3HGLA

Crystal of avrptob 121-205
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
GAVAHANSIVQQLVSEGADISHTRNMLRNAMNGDAVAFSRVEQNIFRQHFPNMPMHGISRDSELAIELRGALRRAVHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Effector protein hopAB2
publication title Crystal Structure of the Complex between Pseudomonas Effector AvrPtoB and the Tomato Pto Kinase Reveals Both a Shared and a Unique Interface Compared with AvrPto-Pto
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 21
structure length 78
sequence length 78
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.110 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3hglA00
3HGLA 3SVIA 3TJYA 3HGKE
chains in the Genus database with same CATH superfamily
4GAMC 1JW2A 3NAEA 1XVGE 4IT5A 3OGMB 3V7DB 4FJ7A 4M3ZA 1MHZG 3TAGA 2OZSA 4KHWA 4KHYA 1FZ7E 4X5MA 4FK4A 4X5NA 1FXXA 3C94A 4JS5A 2OZMA 1FZ9E 2P1MB 5IREA 4JRQA 4FJNA 3QEPA 2OVRB 3HGKE 4KI6A 3S9HA 4KHNA 3SVIA 2OVQB 3SQ2A 4DU1A 3LDSA 3SUNA 2QXFA 4DTNA 3SCXA 3OGKB 4M3UA 4M41A 3NGIA 3SUPA 2OYQA 3N1EA 4FJIA 2B8IA 3QEXA 3SUQA 1XU3E 2MW2A 1FZIE 1XVBE 4FJ8A 3NHGA 2P1PB 3SQ0A 3SJJA 1XL3C 2MMBA 2JHPA 1FZ2E 4I9LA 2RKHA 4EPHA 5IBKB 1FZ5E 4E3SA 3KD1E 4RL5A 2HD0A 4KHSA 2P1OB 3TL8B 3CQ8A 4E4BA 4DTRA 3E4WA 4M3TA 3RMCA 2LF3A 4QNCA 2JPNA 1MMOG 4M3WA 4J2EA 4M3RA 3QEWA 4FK0A 2ATQA 4KHQA 1NEXB 2E32A 1FZ3E 3SI6A 4KI4A 2B1EA 2DY4A 3HGLA 3HL8A 3QERA 4FVMA 2E31A 4FJJA 1IH7A 2LF6A 2P1NB 2PFVA 3C95A 4DTUA 4HCCA 1FS1A 3L2OB 3UO3A 5IZ7A 3RMDA 2DEBA 3QEVA 3SPZA 3QEIA 3SQ4A 4FJHA 4ICGC 1XU5E 3CFPA 4RNGA 3QETA 3TABA 4AKIA 4RG8A 3CFRA 1FZ6E 3LZIA 4QNDA 3NDKA 1IG9A 4DTMA 1XMHE 3KD5E 1FZ1E 3LZJA 4DTJA 1LDKE 3L8BA 1FZ8E 1FZ4E 4EYWA 3QNOA 2H4TA 3OGLB 3QNNA 4J2BA 2YB5A 4AKGA 4M45A 4FJGA 4I6JB 1N1CA 2VIXA 4DTPA 3SQ1A 4DU3A 3C6PB 3RMBA 2JHAA 4ADOA 4FK2A 4M3YA 4FJLA 3WSOA 4B08A 2DTUA 1FPOA 3TJYA 3CFOA 2P5OA 2JHCA 3C6OB 3LDBA 4AI6A 3TAEA 3SUOA 1MTYG 1XMGE 1XVDE 3J27A 5H37A 4DTSA 1XVEE 4DTOA 1Q9YA 2P5GA 1FZ0E 3E4YA 3RWUA 3L0MA 3N1BA 4FJXA 4M42A 2JH9A 3MKSB 3K2OA 1Q9XA 4AKHA 3NE6A 4FJ9A 3SPYA 2JH8A 2B7MA 2MZWB 3NCIA 1CLQA 2K5SA 4I9QA 2P1QB 3QESA 4J2AA 2OVPB 3C6NB 3L1NA 4FJKA 1XVCE 1WAJA 3UIQA 4KHUA 4DTXA 3LD8A 2VJ5A 1WAFA 1MHYG 2VJ4A 2FW3A 3HP9A 4FJMA 4M3XA 1XMFE 2FYOA 3BVOA 4JRPA 4JS4A 3SNNA 3TAFA 1XVFE 4HCBA 1P22A 3RMAA 4FJ5A 4J2DA 2PFTA 4ADNA 2JQTA 3UO2A 4DU4A 3J2PA 1FZHE 1FYZE 2RCUA 4EP9A
