3HGLA

Crystal of avrptob 121-205
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
b'GAVAHANSIVQQLVSEGADISHTRNMLRNAMNGDAVAFSRVEQNIFRQHFPNMPMHGISRDSELAIELRGALRRAVHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Effector protein hopAB2
publication title Crystal Structure of the Complex between Pseudomonas Effector AvrPtoB and the Tomato Pto Kinase Reveals Both a Shared and a Unique Interface Compared with AvrPto-Pto
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Ligase
total genus 21
structure length 78
sequence length 78
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.110 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3hglA00
3SVIA 3HGLA 3HGKE 3TJYA
chains in the Genus database with same CATH superfamily
1FZ6E 2LF6A 4EP9A 1MMOG 4M3UA 4FJ5A 4KHSA 1LDKE 4FVMA 1FZ9E 4FJNA 3NGIA 3RMDA 3SJJA 1IH7A 4JRQA 4GAMC 4RL5A 3KD5E 1FZIE 2P5OA 4FK4A 2P1PB 3QNNA 4J2AA 3SQ1A 4KI4A 1FXXA 4JS5A 2ATQA 3RMCA 4HCCA 4AKIA 4KHUA 3UO3A 2JH8A 4DU1A 3SUPA 4DU4A 3TAFA 3C94A 2FYOA 3SUOA 3N1BA 1CLQA 2DTUA 3L8BA 4RNGA 1XMHE 4EPHA 4X5MA 4DTSA 4FJLA 4I9LA 3WSOA 1FZ0E 1XVCE 2OVPB 2RKHA 4JS4A 3UIQA 4QNDA 1FZ4E 4FK2A 2MZWB 5IBKB 3CFOA 2K5SA 5H37A 4J2EA 4DTOA 1XU5E 2VIXA 1MTYG 3LDSA 1IG9A 2OYQA 4FJGA 2DEBA 3TABA 2B8IA 3L0MA 4DTRA 3SVIA 5IREA 4FJ8A 1P22A 3QEWA 2JQTA 3QEXA 2P1MB 4ADNA 4FJIA 3TAEA 4I6JB 3RMBA 2PFVA 2P1OB 3N1EA 3LZIA 3RWUA 1FYZE 1MHZG 1FZ3E 4AKGA 1WAFA 3SNNA 4I9QA 4HCBA 4M45A 4M3TA 4DTMA 3KD1E 4DTPA 1FZ1E 3NHGA 3NCIA 1XVDE 2OVRB 4RG8A 4FJHA 3S9HA 2VJ4A 4FJ9A 2JHCA 2B1EA 3UO2A 4KI6A 4DTJA 4M3XA 1XVGE 3C6PB 2P1QB 3HGLA 3SPZA 4FJMA 4AI6A 2VJ5A 1NEXB 4KHYA 3RMAA 1XU3E 2RCUA 3TL8B 4FJ7A 1WAJA 4B08A 3LD8A 3QESA 1FZHE 3SQ4A 1XL3C 3CFPA 3E4WA 2MW2A 3J27A 3V7DB 3SCXA 3SQ0A 3LDBA 4EYWA 3NAEA 4ADOA 4E4BA 3NE6A 4DU3A 1FZ8E 4ICGC 3HL8A 4AKHA 2PFTA 3NDKA 3SQ2A 1XMFE 5IZ7A 4DTNA 4FJJA 3E4YA 3L1NA 2JPNA 4M3YA 2JHPA 3CFRA 4DTUA 1N1CA 2E31A 1XVBE 3C6OB 3OGMB 3K2OA 2MMBA 2LF3A 3QEIA 3SUQA 1FS1A 2OZMA 2JHAA 1Q9XA 4IT5A 4X5NA 4FJKA 1XVFE 3OGLB 3SI6A 4FJXA 2B7MA 3C95A 1FZ2E 4E3SA 4M42A 3HGKE 2OVQB 3CQ8A 2P1NB 3SPYA 4J2BA 1FPOA 3SUNA 2FW3A 3QETA 4FK0A 3TAGA 1XVEE 3C6NB 4JRPA 2P5GA 4KHWA 3BVOA 1FZ7E 1FZ5E 2E32A 4KHQA 2DY4A 2JH9A 3QEVA 1XMGE 3LZJA 3QEPA 2OZSA 4M3ZA 4DTXA 3J2PA 3MKSB 2HD0A 3TJYA 3OGKB 1MHYG 2YB5A 4M41A 4QNCA 3L2OB 2QXFA 3QERA 2H4TA 4M3RA 1JW2A 4M3WA 1Q9YA 4J2DA 4KHNA 3QNOA 3HP9A
