2RKHA

Crystal structure of a putative apha-like transcription factor (zp_00208345.1) from magnetospirillum magnetotacticum ms-1 at 2.00 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
164
Chain Sequence
b'TLTPKEAVRLCALGTIASQPMRYSELAGSVRHFTSRIMGPSLELMGISIELLRYEGLVEAVDAMLAISAAGRRELHSLLTARLRPGSDLSKLVVALKMRFLGLMEAEERAHQIDLLIEGVDSELARLADLRGGEGGSALAAWLDHDMALLESRLAWLEDFRARL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative AphA-like transcription factor
publication title Crystal structure of a putative AphA-like transcription factor (ZP_00208345.1) from Magnetospirillum magnetotacticum MS-1 at 2.00 A resolution
rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Transcription
total genus 49
structure length 164
sequence length 174
ec nomenclature
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rkhA01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 2rkhA02
2M5WA 2PFBA 2L01A 3WGGA 3IL2A 5LGTA 1SAXA 3KLNA 2DLLA 5ILUA 1ZGJA 1FT9A 1P4AA 2NNYA 2KRFA 4UVBA 3ZQ7A 2FSWA 3HHHA 1HKTA 1OMIA 5F6FA 3E6DA 4CGZA 3HUGA 3BROA 3KP4A 3KP6A 3FMQA 5JI6A 4LLGF 5L3CA 4Y13A 3FWEA 3GWZA 1R7JA 3TQNA 1ZLKA 4LG0B 4U7DA 1BI2A 2BEOA 1S8NA 4EVIA 5HS7A 1TQIA 4UVAA 3EDPA 2CQKA 4ASNA 1FPOA 3RDIA 3F72A 1ZAOA 2FRHA 1ZN2A 2OQGA 4YIIA 2O61A 4ZYHA 1X3UA 2GXBA 2MBFA 3QAHA 1XB4A 1YG2A 3LA2A 2ESNA 3KE2A 4G7ZF 4I09A 4YFXF 1RUNA 3MEXA 2A69F 4ZYEA 5LGUA 3JSOA 3HRUA 2L54A 4EJOA 1XSDA 2PLYA 5L3GA 5HS9A 4OOIA 3GF2A 4G8XA 3L00A 3BPXA 4G94A 3QU3A 4FX0A 4MQ9F 3I64A 1TNTA 2IJLA 3MFKA 3DEUA 1BC7C 4EJUA 2V6CA 2OU2A 2VE9A 3KZZA 2HQRA 3IRQA 3BZ6A 3DV8A 2KJBA 2OZUA 2FQ3A 1XCVA 1Q1HA 1G3SA 4BXUA 2PI0A 2ZNYA 5D4SA 1UHMA 4U0VA 3I71A 1BI0A 3H92A 1K78B 1F5TA 2Z99A 3EYYA 4U0YA 1STZA 2PQ8A 5CVUA 1T98A 1PP7U 4ZH4F 2XAJA 5TJJA 4RAYA 1YLFA 3LA3A 2RV8A 1W5SA 4WX9A 4ESFA 5HOOA 4RGXA 2ZKZA 1RNLA 1U2WA 3ZMVA 1TLHB 3T8TA 4BQAA 1GVJA 1R58A 3RIRA 1DDNA 1FPQA 4U0WA 4NB5A 1B1BA 2HZTA 2PG4A 2G7HA 3OOPA 1U5TA 3EUHA 2RGVA 5HDGA 3CUQA 2DU9A 5E17F 5D5UB 5FB2A 2F2EA 1A04A 1FC3A 2FBHA 3F8MA 1U78A 2OD5A 2ZNZA 2K4JA 4HX8A 4Y15A 1B9MA 2PBIA 1W7PB 4AIKA 3I5UA 5JHUA 1XSVA 4L0ZB 4G9YA 4I0BA 1O57A 2NYXA 4HV6A 3R0JA 1ZYRF 1QZYA 5D6FA 2MC3A 4A6DA 3BP8A 2XKOA 3HOSA 2DTRA 2F5FA 5HS8A 3COAC 3EETA 3ML6A 5JR3A 3CUOA 1BI3A 2GZWA 5J6XA 1UB9A 2R7DA 3GVAA 5DUKA 1TW3A 4IVNA 5KK1A 3K1NA 4HQEA 3RKWA 2CSOA 2HTJA 4KFCA 2IVMA 3L9FA 4BNCA 1FZPB 5CVJA 1U3EM 1Z91A 5ICEA 4A5MA 1WWXA 3WTZA 1JGSA 1H9GA 2PEXA 4P9UA 3VOEA 1E17A 2HYGD 4ESJA 3M7GA 2O3FA 2KIMA 3DP7A 3F3XA 3ECHA 4KNYA 5DEQA 1J2XA 3LSTA 4R8HA 2WV0A 2IA2A 2BYVE 2FEZA 3JAMK 4CXFA 4I02A 5H20A 2IW5A 1F9NA 2HQNA 2QQAA 4I2OA 5D4RA 1IXCA 2YX7A 4ZYDA 2IA1A 3K1PA 2FOKA 3HHGA 4M71A 2VBYA 2K7LA 3DF8A 3HRMA 4ETSA 4HF0A 1LDJA 4HOBA 3WTVC 2XAQA 3BJ6A 3FXUA 3T1BA 1YW8A 1MKMA 5HLIA 5LHGA 2XROA 3I0TA 3CDHA 1RI7A 3IHUA 3M8EA 2YSRA 1EH7A 3GEZA 4KICA 2DI3A 3R6SA 1O7LA 1SD4A 1IRFA 2QLZA 3DFGA 4RGRA 1MD0A 1V4RA 4KIGA 4EGYA 2XAHA 3RYPA 1EH6A 1HSTA 3ZP5A 2O6GE 3ZMTA 2Y0MA 3QPHA 4WXDA 5AIQA 3ZMZA 3FZVA 2DK8A 3EYIA 3M9AA 2F5EA 1IN8A 3K0LA 4UHTA 5IT9K 5FFXA 3G73A 3ABUA 1V3FA 1TNSA 3TOAA 2ELHA 1CF7A 1KQ9A 3F6OA 4OIQF 1MJAA 3I54A 3WTSC 2OA4A 3K1MA 2G7UA 4IRHA 4YFKF 1O3QA 2LSOA 3RKYA 3CLOA 1IAWA 3B02A 4M9XA 3DKWA 2EV5A 2YR2A 3JTHA 3PFIA 4BAYA 2EFOA 4P55A 4N9IA 2XAFA 3P9CA 1ZLJA 4YIFA 3C1DA 1XN7A 