chains in the Genus database with same CATH topology
4GAMC 3NAEA 1XVGE 3V7DB 3OGMB 4M3ZA 4FJ7A 1MHZG 3TAGA 2OZSA 4KHWA 4KHYA 1FZ7E 4X5MA 4FK4A 4X5NA 1FXXA 3C94A 4JS5A 2OZMA 1FZ9E 2P1MB 5IREA 4JRQA 4FJNA 3QEPA 2OVRB 3HGKE 4KI6A 3S9HA 4KHNA 3SVIA 2OVQB 3SQ2A 4DU1A 3LDSA 3SUNA 2QXFA 4DTNA 3SCXA 3OGKB 4M3UA 4M41A 3NGIA 3SUPA 2OYQA 3N1EA 4FJIA 2B8IA 3QEXA 3SUQA 1XU3E 1FZIE 1XVBE 4FJ8A 3NHGA 2P1PB 3SQ0A 3SJJA 1XL3C 2MMBA 2JHPA 1FZ2E 4I9LA 4EPHA 5IBKB 4E3SA 1FZ5E 3KD1E 4RL5A 2HD0A 4KHSA 2P1OB 3TL8B 3CQ8A 4E4BA 4DTRA 3E4WA 4M3TA 3RMCA 2LF3A 4QNCA 2JPNA 1MMOG 4M3WA 4J2EA 4M3RA 3QEWA 4FK0A 2ATQA 4KHQA 1NEXB 2E32A 1FZ3E 3SI6A 4KI4A 2B1EA 2DY4A 3HGLA 3HL8A 3QERA 4FVMA 2E31A 4FJJA 1IH7A 2LF6A 2P1NB 2PFVA 3C95A 4DTUA 4HCCA 1FS1A 3L2OB 3RMDA 5IZ7A 2DEBA 3QEVA 3SPZA 3QEIA 3SQ4A 4FJHA 1XU5E 3CFPA 4RNGA 3QETA 3TABA 4AKIA 4RG8A 3CFRA 1FZ6E 3LZIA 4QNDA 3NDKA 1IG9A 4DTMA 1XMHE 3KD5E 1FZ1E 3LZJA 4DTJA 1LDKE 3L8BA 1FZ8E 1FZ4E 4EYWA 3QNOA 2H4TA 3OGLB 3QNNA 4J2BA 2YB5A 4AKGA 4M45A 4FJGA 4I6JB 2VIXA 4DTPA 3SQ1A 4DU3A 3C6PB 3RMBA 2JHAA 4ADOA 4FK2A 4M3YA 4FJLA 3WSOA 4B08A 2DTUA 3TJYA 3CFOA 2P5OA 2JHCA 3C6OB 3LDBA 4AI6A 3TAEA 3SUOA 1MTYG 1XMGE 1XVDE 3J27A 5H37A 4DTSA 1XVEE 4DTOA 1Q9YA 2P5GA 1FZ0E 3E4YA 3RWUA 3L0MA 3N1BA 4FJXA 4M42A 2JH9A 3MKSB 3K2OA 1Q9XA 4AKHA 3NE6A 4FJ9A 3SPYA 2JH8A 2B7MA 2MZWB 3NCIA 1CLQA 4I9QA 2P1QB 3QESA 4J2AA 2OVPB 3C6NB 3L1NA 4FJKA 1XVCE 1WAJA 3UIQA 4KHUA 4DTXA 3LD8A 2VJ5A 1WAFA 1MHYG 2VJ4A 2FW3A 3HP9A 4FJMA 4M3XA 1XMFE 2FYOA 4JRPA 4JS4A 3SNNA 3TAFA 1XVFE 4HCBA 1P22A 3RMAA 4FJ5A 4J2DA 2PFTA 4ADNA 4DU4A 3J2PA 1FZHE 1FYZE 2RCUA 4EP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HGL A;  3SVI A;  3TJY A;  3HGK E; 
#chains in the Genus database with same CATH topology
 4GAM C;  1JW2 A;  3NAE A;  1XVG E;  4IT5 A;  3OGM B;  3V7D B;  4FJ7 A;  4M3Z A;  1MHZ G;  3TAG A;  2OZS A;  4KHW A;  4KHY A;  1FZ7 E;  4X5M A;  4FK4 A;  4X5N A;  1FXX A;  3C94 A;  4JS5 A;  2OZM A;  1FZ9 E;  2P1M B;  5IRE A;  4JRQ A;  4FJN A;  3QEP A;  2OVR B;  3HGK E;  4KI6 A;  3S9H A;  4KHN A;  3SVI A;  2OVQ B;  3SQ2 A;  4DU1 A;  3LDS A;  3SUN A;  2QXF A;  4DTN