1FZ1E

Methane monooxygenase hydroxylase, form iii oxidized
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz1E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz1E02
1XVCE 1FZ8E 1XVGE 1XVDE 1FZ2E 1MHZG 1FZ9E 1FZ3E 1FZ6E 1FZIE 4GAMC 1XVBE 1XMFE 1FZ0E 1XMGE 1MHYG 1FZ5E 1XU5E 1FZ4E 1FZ1E 1FYZE 1XMHE 1MMOG 1FZHE 1XVFE 1XVEE 1XU3E 1MTYG 1FZ7E
chains in the Genus database with same CATH superfamily
2OVRB 2YB5A 3UO3A 2VJ5A 3NAEA 2FW3A 3SUQA 3SQ1A 2P1MB 3TL8B 4JRQA 3L0MA 1FXXA 2DY4A 3SUOA 4RL5A 4DTOA 1FS1A 1N1CA 3WSOA 4JS4A 3UO2A 1FZIE 3QEWA 1Q9YA 2QXFA 4M3XA 4FJ8A 4FJ9A 4KHYA 4AI6A 3SNNA 4M42A 1FZ0E 3SVIA 4FJXA 4E4BA 3RWUA 3E4WA 4KHUA 2PFVA 4FJKA 1MHYG 1LDKE 4FJ7A 3SQ4A 4FK4A 2RKHA 2ATQA 3HGKE 1XMHE 1MMOG 3N1EA 3HGLA 1FPOA 2B7MA 3KD1E 4KHQA 4J2BA 4M41A 2JHPA 3QEIA 2JQTA 2JHAA 2HD0A 4IT5A 3RMBA 3E4YA 3HL8A 3TJYA 3QNNA 3SPYA 3TAFA 3UIQA 4M3YA 2P1QB 2RCUA 3CFPA 3OGMB 5IREA 4HCBA 2MZWB 1MHZG 1FZ9E 4ADOA 3SJJA 4FVMA 4DTRA 3L2OB 3QETA 4AKHA 4DTPA 4RG8A 4M3WA 4FJJA 4FJNA 1XVBE 4AKGA 3RMAA 3CFRA 5IZ7A 2FYOA 2LF3A 3V7DB 3LD8A 2MW2A 3LDBA 4FJMA 4B08A 3QNOA 4E3SA 3J27A 1FZ4E 3BVOA 1FZHE 1IH7A 2PFTA 3NGIA 4KI4A 4QNDA 3RMDA 4QNCA 1XVEE 4EPHA 4JRPA 3SUPA 3KD5E 4AKIA 1FZ7E 3SI6A 5IBKB 1NEXB 3SQ2A 4FK0A 2E32A 4EYWA 3MKSB 4J2DA 1CLQA 1WAJA 2LF6A 1XVGE 1XVDE 3C94A 2E31A 3HP9A 3C6PB 3LZIA 4DTUA 3L8BA 1P22A 2OYQA 2P1OB 2P1PB 3LZJA 3CFOA 3J2PA 4GAMC 4ICGC 2VIXA 3SQ0A 4I9QA 3QEVA 4M3TA 2DTUA 4FK2A 2P5OA 3L1NA 3C6NB 4M45A 1FZ5E 2K5SA 4KI6A 4J2AA 4DU4A 4X5MA 3QEPA 1FYZE 4DTJA 3TAEA 2DEBA 2P5GA 3QERA 4KHNA 3C95A 3QESA 3CQ8A 3K2OA 1WAFA 1XL3C 4RNGA 3NHGA 1XU3E 1MTYG 4M3RA 4DTXA 4I9LA 3TABA 1JW2A 2P1NB 1Q9XA 3N1BA 3NE6A 2OZMA 1XVCE 3SPZA 4I6JB 1FZ8E 4FJGA 4X5NA 4DTMA 5H37A 1FZ2E 2JHCA 3OGLB 4KHSA 4KHWA 4JS5A 4DTNA 4J2EA 2JH9A 4DU1A 3LDSA 1FZ3E 1FZ6E 4HCCA 2JPNA 4FJIA 2MMBA 2H4TA 1XMFE 4M3UA 2OVPB 4FJ5A 1XMGE 3SUNA 4DTSA 3RMCA 1XU5E 4ADNA 3NDKA 1XVFE 1FZ1E 4DU3A 3QEXA 2OZSA 4FJLA 4EP9A 3NCIA 3SCXA 4FJHA 2B1EA 1IG9A 2OVQB 4M3ZA 3S9HA 2VJ4A 3C6OB 3TAGA 2B8IA 3OGKB 2JH8A
chains in the Genus database with same CATH topology