2K27A 5ICCA 5L3DA 4IRGA 3TKYA 1LQ1A 4WK8F 4U88A 3ZMDA 3U2RA 5LRRA 1U5TC 3KEOA 2FBKA 1BIBA 4EQQA 2K86A 1U5TB 3CUQC 2EB7A 1R23A 1USTA 2LKPA 2P5KA 1Y0UA 5L3EA 1ZG5A 2TDXA 2R3SA 3CUQB 1TBXA 2O0YA 1FP2A 2P8TA 4Q47A 2RDPA 3D0SA 4O3MA 3K9TA 1SMTA 4L5JA 4KMUX 4HYEA 1T38A 1FYMA 1R1VA 5L3FA 3T8RA 4HDUA 2QENA 2LF8A 1ZRCA 4WXCA 4ZZDA 2J5PA 1LDDA 2DQRA 2XRNA 1L3LA 3MAJA 5ICFA 3UO2A 2Q8KA 2OBPA 2D2WA 1FBUA 1TTYA 3CTAA 1YTYA 1Z05A 3D5LA 4BYYA 4RAZA 2QVOA 2PMUA 4ON0A 1QBJA 5FLXZ 4PDKA 3W6KB 4KN7X 3V7CA 2HKXA 4TV7A 4ZYGA 3R60A 4F7ZA 3E5UA 4G6DA 4ENJA 2HYFA 3GZ5A 4ENKA 2FE3A 2NRAC 4KUMA 3G3ZA 1R5GA 3BWGA 4KA4A 3SZTA 1AWCA 1QO0D 4A0YA 1JHFA 2Q2EA 2EV0A 5CVRA 3L2CA 3LQRA 1ZREA 4B09A 2VT2A 4L9NA 5ED4A 3T5XA 3K69A 2UXXA 1HSJA 4RB2C 1W5TA 2XKPA 2ZMEA 5FD6A 2P5LC 3MZYA 1WRJA 2DPUA 1IW7F 1DPRA 4FHTA 5K5QA 3Q5FA 3TGNA 2HWVA 3PQJA 5D5XB 1SD6A 4S05A 1SD7A 4OMYA 3FXQA 3JW4A 1S7OA 4XRFA 3V4GA 4HA8A 2B0LA 3I59A 1RZ4A 4A0ZA 1FSEA 2JRTA 2FMYA 2FXAA 4JK1X 2A3SA 3HSEA 1ULYA 2O8XA 4A2UA 1BOAA 2LF7A 2O03A 1LEAA 2UWMA 2QBYA 4EJTA 2GA1A 1JXSA 1ZG1A 3F23A 3SXYA 3TO9A 2KIFA 2A6HF 1R00A 5FO5A 3QPTA 1TQMA 2H27A 3WU0A 5BPIA 2QWWA 5E8GA 2DPDA 4MTDA 1T2KA 1R1TA 3KETA 3O2PE 2A5YB 3SZPA 3HRSA 4P9FA 4O6JA 1KU9A 1XGOA 1FBSA 1DUXC 1DP7P 1IXRC 2XAGA 1S7AA 3M8FA 2CGPA 3ABTA 4EV0A 3BJOA 2FF4A 2XIGA 1KGSA 2FA5A 3H3ZA 4KT5C 1FX7A 1QQIA 5TRDA 3WTUC 4ZZLA 1FWZA 1FSHA 5K1YA 3TDUC 2GIVA 2W24A 5ILVA 4OMZA 2V79A 2XVCA 1W7PD 2DK5A 2ZFWA 4XBFA 4EGZA 4L9TA 2YU3A 1HBXG 1XD7A 3PQKA 4MNUA 3JTGA 2DQLA 4L18B 1IN5A 1R36A 1MGTA 4XSXF 3ZN0A 4MTEA 3GW2A 1AOYA 2KKOA 5CLSA 2W25A 3MZHA 4NQWA 1J59A 4KDPA 3FF5A 3CO6C 4AIJA 1REPC 3WTYC 3I4PA 3RPUA 4OINF 2PN6A 4LJZF 4MGRA 1OYYA 2CG4A 4N9HA 1T39A 1SFEA 5IT3A 2F5DA 1R1UA 1MDMA 2M8EA 3J80Z 2HR3A 1ODDA 3E5QA 3R61A 4QLCU 4CYDA 1B6AA 2JPCA 3CJNA 1SMYF 4P5OA 1P6RA 2EA4A 3WODF 4A0XA 1NHAA 2ESHA 4OU0A 2EK5A 1UCRA 1I1GA 2E1NA 2IT0A 4I7HA 1SFUA 3FXRA 3VB2A 4HBLA 3C3WA 3QRFF 1SD5A 2XUBA 5BOXA 5J8FA 3SQNA 3DPTA 2BV6A 2OZ6A 4RS8A 1I5ZA 4LB6B 2WWYA 1OYWA 3OV8A 4KYWA 1QGPA 1F4KA 1HW1A 1H9TA 3GX4X 1I1SA 3ZMUA 4BH9A 1XSXA 2NNNA 2EFQA 3V8KA 3QOPA 4GYGA 5CVVA 1J7KA 1IN7A 5AONA 4OIRF 2L02A 5DCMA 4KN4X 3KZYA 1U8RA 4P96A 4ENMA 2LDUA 2M30A 2EFPA 4WF2A 3VFZA 1FBQA 1PDNC 5JFRA 3TO6A 1HW2A 5E8IA 2YPRA 3ZMSA 3ISPA 1O3RA 3FX3A 1G3YA 2Z9OA 3GXOA 4Y17A 5E1WA 1LB2A 4M6XA 4BHPA 1PP8F 4ENNA 3UO3A 1KA8A 3E6CC 3WGIA 5DUIA 1Z1DA 2Z33A 1B59A 1P4XA 3IWZA 1IXSB 3S2WA 3I59B 1MZBA 2L3DA 4HQMA 4IPAA 2A68F 3RYRA 2X0LA 2QUFA 3V8JA 2Y75A 3F21A 4HLYA 1FNNA 3R0AA 5E20A 4LK1F 3HYIA 1HW5A 5HLGA 1LJ9A 5E1XA 2HGCA 5DDGA 5HDNA 5A2QZ 4EM2A 1YFHA 2V9VA 3C7JA 1LDKB 3IC7A 3DPLC 4FX4A 1D5VA 1GXPA 2VC1A 2DFIA 4HDVA 1WQ2A 1PUEE 2HEOA 1KQ0A 4DQ2A 5BS6A 5E18F 4XLNF 4MQVA 2J5OA 1ON1A 2RVCA 4M6YA 1G3WA 4U7BA 2UXNA 5BPDA 2PMHA 5H6QA 4Q5SF 1WI9A 4RB3C 5CJ9A 4Q4ZF 5LBQA 1ON2A 3LAPA 2D45A 4IF4A 4G6QA 2VOOA 2MLGA 1BM9A 3HRTA 2V1UA 1ZGAA 3N4MA 1UHWA 3KP2A 2R7FA 5LLQA 1FP1D 4UV9A 2XASA 3BJAA 4XSZF 4E70A 2VXZA 2COMA 1YYVA 4HLXA 3GLXA 2ZO4A 3ULQB 2D1HA 4GO1A 4CHUA 2A6EF 3WU1B 4KIBA 3E6MA 3O3KA 4LFUA 2M87A 3N97A 4D0PA 3DQVC 1XDUA 4UNOA 3F8FA 2ADUA 1P4WA 4GXOA 5HDKA 1Z6TA 5ILSA 3GFLA 3P7NA 1WKMA 4JQFA 4IHSA 5KVRA 4IJAA 1K7AA 4EMSA 2HFHA 1CGPA 2VC0A 2DW4A 1S29A 2F5CA 1DPUA 2YX4A 1HXDA 1EH8A 2RQPA 4HV5A 1GHCA 2QQ9A 2RN7A 2GQQA 2MH2A 1D3YA 