1FZ1E

Methane monooxygenase hydroxylase, form iii oxidized
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz1E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz1E02
4GAMC 1XMFE 1MMOG 1XVGE 1FZ4E 1XVDE 1XU5E 1FZ0E 1XVCE 1XU3E 1MHZG 1FZ5E 1FZ3E 1MTYG 1FZ8E 1XMGE 1FZHE 1XMHE 1FZ7E 1FZ1E 1FZ2E 1FZIE 1FZ6E 1MHYG 1FYZE 1XVEE 1XVBE 1XVFE 1FZ9E
chains in the Genus database with same CATH superfamily
1XMFE 4X5MA 3HGLA 3LDSA 1MMOG 1P22A 3LZJA 3QEIA 4E4BA 3J2PA 2DY4A 4AKHA 1FZ4E 4M41A 4FJ5A 1XU5E 4J2BA 3QETA 2MMBA 4M3UA 3E4WA 3QEXA 4HCBA 5H37A 2OVQB 3TAFA 1WAFA 3WSOA 3C95A 4J2AA 4DTJA 1Q9XA 2JHCA 3RMCA 1Q9YA 2E32A 3HL8A 3QNOA 4FVMA 4M3WA 2PFVA 1NEXB 3V7DB 1MTYG 4EPHA 4I6JB 3NE6A 4M3XA 2OZSA 4HCCA 2P1QB 3S9HA 3SUNA 4DTUA 4EYWA 4FJ8A 3SNNA 4ICGC 2FYOA 3TAEA 3L2OB 3TJYA 4AKIA 3OGKB 3UIQA 3CFOA 4M42A 4I9LA 3L1NA 3SPZA 2RCUA 4FK4A 3RWUA 2DTUA 2B7MA 2JH9A 4FJJA 3LD8A 4FJ7A 1CLQA 3HP9A 3L8BA 1N1CA 4KI6A 4QNDA 4DTPA 1XVGE 3QERA 4DTNA 4FJGA 1XVDE 3NCIA 3C6NB 4JRQA 4M3TA 1FXXA 3J27A 4DU1A 1FPOA 1IG9A 1MHZG 2OZMA 4IT5A 2OYQA 4RL5A 3SQ1A 2B1EA 4JS5A 2P1PB 3UO2A 4DTRA 4QNCA 2MZWB 1FZHE 1XMHE 4JS4A 3RMAA 4DU4A 3OGLB 4KHWA 4DTXA 3CFPA 2P5OA 4E3SA 3OGMB 2FW3A 3SVIA 4AKGA 3NHGA 4DTSA 4FJXA 4FJ9A 3CQ8A 1XVEE 2JHPA 3K2OA 2P1NB 4FJNA 3SUPA 2LF6A 2JQTA 2VIXA 5IBKB 2OVRB 3SQ2A 3L0MA 3N1EA 2ATQA 4KHNA 1FZ0E 4I9QA 2VJ4A 1XL3C 1XVCE 2JPNA 3BVOA 4KI4A 5IREA 3C6PB 1FZ5E 1FZ3E 3LDBA 2MW2A 3LZIA 1XMGE 1JW2A 4FJMA 2K5SA 4B08A 2OVPB 4ADOA 4KHQA 3SI6A 1WAJA 4ADNA 3TL8B 2P5GA 3SJJA 3TABA 4FJIA 1MHYG 4M3RA 2LF3A 1FYZE 2DEBA 2JH8A 1XVBE 4FJHA 1XVFE 3C6OB 1FZ9E 4EP9A 3QEVA 3RMDA 4GAMC 2QXFA 4J2EA 4J2DA 2JHAA 4KHUA 2YB5A 4FJKA 3UO3A 4AI6A 4JRPA 3QESA 3SPYA 4RG8A 4FJLA 3C94A 1LDKE 3SQ4A 2RKHA 1XU3E 4DTOA 4X5NA 3E4YA 2HD0A 3N1BA 3KD5E 3NAEA 2B8IA 3KD1E 1FZ8E 2VJ5A 3QEWA 4KHYA 4RNGA 4DU3A 3SUQA 2P1MB 1FZ7E 1FZ1E 2E31A 2H4TA 2P1OB 3HGKE 4FK2A 1FZ2E 3SCXA 1FZIE 3NDKA 3NGIA 1FS1A 1FZ6E 3TAGA 4M3YA 4M3ZA 3SUOA 2PFTA 3SQ0A 4FK0A 4KHSA 4M45A 1IH7A 4DTMA 3QNNA 5IZ7A 3QEPA 3RMBA 3MKSB 3CFRA
chains in the Genus database with same CATH topology