A;  3SCX A;  3OGK B;  4M3U A;  4M41 A;  3NGI A;  3SUP A;  2OYQ A;  3N1E A;  4FJI A;  2B8I A;  3QEX A;  3SUQ A;  1XU3 E;  2MW2 A;  1FZI E;  1XVB E;  4FJ8 A;  3NHG A;  2P1P B;  3SQ0 A;  3SJJ A;  1XL3 C;  2MMB A;  2JHP A;  1FZ2 E;  4I9L A;  2RKH A;  4EPH A;  5IBK B;  1FZ5 E;  4E3S A;  3KD1 E;  4RL5 A;  2HD0 A;  4KHS A;  2P1O B;  3TL8 B;  3CQ8 A;  4E4B A;  4DTR A;  3E4W A;  4M3T A;  3RMC A;  2LF3 A;  4QNC A;  2JPN A;  1MMO G;  4M3W A;  4J2E A;  4M3R A;  3QEW A;  4FK0 A;  2ATQ A;  4KHQ A;  1NEX B;  2E32 A;  1FZ3 E;  3SI6 A;  4KI4 A;  2B1E A;  2DY4 A;  3HGL A;  3HL8 A;  3QER A;  4FVM A;  2E31 A;  4FJJ A;  1IH7 A;  2LF6 A;  2P1N B;  2PFV A;  3C95 A;  4DTU A;  4HCC A;  1FS1 A;  3L2O B;  3UO3 A;  5IZ7 A;  3RMD A;  2DEB A;  3QEV A;  3SPZ A;  3QEI A;  3SQ4 A;  4FJH A;  4ICG C;  1XU5 E;  3CFP A;  4RNG A;  3QET A;  3TAB A;  4AKI A;  4RG8 A;  3CFR A;  1FZ6 E;  3LZI A;  4QND A;  3NDK A;  1IG9 A;  4DTM A;  1XMH E;  3KD5 E;  1FZ1 E;  3LZJ A;  4DTJ A;  1LDK E;  3L8B A;  1FZ8 E;  1FZ4 E;  4EYW A;  3QNO A;  2H4T A;  3OGL B;  3QNN A;  4J2B A;  2YB5 A;  4AKG A;  4M45 A;  4FJG A;  4I6J B;  1N1C A;  2VIX A;  4DTP A;  3SQ1 A;  4DU3 A;  3C6P B;  3RMB A;  2JHA A;  4ADO A;  4FK2 A;  4M3Y A;  4FJL A;  3WSO A;  4B08 A;  2DTU A;  1FPO A;  3TJY A;  3CFO A;  2P5O A;  2JHC A;  3C6O B;  3LDB A;  4AI6 A;  3TAE A;  3SUO A;  1MTY G;  1XMG E;  1XVD E;  3J27 A;  5H37 A;  4DTS A;  1XVE E;  4DTO A;  1Q9Y A;  2P5G A;  1FZ0 E;  3E4Y A;  3RWU A;  3L0M A;  3N1B A;  4FJX A;  4M42 A;  2JH9 A;  3MKS B;  3K2O A;  1Q9X A;  4AKH A;  3NE6 A;  4FJ9 A;  3SPY A;  2JH8 A;  2B7M A;  2MZW B;  3NCI A;  1CLQ A;  2K5S A;  4I9Q A;  2P1Q B;  3QES A;  4J2A A;  2OVP B;  3C6N B;  3L1N A;  4FJK A;  1XVC E;  1WAJ A;  3UIQ A;  4KHU A;  4DTX A;  3LD8 A;  2VJ5 A;  1WAF A;  1MHY G;  2VJ4 A;  2FW3 A;  3HP9 A;  4FJM A;  4M3X A;  1XMF E;  2FYO A;  3BVO A;  4JRP A;  4JS4 A;  3SNN A;  3TAF A;  1XVF E;  4HCB A;  1P22 A;  3RMA A;  4FJ5 A;  4J2D A;  2PFT A;  4ADN A;  2JQT A;  3UO2 A;  4DU4 A;  3J2P A;  1FZH E;  1FYZ E;  2RCU A;  4EP9 A; 
#chains in the Genus database with same CATH homology