4IXAA 4EM1A 1G3TA 1MDMB 2ZBKA 4ESBA 3VODA 1RUOA 2HOEA 2EV6A 2RNJA 3GFIA 2C6YA 2AS5F 4M74A 2H6BA 2V1XA 2D1VA 2VOPA 3HSFA 2EFNA 1JE8A 3KLOA 3IWFA 1XGNA 4MEXF 2K02A 1R5HA 5D5WB 4I0AA 4HAMA 2MD5A 1B4AA 1MJ9A 1LNWA 3WE3A 3F22A 2ACJA 3REOA 4PGHA 2JZYA 2FNPA 3MQ0A 3K2ZA 2VONA 4WWCA 2QQBA 4O5VA 1J5YA 2WTEA 1O3TA 4IT5A 2A61A 5K5OA 1R22A 3E97A 5K5RA 1BIAA 2STTA 5DCMB 3J81Z 2ZXJA 5D8KB 1KQ8A 3LA7A 2GA2A 2QYOA 2VE8A 4OIOF 3WTTC 5J8CA 2RKHA 3QU6A 1P2FA 3VEPA 1I6XA 4YFNF 4A12A 3HTUA 1ZH5A 2KJCA 1H0MA 1HQCA 5LEKA 2LNBA 1BI1A 3MWMA 4PZJA 3RJPA 3QP6A 3HOTA 4RGSA 3BVOA 5ICGA 3P9IA 5BQTA 4GYIA 2PJPA 1VTNC 3HTSB 3DXJF 5CVIA 3V7SA 1FYKA 4LK0F 2FBIA 3RKXA 3BOQA 2Q0OA 5D8LB 1S6LA 4EJWA 1BN5A 2E1CA 3B73A 3GFJA 3HSRA 1QNTA 4UUVA 3MCZA 2DAOA 5E1ZB 5FLXK 4XLPF 3NQOA 2CW0F 4BHCA 3GZ6A 1TQPA 1K79A 3KCCA 1TW2A 2GWRA 1FLIA 3KP7A 1N1CA 3Q9VA 3KFWX 1BBYA 3H3UA 4YG2F 1KYWA 4UV8A 4Q48A 1OPCA 1YW9A 3FHZA 5LHIA 4RGUA 3J81K 3SFZA 3TOBA 4LMYA 4L0YB 2CYYA 1CF7B 4IHTA 3TDZC 5FD5A 1FY7A 4HX7A 3WG9A 1JHHA 2VN2A 3LAJA 1GXQA 3NRVA 2K4BA 2Z5UA 2MA3A 3L7WA 4OIPF 3LWFA 4CDGA 1SFXA 4LB5A 3CO7C 3HIFA 1FYLA 4H0EA 1ZRDA 3KEQA 4LLNA 2M45A 3WE2A 4L9JA 4HZFA 2DBBA 4WCGA 4M9ZA 1RIOH 5D5VB 1HKSA 5EEGA 2CFXA 3U1DA 2VBXA 1IUYA 3F6VA 2ISYA 4M72A 3T0YA 5BMZA 2HDCA 2W85A 5EEHA 4K2EA 4A6EA 2STWA 4NHJA 2A07F 2FNAA 2IA0A 3IRRA 1KYZA 2M1BA 3FMSA 3ROUA 4G7HF 4B8XA 4LD5A 1W4MA 2JSCA 2EWNA 5CYVA 3JAMZ 1KU7A 3FMRA 2JPBA 3TO7A 3FM3A 2L4MA 4FT8A 4R1HA 3WGHA 4PCQA 2XGXA 3ERED 4RB1A 1D8JA 3GYHX 3SHFA 2JTVA 2L4AA 1YO5C 4I01A 2ETHA 5LRSA 3Q9SA 5AIPA 4GCVA 4L9VA 2NAZA 4M9SA 1ZARA 1XMAA 2IRFG 2FMLA 1YW7A 5JVTA 2V1DA 2GXGA 1HKQA 4AD9A 3GO5A 2P5VA 3P9KA 2ISZA 2VBWA 5HVQC 1Z6RA 1YS6A 4MHGA 4IRIA 1ZRFA 3E3VA 3EQLF 2DT5A 4LLLA 4RB0A 3WTWC 4LG0A 1KU3A 2ZMEB 4KMFA 4Z2YA 3LFKA 5LHHA 5IT9Z 2P7VB 1U6GA 2H09A 2VT3A 2NS0A 1IN6A 4EM0B 1MJBA 1YQAA 4UVCA 4S04A 3GUDA 3U9GA 2MLKA 3RTRA 1G4DA 4CICA 1G6NA 4BHBA 1Z9CA 1KU2A 3E5XA 5DD8A 3F8BA 5DYMA 1I27A 3QP5A 3J80K 4G7OF 3O6BB 4PGGA 1UFMA 5ERIA 3V7RA 2W57A 2HKOA 2X4HA 3IKTA 2RC4A 2KIUA 2E7WA 2P4WA 2IPQX 3L09A 2ZCWA 3FM5A 2WC2A 1YS7A 3E6BA 3NEUA 4EJVA 1ZHFA 2QBYB 5HLHA 2E7XA 2IP2A 1OKRA 3I53A 5DD4A 4WXHA 2XV4S 1T0FA 1EV7A 3ELKA 4A5NA 1BC8C 2JT1A 3F8CA 2P6SA 2EA2A 4I98B 4L5IA 4N0BA 3I58A 1ZG3A 1USSA 1LVAA 2HS5A 3ZN1A 3IKVA 2EJRA 3C18A 3JSPA 2VODA 4CZZA 1Z7UA 1T6SA 3RI4A 1K78A 3ZPLA 1FOKA 4M73A 1LEBA 4AWXB 2AXLA 2W84A 3BPVA 2Z3YA 4HF2A 2CWEA 1YIOA 3R4KA 4HW0A 2VBZA 5DV5A 1XMKA 1OYIA 2FU4A 2P6TA 1XCBA 2ZJ2A 2BGCA 4JBAA 2BE5F 4MEYF 1WSUA 1QZZA 1IF1A 3BDDA 1QPMA 2H6CA 4AVPA 5FFZA 1B9NA 3AAFA 1L0OC 2UZKA 2MH9A 5LGNA 2EFWA 1XDSA 3ECOA 1O7FA 2QM3A 3KP5A 1OR7A 2CO5A 5D6EA 4LGWA 3KP3A 5L3BA 3WTXC 5A2QK 2XHKA 2OQRA 2Y48A 4KIFA 5DCFA 1J9IA 1BJAA 5LEJA 4CO8A 3M1EA 6PAXA 1D8KA 1O3SA 4UXNA 1K6OA 3RPQA 1IRGA 1P92A 4R79A 1XGMA 3BY6A 1W7PA 1E2XA 1F1ZA 3J7AO 5F64A 2HTSA 5F1RA 1XGSA 2BBYA 1J0RA 4GGGA 1J75A 3GFMA 4QWQA 1IZ1A 1IN4A 2G9WA 4DNCA 3V8LA 4HF1A 4AIHA 3W6JB 5FGMA 2DO7A 5H6RA 2P7CB 4HX4A 3LQQA 2GAUA 1ONVA 2QZ8A 1S3JA 3F8NA 1C0WA 2OAZA 2H94A
chains in the Genus database with same CATH superfamily