1XMFE 4X5MA 3HGLA 3LDSA 1MMOG 1P22A 3LZJA 3QEIA 4E4BA 3J2PA 2DY4A 4AKHA 1FZ4E 4M41A 4FJ5A 1XU5E 4J2BA 3QETA 2MMBA 4M3UA 3E4WA 3QEXA 4HCBA 5H37A 2OVQB 3TAFA 1WAFA 3WSOA 3C95A 4J2AA 4DTJA 1Q9XA 2JHCA 3RMCA 1Q9YA 2E32A 3HL8A 3QNOA 4FVMA 4M3WA 2PFVA 1NEXB 3V7DB 1MTYG 4EPHA 4I6JB 3NE6A 4M3XA 2OZSA 4HCCA 2P1QB 3S9HA 3SUNA 4DTUA 4EYWA 4FJ8A 3SNNA 2FYOA 3TAEA 3L2OB 3TJYA 4AKIA 3OGKB 3UIQA 3CFOA 4M42A 4I9LA 3L1NA 3SPZA 2RCUA 4FK4A 3RWUA 2DTUA 2B7MA 2JH9A 4FJJA 3LD8A 4FJ7A 1CLQA 3HP9A 3L8BA 4KI6A 4QNDA 4DTPA 1XVGE 3QERA 4DTNA 4FJGA 1XVDE 3NCIA 3C6NB 4JRQA 4M3TA 1FXXA 3J27A 4DU1A 1IG9A 1MHZG 2OZMA 2OYQA 4RL5A 3SQ1A 2B1EA 4JS5A 2P1PB 4DTRA 4QNCA 2MZWB 1FZHE 1XMHE 4JS4A 3RMAA 4DU4A 3OGLB 4KHWA 4DTXA 3CFPA 2P5OA 4E3SA 3OGMB 2FW3A 3SVIA 4AKGA 3NHGA 4DTSA 4FJXA 4FJ9A 3CQ8A 1XVEE 2JHPA 3K2OA 2P1NB 4FJNA 3SUPA 2LF6A 2VIXA 5IBKB 2OVRB 3SQ2A 3L0MA 3N1EA 2ATQA 4KHNA 1FZ0E 4I9QA 2VJ4A 1XL3C 1XVCE 2JPNA 4KI4A 5IREA 3C6PB 1FZ5E 1FZ3E 3LDBA 3LZIA 1XMGE 4FJMA 4B08A 2OVPB 4ADOA 4KHQA 3SI6A 1WAJA 4ADNA 3TL8B 2P5GA 3SJJA 3TABA 4FJIA 1MHYG 4M3RA 2LF3A 1FYZE 2DEBA 2JH8A 1XVBE 4FJHA 1XVFE 3C6OB 1FZ9E 4EP9A 3QEVA 3RMDA 4GAMC 2QXFA 4J2EA 4J2DA 2JHAA 4KHUA 2YB5A 4FJKA 4AI6A 4JRPA 3QESA 3SPYA 4RG8A 4FJLA 3C94A 1LDKE 3SQ4A 1XU3E 4DTOA 4X5NA 3E4YA 2HD0A 3N1BA 3KD5E 3NAEA 2B8IA 3KD1E 1FZ8E 2VJ5A 3QEWA 4KHYA 4RNGA 4DU3A 3SUQA 2P1MB 1FZ7E 1FZ1E 2E31A 2H4TA 2P1OB 3HGKE 4FK2A 1FZ2E 3SCXA 1FZIE 3NDKA 3NGIA 1FS1A 1FZ6E 3TAGA 4M3YA 4M3ZA 3SUOA 2PFTA 3SQ0A 4FK0A 4KHSA 4M45A 1IH7A 4DTMA 3QNNA 5IZ7A 3QEPA 3RMBA 3MKSB 3CFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GAM C;  1XMF E;  1MMO G;  1XVG E;  1FZ4 E;  1XVD E;  1XU5 E;  1FZ0 E;  1XVC E;  1XU3 E;  1MHZ G;  1FZ5 E;  1FZ3 E;  1MTY G;  1FZ8 E;  1XMG E;  1FZH E;  1XMH E;  1FZ7 E;  1FZ1 E;  1FZ2 E;  1FZI E;  1FZ6 E;  1MHY G;  1FYZ E;  1XVE E;  1XVB E;  1XVF E;  1FZ9 E; 
#chains in the Genus database with same CATH topology
 1XMF E;  4X5M A;  3HGL A;  3LDS A;  1MMO G;  1P22 A;  3LZJ A;  3QEI A;  4E4B A;  3J2P A;  2DY4 A;  4AKH A;  1FZ4 E;  4M41 A;  4FJ5 A;  1XU5 E;  4J2B A;  3QET A;  2MMB A;  4M3U A;  3E4W A;  3QEX A;  4HCB A;  5H37 A;  2OVQ B;  3TAF A;  1WAF A;  3WSO A;  3C95 A;  4J2A A;  4DTJ A;  1Q9X A;  2JHC A;  3RMC A;  1Q9Y A;  2E32 A;  3HL8 A;  3QNO A;  4FVM A;  4M3W A;  2PFV A;  1NEX B;  3V7D B;  1MTY G;  4EPH A;  4I6J