 4GAM C;  3NAE A;  1XVG E;  3V7D B;  3OGM B;  4M3Z A;  4FJ7 A;  1MHZ G;  3TAG A;  2OZS A;  4KHW A;  4KHY A;  1FZ7 E;  4X5M A;  4FK4 A;  4X5N A;  1FXX A;  3C94 A;  4JS5 A;  2OZM A;  1FZ9 E;  2P1M B;  5IRE A;  4JRQ A;  4FJN A;  3QEP A;  2OVR B;  3HGK E;  4KI6 A;  3S9H A;  4KHN A;  3SVI A;  2OVQ B;  3SQ2 A;  4DU1 A;  3LDS A;  3SUN A;  2QXF A;  4DTN A;  3SCX A;  3OGK B;  4M3U A;  4M41 A;  3NGI A;  3SUP A;  2OYQ A;  3N1E A;  4FJI A;  2B8I A;  3QEX A;  3SUQ A;  1XU3 E;  1FZI E;  1XVB E;  4FJ8 A;  3NHG A;  2P1P B;  3SQ0 A;  3SJJ A;  1XL3 C;  2MMB A;  2JHP A;  1FZ2 E;  4I9L A;  4EPH A;  5IBK B;  4E3S A;  1FZ5 E;  3KD1 E;  4RL5 A;  2HD0 A;  4KHS A;  2P1O B;  3TL8 B;  3CQ8 A;  4E4B A;  4DTR A;  3E4W A;  4M3T A;  3RMC A;  2LF3 A;  4QNC A;  2JPN A;  1MMO G;  4M3W A;  4J2E A;  4M3R A;  3QEW A;  4FK0 A;  2ATQ A;  4KHQ A;  1NEX B;  2E32 A;  1FZ3 E;  3SI6 A;  4KI4 A;  2B1E A;  2DY4 A;  3HGL A;  3HL8 A;  3QER A;  4FVM A;  2E31 A;  4FJJ A;  1IH7 A;  2LF6 A;  2P1N B;  2PFV A;  3C95 A;  4DTU A;  4HCC A;  1FS1 A;  3L2O B;  3RMD A;  5IZ7 A;  2DEB A;  3QEV A;  3SPZ A;  3QEI A;  3SQ4 A;  4FJH A;  1XU5 E;  3CFP A;  4RNG A;  3QET A;  3TAB A;  4AKI A;  4RG8 A;  3CFR A;  1FZ6 E;  3LZI A;  4QND A;  3NDK A;  1IG9 A;  4DTM A;  1XMH E;  3KD5 E;  1FZ1 E;  3LZJ A;  4DTJ A;  1LDK E;  3L8B A;  1FZ8 E;  1FZ4 E;  4EYW A;  3QNO A;  2H4T A;  3OGL B;  3QNN A;  4J2B A;  2YB5 A;  4AKG A;  4M45 A;  4FJG A;  4I6J B;  2VIX A;  4DTP A;  3SQ1 A;  4DU3 A;  3C6P B;  3RMB A;  2JHA A;  4ADO A;  4FK2 A;  4M3Y A;  4FJL A;  3WSO A;  4B08 A;  2DTU A;  3TJY A;  3CFO A;  2P5O A;  2JHC A;  3C6O B;  3LDB A;  4AI6 A;  3TAE A;  3SUO A;  1MTY G;  1XMG E;  1XVD E;  3J27 A;  5H37 A;  4DTS A;  1XVE E;  4DTO A;  1Q9Y A;  2P5G A;  1FZ0 E;  3E4Y A;  3RWU A;  3L0M A;  3N1B A;  4FJX A;  4M42 A;  2JH9 A;  3MKS B;  3K2O A;  1Q9X A;  4AKH A;  3NE6 A;  4FJ9 A;  3SPY A;  2JH8 A;  2B7M A;  2MZW B;  3NCI A;  1CLQ A;  4I9Q A;  2P1Q B;  3QES A;  4J2A A;  2OVP B;  3C6N B;  3L1N A;  4FJK A;  1XVC E;  1WAJ A;  3UIQ A;  4KHU A;  4DTX A;  3LD8 A;  2VJ5 A;  1WAF A;  1MHY G;  2VJ4 A;  2FW3 A;  3HP9 A;  4FJM A;  4M3X A;  1XMF E;  2FYO A;  4JRP A;  4JS4 A;  3SNN A;  3TAF A;  1XVF E;  4HCB A;  1P22 A;  3RMA A;  4FJ5 A;  4J2D A;  2PFT A;  4ADN A;  4DU4 A;  3J2P A;  1FZH E;  1FYZ E;  2RCU A;  4EP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...