chains in the Genus database with same CATH topology
1FZ6E 2LF6A 4EP9A 1MMOG 4M3UA 4FJ5A 4KHSA 1LDKE 4FVMA 1FZ9E 4FJNA 3NGIA 3RMDA 3SJJA 1IH7A 4JRQA 4GAMC 4RL5A 3KD5E 1FZIE 2P5OA 4FK4A 2P1PB 3QNNA 4J2AA 3SQ1A 4KI4A 1FXXA 4JS5A 2ATQA 3RMCA 4HCCA 4AKIA 4KHUA 4DU1A 2JH8A 3SUPA 4DU4A 3TAFA 3C94A 2FYOA 3SUOA 3N1BA 1CLQA 2DTUA 3L8BA 4RNGA 1XMHE 4EPHA 4X5MA 4DTSA 4FJLA 4I9LA 3WSOA 1FZ0E 1XVCE 2OVPB 4JS4A 3UIQA 4FK2A 4QNDA 1FZ4E 2MZWB 5IBKB 3CFOA 5H37A 4J2EA 4DTOA 1XU5E 2VIXA 1MTYG 3LDSA 1IG9A 2OYQA 4FJGA 2DEBA 3TABA 2B8IA 3L0MA 4DTRA 3SVIA 5IREA 4FJ8A 1P22A 3QEWA 3QEXA 2P1MB 4ADNA 4FJIA 3TAEA 4I6JB 3RMBA 2PFVA 2P1OB 3N1EA 3LZIA 3RWUA 1FYZE 1MHZG 1FZ3E 4AKGA 1WAFA 3SNNA 4I9QA 4HCBA 4M45A 4M3TA 4DTMA 3KD1E 4DTPA 1FZ1E 3NHGA 3NCIA 1XVDE 2OVRB 4RG8A 4FJHA 3S9HA 2VJ4A 4FJ9A 2JHCA 2B1EA 4KI6A 4DTJA 4M3XA 3C6PB 1XVGE 2P1QB 3HGLA 3SPZA 4FJMA 4AI6A 2VJ5A 1NEXB 4KHYA 3RMAA 1XU3E 2RCUA 3TL8B 4FJ7A 1WAJA 4B08A 3LD8A 3QESA 1FZHE 3SQ4A 1XL3C 3CFPA 3E4WA 3J27A 3SQ0A 3V7DB 3SCXA 3LDBA 4EYWA 3NAEA 4ADOA 4E4BA 3NE6A 4DU3A 1FZ8E 3HL8A 4AKHA 2PFTA 3NDKA 3SQ2A 1XMFE 5IZ7A 4DTNA 4FJJA 3E4YA 3L1NA 2JPNA 4M3YA 2JHPA 3CFRA 4DTUA 2E31A 1XVBE 3C6OB 3OGMB 3K2OA 2MMBA 2LF3A 3QEIA 3SUQA 1FS1A 2OZMA 2JHAA 1Q9XA 4X5NA 4FJKA 1XVFE 3OGLB 3SI6A 4FJXA 2B7MA 3C95A 1FZ2E 4E3SA 4M42A 3HGKE 2OVQB 3CQ8A 2P1NB 3SPYA 4J2BA 3SUNA 2FW3A 3QETA 4FK0A 3TAGA 1XVEE 3C6NB 4JRPA 2P5GA 4KHWA 1FZ7E 1FZ5E 2E32A 4KHQA 2DY4A 2JH9A 3QEVA 1XMGE 3LZJA 3QEPA 2OZSA 4M3ZA 4DTXA 3J2PA 3MKSB 2HD0A 3TJYA 3OGKB 1MHYG 2YB5A 4M41A 4QNCA 3L2OB 2QXFA 3QERA 2H4TA 4M3RA 4M3WA 1Q9YA 4J2DA 4KHNA 3QNOA 3HP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVI A;  3HGL A;  3HGK E;  3TJY A; 
#chains in the Genus database with same CATH topology
 1FZ6 E;  2LF6 A;  4EP9 A;  1MMO G;  4M3U A;  4FJ5 A;  4KHS A;  1LDK E;  4FVM A;  1FZ9 E;  4FJN A;  3NGI A;  3RMD A;  3SJJ A;  1IH7 A;  4JRQ A;  4GAM C;  4RL5 A;  3KD5 E;  1FZI E;  2P5O A;  4FK4 A;  2P1P B;  3QNN A;  4J2A A;  3SQ1 A;  4KI4 A;  1FXX A;  4JS5 A;  2ATQ A;  3RMC A;  4HCC A;  4AKI A;  4KHU A;  3UO3 A;  2JH8 A;  4DU1 A;  3SUP A;  4DU4 A;  3TAF