1FZ1E

Methane monooxygenase hydroxylase, form iii oxidized
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz1E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz1E02
1FZ8E 1MHYG 1XVGE 1XMGE 1XMFE 1FZ5E 1FZ3E 1FYZE 1FZ6E 1MTYG 1XU3E 1FZ0E 1MHZG 1XVDE 1XU5E 1XVEE 1MMOG 1XVCE 1XVFE 1FZ9E 1XMHE 4GAMC 1FZ1E 1FZIE 1FZ4E 1FZ2E 1FZHE 1FZ7E 1XVBE
chains in the Genus database with same CATH superfamily
1NEXB 1FZ8E 3SPZA 4FJIA 2OYQA 1WAFA 2VJ5A 3MKSB 2RCUA 4FJKA 1JW2A 4FJ7A 4RNGA 2LF3A 4JRQA 4M3TA 1XL3C 3KD5E 1FZ6E 4E4BA 4ADNA 3C6OB 4KHUA 2E32A 3HL8A 4KHSA 1FZ0E 1XU3E 3SQ4A 2DEBA 3CFPA 3SUQA 2RKHA 4I9LA 4FJ9A 3QEPA 4I9QA 3CFRA 2P5OA 2PFVA 3NGIA 3NE6A 4AI6A 3C6NB 4E3SA 3HGLA 2OZMA 2ATQA 1XMHE 3CFOA 2OVQB 4RG8A 3TL8B 2QXFA 4DTUA 4AKHA 1FZ4E 5IBKB 1FZ2E 3KD1E 4DTPA 3HGKE 1XVCE 3NAEA 3RMCA 2B1EA 4KHYA 2JPNA 3NCIA 1MHYG 2P1QB 3UO2A 4KHNA 3SVIA 4EP9A 3J2PA 2JHPA 2MW2A 2YB5A 4KI6A 1XMGE 1XMFE 3SQ2A 2E31A 4DTXA 3E4YA 1IH7A 4RL5A 3L1NA 2OVPB 3OGKB 3SQ1A 4B08A 4FK0A 4FJGA 2LF6A 3K2OA 3E4WA 4J2DA 1MHZG 2VJ4A 2PFTA 3UIQA 4M3ZA 4J2AA 4FVMA 3QETA 4KHQA 4M3UA 3WSOA 3TJYA 3L0MA 1FZ9E 2P1MB 1FZIE 2JH8A 4X5NA 3SUNA 3BVOA 2DTUA 4EYWA 3LZIA 1FZHE 3TABA 4DTJA 3LZJA 3TAFA 3LD8A 3NDKA 4FK4A 1P22A 3C6PB 3N1BA 3RMAA 4FJJA 4J2EA 4M3XA 1XVGE 2FYOA 4QNDA 3LDSA 3QNNA 4M41A 3QERA 3QNOA 4FJNA 4DU1A 2OZSA 1FZ3E 2MZWB 1FPOA 3UO3A 4DTNA 3QESA 3SNNA 1MTYG 4KI4A 3LDBA 4AKIA 4M42A 3L2OB 2JH9A 2P1PB 1FS1A 5IREA 4JRPA 1XVDE 3SUPA 3C94A 3QEWA 3SCXA 4IT5A 4JS4A 3SJJA 4FK2A 4EPHA 3C95A 4M3YA 2OVRB 3TAGA 4HCCA 2DY4A 1MMOG 4FJXA 4X5MA 3SQ0A 2P1NB 3N1EA 4QNCA 4KHWA 1Q9XA 1CLQA 4JS5A 2H4TA 1FZ7E 1WAJA 3SUOA 5IZ7A 4DU3A 4FJ5A 4M45A 4I6JB 1FXXA 2JHCA 3QEIA 3RMBA 3RMDA 1FZ5E 4M3RA 3QEXA 1IG9A 2B8IA 4DTSA 3OGMB 3NHGA 1FYZE 2B7MA 3L8BA 4DTOA 3SI6A 4FJ8A 2MMBA 3HP9A 2HD0A 3SPYA 4FJMA 4DU4A 3J27A 1N1CA 3OGLB 4HCBA 4ICGC 1XU5E 2P1OB 3V7DB 3CQ8A 3TAEA 2P5GA 3QEVA 1XVEE 3S9HA 2JHAA 1Q9YA 4DTRA 2K5SA 1LDKE 1XVFE 2FW3A 2VIXA 3RWUA 4GAMC 4ADOA 1FZ1E 5H37A 4DTMA 4FJLA 2JQTA 4FJHA 4J2BA 4M3WA 4AKGA 1XVBE
chains in the Genus database with same CATH topology
