1FZ1E

Methane monooxygenase hydroxylase, form iii oxidized
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz1E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz1E02
1XMGE 1XU5E 1FZHE 1FZIE 1MMOG 1FZ8E 1MHZG 1FZ5E 1MTYG 1XVFE 1XMHE 1XU3E 1FZ7E 1FZ0E 1FZ6E 1FZ4E 1FZ9E 4GAMC 1FZ2E 1XMFE 1FZ1E 1XVBE 1XVCE 1XVEE 1FYZE 1MHYG 1XVDE 1XVGE 1FZ3E
chains in the Genus database with same CATH superfamily
3QEVA 3C6OB 3OGLB 4M3RA 2YB5A 2PFVA 1XL3C 2P1QB 3J27A 2OYQA 2E31A 3QEIA 1NEXB 4DTXA 4DTNA 4FJIA 4DTJA 4J2EA 3CFPA 3J2PA 3HGLA 3L8BA 2P5GA 4AKIA 4FJNA 3UIQA 3TAFA 4M3WA 3SPYA 2H4TA 3LDBA 3L1NA 3N1EA 4QNCA 2P1OB 3SQ0A 2FW3A 4ADNA 2QXFA 2JH9A 4J2DA 3N1BA 3RMBA 4FK2A 4RG8A 4FK0A 3QEPA 2OZSA 4FJ9A 2OZMA 4KHWA 3QNOA 1JW2A 5H37A 3NDKA 2K5SA 3QESA 3QETA 2VJ5A 1MTYG 1XVFE 2JQTA 4JS4A 2RKHA 3V7DB 3SVIA 3QEWA 4DU4A 4M3YA 2OVPB 4FJHA 3CQ8A 2VIXA 4KI4A 1Q9YA 2JHPA 4AKGA 1FZ9E 2JHCA 2JPNA 4QNDA 4M41A 4FJGA 3SUQA 2OVRB 3UO2A 2P1NB 4M3XA 3NAEA 4DTUA 4HCBA 4FVMA 2MZWB 1FZ1E 2DY4A 4RNGA 2DTUA 2MMBA 4I9LA 4JS5A 1Q9XA 3HGKE 1IG9A 4AI6A 3SNNA 1XVEE 4IT5A 3SQ1A 1FYZE 3TAGA 4E3SA 4FJXA 1FZ3E 4JRQA 1LDKE 3WSOA 4I9QA 1FZHE 2FYOA 1MMOG 1FZ8E 2MW2A 3E4YA 4DTMA 1CLQA 3NHGA 3QEXA 4J2AA 1MHZG 1FZ5E 5IBKB 3SQ4A 3K2OA 1XMHE 3OGMB 3RWUA 4FJ5A 3C6PB 3L0MA 3BVOA 3C94A 4AKHA 3LZJA 4ADOA 2HD0A 2JH8A 3RMCA 1FZ6E 4FJKA 4EPHA 3TJYA 1FZ4E 3HL8A 4JRPA 2ATQA 4EYWA 3NCIA 1P22A 2P5OA 4B08A 4KHYA 2RCUA 4KHSA 4FJJA 2JHAA 4FJMA 4X5MA 2B1EA 3SPZA 3KD1E 1FZ2E 4KHNA 3C95A 4KI6A 3SUOA 1WAJA 4DTSA 4KHUA 2DEBA 1MHYG 5IREA 1FS1A 1N1CA 2LF6A 1WAFA 4KHQA 3LZIA 3NGIA 2B7MA 3TAEA 3SUPA 3OGKB 1XMGE 2P1PB 1XU5E 4I6JB 4E4BA 1FZIE 4EP9A 1IH7A 3RMAA 4FJLA 3SI6A 4M45A 4J2BA 4DU1A 3SJJA 3LD8A 4DTPA 3L2OB 4RL5A 3CFRA 4DTOA 2PFTA 1XU3E 3KD5E 1FZ7E 2OVQB 4FJ8A 4M42A 1FZ0E 3LDSA 4DU3A 3SUNA 3TL8B 4HCCA 2E32A 3HP9A 2VJ4A 4M3UA 3SCXA 1FPOA 2LF3A 4GAMC 3C6NB 1XMFE 2P1MB 5IZ7A 4M3ZA 3E4WA 3QERA 3TABA 1XVBE 3SQ2A 1XVCE 4FK4A 4FJ7A 3MKSB 4M3TA 1FXXA 4X5NA 2B8IA 3RMDA 3QNNA 4DTRA 4ICGC 3NE6A 3UO3A 3CFOA 3S9HA 1XVDE 1XVGE
chains in the Genus database with same CATH topology