B;  3NE6 A;  4M3X A;  2OZS A;  4HCC A;  2P1Q B;  3S9H A;  3SUN A;  4DTU A;  4EYW A;  4FJ8 A;  3SNN A;  4ICG C;  2FYO A;  3TAE A;  3L2O B;  3TJY A;  4AKI A;  3OGK B;  3UIQ A;  3CFO A;  4M42 A;  4I9L A;  3L1N A;  3SPZ A;  2RCU A;  4FK4 A;  3RWU A;  2DTU A;  2B7M A;  2JH9 A;  4FJJ A;  3LD8 A;  4FJ7 A;  1CLQ A;  3HP9 A;  3L8B A;  1N1C A;  4KI6 A;  4QND A;  4DTP A;  1XVG E;  3QER A;  4DTN A;  4FJG A;  1XVD E;  3NCI A;  3C6N B;  4JRQ A;  4M3T A;  1FXX A;  3J27 A;  4DU1 A;  1FPO A;  1IG9 A;  1MHZ G;  2OZM A;  4IT5 A;  2OYQ A;  4RL5 A;  3SQ1 A;  2B1E A;  4JS5 A;  2P1P B;  3UO2 A;  4DTR A;  4QNC A;  2MZW B;  1FZH E;  1XMH E;  4JS4 A;  3RMA A;  4DU4 A;  3OGL B;  4KHW A;  4DTX A;  3CFP A;  2P5O A;  4E3S A;  3OGM B;  2FW3 A;  3SVI A;  4AKG A;  3NHG A;  4DTS A;  4FJX A;  4FJ9 A;  3CQ8 A;  1XVE E;  2JHP A;  3K2O A;  2P1N B;  4FJN A;  3SUP A;  2LF6 A;  2JQT A;  2VIX A;  5IBK B;  2OVR B;  3SQ2 A;  3L0M A;  3N1E A;  2ATQ A;  4KHN A;  1FZ0 E;  4I9Q A;  2VJ4 A;  1XL3 C;  1XVC E;  2JPN A;  3BVO A;  4KI4 A;  5IRE A;  3C6P B;  1FZ5 E;  1FZ3 E;  3LDB A;  2MW2 A;  3LZI A;  1XMG E;  1JW2 A;  4FJM A;  2K5S A;  4B08 A;  2OVP B;  4ADO A;  4KHQ A;  3SI6 A;  1WAJ A;  4ADN A;  3TL8 B;  2P5G A;  3SJJ A;  3TAB A;  4FJI A;  1MHY G;  4M3R A;  2LF3 A;  1FYZ E;  2DEB A;  2JH8 A;  1XVB E;  4FJH A;  1XVF E;  3C6O B;  1FZ9 E;  4EP9 A;  3QEV A;  3RMD A;  4GAM C;  2QXF A;  4J2E A;  4J2D A;  2JHA A;  4KHU A;  2YB5 A;  4FJK A;  3UO3 A;  4AI6 A;  4JRP A;  3QES A;  3SPY A;  4RG8 A;  4FJL A;  3C94 A;  1LDK E;  3SQ4 A;  2RKH A;  1XU3 E;  4DTO A;  4X5N A;  3E4Y A;  2HD0 A;  3N1B A;  3KD5 E;  3NAE A;  2B8I A;  3KD1 E;  1FZ8 E;  2VJ5 A;  3QEW A;  4KHY A;  4RNG A;  4DU3 A;  3SUQ A;  2P1M B;  1FZ7 E;  1FZ1 E;  2E31 A;  2H4T A;  2P1O B;  3HGK E;  4FK2 A;  1FZ2 E;  3SCX A;  1FZI E;  3NDK A;  3NGI A;  1FS1 A;  1FZ6 E;  3TAG A;  4M3Y A;  4M3Z A;  3SUO A;  2PFT A;  3SQ0 A;  4FK0 A;  4KHS A;  4M45 A;  1IH7 A;  4DTM A;  3QNN A;  5IZ7 A;  3QEP A;  3RMB A;  3MKS B;  3CFR A; 
#chains in the Genus database with same CATH homology
