMC 4DTJA 3BVOA 3LZJA 4AI6A 2P5GA 3NHGA 1XVFE 1XU5E 2B8IA 4AKGA 4KHUA 1XVCE 2MMBA 4RG8A 3L2OB 3UIQA 2VJ4A 4ADOA 4M3TA 2DY4A 1FS1A 4FJMA 3C95A 2P1OB 4ADNA 3SUOA 4M3UA 3QEPA 3QEXA 3RWUA 1FZ5E 1JW2A 1NEXB 1FZ8E 2P1MB 3SPZA 3NE6A 1XVGE 4QNCA 4AKIA 4FJJA 4M45A 3SUPA 1IH7A 1FZ2E 2VIXA 3RMBA 1FZ7E 2K5SA 3SPYA 5IREA
chains in the Genus database with same CATH topology
3C94A 4KHQA 4M3WA 1IG9A 3QEIA 2E32A 1MHZG 1FZ3E 3WSOA 1CLQA 1FZ9E 2DEBA 3HL8A 4I6JB 3KD5E 3KD1E 4B08A 4JS4A 2PFTA 3C6NB 4KHYA 2OVQB 2JHCA 4M3YA 3RMCA 3SQ0A 3N1EA 4KI6A 5H37A 1Q9YA 4FJ8A 3SQ1A 2MZWB 2B7MA 4KI4A 1FZHE 1XL3C 4EPHA 3QERA 4DTXA 2DTUA 3QEWA 2P1PB 3LDSA 3QEVA 2JPNA 1WAFA 4HCCA 2OVPB 4DU4A 4J2BA 2H4TA 4DTRA 1MTYG 3S9HA 1P22A 2OVRB 3E4WA 2YB5A 4JRPA 4J2AA 4FJXA 1MHYG 1FZ4E 4FVMA 5IBKB 3SUNA 1FZ6E 3C6OB 3HP9A 3LD8A 3NDKA 3QNOA 2LF3A 1FXXA 4DTPA 3SUQA 3SCXA 3SQ4A 4DTSA 4FJLA 4RNGA 2E31A 2QXFA 3NCIA 4M3XA 1XU3E 4FJ9A 4FJ7A 3SJJA 1FYZE 1XVEE 2OZMA 4EP9A 3QESA 1FZ1E 4JS5A 3J2PA 4HCBA 1Q9XA 4M42A 2HD0A 3LDBA 1XVDE 4DTUA 3N1BA 2RCUA 3V7DB 2P1NB 2PFVA 3TABA 4FJKA 3NAEA 3QNNA 4J2EA 4RL5A 2JH8A 3HGLA 4M3RA 4DTOA 4FK0A 2VJ5A 4DU3A 3LZIA 3SVIA 2FYOA 2P5OA 1XMFE 3TAEA 4I9LA 5IZ7A 3L8BA 1FZ0E 4KHSA 4EYWA 3E4YA 3CFRA 3TL8B 3K2OA 3OGLB 4QNDA 4FJHA 4JRQA 4M3ZA 3L1NA 4X5MA 4FJIA 2ATQA 1XVBE 3C6PB 1FZIE 1XMHE 1LDKE 3CFPA 3CQ8A 4DTNA 4KHNA 3J27A 2JHPA 4M41A 4KHWA 4I9QA 1MMOG 2B1EA 2OYQA 3OGKB 3SI6A 1XMGE 4FJ5A 3TAGA 4J2DA 2P1QB 3L0MA 4E3SA 4FJNA 3RMAA 3QETA 3NGIA 1WAJA 2JHAA 2FW3A 2LF6A 3OGMB 4FK4A 3MKSB 3RMDA 3HGKE 4X5NA 3TAFA 3SQ2A 2JH9A 3TJYA 2OZSA 4DTMA 4FJGA 4AKHA 4DU1A 3SNNA 4FK2A 3CFOA 4E4BA 4GAMC 4DTJA 3LZJA 4AI6A 2P5GA 3NHGA 1XVFE 1XU5E 2B8IA 4AKGA 4KHUA 1XVCE 2MMBA 4RG8A 3L2OB 3UIQA 2VJ4A 4ADOA 4M3TA 2DY4A 1FS1A 4FJMA 3C95A 2P1OB 4ADNA 3SUOA 4M3UA 3QEPA 3QEXA 3RWUA 1FZ5E 1NEXB 1FZ8E 2P1MB 3SPZA 3NE6A 1XVGE 4QNCA 4AKIA 4FJJA 4M45A 3SUPA 1IH7A 1FZ2E 2VIXA 3RMBA 1FZ7E 3SPYA 5IREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHY G;  1FZ4 E;  1FZ0 E;  4GAM C;  1FZ6 E;  1MHZ G;  1FZ3 E;  1FZ9 E;  1XVF E;  1XU5 E;  1XVC E;  1XVB E;  1XU3 E;  1FZI E;  1XMH E;  1FYZ E;  1XVE E;  1FZ1 E;  1MMO G;  1FZH E;  1XMG E;  1XVD E;  1FZ5 E;  1FZ8 E;  1XVG E;  1MTY G;  1FZ2 E;  1FZ7 E;  1XMF E; 
#chains in the Genus database with same CATH topology