1NEXB 1FZ8E 3SPZA 4FJIA 2OYQA 1WAFA 2VJ5A 3MKSB 2RCUA 4FJKA 4FJ7A 4RNGA 2LF3A 4JRQA 4M3TA 1XL3C 3KD5E 1FZ6E 4E4BA 4ADNA 3C6OB 4KHUA 2E32A 3HL8A 4KHSA 1FZ0E 1XU3E 3SQ4A 2DEBA 3CFPA 3SUQA 4I9LA 4FJ9A 3QEPA 4I9QA 3CFRA 2P5OA 2PFVA 3NGIA 3NE6A 4AI6A 3C6NB 4E3SA 3HGLA 2OZMA 2ATQA 1XMHE 3CFOA 2OVQB 4RG8A 3TL8B 2QXFA 4DTUA 4AKHA 1FZ4E 5IBKB 1FZ2E 3KD1E 4DTPA 3HGKE 1XVCE 3NAEA 3RMCA 2B1EA 4KHYA 2JPNA 3NCIA 1MHYG 2P1QB 4KHNA 3SVIA 4EP9A 3J2PA 2JHPA 2YB5A 4KI6A 1XMGE 1XMFE 3SQ2A 2E31A 4DTXA 3E4YA 1IH7A 4RL5A 3L1NA 2OVPB 3OGKB 3SQ1A 4B08A 4FK0A 4FJGA 2LF6A 3K2OA 3E4WA 4J2DA 1MHZG 2VJ4A 2PFTA 3UIQA 4M3ZA 4J2AA 4FVMA 3QETA 4KHQA 4M3UA 3WSOA 3TJYA 3L0MA 1FZ9E 2P1MB 1FZIE 2JH8A 4X5NA 3SUNA 2DTUA 4EYWA 3LZIA 1FZHE 3TABA 4DTJA 3LZJA 3TAFA 3LD8A 3NDKA 4FK4A 1P22A 3C6PB 3N1BA 3RMAA 4FJJA 4J2EA 4M3XA 1XVGE 2FYOA 4QNDA 3LDSA 3QNNA 4M41A 3QERA 3QNOA 4FJNA 4DU1A 2OZSA 1FZ3E 2MZWB 4KI4A 4AKIA 4DTNA 3QESA 3SNNA 1MTYG 3LDBA 4M42A 3L2OB 2JH9A 2P1PB 1FS1A 5IREA 4JRPA 1XVDE 3SUPA 3C94A 3QEWA 3SCXA 3SJJA 4JS4A 4FK2A 4EPHA 3C95A 4M3YA 2OVRB 3TAGA 4HCCA 2DY4A 1MMOG 4FJXA 4X5MA 3SQ0A 2P1NB 3N1EA 4QNCA 4KHWA 1Q9XA 1CLQA 4JS5A 2H4TA 1FZ7E 1WAJA 3SUOA 5IZ7A 4DU3A 4FJ5A 4M45A 4I6JB 1FXXA 2JHCA 3QEIA 3RMBA 3RMDA 1FZ5E 4M3RA 3QEXA 1IG9A 2B8IA 4DTSA 3OGMB 3NHGA 1FYZE 2B7MA 3L8BA 4DTOA 3SI6A 4FJ8A 2MMBA 3HP9A 2HD0A 3SPYA 4FJMA 4DU4A 3J27A 3OGLB 4HCBA 2P5GA 1XU5E 2P1OB 3V7DB 3CQ8A 3TAEA 3QEVA 1XVEE 3S9HA 2JHAA 1Q9YA 4DTRA 1LDKE 1XVFE 2FW3A 2VIXA 3RWUA 4GAMC 4ADOA 1FZ1E 5H37A 4DTMA 4FJLA 4FJHA 4J2BA 4M3WA 4AKGA 1XVBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ8 E;  1MHY G;  1XVG E;  1XMG E;  1XMF E;  1FZ5 E;  1FZ3 E;  1FYZ E;  1FZ6 E;  1MTY G;  1XU3 E;  1FZ0 E;  1MHZ G;  1XVD E;  1XU5 E;  1XVE E;  1MMO G;  1XVC E;  1XVF E;  1FZ9 E;  1XMH E;  4GAM C;  1FZ1 E;  1FZI E;  1FZ4 E;  1FZ2 E;  1FZH E;  1FZ7 E;  1XVB E; 
#chains in the Genus database with same CATH topology
 1NEX B;  1FZ8 E;  3SPZ A;  4FJI A;  2OYQ A;  1WAF A;  2VJ5 A;  3MKS B;  2RCU A;  4FJK A;  1JW2 A;  4FJ7 A;  4RNG A;  2LF3 A;  4JRQ A;  4M3T A;  1XL3 C;  3KD5 E;  1FZ6 E;  4E4B A;  4ADN A;  3C6O B;  4KHU A;  2E32 A;  3HL8 A;  4KHS A;  1FZ0 E;  1XU3 E;  3SQ4 A;  2DEB A;  3CFP A;  3SUQ A;  2RKH A;  4I9L A;  4FJ9 A;  3QEP A;  4I9Q A;  3CFR A;  2P5O A;  2PFV A;  3NGI A;  3NE6 A;  4AI6 A;  3C6N B;  4E3S A;  3HGL