2M5WA 2HOTA 4XM3A 1LFBA 2DA7A 2L01A 2PFBA 3WGGA 3IL2A 4D7MA 1ETKA 5LGTA 1R4NB 1SAXA 3KLNA 2DLLA 5IP6A 1N75A 5ILUA 2EIKH 1ZGJA 1ETXA 1FT9A 1P4AA 1Q9YA 2NNYA 2KRFA 4UVBA 2R7QA 2FSWA 3HHHA 3H36A 3ZQ7A 4F91B 1HKTA 2HVSA 2X9DA 3SQ1A 2DMPA 3D1NI 2O8KA 2VJ5A 2HOSA 2K40A 1FOWA 5E3NA 1OMIA 5F6FA 3CQ8A 3E6DA 2K9NA 3FXJA 5M5XJ 2V26A 4CGZA 2JA2A 2W4SA 1MBHA 1LE8A 2DMNA 3HUGA 3BROA 3KP4A 3KP6A 3FMQA 2XF7A 5JI6A 2XC7A 2IBDA 2Y30A 2R4GA 4LLGF 5L3CA 4Y13A 3FWEA 2KRHA 3L2UA 3GWZA 2MC4A 1R7JA 1CLQA 3TQNA 1ZLKA 2JMWA 4LG0B 1PUFA 3TW7A 2L7KA 3K2OA 4U7DA 1BI2A 3PO3J 2BEOA 1S8NA 1SFKA 2X6XA 3FXOA 5HS7A 4EVIA 1TQIA 4UVAA 3EDPA 2VQCA 5JHFA 2CQKA 1IDYA 4ASNA 1FPOA 4CUGA 3RDIA 3LNQA 3F72A 5CKTA 1ZAOA 2R92J 1VQ5I 2NVXJ 3HOZJ 2FRHA 1ZN2A 3QEIA 1E3PA 3KYDB 2VPLA 2OQGA 3S2DJ 4M3GA 4IHYA 4M3RA 3SJJA 4YIIA 2O61A 4ZYHA 4UUSB 1X3UA 2LRDA 2JHPA 2GXBA 2MBFA 3QAHA 2LF3A 3MKWB 5FKMA 1XB4A 1YG2A 3LA2A 2BHZA 2ESNA 3MVPA 3N05A 3KE2A 4G7ZF 4I09A 4YFXF 1ZTRA 1RUNA 2L9RA 2A69F 3MEXA 2R7TA 2HU9A 1MW7A 5EJCA 4ZYEA 3HRUA 2L54A 5LGUA 3JSOA 4J19A 4W1UA 1TT0A 4EJOA 1XSDA 1KZHA 2PLYA 1WJFA 3A1YA 3J7YJ 5L3GA 1H88C 1UG0A 5HS9A 1G8XA 4OOIA 1LVKA 3GF2A 4XLCA 5IOYA 1J09A 4YRVA 3AFHA 5M5WJ 4G8XA 3L00A 2E32A 3BPXA 3TMOA 4KI4A 2PFTA 4G94A 1FYZE 3QU3A 4FX0A 4KHNA 2JQTA 4MQ9F 3HGLA 1U8BA 4BU2A 3I64A 1TNTA 3GTJJ 1ETYA 2IJLA 3MFKA 3VYSB 1G2HA 2JVHA 2LBFA 3DEUA 4AM3A 1JKQC 1BC7C 3HXLA 4EJUA 1X3ZB 3H5NA 3HC7A 2WADA 5E3MA 1T0FC 2NVYJ 2DJNA 2V6CA 2OU2A 1UJ8A 2EIJH 2AQEA 2FOWA 3KZZA 5GTIC 2XGDA 2HQRA 2VE9A 1QHGA 2X85A 3IRQA 3BZ6A 2R0QC 3DV8A 5DM7F 4KT6A 3G6EI 2KJBA 2NOGA 2FQ3A 2OZUA 1XCVA 4BQNA 4NC8A 2KFDA 1Q1HA 1SVOA 3WU2C 1A36A 3HL8A 1G3SA 4BXUA 5CQEA 2PI0A 3E1SA 3CCVI 1RPWA 2ZNYA 2CS3A 2X1CA 4B47A 1I50J 4BXXJ 2MYSA 4NNJA 5D4SA 1UHMA 3VDXA 1WJAA 4U0VA 3I71A 1BI0A 3OYFA 1QRYA 1MBGA 3H92A 1C0WA 1K78B 4RLQA 1A31A 1F5TA 2M8GX 2Z99A 1FZ0E 3EYYA 4U0YA 4Z6YA 1B72B 5GPAA 1STZA 2PQ8A 5CVUA 3SCXA 3ERMA 3G1LA 2B9SA 1JJ8C 4GDFA 1T98A 4E4HA 4KHYA 1PP7U 2BHYA 3ZXSA 4ZH4F 1LFPA 3OYCA 4M42A 3SQ4A 2XAJA 4E7ZA 5TJJA 2WAQA 1YX3A 1YLFA 3LA3A 3IAM2 4JX6A 4RAYA 2GLOA 2RV8A 1W5SA 4WX9A 4ESFA 1GUUA 1K83J 5HOOA 3ABMH 3HPGA 4RGXA 4C3IJ 2ZKZA 1RNLA 4KHWA 1U2WA 3ZMVA 1TLHB 3T8TA 3AL0B 4BQAA 4AKIA 1GVJA 3OY9A 1R58A 4MLOA 4PJLA 3RIRA 1DDNA 1XPXA 2LOOA 4JOMA 2PMZN 4HG2A 1FPQA 1OR7C 4A3CJ 3H1CA 1MNMC 2E2HJ 4U0WA 5FKOA 4NDLA 4NB5A 3QERA 4ABZA 2XB5A 1RESA 4HEA2 1B1BA 1QHHD 2DFEA 2HZTA 2PG4A 2HYJA 2G7HA 2IGNA 4V2GA 3OOPA 3RSNA 5C44J 1U5TA 2ZSHB 3DEEA 3EUHA 1FZ9E 2RGVA 4QNDA 5HDGA 5GTHC 1ZELA 3CMAI 3RQIA 2OCEA 1HA8A 4XKCA 3CUQA 3K4BA 2DU9A 2WAFA 5E17F 4DZPA 5D5UB 3QEPA 4FJNA 5FB2A 2DA2A 2F2EA 5B66C 1A04A 4RBOA 1FC3A 4JS5A 2FBHA 3ABLH 3F8MA 5DTDA 1U78A 1MHYG 5F27A 2OD5A 2ZNZA 5FKKA 4JYKA 5C4JJ 4DTSA 3PIOF 2OZMA 2K4JA 4HX8A 2KMUA 1IH7A 2WAEA 4Y15A 3SPZA 4GRIA 2JVGA 1B9MA 2PBIA 1X1AA 1W7PB 4AIKA 4IHVA 3C95A 3I5UA 4BE0A 4FJLA 5JHUA 3DCFA 1XSVA 4L0ZB 1W5CC 3L2OB 1D1AA 3ZOBA 3CCEI 1VI0A 3OYEA 4G9YA 4I0BA 1O57A 2ZC2A 3OYBA 2NYXA 3PNYA 4HV6A 3R0JA 1V5EA 2FW3A 5KHDA 1ZYRF 4M3XA 1OCCH 3CQZJ 1VQOI 2E60A 2CU7A 1QZYA 5D6FA 2MC3A 4A6DA 3BP8A 2XKOA 4QIWN 5FLMJ 3HOSA 2DTRA 2QGUA 2F5FA 3M8JA 5HS8A 5J40A 3EETA 3ML6A 3COAC 1YIJI 2R93J 5JR3A 3K6GA 1R71A 4PJNA 2GBYA 3GTGJ 3J7AY 2LY1A 3CUOA 1BI3A 2GZWA 2LY9A 2H1LA 2EIMH 1S5LC 4RNGA 5J6XA 2OVRB 2N8GA 1UB9A 3UNGC 2R7DA 3GVAA 2EBIA 1R9TJ 1JTYA 5DUKA 1TW3A 2JJ7A 4X5NA 4RM3A 4IVNA 3U21A 2QSHX 4PSXA 4J2BA 5KK1A 4IX7A 1X19A 4BACA 1TZLA 4IHXA 3K1NA 4HQEA 3RKWA 4BS9A 3K2AA 3PSIA 3OSGA 2DA5A 4UUTA 1RKTA 4N4NB 