 3C94 A;  4KHQ A;  4M3W A;  1IG9 A;  3QEI A;  2E32 A;  1MHZ G;  1FZ3 E;  3WSO A;  1CLQ A;  1FZ9 E;  2DEB A;  3HL8 A;  4I6J B;  3KD5 E;  3KD1 E;  4B08 A;  4JS4 A;  2PFT A;  3C6N B;  4KHY A;  2OVQ B;  2JHC A;  4M3Y A;  3RMC A;  3SQ0 A;  3N1E A;  4KI6 A;  5H37 A;  1Q9Y A;  4FJ8 A;  4IT5 A;  3SQ1 A;  2MZW B;  2B7M A;  4KI4 A;  1N1C A;  1FZH E;  1XL3 C;  4EPH A;  3QER A;  4DTX A;  2DTU A;  3QEW A;  2JQT A;  2P1P B;  3LDS A;  3QEV A;  2JPN A;  1WAF A;  4HCC A;  2OVP B;  4DU4 A;  4J2B A;  2H4T A;  4DTR A;  1MTY G;  3S9H A;  1P22 A;  2OVR B;  3E4W A;  2YB5 A;  4JRP A;  4J2A A;  3UO3 A;  4FJX A;  1MHY G;  1FZ4 E;  2MW2 A;  4FVM A;  5IBK B;  3SUN A;  1FZ6 E;  3C6O B;  3HP9 A;  3LD8 A;  3NDK A;  3QNO A;  2LF3 A;  1FXX A;  4DTP A;  3SUQ A;  3SCX A;  3SQ4 A;  4DTS A;  4FJL A;  4RNG A;  2E31 A;  1FPO A;  2QXF A;  3NCI A;  4M3X A;  1XU3 E;  4FJ9 A;  4FJ7 A;  3SJJ A;  1FYZ E;  1XVE E;  2OZM A;  4EP9 A;  3QES A;  1FZ1 E;  4JS5 A;  3J2P A;  4HCB A;  1Q9X A;  4M42 A;  2HD0 A;  3LDB A;  1XVD E;  4DTU A;  3N1B A;  4ICG C;  2RCU A;  3V7D B;  2P1N B;  2PFV A;  3UO2 A;  3TAB A;  4FJK A;  3NAE A;  3QNN A;  4J2E A;  4RL5 A;  2JH8 A;  3HGL A;  4M3R A;  4DTO A;  4FK0 A;  2VJ5 A;  4DU3 A;  3LZI A;  3SVI A;  2FYO A;  2P5O A;  1XMF E;  3TAE A;  4I9L A;  5IZ7 A;  3L8B A;  1FZ0 E;  4KHS A;  4EYW A;  3E4Y A;  3CFR A;  3TL8 B;  3K2O A;  3OGL B;  4QND A;  4FJH A;  4JRQ A;  4M3Z A;  3L1N A;  4X5M A;  4FJI A;  2ATQ A;  1XVB E;  3C6P B;  1FZI E;  1XMH E;  1LDK E;  3CFP A;  3CQ8 A;  4DTN A;  4KHN A;  3J27 A;  2JHP A;  4M41 A;  4KHW A;  4I9Q A;  1MMO G;  2B1E A;  2OYQ A;  3OGK B;  3SI6 A;  1XMG E;  4FJ5 A;  3TAG A;  4J2D A;  2P1Q B;  2RKH A;  3L0M A;  4E3S A;  4FJN A;  3RMA A;  3QET A;  3NGI A;  1WAJ A;  2JHA A;  2FW3 A;  2LF6 A;  3OGM B;  4FK4 A;  3MKS B;  3RMD A;  3HGK E;  4X5N A;  3TAF A;  3SQ2 A;  2JH9 A;  3TJY A;  2OZS A;  4DTM A;  4FJG A;  4AKH A;  4DU1 A;  3SNN A;  4FK2 A;  3CFO A;  4E4B A;  4GAM C;  4DTJ A;  3BVO A;  3LZJ A;  4AI6 A;  2P5G A;  3NHG A;  1XVF E;  1XU5 E;  2B8I A;  4AKG A;  4KHU A;  1XVC E;  2MMB A;  4RG8 A;  3L2O B;  3UIQ A;  2VJ4 A;  4ADO A;  4M3T A;  2DY4 A;  1FS1 A;  4FJM A;  3C95 A;  2P1O B;  4ADN A;  3SUO A;  4M3U A;  3QEP A;  3QEX A;  3RWU A;  1FZ5 E;  1JW2 A;  1NEX B;  1FZ8 E;  2P1M B;  3SPZ A;  3NE6 A;  1XVG E;  4QNC A;  4AKI A;  4FJJ A;  4M45 A;  3SUP A;  1IH7 A;  1FZ2 E;  2VIX A;  3RMB A;  1FZ7 E;  2K5S A;  3SPY A;  5IRE A; 
#chains in the Genus database with same CATH homology