3QEVA 3C6OB 3OGLB 4M3RA 2YB5A 2PFVA 1XL3C 2P1QB 3J27A 2OYQA 2E31A 3QEIA 1NEXB 4DTXA 4DTNA 4FJIA 4DTJA 4J2EA 3CFPA 3J2PA 3HGLA 3L8BA 2P5GA 4AKIA 4FJNA 3UIQA 3TAFA 4M3WA 3SPYA 2H4TA 3LDBA 3L1NA 3N1EA 4QNCA 2P1OB 3SQ0A 2FW3A 4ADNA 2QXFA 2JH9A 4J2DA 3N1BA 3RMBA 4FK2A 4RG8A 4FK0A 3QEPA 2OZSA 4FJ9A 2OZMA 4KHWA 3QNOA 5H37A 3NDKA 3QESA 3QETA 2VJ5A 1MTYG 1XVFE 4JS4A 3V7DB 3SVIA 3QEWA 4DU4A 4M3YA 2OVPB 4FJHA 3CQ8A 2VIXA 4KI4A 1Q9YA 2JHPA 4AKGA 1FZ9E 2JHCA 2JPNA 4QNDA 4M41A 4FJGA 3SUQA 2OVRB 2P1NB 4M3XA 3NAEA 4DTUA 4HCBA 4FVMA 2MZWB 1FZ1E 2DY4A 4RNGA 2DTUA 2MMBA 4I9LA 4JS5A 1Q9XA 3HGKE 1IG9A 4AI6A 3SNNA 1XVEE 3SQ1A 1FYZE 3TAGA 4E3SA 4FJXA 1FZ3E 4JRQA 1LDKE 3WSOA 4I9QA 1FZHE 2FYOA 1MMOG 1FZ8E 4DTMA 3E4YA 1CLQA 3NHGA 3QEXA 4J2AA 1MHZG 1FZ5E 5IBKB 3SQ4A 3K2OA 1XMHE 3OGMB 3RWUA 4FJ5A 3C6PB 3L0MA 3C94A 4AKHA 3LZJA 4ADOA 2HD0A 2JH8A 3RMCA 1FZ6E 4FJKA 4EPHA 3TJYA 1FZ4E 3HL8A 4JRPA 2ATQA 4EYWA 3NCIA 1P22A 2P5OA 4B08A 4KHYA 2RCUA 4KHSA 4FJJA 2JHAA 4FJMA 4X5MA 2B1EA 3SPZA 3KD1E 1FZ2E 4KHNA 3C95A 4KI6A 3SUOA 1WAJA 4DTSA 4KHUA 2DEBA 1MHYG 5IREA 1FS1A 4KHQA 2LF6A 1WAFA 3LZIA 3NGIA 2B7MA 3TAEA 3SUPA 3OGKB 1XMGE 2P1PB 1XU5E 4I6JB 4E4BA 1FZIE 4EP9A 1IH7A 3RMAA 4FJLA 3SI6A 4M45A 4J2BA 4DU1A 3SJJA 3LD8A 4DTPA 3L2OB 4RL5A 3CFRA 4DTOA 2PFTA 1XU3E 3KD5E 1FZ7E 2OVQB 4FJ8A 4M42A 1FZ0E 3LDSA 4DU3A 3SUNA 3TL8B 4HCCA 2E32A 3HP9A 2VJ4A 4M3UA 3SCXA 2LF3A 4GAMC 3C6NB 1XMFE 2P1MB 5IZ7A 4M3ZA 3E4WA 3QERA 3TABA 1XVBE 3SQ2A 1XVCE 4FK4A 4FJ7A 3MKSB 4M3TA 1FXXA 4X5NA 2B8IA 3RMDA 3QNNA 4DTRA 3NE6A 3S9HA 3CFOA 1XVDE 1XVGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMG E;  1XU5 E;  1FZH E;  1FZI E;  1MMO G;  1FZ8 E;  1MHZ G;  1FZ5 E;  1MTY G;  1XVF E;  1XMH E;  1XU3 E;  1FZ7 E;  1FZ0 E;  1FZ6 E;  1FZ4 E;  1FZ9 E;  4GAM C;  1FZ2 E;  1XMF E;  1FZ1 E;  1XVB E;  1XVC E;  1XVE E;  1FYZ E;  1MHY G;  1XVD E;  1XVG E;  1FZ3 E; 
#chains in the Genus database with same CATH topology
 3QEV A;  3C6O B;  3OGL B;  4M3R A;  2YB5 A;  2PFV A;  1XL3 C;  2P1Q B;  3J27 A;  2OYQ A;  2E31 A;  3QEI A;  1NEX B;  4DTX A;  4DTN A;  4FJI A;  4DTJ A;  4J2E A;  3CFP A;  3J2P A;  3HGL A;  3L8B A;  2P5G A;  4AKI A;  4FJN A;  3UIQ A;  3TAF A;  4M3W A;  3SPY A;  2H4T A;  3LDB A;  3L1N A;  3N1E A;  4QNC A;  2P1O B;  3SQ0 A;  2FW3 A;  4ADN A;  2QXF A;  2JH9 A;  4J2D A;  3N1B A;  3RMB A;  4FK2 A;  4RG8 A;  4FK0 