1IO2A 2CSOA 2HTJA 4KFCA 1FEXA 5EEAA 2IVMA 2K5CA 3HUGB 3OS2A 2K9LA 1LE8B 1YRNA 3SJMA 3ZQLA 1ZGWA 3SUNA 3L9FA 4BNCA 3C2BA 3RMDA 2LTPA 1FZPB 2JH8A 1MH3A 1SANA 4HRIA 1S7EA 5CVJA 4IZZA 3QEVA 1D1CA 1U3EM 1Z91A 2RREA 3FKIJ 5ICEA 4A5MA 1WWXA 1SEUA 3WTZA 1JGSA 2VJJA 3J2PA 1H9GA 2PEXA 4P9UA 3VOEA 1PUFB 3GTQJ 5EF6A 3OS1A 1E17A 1WZ2A 2HYGD 4ESJA 3OYAA 3M7GA 1ETWA 2GOMA 2CQXA 2KIMA 2O3FA 2W48A 3DP7A 3F3XA 3ECHA 3JR9A 3HL2A 4KNYA 2CW7A 5B1BH 3C2HA 1WPKA 2DOFA 2VQHA 5DEQA 1J2XA 3LSTA 4R8HA 5J1YA 1QPIA 2WV0A 2LYCA 2IA2A 2BYVE 2FEZA 2PFVA 5M3MJ 3PJRA 1JKPC 3JAMK 4CXFA 4CYCA 3MMYB 4I02A 2E2IJ 5H20A 2IW5A 1F9NA 1R4MB 4JS4A 1UZCA 2HQNA 4ADNA 2QQAA 3S3MA 3TBIA 1W0UA 4I2OA 5D4RA 1IXCA 2YX7A 4BQQA 4ZYDA 2DN0A 3DBRB 2IA1A 3FK7A 1JI8A 1XMGE 1P22A 5IYCJ 3K1PA 2FOKA 4E4BA 1WFXA 3HHGA 4ITVA 2IS1A 4X5MA 3DTKA 4M71A 4ANJA 1FOXA 2VBYA 2K7LA 3DF8A 1RC9A 2JK3A 3HRMA 1IRZA 1S72I 2Y2ZA 4ETSA 1I3AA 4HF0A 1LDJA 1MNEA 2CUFA 4HOBA 2ZXHA 3WTVC 2XAQA 3BJ6A 3K4KA 4FK0A 3FXUA 1FZ3E 1ENHA 3S1NJ 2B1EA 2JA7J 3T1BA 1YW8A 1MKMA 3SUPA 4I9QA 2LG4A 5HLIA 5LHGA 9ANTA 3I4NJ 1ETOA 2XROA 3I0TA 3ZRGA 1E3HA 1MMAA 4AKHA 4QPOA 1FIAA 2MD0A 3CDHA 1RI7A 3RMAA 3IHUA 3M8EA 5F0HA 2YSRA 1EH7A 1FMWA 3GEZA 4M41A 2CRGA 1WJ5A 2Y9ZA 4KICA 1V5GA 1EF4A 4M45A 3CJTB 1FZ1E 2DI3A 3R6SA 3OYLA 3TEDA 5J1RA 1O7LA 1ETQA 1AKHA 3GTMJ 1SD4A 2DY4A 1IRFA 2QLZA 2KQRA 2Y31A 3DFGA 3IP4B 4HPQA 4D7NA 2JQ7A 3N1BA 3KD5E 4RGRA 4DBRA 1MD0A 1V4RA 1G59A 4X6AJ 1ZR4A 4UY8I 3S3OA 3TW6A 4KIGA 4XL9A 1EKEA 2XAHA 4EGYA 3RYPA 4CCLA 4KHUA 1EH6A 1HSTA 1JUPA 3ZP5A 2O6GE 3ZMTA 2Y0MA 4EEFG 1YX5A 4E6KG 4XOPA 2E1OA 1H8AC 1FZHE 3SQ2A 3QNOA 2RCUA 3OR2C 3QPHA 4WXDA 5AIQA 3ZMZA 3FZVA 2LKXA 2DK8A 5GP9A 3H9GA 1VQ7I 3EYIA 3M9AA 2F5EA 1IN8A 3K0LA 4UHTA 5IT9K 2E35A 1V5FA 5FFXA 3G73A 3KYLA 2DA4A 3TJYA 4N4OB 5B3SH 2Z1DA 3ABUA 1V3FA 1TNSA 3DLAA 3TOAA 5FRMA 2ELHA 1CF7A 4FE4A 1KQ9A 3F6OA 4OIQF 3EPZA 4FJKA 2DDAA 1MJAA 1AA7A 3I54A 4ZTJA 2WB1A 3WTSC 3RPUD 2OA4A 1PYVA 1JW2A 3K1MA 4IOAF 2G7UA 4IRHA 3G4SI 2MW2A 4BEHA 4YFKF 1O3QA 1MBKA 2LSOA 3BCAA 2OTLI 2CQNA 4XLFA 3RKYA 3CLOA 2WA0A 1BR2A 1IAWA 3GTKJ 1CQTA 3B02A 4M9XA 3DKWA 2EV5A 2YR2A 3JTHA 4HNVA 3PFIA 4BAYA 2EFOA 4P55A 4XRSA 4N9IA 5FLVA 4DTRA 4FVMA 2OCCH 2XAFA 3BTCA 1XVEE 4J2DA 3P9CA 1YI2I 1ZLJA 4QTRA 1W36C 2UUZA 4YIFA 2X48A 3A01A 3C1DA 1DP3A 1XN7A 2K27A 4AIDA 4P1WA 1VFCA 4XN0A 5ICCA 5L3DA 5J4VA 3AKZA 4IRGA 3TKYA 2E36A 1LQ1A 4WK8F 4U88A 3ZMDA 4KJZA 3U2RA 5LRRA 1U5TC 3BG6A 3KEOA 2FBKA 1BIBA 4EQQA 2EZKA 1K6YA 2K86A 5GAEJ 1QVUA 1U5TB 3CUQC 4W97A 2EB7A 1R23A 5IPAA 1USTA 4FJ7A 1XL3C 2LKPA 2P5KA 1Y0UA 5L3EA 1TWCJ 2TDXA 2R3SA 3CUQB 1ZG5A 4AYBN 1TBXA 2O0YA 1I6HJ 3CD6I 2K9SA 2IS4A 3TABA 1FP2A 1POGA 4U87A 2DMQA 2P8TA 3EUAA 4Y52J 4Q47A 2RDPA 3D0SA 3L2RA 4O3MA 3BQYA 4DU1A 3K9TA 1SMTA 3HBLA 4L5JA 4KMUX 4HYEA 1T38A 1FYMA 2Y0SA 4BJ5C 2DXIA 1X4OA 2BZTA 1XVCE 4DTOA 1R1VA 3LSGA 3LSMA 2ID3A 5L3FA 3T8RA 3GTPJ 3TAGA 2LP0A 4HDUA 3LSRA 2QENA 2LF8A 3W3CA 1ZRCA 4WXCA 2LKSA 4ZZDA 2J5PA 1LDDA 2CV2A 2DQRA 2XRNA 1LFUP 1L3LA 4I99C 2KHMA 3MAJA 5ICFA 3UO2A 2Q8KA 2OBPA 1LPQA 2D2WA 1FBUA 1TTYA 5JVGF 2X1EA 3CTAA 1OFCX 1YTYA 1X58A 2EPFA 2HDWA 4IKFA 1Z05A 3D5LA 5FROA 3OYJA 2VL8A 4EATA 4BYYA 2RNGA 4RAZA 2L9SA 1Z0XA 2QVOA 2PMUA 4ON0A 1QBJA 2E71A 2R7XA 3NWSA 1ERDA 3JRHA 4FE7A 4DYRA 5FLXZ 4XKWA 4PDKA 2I8DA 2IS6A 3WSOA 4PJ0C 3K7AJ 5IREA 5IP9J 1VQKI 3W6KB 