A;  3C94 A;  2FYO A;  3SUO A;  3N1B A;  1CLQ A;  2DTU A;  3L8B A;  4RNG A;  1XMH E;  4EPH A;  4X5M A;  4DTS A;  4FJL A;  4I9L A;  3WSO A;  1FZ0 E;  1XVC E;  2OVP B;  2RKH A;  4JS4 A;  3UIQ A;  4QND A;  1FZ4 E;  4FK2 A;  2MZW B;  5IBK B;  3CFO A;  2K5S A;  5H37 A;  4J2E A;  4DTO A;  1XU5 E;  2VIX A;  1MTY G;  3LDS A;  1IG9 A;  2OYQ A;  4FJG A;  2DEB A;  3TAB A;  2B8I A;  3L0M A;  4DTR A;  3SVI A;  5IRE A;  4FJ8 A;  1P22 A;  3QEW A;  2JQT A;  3QEX A;  2P1M B;  4ADN A;  4FJI A;  3TAE A;  4I6J B;  3RMB A;  2PFV A;  2P1O B;  3N1E A;  3LZI A;  3RWU A;  1FYZ E;  1MHZ G;  1FZ3 E;  4AKG A;  1WAF A;  3SNN A;  4I9Q A;  4HCB A;  4M45 A;  4M3T A;  4DTM A;  3KD1 E;  4DTP A;  1FZ1 E;  3NHG A;  3NCI A;  1XVD E;  2OVR B;  4RG8 A;  4FJH A;  3S9H A;  2VJ4 A;  4FJ9 A;  2JHC A;  2B1E A;  3UO2 A;  4KI6 A;  4DTJ A;  4M3X A;  1XVG E;  3C6P B;  2P1Q B;  3HGL A;  3SPZ A;  4FJM A;  4AI6 A;  2VJ5 A;  1NEX B;  4KHY A;  3RMA A;  1XU3 E;  2RCU A;  3TL8 B;  4FJ7 A;  1WAJ A;  4B08 A;  3LD8 A;  3QES A;  1FZH E;  3SQ4 A;  1XL3 C;  3CFP A;  3E4W A;  2MW2 A;  3J27 A;  3V7D B;  3SCX A;  3SQ0 A;  3LDB A;  4EYW A;  3NAE A;  4ADO A;  4E4B A;  3NE6 A;  4DU3 A;  1FZ8 E;  4ICG C;  3HL8 A;  4AKH A;  2PFT A;  3NDK A;  3SQ2 A;  1XMF E;  5IZ7 A;  4DTN A;  4FJJ A;  3E4Y A;  3L1N A;  2JPN A;  4M3Y A;  2JHP A;  3CFR A;  4DTU A;  1N1C A;  2E31 A;  1XVB E;  3C6O B;  3OGM B;  3K2O A;  2MMB A;  2LF3 A;  3QEI A;  3SUQ A;  1FS1 A;  2OZM A;  2JHA A;  1Q9X A;  4IT5 A;  4X5N A;  4FJK A;  1XVF E;  3OGL B;  3SI6 A;  4FJX A;  2B7M A;  3C95 A;  1FZ2 E;  4E3S A;  4M42 A;  3HGK E;  2OVQ B;  3CQ8 A;  2P1N B;  3SPY A;  4J2B A;  1FPO A;  3SUN A;  2FW3 A;  3QET A;  4FK0 A;  3TAG A;  1XVE E;  3C6N B;  4JRP A;  2P5G A;  4KHW A;  3BVO A;  1FZ7 E;  1FZ5 E;  2E32 A;  4KHQ A;  2DY4 A;  2JH9 A;  3QEV A;  1XMG E;  3LZJ A;  3QEP A;  2OZS A;  4M3Z A;  4DTX A;  3J2P A;  3MKS B;  2HD0 A;  3TJY A;  3OGK B;  1MHY G;  2YB5 A;  4M41 A;  4QNC A;  3L2O B;  2QXF A;  3QER A;  2H4T A;  4M3R A;  1JW2 A;  4M3W A;  1Q9Y A;  4J2D A;  4KHN A;  3QNO A;  3HP9 A; 
#chains in the Genus database with same CATH homology