 3C94 A;  4KHQ A;  4M3W A;  1IG9 A;  3QEI A;  2E32 A;  1MHZ G;  1FZ3 E;  3WSO A;  1CLQ A;  1FZ9 E;  2DEB A;  3HL8 A;  4I6J B;  3KD5 E;  3KD1 E;  4B08 A;  4JS4 A;  2PFT A;  3C6N B;  4KHY A;  2OVQ B;  2JHC A;  4M3Y A;  3RMC A;  3SQ0 A;  3N1E A;  4KI6 A;  5H37 A;  1Q9Y A;  4FJ8 A;  3SQ1 A;  2MZW B;  2B7M A;  4KI4 A;  1FZH E;  1XL3 C;  4EPH A;  3QER A;  4DTX A;  2DTU A;  3QEW A;  2P1P B;  3LDS A;  3QEV A;  2JPN A;  1WAF A;  4HCC A;  2OVP B;  4DU4 A;  4J2B A;  2H4T A;  4DTR A;  1MTY G;  3S9H A;  1P22 A;  2OVR B;  3E4W A;  2YB5 A;  4JRP A;  4J2A A;  4FJX A;  1MHY G;  1FZ4 E;  4FVM A;  5IBK B;  3SUN A;  1FZ6 E;  3C6O B;  3HP9 A;  3LD8 A;  3NDK A;  3QNO A;  2LF3 A;  1FXX A;  4DTP A;  3SUQ A;  3SCX A;  3SQ4 A;  4DTS A;  4FJL A;  4RNG A;  2E31 A;  2QXF A;  3NCI A;  4M3X A;  1XU3 E;  4FJ9 A;  4FJ7 A;  3SJJ A;  1FYZ E;  1XVE E;  2OZM A;  4EP9 A;  3QES A;  1FZ1 E;  4JS5 A;  3J2P A;  4HCB A;  1Q9X A;  4M42 A;  2HD0 A;  3LDB A;  1XVD E;  4DTU A;  3N1B A;  2RCU A;  3V7D B;  2P1N B;  2PFV A;  3TAB A;  4FJK A;  3NAE A;  3QNN A;  4J2E A;  4RL5 A;  2JH8 A;  3HGL A;  4M3R A;  4DTO A;  4FK0 A;  2VJ5 A;  4DU3 A;  3LZI A;  3SVI A;  2FYO A;  2P5O A;  1XMF E;  3TAE A;  4I9L A;  5IZ7 A;  3L8B A;  1FZ0 E;  4KHS A;  4EYW A;  3E4Y A;  3CFR A;  3TL8 B;  3K2O A;  3OGL B;  4QND A;  4FJH A;  4JRQ A;  4M3Z A;  3L1N A;  4X5M A;  4FJI A;  2ATQ A;  1XVB E;  3C6P B;  1FZI E;  1XMH E;  1LDK E;  3CFP A;  3CQ8 A;  4DTN A;  4KHN A;  3J27 A;  2JHP A;  4M41 A;  4KHW A;  4I9Q A;  1MMO G;  2B1E A;  2OYQ A;  3OGK B;  3SI6 A;  1XMG E;  4FJ5 A;  3TAG A;  4J2D A;  2P1Q B;  3L0M A;  4E3S A;  4FJN A;  3RMA A;  3QET A;  3NGI A;  1WAJ A;  2JHA A;  2FW3 A;  2LF6 A;  3OGM B;  4FK4 A;  3MKS B;  3RMD A;  3HGK E;  4X5N A;  3TAF A;  3SQ2 A;  2JH9 A;  3TJY A;  2OZS A;  4DTM A;  4FJG A;  4AKH A;  4DU1 A;  3SNN A;  4FK2 A;  3CFO A;  4E4B A;  4GAM C;  4DTJ A;  3LZJ A;  4AI6 A;  2P5G A;  3NHG A;  1XVF E;  1XU5 E;  2B8I A;  4AKG A;  4KHU A;  1XVC E;  2MMB A;  4RG8 A;  3L2O B;  3UIQ A;  2VJ4 A;  4ADO A;  4M3T A;  2DY4 A;  1FS1 A;  4FJM A;  3C95 A;  2P1O B;  4ADN A;  3SUO A;  4M3U A;  3QEP A;  3QEX A;  3RWU A;  1FZ5 E;  1NEX B;  1FZ8 E;  2P1M B;  3SPZ A;  3NE6 A;  1XVG E;  4QNC A;  4AKI A;  4FJJ A;  4M45 A;  3SUP A;  1IH7 A;  1FZ2 E;  2VIX A;  3RMB A;  1FZ7 E;  3SPY A;  5IRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...