3K4JA 1GT0C 3TAFA 4KN7X 1TWAJ 3V7CA 2NVTJ 1HCRA 2HKXA 1FJLA 4TV7A 4ZYGA 4DYCA 3R60A 1Z7LA 4F7ZA 4FETA 3I56I 4ZTFA 4AC0A 3E5UA 3A02A 4ZDPA 4G6DA 4ENJA 3AG1H 4RG8A 3HGKE 2ZJPF 2HYFA 2XPUA 2M2EA 2R5ZB 3GZ5A 4ENKA 2FE3A 2HDDA 3BCBA 3HKZN 1FMVA 2NRAC 3ONQA 4KUMA 3G3ZA 2H8RA 3CCLI 1R5GA 3BWGA 1HC8A 2M0MA 4KA4A 3SZTA 4E7SA 1FIPA 1PVEA 1AWCA 3BR5A 4FK2A 2HD0A 1X3WB 1T95A 1XTAA 1VQMI 1HLVA 2DTUA 1QO0D 4A0YA 2L9VA 3IV5A 5J1UA 3CFRA 1JHFA 1WJCA 2Q2EA 5KNLA 2EV0A 4XNFA 5CVRA 3L2CA 1YRNB 2L2OA 3LQRA 1ZREA 4B09A 2VT2A 4L9NA 2M7AA 3T5XA 5ED4A 3JRFA 1VQ9I 3ZQCA 5M3FJ 1NG7A 3I9V2 3K69A 5IYBJ 5IY5H 2UXXA 5KCMA 1HSJA 4S0HB 4RB2C 1KONA 2LFBA 1W5TA 2XKPA 2ZMEA 5FD6A 4YEJA 2ZFUA 2P5LC 3MZYA 1WRJA 2DPUA 2JSPA 3IH4A 1IW7F 1DPRA 3LZJA 2E31A 2ECBA 1IGNA 4FHTA 5K5QA 3Q5FA 2F4OB 1T08B 3TGNA 1AU7A 2HWVA 2F4MB 3PQJA 3E7LA 5D5XB 1JUSA 4DU3A 4Y33A 3CDLA 2MMBA 1SD6A 1X4PA 2X1DA 4S05A 4CH7A 1SD7A 4CSWA 4OMYA 3S17J 3FXQA 2QA4I 3JW4A 4A3KJ 2FX0A 1WH7A 2NVUB 2QXFA 1S7OA 3H9JA 4II3A 4XRFA 4F3QA 2YB5A 3V4GA 4HA8A 2QCOA 2B0LA 3ESWB 3G1OA 4MFEA 3I59A 1RZ4A 4A0ZA 1FSEA 2JRTA 2KT0A 2DJIA 5J47A 4BDZA 2NOJB 2FMYA 3OL3A 2FUG2 2FXAA 4ZJZA 4JK1X 5H37A 2A3SA 3HSEA 2JN6A 5K7FA 1XVFE 1ULYA 2O8XA 2XRLA 1TL8A 2R7VA 2BXZA 3F0CA 3RCOA 3PO2J 1IG9A 3H0DA 4A2UA 1BOAA 1XMHE 2IEKA 5IZ7A 2VPRA 2LF7A 2O03A 2F6CA 3NAEA 1T33A 1LEAA 2UWMA 3FDYA 2QBYA 4EJTA 2GA1A 1JXSA 3CZ6A 1ZG1A 3F23A 3SXYA 2K9MA 1IJWC 1DU0A 3TO9A 4ZYAA 3RZOJ 1TP4A 2KIFA 2A6HF 4MO7A 1M1EB 1R00A 2L7MP 2W1OA 3I55I 2ICWG 4DJAA 2HXOA 5FO5A 3OR1C 2HNHA 3H9QA 2DODA 1D0YA 2XF6A 5FRNA 2VKHA 3QPTA 4FCYA 1TQMA 3OIPA 1JKOC 1Y39A 4MFDA 3BTJA 2H4TA 1AKHB 3QETA 2H27A 3Q0UA 2NS7A 1FZIE 3WU0A 2I5UA 5BPIA 1DGRM 2QWWA 3D5RC 5E8GA 2LD5A 2DPDA 4XMYA 4MTDA 1T2KA 3HP9A 1R1TA 1ZQ3P 5IOZA 3KETA 3H5RA 3L8BA 4AU7A 2VKDA 2XAUA 2ID6A 3O2PE 3S32A 3ZQIA 2A5YB 2QKMB 3SZPA 1NEXB 2DFFA 3HRSA 4P9FA 2DTZA 4O6JA 3OGLB 1D5YA 1Z3YA 2CUEA 2IGKA 3FXKA 1KU9A 1XGOA 2KPMA 1FBSA 1DUXC 1DP7P 2FD5A 4PSWA 1IXRC 4RA2A 4E7HA 2VXDA 1A5JA 2CMPA 2XAGA 3UIQA 1S7AA 3M8FA 2CGPA 1ACIA 2DMUA 3ABTA 4EV0A 5FKNA 3BJOA 4C2UA 1FZ2E 3AL0C 1Y8RB 2FF4A 1HDDC 2XIGA 3FXMA 1VQ4I 1KGSA 2FA5A 4DTPA 1Y56A 2P1QB 5F08A 3H3ZA 4KT5C 1FX7A 3Q0WA 3EUKL 1R49A 3K4MA 3CLQA 1QQIA 4XR6A 1SAUA 1U9NA 4ZZLA 3WTUC 1FWZA 2KIQA 5TRDA 1FSHA 1Y6IA 5K1YA 3TDUC 1XU3E 1E3OC 2GIVA 2W24A 5ILVA 3SDGA 4OMZA 5TISC 4CCMA 2V79A 2XVCA 1W7PD 2DK5A 2ZFWA 5HNFA 1RR8C 3LSHA 4XORA 4HSTA 4XBFA 4EGZA 4L9TA 2YU3A 1ZK8A 1HBXG 3N1EA 1XD7A 3BR1A 1OLTA 3PQKA 4MNUA 3JTGA 4OWRB 2DQLA 4L18B 1IN5A 1R36A 1OQYA 1MGTA 2QQ8A 4XSXF 3ZN0A 3ZCOA 4RLFA 3FIWA 4MTEA 1OCOH 1A35A 5K7HA 3GW2A 2FJ1A 1YHQI 2GOXB 3L2QA 2JRMA 1AOYA 1U9OA 2KKOA 5CLSA 4UB8C 2W25A 3MZHA 2ATQA 2CV0A 4NQWA 1J59A 2E5NA 3JCUC 3NGIA 4KDPA 3FF5A 3LSKA 3CO6C 4AIJA 1REPC 3WTYC 3I4PA 3RPUA 4OINF 4BKXA 2PN6A 4LJZF 4MGRA 1OYYA 2CG4A 4N9HA 1T39A 1BJZA 2XPWA 2ELKA 2IGMA 1LKXA 2R7UA 3DKXA 1SFEA 5IT3A 2D5VA 4A3DJ 2F5DA 4F52A 4E7KA 1R1UA 1MDMA 2KRCA 1BW6A 1B8IA 2A5WA 2M8EA 3J80Z 2HR3A 1ODDA 4IQJA 1WAJA 3D5SC 5J3LA 3E5QA 3R61A 4QLCU 1QA6A 4CYDA 1B6AA 2JWTA 2JPCA 2ZJRF 3CJNA 3GTOJ 1SMYF 4P5OA 1P6RA 5IP7J 2EA4A 2QSGX 3BTIA 3LSJA 3WODF 3QODA 4A0XA 4OAZA 1UMQA 1NHAA 2ESHA 4OU0A 2EK5A 1UCRA 1I1GA 1TWGJ 2JA8J 2E1NA 2IT0A 4I7HA 4C30A 2OYQA 1SFUA 3FXRA 4F55A 3VB2A 2COBA 3C3WA 4HBLA 4J01A 3CCMI 4NUBA 