2OVRB 2YB5A 2VJ5A 3NAEA 2FW3A 3SUQA 3SQ1A 2P1MB 3TL8B 4JRQA 3L0MA 1FXXA 2DY4A 3SUOA 4RL5A 4DTOA 1FS1A 3WSOA 4JS4A 1FZIE 3QEWA 1Q9YA 2QXFA 4M3XA 4FJ8A 4FJ9A 4KHYA 4AI6A 3SNNA 4M42A 1FZ0E 3SVIA 4FJXA 4E4BA 3RWUA 3E4WA 4KHUA 2PFVA 4FJKA 1MHYG 1LDKE 4FJ7A 3SQ4A 4FK4A 2ATQA 3HGKE 1XMHE 1MMOG 3N1EA 3HGLA 2B7MA 3KD1E 4KHQA 4J2BA 4M41A 2JHPA 3QEIA 2JHAA 2HD0A 3RMBA 3E4YA 3HL8A 3TJYA 3QNNA 3SPYA 3TAFA 3UIQA 4M3YA 2P1QB 2RCUA 3CFPA 3OGMB 5IREA 4HCBA 2MZWB 1MHZG 1FZ9E 4ADOA 3SJJA 4FVMA 4DTRA 3L2OB 3QETA 4AKHA 4DTPA 4RG8A 4M3WA 4FJJA 4FJNA 1XVBE 4AKGA 3RMAA 3CFRA 5IZ7A 2FYOA 2LF3A 3V7DB 3LD8A 3LDBA 4FJMA 4B08A 3QNOA 4E3SA 3J27A 1FZ4E 2PFTA 1FZHE 1IH7A 3NGIA 4KI4A 4QNDA 3RMDA 4QNCA 1XVEE 4EPHA 4JRPA 3SUPA 3KD5E 4AKIA 1FZ7E 3SI6A 5IBKB 1NEXB 3SQ2A 4FK0A 2E32A 4EYWA 3MKSB 4J2DA 1CLQA 1WAJA 2LF6A 1XVGE 1XVDE 3C94A 2E31A 3HP9A 3C6PB 3LZIA 4DTUA 3L8BA 1P22A 2OYQA 2P1OB 2P1PB 3LZJA 3CFOA 3J2PA 4GAMC 2VIXA 3SQ0A 4I9QA 3QEVA 4M3TA 2DTUA 4FK2A 2P5OA 3L1NA 3C6NB 4M45A 1FZ5E 4KI6A 4J2AA 4DU4A 4X5MA 3QEPA 1FYZE 4DTJA 3TAEA 2DEBA 2P5GA 3QERA 4KHNA 3C95A 3QESA 3CQ8A 3K2OA 1WAFA 1XL3C 4RNGA 3NHGA 1XU3E 1MTYG 4M3RA 4DTXA 4I9LA 3TABA 2P1NB 1Q9XA 3N1BA 3NE6A 2OZMA 1XVCE 3SPZA 4I6JB 1FZ8E 4FJGA 4X5NA 4DTMA 5H37A 1FZ2E 2JHCA 3OGLB 4KHSA 4KHWA 4JS5A 4DTNA 4J2EA 2JH9A 4DU1A 3LDSA 1FZ3E 1FZ6E 4HCCA 2JPNA 4FJIA 2MMBA 2H4TA 1XMFE 4M3UA 2OVPB 4FJ5A 1XMGE 3SUNA 4DTSA 3RMCA 1XU5E 4ADNA 3NDKA 1XVFE 1FZ1E 4DU3A 3QEXA 2OZSA 4FJLA 4EP9A 3NCIA 3SCXA 4FJHA 2B1EA 1IG9A 2OVQB 4M3ZA 3S9HA 2VJ4A 3C6OB 3TAGA 2B8IA 3OGKB 2JH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVC E;  1FZ8 E;  1XVG E;  1XVD E;  1FZ2 E;  1MHZ G;  1FZ9 E;  1FZ3 E;  1FZ6 E;  1FZI E;  4GAM C;  1XVB E;  1XMF E;  1FZ0 E;  1XMG E;  1MHY G;  1FZ5 E;  1XU5 E;  1FZ4 E;  1FZ1 E;  1FYZ E;  1XMH E;  1MMO G;  1FZH E;  1XVF E;  1XVE E;  1XU3 E;  1MTY G;  1FZ7 E; 
#chains in the Genus database with same CATH topology
 2OVR B;  2YB5 A;  3UO3 A;  2VJ5 A;  3NAE A;  2FW3 A;  3SUQ A;  3SQ1 A;  2P1M B;  3TL8 B;  4JRQ A;  3L0M A;  1FXX A;  2DY4 A;  3SUO A;  4RL5 A;  4DTO A;  1FS1 A;  1N1C A;  3WSO A;  4JS4 A;  3UO2 A;  1FZI E;  3QEW A;  1Q9Y A;  2QXF A;  4M3X A;  4FJ8 A;  4FJ9 A;  4KHY A;  4AI6 A;  3SNN A;  4M42 A;  1FZ0 E;  3SVI A;  4FJX A;  4E4B A;  3RWU A;  3E4W A;  4KHU A;  2PFV A;  4FJK A;  1MHY G;  1LDK E;  4FJ7 A;  3SQ4 