A;  3QEP A;  2OZS A;  4FJ9 A;  2OZM A;  4KHW A;  3QNO A;  1JW2 A;  5H37 A;  3NDK A;  2K5S A;  3QES A;  3QET A;  2VJ5 A;  1MTY G;  1XVF E;  2JQT A;  4JS4 A;  2RKH A;  3V7D B;  3SVI A;  3QEW A;  4DU4 A;  4M3Y A;  2OVP B;  4FJH A;  3CQ8 A;  2VIX A;  4KI4 A;  1Q9Y A;  2JHP A;  4AKG A;  1FZ9 E;  2JHC A;  2JPN A;  4QND A;  4M41 A;  4FJG A;  3SUQ A;  2OVR B;  3UO2 A;  2P1N B;  4M3X A;  3NAE A;  4DTU A;  4HCB A;  4FVM A;  2MZW B;  1FZ1 E;  2DY4 A;  4RNG A;  2DTU A;  2MMB A;  4I9L A;  4JS5 A;  1Q9X A;  3HGK E;  1IG9 A;  4AI6 A;  3SNN A;  1XVE E;  4IT5 A;  3SQ1 A;  1FYZ E;  3TAG A;  4E3S A;  4FJX A;  1FZ3 E;  4JRQ A;  1LDK E;  3WSO A;  4I9Q A;  1FZH E;  2FYO A;  1MMO G;  1FZ8 E;  2MW2 A;  3E4Y A;  4DTM A;  1CLQ A;  3NHG A;  3QEX A;  4J2A A;  1MHZ G;  1FZ5 E;  5IBK B;  3SQ4 A;  3K2O A;  1XMH E;  3OGM B;  3RWU A;  4FJ5 A;  3C6P B;  3L0M A;  3BVO A;  3C94 A;  4AKH A;  3LZJ A;  4ADO A;  2HD0 A;  2JH8 A;  3RMC A;  1FZ6 E;  4FJK A;  4EPH A;  3TJY A;  1FZ4 E;  3HL8 A;  4JRP A;  2ATQ A;  4EYW A;  3NCI A;  1P22 A;  2P5O A;  4B08 A;  4KHY A;  2RCU A;  4KHS A;  4FJJ A;  2JHA A;  4FJM A;  4X5M A;  2B1E A;  3SPZ A;  3KD1 E;  1FZ2 E;  4KHN A;  3C95 A;  4KI6 A;  3SUO A;  1WAJ A;  4DTS A;  4KHU A;  2DEB A;  1MHY G;  5IRE A;  1FS1 A;  1N1C A;  2LF6 A;  1WAF A;  4KHQ A;  3LZI A;  3NGI A;  2B7M A;  3TAE A;  3SUP A;  3OGK B;  1XMG E;  2P1P B;  1XU5 E;  4I6J B;  4E4B A;  1FZI E;  4EP9 A;  1IH7 A;  3RMA A;  4FJL A;  3SI6 A;  4M45 A;  4J2B A;  4DU1 A;  3SJJ A;  3LD8 A;  4DTP A;  3L2O B;  4RL5 A;  3CFR A;  4DTO A;  2PFT A;  1XU3 E;  3KD5 E;  1FZ7 E;  2OVQ B;  4FJ8 A;  4M42 A;  1FZ0 E;  3LDS A;  4DU3 A;  3SUN A;  3TL8 B;  4HCC A;  2E32 A;  3HP9 A;  2VJ4 A;  4M3U A;  3SCX A;  1FPO A;  2LF3 A;  4GAM C;  3C6N B;  1XMF E;  2P1M B;  5IZ7 A;  4M3Z A;  3E4W A;  3QER A;  3TAB A;  1XVB E;  3SQ2 A;  1XVC E;  4FK4 A;  4FJ7 A;  3MKS B;  4M3T A;  1FXX A;  4X5N A;  2B8I A;  3RMD A;  3QNN A;  4DTR A;  4ICG C;  3NE6 A;  3UO3 A;  3CFO A;  3S9H A;  1XVD E;  1XVG E; 
#chains in the Genus database with same CATH homology