 1FZ6 E;  2LF6 A;  4EP9 A;  1MMO G;  4M3U A;  4FJ5 A;  4KHS A;  1LDK E;  4FVM A;  1FZ9 E;  4FJN A;  3NGI A;  3RMD A;  3SJJ A;  1IH7 A;  4JRQ A;  4GAM C;  4RL5 A;  3KD5 E;  1FZI E;  2P5O A;  4FK4 A;  2P1P B;  3QNN A;  4J2A A;  3SQ1 A;  4KI4 A;  1FXX A;  4JS5 A;  2ATQ A;  3RMC A;  4HCC A;  4AKI A;  4KHU A;  4DU1 A;  2JH8 A;  3SUP A;  4DU4 A;  3TAF A;  3C94 A;  2FYO A;  3SUO A;  3N1B A;  1CLQ A;  2DTU A;  3L8B A;  4RNG A;  1XMH E;  4EPH A;  4X5M A;  4DTS A;  4FJL A;  4I9L A;  3WSO A;  1FZ0 E;  1XVC E;  2OVP B;  4JS4 A;  3UIQ A;  4FK2 A;  4QND A;  1FZ4 E;  2MZW B;  5IBK B;  3CFO A;  5H37 A;  4J2E A;  4DTO A;  1XU5 E;  2VIX A;  1MTY G;  3LDS A;  1IG9 A;  2OYQ A;  4FJG A;  2DEB A;  3TAB A;  2B8I A;  3L0M A;  4DTR A;  3SVI A;  5IRE A;  4FJ8 A;  1P22 A;  3QEW A;  3QEX A;  2P1M B;  4ADN A;  4FJI A;  3TAE A;  4I6J B;  3RMB A;  2PFV A;  2P1O B;  3N1E A;  3LZI A;  3RWU A;  1FYZ E;  1MHZ G;  1FZ3 E;  4AKG A;  1WAF A;  3SNN A;  4I9Q A;  4HCB A;  4M45 A;  4M3T A;  4DTM A;  3KD1 E;  4DTP A;  1FZ1 E;  3NHG A;  3NCI A;  1XVD E;  2OVR B;  4RG8 A;  4FJH A;  3S9H A;  2VJ4 A;  4FJ9 A;  2JHC A;  2B1E A;  4KI6 A;  4DTJ A;  4M3X A;  3C6P B;  1XVG E;  2P1Q B;  3HGL A;  3SPZ A;  4FJM A;  4AI6 A;  2VJ5 A;  1NEX B;  4KHY A;  3RMA A;  1XU3 E;  2RCU A;  3TL8 B;  4FJ7 A;  1WAJ A;  4B08 A;  3LD8 A;  3QES A;  1FZH E;  3SQ4 A;  1XL3 C;  3CFP A;  3E4W A;  3J27 A;  3SQ0 A;  3V7D B;  3SCX A;  3LDB A;  4EYW A;  3NAE A;  4ADO A;  4E4B A;  3NE6 A;  4DU3 A;  1FZ8 E;  3HL8 A;  4AKH A;  2PFT A;  3NDK A;  3SQ2 A;  1XMF E;  5IZ7 A;  4DTN A;  4FJJ A;  3E4Y A;  3L1N A;  2JPN A;  4M3Y A;  2JHP A;  3CFR A;  4DTU A;  2E31 A;  1XVB E;  3C6O B;  3OGM B;  3K2O A;  2MMB A;  2LF3 A;  3QEI A;  3SUQ A;  1FS1 A;  2OZM A;  2JHA A;  1Q9X A;  4X5N A;  4FJK A;  1XVF E;  3OGL B;  3SI6 A;  4FJX A;  2B7M A;  3C95 A;  1FZ2 E;  4E3S A;  4M42 A;  3HGK E;  2OVQ B;  3CQ8 A;  2P1N B;  3SPY A;  4J2B A;  3SUN A;  2FW3 A;  3QET A;  4FK0 A;  3TAG A;  1XVE E;  3C6N B;  4JRP A;  2P5G A;  4KHW A;  1FZ7 E;  1FZ5 E;  2E32 A;  4KHQ A;  2DY4 A;  2JH9 A;  3QEV A;  1XMG E;  3LZJ A;  3QEP A;  2OZS A;  4M3Z A;  4DTX A;  3J2P A;  3MKS B;  2HD0 A;  3TJY A;  3OGK B;  1MHY G;  2YB5 A;  4M41 A;  4QNC A;  3L2O B;  2QXF A;  3QER A;  2H4T A;  4M3R A;  4M3W A;  1Q9Y A;  4J2D A;  4KHN A;  3QNO A;  3HP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...