A;  2OZM A;  2ATQ A;  1XMH E;  3CFO A;  2OVQ B;  4RG8 A;  3TL8 B;  2QXF A;  4DTU A;  4AKH A;  1FZ4 E;  5IBK B;  1FZ2 E;  3KD1 E;  4DTP A;  3HGK E;  1XVC E;  3NAE A;  3RMC A;  2B1E A;  4KHY A;  2JPN A;  3NCI A;  1MHY G;  2P1Q B;  3UO2 A;  4KHN A;  3SVI A;  4EP9 A;  3J2P A;  2JHP A;  2MW2 A;  2YB5 A;  4KI6 A;  1XMG E;  1XMF E;  3SQ2 A;  2E31 A;  4DTX A;  3E4Y A;  1IH7 A;  4RL5 A;  3L1N A;  2OVP B;  3OGK B;  3SQ1 A;  4B08 A;  4FK0 A;  4FJG A;  2LF6 A;  3K2O A;  3E4W A;  4J2D A;  1MHZ G;  2VJ4 A;  2PFT A;  3UIQ A;  4M3Z A;  4J2A A;  4FVM A;  3QET A;  4KHQ A;  4M3U A;  3WSO A;  3TJY A;  3L0M A;  1FZ9 E;  2P1M B;  1FZI E;  2JH8 A;  4X5N A;  3SUN A;  3BVO A;  2DTU A;  4EYW A;  3LZI A;  1FZH E;  3TAB A;  4DTJ A;  3LZJ A;  3TAF A;  3LD8 A;  3NDK A;  4FK4 A;  1P22 A;  3C6P B;  3N1B A;  3RMA A;  4FJJ A;  4J2E A;  4M3X A;  1XVG E;  2FYO A;  4QND A;  3LDS A;  3QNN A;  4M41 A;  3QER A;  3QNO A;  4FJN A;  4DU1 A;  2OZS A;  1FZ3 E;  2MZW B;  1FPO A;  3UO3 A;  4DTN A;  3QES A;  3SNN A;  1MTY G;  4KI4 A;  3LDB A;  4AKI A;  4M42 A;  3L2O B;  2JH9 A;  2P1P B;  1FS1 A;  5IRE A;  4JRP A;  1XVD E;  3SUP A;  3C94 A;  3QEW A;  3SCX A;  4IT5 A;  4JS4 A;  3SJJ A;  4FK2 A;  4EPH A;  3C95 A;  4M3Y A;  2OVR B;  3TAG A;  4HCC A;  2DY4 A;  1MMO G;  4FJX A;  4X5M A;  3SQ0 A;  2P1N B;  3N1E A;  4QNC A;  4KHW A;  1Q9X A;  1CLQ A;  4JS5 A;  2H4T A;  1FZ7 E;  1WAJ A;  3SUO A;  5IZ7 A;  4DU3 A;  4FJ5 A;  4M45 A;  4I6J B;  1FXX A;  2JHC A;  3QEI A;  3RMB A;  3RMD A;  1FZ5 E;  4M3R A;  3QEX A;  1IG9 A;  2B8I A;  4DTS A;  3OGM B;  3NHG A;  1FYZ E;  2B7M A;  3L8B A;  4DTO A;  3SI6 A;  4FJ8 A;  2MMB A;  3HP9 A;  2HD0 A;  3SPY A;  4FJM A;  4DU4 A;  3J27 A;  1N1C A;  3OGL B;  4HCB A;  4ICG C;  1XU5 E;  2P1O B;  3V7D B;  3CQ8 A;  3TAE A;  2P5G A;  3QEV A;  1XVE E;  3S9H A;  2JHA A;  1Q9Y A;  4DTR A;  2K5S A;  1LDK E;  1XVF E;  2FW3 A;  2VIX A;  3RWU A;  4GAM C;  4ADO A;  1FZ1 E;  5H37 A;  4DTM A;  4FJL A;  2JQT A;  4FJH A;  4J2B A;  4M3W A;  4AKG A;  1XVB E; 
#chains in the Genus database with same CATH homology