1GVDA 3QRFF 2JA5J 1SD5A 2XUBA 4XIDA 2E5ZA 5BOXA 4AUXA 5J8FA 3KPHA 3FBNB 3DPTA 2BV6A 2OZ6A 3SQNA 4RS8A 1I5ZA 3HG9A 1P7JA 2TRTA 3LDSA 4LB6B 4FJJA 2WWYA 1OYWA 4FJ8A 3OMYA 3OV8A 4KYWA 3V42A 1QGPA 4FJHA 1F4KA 1HW1A 2XGEA 3MKZA 1H9TA 1GDTA 3K4LA 3HJEA 3GX4X 3GBGA 1I1SA 5J4YA 1BA5A 3M3YJ 3OYIA 1VQ6I 3ZMUA 4BH9A 4FJGA 3SZGA 1XSXA 2NNNA 2EFQA 3V8KA 3QOPA 4DGWB 1XC5A 3JREA 2R7ZJ 2FQ4A 4GYGA 3L1PA 1F43A 5CVVA 3LFUA 3PM1A 1J7KA 3VSKA 3FK6A 1IN7A 2DYRH 5AONA 2CQ7A 2M4GA 4OIRF 3H0GJ 2L02A 5DCMA 2E19A 4KN4X 3X2QH 1YOVB 3KZYA 4E7IA 2OC6A 1U8RA 4P96A 2WAQN 4ENMA 2LDUA 2M30A 1N25A 2EFPA 3AG2H 3SNNA 4AVZA 3LSPA 3DBLB 4WF2A 1V55H 2W00A 3VFZA 1FBQA 4CCNA 1NK2P 3VYUB 1PDNC 5JFRA 3TO6A 3QEXA 1HW2A 5E8IA 1TWHJ 2YPRA 3ZMSA 4XLAA 3ISPA 3W2VA 5GAGJ 1O3RA 3FX3A 2QKLB 1G3YA 1YJWI 2L9NA 2Z9OA 3GXOA 2DT6A 4Y17A 5E1WA 1LB2A 4M6XA 4G6TB 1ZR2A 4NC6A 3BZCA 1XU5E 2DA6A 2KISA 2KLOA 3BT9A 4BHPA 1PP8F 3DLLF 4ENNA 3UO3A 4BDYA 1KA8A 3A03A 3E6CC 2R7SA 5EDNA 1ETVA 3WGIA 5DUIA 3NE6A 1Z1DA 2OVPB 2Z33A 4OAYA 3PNTA 2IXSA 1B59A 3BTLA 1P4XA 1YITI 1X2NA 3IWZA 1IXSB 3S2WA 3I59B 1MZBA 5EYRA 2L3DA 4HQMA 4IPAA 2A68F 3RYRA 1P9QC 1P7IA 2X0LA 5H2FC 2QUFA 4ICGC 3V8JA 2DOEA 1RR7A 3SUQA 2Y75A 2Z16A 3VYTB 3F21A 4HLYA 1FNNA 3R0AA 5E20A 4LK1F 3HYIA 1HW5A 5HLGA 2DEBA 1LJ9A 5E1XA 2E1MC 4C3JJ 2HGCA 2LLKA 5DDGA 5HDNA 3BG3A 5A2QZ 4EM2A 1YFHA 3CJRB 2HVRA 1QVTA 2V9VA 2E1MB 3C7JA 2OTJI 4DTXA 2LBFB 1LDKB 5E3LA 3IC7A 5LD2C 3JRAA 3DPLC 4FX4A 2YS9A 1D5VA 1GXPA 5EG0A 2VC1A 4PUSA 3OIQA 2DFIA 4HDVA 4I76A 1WQ2A 1PUEE 1Y0NA 2HEOA 3C6PB 5CQGA 4ZDOA 2BW3A 1KQ0A 4DQ2A 5BS6A 2M4KA 3QWLA 3ZGKA 3BC8A 5E18F 4X0GA 4XLNF 2LVSA 4E7LA 3OYDA 3CC4I 4MQVA 2J5OA 2AO9A 3DTIA 1ON1A 3RZDJ 2RVCA 4M6YA 1G3WA 4U7BA 2NVQJ 2UXNA 3PIPF 2ME0A 5BPDA 2PMHA 5H6QA 3NARA 1Z3XA 3IH3A 4Q5SF 1VQNI 1FZ6E 1WI9A 3W2WA 4RB3C 3BR0A 2WY8Q 3KZIC 5CJ9A 4Q4ZF 5EZHA 1D0XA 5LBQA 1MTYG 1ON2A 4BY1J 1HOMA 4JRPA 1W36D 3LAPA 2D45A 4IF4A 3SYTA 2WV1A 1OJLA 1Q9XA 4G6QA 3CP8A 3MKSB 4ADOA 4KHQA 4ZDLA 3ZQQA 2VOOA 4X1EA 2OZSA 2MLGA 4CCOA 1BM9A 2EZLA 3HRTA 2V1UA 1ZGAA 3N4MA 2OJED 4M6VA 2UV1A 3DPUA 4XICA 1WJDA 1UHWA 1WGXA 2EINH 2HI3A 3RQ4A 3KP2A 1MSFC 1RRJA 3QEWA 2R7FA 2ZB9A 4YELA 5LLQA 2VQLA 1FP1D 3L2WA 3QYEA 2XASA 3BJAA 4UV9A 4XSZF 3M4OJ 3OIOA 4E70A 2VXZA 3GMEA 5E3OA 5F0CA 2COMA 2VI6A 1VZ0A 3NWTA 1YYVA 4M3FA 3A0HC 4HLXA 3G71I 4DYQA 3C94A 3GLXA 4GAMC 4C3HJ 4FQGA 5EZGA 2ZO4A 3ULQB 2D1HA 1JJ6C 4GO1A 2GM4A 2A6EF 4CHUA 3WU1B 4KIBA 3E6MA 4RDUA 2E34A 4MIMA 2LY2A 3O3KA 3RWUA 3EUHC 4DTUA 4A3JJ 4LFUA 2M87A 3N97A 4D0PA 1OCPA 3DQVC 1XDUA 3K70C 4UNOA 3V7DB 3F8FA 2ADUA 1OCRH 1MH4A 1P4WA 2VIXA 4GXOA 5KAFC 5HDKA 1Z6TA 2R5YA 1DU6A 5ILSA 2HQAA 3GFLA 1WKMA 3P7NA 3QOEA 4IOCF 4JQFA 3S93A 4BE1A 4IHSA 1FZ5E 3S9HA 5KVRA 4IJAA 1K7AA 1WHUA 1LDKE 4EMSA 2HFHA 1CGPA 3JRDA 5HNHA 4NQWB 1BR4A 1WH5A 2VC0A 3CMYA 1FXXA 3TAEA 1XS9A 2DW4A 1S29A 4BXFA 2M3AA 3DTEA 2F5CA 3OYKA 1DPUA 3KD1E 2YX4A 2BOLA 1HXDA 1EH8A 2RQPA 4HV5A 4A3IJ 1GHCA 2QQ9A 2RN7A 2GQQA 2H8WA 2ECCA 1MMDA 1WJEA 1D3YA 1R6RA 2MH2A 4IXAA 4EM1A 2IS2A 1G3TA 4KHSA 4D5FA 3L1NA 1MDMB 3ASNH 2ZBKA 2AXTC 1B8IB 4ESBA 1VNDA 1JKRC 4PJMA 4XLHA 3VODA 1RUOA 2RAEA 4D9JA 4PJJA 2HOEA 2EV6A 2RNJA 4KISA 4I6JB 1R5ID 3W2AA 2BXYA 5FJ8J 3GFIA 2C6YA 2Y9YA 1FZ7E 2AS5F 3SFIA 3RMBA 4A3MJ 4M74A 1JT6A 2H6BA 2V1XA 3Q3SA 1XVBE 2LC2A 2D1VA 2VOPA 4BBRJ 2KDZA 1BL0A 3C2GA 3HSFA 