 3QEV A;  3C6O B;  3OGL B;  4M3R A;  2YB5 A;  2PFV A;  1XL3 C;  2P1Q B;  3J27 A;  2OYQ A;  2E31 A;  3QEI A;  1NEX B;  4DTX A;  4DTN A;  4FJI A;  4DTJ A;  4J2E A;  3CFP A;  3J2P A;  3HGL A;  3L8B A;  2P5G A;  4AKI A;  4FJN A;  3UIQ A;  3TAF A;  4M3W A;  3SPY A;  2H4T A;  3LDB A;  3L1N A;  3N1E A;  4QNC A;  2P1O B;  3SQ0 A;  2FW3 A;  4ADN A;  2QXF A;  2JH9 A;  4J2D A;  3N1B A;  3RMB A;  4FK2 A;  4RG8 A;  4FK0 A;  3QEP A;  2OZS A;  4FJ9 A;  2OZM A;  4KHW A;  3QNO A;  5H37 A;  3NDK A;  3QES A;  3QET A;  2VJ5 A;  1MTY G;  1XVF E;  4JS4 A;  3V7D B;  3SVI A;  3QEW A;  4DU4 A;  4M3Y A;  2OVP B;  4FJH A;  3CQ8 A;  2VIX A;  4KI4 A;  1Q9Y A;  2JHP A;  4AKG A;  1FZ9 E;  2JHC A;  2JPN A;  4QND A;  4M41 A;  4FJG A;  3SUQ A;  2OVR B;  2P1N B;  4M3X A;  3NAE A;  4DTU A;  4HCB A;  4FVM A;  2MZW B;  1FZ1 E;  2DY4 A;  4RNG A;  2DTU A;  2MMB A;  4I9L A;  4JS5 A;  1Q9X A;  3HGK E;  1IG9 A;  4AI6 A;  3SNN A;  1XVE E;  3SQ1 A;  1FYZ E;  3TAG A;  4E3S A;  4FJX A;  1FZ3 E;  4JRQ A;  1LDK E;  3WSO A;  4I9Q A;  1FZH E;  2FYO A;  1MMO G;  1FZ8 E;  4DTM A;  3E4Y A;  1CLQ A;  3NHG A;  3QEX A;  4J2A A;  1MHZ G;  1FZ5 E;  5IBK B;  3SQ4 A;  3K2O A;  1XMH E;  3OGM B;  3RWU A;  4FJ5 A;  3C6P B;  3L0M A;  3C94 A;  4AKH A;  3LZJ A;  4ADO A;  2HD0 A;  2JH8 A;  3RMC A;  1FZ6 E;  4FJK A;  4EPH A;  3TJY A;  1FZ4 E;  3HL8 A;  4JRP A;  2ATQ A;  4EYW A;  3NCI A;  1P22 A;  2P5O A;  4B08 A;  4KHY A;  2RCU A;  4KHS A;  4FJJ A;  2JHA A;  4FJM A;  4X5M A;  2B1E A;  3SPZ A;  3KD1 E;  1FZ2 E;  4KHN A;  3C95 A;  4KI6 A;  3SUO A;  1WAJ A;  4DTS A;  4KHU A;  2DEB A;  1MHY G;  5IRE A;  1FS1 A;  4KHQ A;  2LF6 A;  1WAF A;  3LZI A;  3NGI A;  2B7M A;  3TAE A;  3SUP A;  3OGK B;  1XMG E;  2P1P B;  1XU5 E;  4I6J B;  4E4B A;  1FZI E;  4EP9 A;  1IH7 A;  3RMA A;  4FJL A;  3SI6 A;  4M45 A;  4J2B A;  4DU1 A;  3SJJ A;  3LD8 A;  4DTP A;  3L2O B;  4RL5 A;  3CFR A;  4DTO A;  2PFT A;  1XU3 E;  3KD5 E;  1FZ7 E;  2OVQ B;  4FJ8 A;  4M42 A;  1FZ0 E;  3LDS A;  4DU3 A;  3SUN A;  3TL8 B;  4HCC A;  2E32 A;  3HP9 A;  2VJ4 A;  4M3U A;  3SCX A;  2LF3 A;  4GAM C;  3C6N B;  1XMF E;  2P1M B;  5IZ7 A;  4M3Z A;  3E4W A;  3QER A;  3TAB A;  1XVB E;  3SQ2 A;  1XVC E;  4FK4 A;  4FJ7 A;  3MKS B;  4M3T A;  1FXX A;  4X5N A;  2B8I A;  3RMD A;  3QNN A;  4DTR A;  3NE6 A;  3S9H A;  3CFO A;  1XVD E;  1XVG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...