 1NEX B;  1FZ8 E;  3SPZ A;  4FJI A;  2OYQ A;  1WAF A;  2VJ5 A;  3MKS B;  2RCU A;  4FJK A;  4FJ7 A;  4RNG A;  2LF3 A;  4JRQ A;  4M3T A;  1XL3 C;  3KD5 E;  1FZ6 E;  4E4B A;  4ADN A;  3C6O B;  4KHU A;  2E32 A;  3HL8 A;  4KHS A;  1FZ0 E;  1XU3 E;  3SQ4 A;  2DEB A;  3CFP A;  3SUQ A;  4I9L A;  4FJ9 A;  3QEP A;  4I9Q A;  3CFR A;  2P5O A;  2PFV A;  3NGI A;  3NE6 A;  4AI6 A;  3C6N B;  4E3S A;  3HGL A;  2OZM A;  2ATQ A;  1XMH E;  3CFO A;  2OVQ B;  4RG8 A;  3TL8 B;  2QXF A;  4DTU A;  4AKH A;  1FZ4 E;  5IBK B;  1FZ2 E;  3KD1 E;  4DTP A;  3HGK E;  1XVC E;  3NAE A;  3RMC A;  2B1E A;  4KHY A;  2JPN A;  3NCI A;  1MHY G;  2P1Q B;  4KHN A;  3SVI A;  4EP9 A;  3J2P A;  2JHP A;  2YB5 A;  4KI6 A;  1XMG E;  1XMF E;  3SQ2 A;  2E31 A;  4DTX A;  3E4Y A;  1IH7 A;  4RL5 A;  3L1N A;  2OVP B;  3OGK B;  3SQ1 A;  4B08 A;  4FK0 A;  4FJG A;  2LF6 A;  3K2O A;  3E4W A;  4J2D A;  1MHZ G;  2VJ4 A;  2PFT A;  3UIQ A;  4M3Z A;  4J2A A;  4FVM A;  3QET A;  4KHQ A;  4M3U A;  3WSO A;  3TJY A;  3L0M A;  1FZ9 E;  2P1M B;  1FZI E;  2JH8 A;  4X5N A;  3SUN A;  2DTU A;  4EYW A;  3LZI A;  1FZH E;  3TAB A;  4DTJ A;  3LZJ A;  3TAF A;  3LD8 A;  3NDK A;  4FK4 A;  1P22 A;  3C6P B;  3N1B A;  3RMA A;  4FJJ A;  4J2E A;  4M3X A;  1XVG E;  2FYO A;  4QND A;  3LDS A;  3QNN A;  4M41 A;  3QER A;  3QNO A;  4FJN A;  4DU1 A;  2OZS A;  1FZ3 E;  2MZW B;  4KI4 A;  4AKI A;  4DTN A;  3QES A;  3SNN A;  1MTY G;  3LDB A;  4M42 A;  3L2O B;  2JH9 A;  2P1P B;  1FS1 A;  5IRE A;  4JRP A;  1XVD E;  3SUP A;  3C94 A;  3QEW A;  3SCX A;  3SJJ A;  4JS4 A;  4FK2 A;  4EPH A;  3C95 A;  4M3Y A;  2OVR B;  3TAG A;  4HCC A;  2DY4 A;  1MMO G;  4FJX A;  4X5M A;  3SQ0 A;  2P1N B;  3N1E A;  4QNC A;  4KHW A;  1Q9X A;  1CLQ A;  4JS5 A;  2H4T A;  1FZ7 E;  1WAJ A;  3SUO A;  5IZ7 A;  4DU3 A;  4FJ5 A;  4M45 A;  4I6J B;  1FXX A;  2JHC A;  3QEI A;  3RMB A;  3RMD A;  1FZ5 E;  4M3R A;  3QEX A;  1IG9 A;  2B8I A;  4DTS A;  3OGM B;  3NHG A;  1FYZ E;  2B7M A;  3L8B A;  4DTO A;  3SI6 A;  4FJ8 A;  2MMB A;  3HP9 A;  2HD0 A;  3SPY A;  4FJM A;  4DU4 A;  3J27 A;  3OGL B;  4HCB A;  2P5G A;  1XU5 E;  2P1O B;  3V7D B;  3CQ8 A;  3TAE A;  3QEV A;  1XVE E;  3S9H A;  2JHA A;  1Q9Y A;  4DTR A;  1LDK E;  1XVF E;  2FW3 A;  2VIX A;  3RWU A;  4GAM C;  4ADO A;  1FZ1 E;  5H37 A;  4DTM A;  4FJL A;  4FJH A;  4J2B A;  4M3W A;  4AKG A;  1XVB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...