A;  4FK4 A;  2RKH A;  2ATQ A;  3HGK E;  1XMH E;  1MMO G;  3N1E A;  3HGL A;  1FPO A;  2B7M A;  3KD1 E;  4KHQ A;  4J2B A;  4M41 A;  2JHP A;  3QEI A;  2JQT A;  2JHA A;  2HD0 A;  4IT5 A;  3RMB A;  3E4Y A;  3HL8 A;  3TJY A;  3QNN A;  3SPY A;  3TAF A;  3UIQ A;  4M3Y A;  2P1Q B;  2RCU A;  3CFP A;  3OGM B;  5IRE A;  4HCB A;  2MZW B;  1MHZ G;  1FZ9 E;  4ADO A;  3SJJ A;  4FVM A;  4DTR A;  3L2O B;  3QET A;  4AKH A;  4DTP A;  4RG8 A;  4M3W A;  4FJJ A;  4FJN A;  1XVB E;  4AKG A;  3RMA A;  3CFR A;  5IZ7 A;  2FYO A;  2LF3 A;  3V7D B;  3LD8 A;  2MW2 A;  3LDB A;  4FJM A;  4B08 A;  3QNO A;  4E3S A;  3J27 A;  1FZ4 E;  3BVO A;  1FZH E;  1IH7 A;  2PFT A;  3NGI A;  4KI4 A;  4QND A;  3RMD A;  4QNC A;  1XVE E;  4EPH A;  4JRP A;  3SUP A;  3KD5 E;  4AKI A;  1FZ7 E;  3SI6 A;  5IBK B;  1NEX B;  3SQ2 A;  4FK0 A;  2E32 A;  4EYW A;  3MKS B;  4J2D A;  1CLQ A;  1WAJ A;  2LF6 A;  1XVG E;  1XVD E;  3C94 A;  2E31 A;  3HP9 A;  3C6P B;  3LZI A;  4DTU A;  3L8B A;  1P22 A;  2OYQ A;  2P1O B;  2P1P B;  3LZJ A;  3CFO A;  3J2P A;  4GAM C;  4ICG C;  2VIX A;  3SQ0 A;  4I9Q A;  3QEV A;  4M3T A;  2DTU A;  4FK2 A;  2P5O A;  3L1N A;  3C6N B;  4M45 A;  1FZ5 E;  2K5S A;  4KI6 A;  4J2A A;  4DU4 A;  4X5M A;  3QEP A;  1FYZ E;  4DTJ A;  3TAE A;  2DEB A;  2P5G A;  3QER A;  4KHN A;  3C95 A;  3QES A;  3CQ8 A;  3K2O A;  1WAF A;  1XL3 C;  4RNG A;  3NHG A;  1XU3 E;  1MTY G;  4M3R A;  4DTX A;  4I9L A;  3TAB A;  1JW2 A;  2P1N B;  1Q9X A;  3N1B A;  3NE6 A;  2OZM A;  1XVC E;  3SPZ A;  4I6J B;  1FZ8 E;  4FJG A;  4X5N A;  4DTM A;  5H37 A;  1FZ2 E;  2JHC A;  3OGL B;  4KHS A;  4KHW A;  4JS5 A;  4DTN A;  4J2E A;  2JH9 A;  4DU1 A;  3LDS A;  1FZ3 E;  1FZ6 E;  4HCC A;  2JPN A;  4FJI A;  2MMB A;  2H4T A;  1XMF E;  4M3U A;  2OVP B;  4FJ5 A;  1XMG E;  3SUN A;  4DTS A;  3RMC A;  1XU5 E;  4ADN A;  3NDK A;  1XVF E;  1FZ1 E;  4DU3 A;  3QEX A;  2OZS A;  4FJL A;  4EP9 A;  3NCI A;  3SCX A;  4FJH A;  2B1E A;  1IG9 A;  2OVQ B;  4M3Z A;  3S9H A;  2VJ4 A;  3C6O B;  3TAG A;  2B8I A;  3OGK B;  2JH8 A; 
#chains in the Genus database with same CATH homology