 1XMF E;  4X5M A;  3HGL A;  3LDS A;  1MMO G;  1P22 A;  3LZJ A;  3QEI A;  4E4B A;  3J2P A;  2DY4 A;  4AKH A;  1FZ4 E;  4M41 A;  4FJ5 A;  1XU5 E;  4J2B A;  3QET A;  2MMB A;  4M3U A;  3E4W A;  3QEX A;  4HCB A;  5H37 A;  2OVQ B;  3TAF A;  1WAF A;  3WSO A;  3C95 A;  4J2A A;  4DTJ A;  1Q9X A;  2JHC A;  3RMC A;  1Q9Y A;  2E32 A;  3HL8 A;  3QNO A;  4FVM A;  4M3W A;  2PFV A;  1NEX B;  3V7D B;  1MTY G;  4EPH A;  4I6J B;  3NE6 A;  4M3X A;  2OZS A;  4HCC A;  2P1Q B;  3S9H A;  3SUN A;  4DTU A;  4EYW A;  4FJ8 A;  3SNN A;  2FYO A;  3TAE A;  3L2O B;  3TJY A;  4AKI A;  3OGK B;  3UIQ A;  3CFO A;  4M42 A;  4I9L A;  3L1N A;  3SPZ A;  2RCU A;  4FK4 A;  3RWU A;  2DTU A;  2B7M A;  2JH9 A;  4FJJ A;  3LD8 A;  4FJ7 A;  1CLQ A;  3HP9 A;  3L8B A;  4KI6 A;  4QND A;  4DTP A;  1XVG E;  3QER A;  4DTN A;  4FJG A;  1XVD E;  3NCI A;  3C6N B;  4JRQ A;  4M3T A;  1FXX A;  3J27 A;  4DU1 A;  1IG9 A;  1MHZ G;  2OZM A;  2OYQ A;  4RL5 A;  3SQ1 A;  2B1E A;  4JS5 A;  2P1P B;  4DTR A;  4QNC A;  2MZW B;  1FZH E;  1XMH E;  4JS4 A;  3RMA A;  4DU4 A;  3OGL B;  4KHW A;  4DTX A;  3CFP A;  2P5O A;  4E3S A;  3OGM B;  2FW3 A;  3SVI A;  4AKG A;  3NHG A;  4DTS A;  4FJX A;  4FJ9 A;  3CQ8 A;  1XVE E;  2JHP A;  3K2O A;  2P1N B;  4FJN A;  3SUP A;  2LF6 A;  2VIX A;  5IBK B;  2OVR B;  3SQ2 A;  3L0M A;  3N1E A;  2ATQ A;  4KHN A;  1FZ0 E;  4I9Q A;  2VJ4 A;  1XL3 C;  1XVC E;  2JPN A;  4KI4 A;  5IRE A;  3C6P B;  1FZ5 E;  1FZ3 E;  3LDB A;  3LZI A;  1XMG E;  4FJM A;  4B08 A;  2OVP B;  4ADO A;  4KHQ A;  3SI6 A;  1WAJ A;  4ADN A;  3TL8 B;  2P5G A;  3SJJ A;  3TAB A;  4FJI A;  1MHY G;  4M3R A;  2LF3 A;  1FYZ E;  2DEB A;  2JH8 A;  1XVB E;  4FJH A;  1XVF E;  3C6O B;  1FZ9 E;  4EP9 A;  3QEV A;  3RMD A;  4GAM C;  2QXF A;  4J2E A;  4J2D A;  2JHA A;  4KHU A;  2YB5 A;  4FJK A;  4AI6 A;  4JRP A;  3QES A;  3SPY A;  4RG8 A;  4FJL A;  3C94 A;  1LDK E;  3SQ4 A;  1XU3 E;  4DTO A;  4X5N A;  3E4Y A;  2HD0 A;  3N1B A;  3KD5 E;  3NAE A;  2B8I A;  3KD1 E;  1FZ8 E;  2VJ5 A;  3QEW A;  4KHY A;  4RNG A;  4DU3 A;  3SUQ A;  2P1M B;  1FZ7 E;  1FZ1 E;  2E31 A;  2H4T A;  2P1O B;  3HGK E;  4FK2 A;  1FZ2 E;  3SCX A;  1FZI E;  3NDK A;  3NGI A;  1FS1 A;  1FZ6 E;  3TAG A;  4M3Y A;  4M3Z A;  3SUO A;  2PFT A;  3SQ0 A;  4FK0 A;  4KHS A;  4M45 A;  1IH7 A;  4DTM A;  3QNN A;  5IZ7 A;  3QEP A;  3RMB A;  3MKS B;  3CFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...