 2OVR B;  2YB5 A;  2VJ5 A;  3NAE A;  2FW3 A;  3SUQ A;  3SQ1 A;  2P1M B;  3TL8 B;  4JRQ A;  3L0M A;  1FXX A;  2DY4 A;  3SUO A;  4RL5 A;  4DTO A;  1FS1 A;  3WSO A;  4JS4 A;  1FZI E;  3QEW A;  1Q9Y A;  2QXF A;  4M3X A;  4FJ8 A;  4FJ9 A;  4KHY A;  4AI6 A;  3SNN A;  4M42 A;  1FZ0 E;  3SVI A;  4FJX A;  4E4B A;  3RWU A;  3E4W A;  4KHU A;  2PFV A;  4FJK A;  1MHY G;  1LDK E;  4FJ7 A;  3SQ4 A;  4FK4 A;  2ATQ A;  3HGK E;  1XMH E;  1MMO G;  3N1E A;  3HGL A;  2B7M A;  3KD1 E;  4KHQ A;  4J2B A;  4M41 A;  2JHP A;  3QEI A;  2JHA A;  2HD0 A;  3RMB A;  3E4Y A;  3HL8 A;  3TJY A;  3QNN A;  3SPY A;  3TAF A;  3UIQ A;  4M3Y A;  2P1Q B;  2RCU A;  3CFP A;  3OGM B;  5IRE A;  4HCB A;  2MZW B;  1MHZ G;  1FZ9 E;  4ADO A;  3SJJ A;  4FVM A;  4DTR A;  3L2O B;  3QET A;  4AKH A;  4DTP A;  4RG8 A;  4M3W A;  4FJJ A;  4FJN A;  1XVB E;  4AKG A;  3RMA A;  3CFR A;  5IZ7 A;  2FYO A;  2LF3 A;  3V7D B;  3LD8 A;  3LDB A;  4FJM A;  4B08 A;  3QNO A;  4E3S A;  3J27 A;  1FZ4 E;  2PFT A;  1FZH E;  1IH7 A;  3NGI A;  4KI4 A;  4QND A;  3RMD A;  4QNC A;  1XVE E;  4EPH A;  4JRP A;  3SUP A;  3KD5 E;  4AKI A;  1FZ7 E;  3SI6 A;  5IBK B;  1NEX B;  3SQ2 A;  4FK0 A;  2E32 A;  4EYW A;  3MKS B;  4J2D A;  1CLQ A;  1WAJ A;  2LF6 A;  1XVG E;  1XVD E;  3C94 A;  2E31 A;  3HP9 A;  3C6P B;  3LZI A;  4DTU A;  3L8B A;  1P22 A;  2OYQ A;  2P1O B;  2P1P B;  3LZJ A;  3CFO A;  3J2P A;  4GAM C;  2VIX A;  3SQ0 A;  4I9Q A;  3QEV A;  4M3T A;  2DTU A;  4FK2 A;  2P5O A;  3L1N A;  3C6N B;  4M45 A;  1FZ5 E;  4KI6 A;  4J2A A;  4DU4 A;  4X5M A;  3QEP A;  1FYZ E;  4DTJ A;  3TAE A;  2DEB A;  2P5G A;  3QER A;  4KHN A;  3C95 A;  3QES A;  3CQ8 A;  3K2O A;  1WAF A;  1XL3 C;  4RNG A;  3NHG A;  1XU3 E;  1MTY G;  4M3R A;  4DTX A;  4I9L A;  3TAB A;  2P1N B;  1Q9X A;  3N1B A;  3NE6 A;  2OZM A;  1XVC E;  3SPZ A;  4I6J B;  1FZ8 E;  4FJG A;  4X5N A;  4DTM A;  5H37 A;  1FZ2 E;  2JHC A;  3OGL B;  4KHS A;  4KHW A;  4JS5 A;  4DTN A;  4J2E A;  2JH9 A;  4DU1 A;  3LDS A;  1FZ3 E;  1FZ6 E;  4HCC A;  2JPN A;  4FJI A;  2MMB A;  2H4T A;  1XMF E;  4M3U A;  2OVP B;  4FJ5 A;  1XMG E;  3SUN A;  4DTS A;  3RMC A;  1XU5 E;  4ADN A;  3NDK A;  1XVF E;  1FZ1 E;  4DU3 A;  3QEX A;  2OZS A;  4FJL A;  4EP9 A;  3NCI A;  3SCX A;  4FJH A;  2B1E A;  1IG9 A;  2OVQ B;  4M3Z A;  3S9H A;  2VJ4 A;  3C6O B;  3TAG A;  2B8I A;  3OGK B;  2JH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...