2F4IA 2EFNA 3JRCA 1JE8A 3FISA 3KLOA 3IWFA 4ZC3A 3MZ8A 1XGNA 3HOWJ 4MEXF 2K02A 1R5HA 2AQFA 1I3QJ 5D5WB 3S2HJ 5GADJ 4I0AA 4HAMA 2MD5A 1B4AA 3DU5A 2B63J 2B7MA 1MJ9A 3E0JB 2M34A 1LNWA 1BOBA 2ZXIA 2JUCA 3MD2A 3WE3A 4B44A 4BJ6C 1TWFJ 2CUZA 2PX9A 3F22A 2ACJA 3IAS2 3REOA 1N78A 3NCIA 2R7RA 4LITA 4PGHA 2JZYA 2FNPA 4XONA 4BE2A 3MQ0A 3K2ZA 2VONA 2P1MB 4EYWA 4RMNA 4WWCA 1XVDE 3HPHA 4PK4A 2ELJA 3G1MA 1X1BA 2QQBA 3LSIA 4O5VA 2DCEA 1J5YA 2WTEA 1O3TA 5F0FA 4IT5A 1SC7A 2A61A 4RAGA 5K5OA 1R22A 3E97A 5IBKB 1PJRA 1IV8A 5K5RA 1EJ9A 1UAAA 4DTNA 2L5QA 1BIAA 2STTA 1K4TA 3AG4H 3DEWA 5DCMB 5DM6F 3J81Z 2ZXJA 1W0TA 3LZIA 2WB1N 5F04A 3ZQFA 5D8KB 2MSYA 3MKYB 1KQ8A 3CFPA 3TP3A 2O9LA 3LA7A 1ORKA 4EPHA 2GA2A 1FOYA 2Q1ZB 2QYOA 3JRIA 2VE8A 3CC7I 2JPNA 2PMZA 4OIOF 3WTTC 3OSFA 5J8CA 2RKHA 3QU6A 1P2FA 1YE9A 2BY1A 3CCQI 2DMTA 1XVGE 4M3WA 3VEPA 1I6XA 4M3UA 4YFNF 1RKWA 1WI3A 4A12A 3CFOA 3HTUA 4QSHA 1ZH5A 1VQLI 3GZNB 1Z21A 2X6WA 4CYCB 2KJCA 3SEZA 1FS1A 1H0MA 3E4YA 1IG7A 2K3FA 1HQCA 2E2JJ 1FTTA 5LEKA 2LNBA 2LR8A 1BI1A 3MWMA 4PZJA 1X2MA 3RJPA 3QESA 2W7NA 3QP6A 3OOUA 3HOTA 2CH0A 4RGSA 3BVOA 5E79C 5ICGA 1ITYA 3P9IA 5BQTA 2BVMA 4GYIA 1W1WE 2HPMA 2PJPA 1VTNC 2DA1A 2X6OA 3HTSB 3DXJF 5CVIA 1A6QA 3V7SA 2DOAA 3QQAA 1I39A 1FYKA 3S15J 2LREA 4LK0F 4CA0A 2FBIA 4FJ9A 1Y8QB 3RKXA 3BOQA 2VJIA 4FJIA 2F48A 4UB6C 3CF2A 3S3NA 2Q0OA 5D8LB 1S6LA 4EJWA 4CCJA 1BN5A 3ASOH 2Y69H 1OCZH 3B73A 3CDIA 3GFJA 3HSRA 4YIRX 2E1CA 1QNTA 2XGCA 4UUVA 4D1QA 3MCZA 3U1KA 2Y0SN 2DAOA 3S14J 2KZGA 2MABA 5E1ZB 5FLXK 4XLPF 1XX5A 3NQOA 2BY0A 3SVIA 1IUFA 3F9KA 3ZQGA 3OGMB 4DZJA 2FYOA 2CW0F 2K85A 1Q1VA 4RL5A 5EG0B 4BHCA 3LL7A 4CCKA 3GZ6A 1TQPA 2O5RA 3OL4A 2CW8A 1K79A 3KCCA 1TW2A 2QEXI 2OPTA 1E0EA 3PUFA 4M3BA 3L2VA 2BW3B 3S8PA 4V2FA 5LFAA 2GWRA 2EZHA 3BG9A 3KP7A 1FLIA 1N1CA 2CV1A 3HM5A 4LIUA 3Q9VA 3K10A 4LG3A 3KFWX 2V9KA 3K4NA 5C4XJ 1BBYA 3DU6A 3H3UA 2BVLA 4YG2F 1KYWA 4UV8A 2V4JC 1EA3A 4M3DA 4XLEA 1IRXA 4Q48A 1NTCA 1OPCA 1ZKGA 4HSRA 4A3BJ 1YW9A 3CCYA 3FHZA 2F5VA 1A6IA 5LHIA 1OISA 3IH2A 2OVQB 4RGUA 3J81K 3MKLA 1X1PA 3SFZA 3TOBA 2NS8A 4LMYA 4L0YB 2CYYA 1CF7B 2MG4A 4IHTA 3TDZC 1MIJA 3KEYA 3KX2A 5FD5A 4E3SA 4M3TA 1FY7A 2A6TA 4HX7A 1JHHA 3WG9A 2VN2A 3LAJA 4BUPA 1GXQA 3NRVA 2P5GA 4BEHB 4JRQA 2K4BA 1H89C 2X51A 2Z5UA 2JA6J 2MA3A 3L7WA 4OIPF 4B48A 3LWFA 4CDGA 3PNVA 1SFXA 3S1MJ 3BG5A 1WCMJ 2LK2A 3M1CA 5EGOA 4LB5A 3CP2A 1SVMA 2LMDA 2EILH 4RM2A 3E4WA 4IQ4A 3CO7C 3HIFA 5FKLA 2EZIA 1FYLA 4H0EA 1ZRDA 3KEQA 4LLNA 4XRSG 3CCRI 2M45A 3WE2A 2K3PA 3A01B 4M3YA 4L9JA 4HZFA 1Z77A 2DBBA 4WCGA 2R7OA 4M9ZA 1RIOH 4QNCA 2VQGA 5JLXA 5D5VB 1MBEA 1Z67A 1HKSA 5EEGA 2CFXA 3U1DA 3BR3A 2VBXA 1WJBA 1IUYA 3F6VA 4B1RA 4XK4A 2ISYA 4M72A 2V7FA 1XMFE 1NH3A 3T0YA 4DOZA 5BMZA 2H1KA 4AKGA 2HDCA 2IAIA 2W85A 3CMMA 3VYRB 3ABKH 5EEHA 5M5YJ 2R5YB 4K2EA 4A6EA 3WG7H 1WAFA 3M07A 3RMCA 2STWA 2PJRA 4NHJA 2A07F 2FNAA 3QPSA 5GPCA 3GLLA 2IA0A 3IRRA 1KYZA 2M1BA 3FMSA 4BY7J 3ROUA 2BY2A 4G7HF 4B8XA 4LD5A 2K9QA 2KP6A 4BQOA 1Y1WJ 1W4MA 2JSCA 2M7BA 2EWNA 5CYVA 2NXNB 1OCTC 2ME6A 1JTXA 3HGGA 3BQZA 1N77A 3JAMZ 2B7EA 3LDBA 1KU7A 3PUBA 4KITB 4II2A 3FMRA 3CCSI 2JPBA 3B6AA 3TO7A 3FM3A 2DFHA 2L4MA 4FJ5A 4H4KC 2VUMJ 1MBJA 4IHWA 4FT8A 4R1HA 3WGHA 3HOXJ 4PCQA 5B1AH 2XGXA 2LH9A 3ERED 4RB1A 3A0BC 4BGDA 4PFOA 4CZCA 3H35A 1MMGA 4QPQA 1MSEC 4AI6A 3HOUJ 1D8JA 3GYHX 2W82A 2JTVA 3SHFA 2L4AA 1YO5C 1FZ8E 1DGWY 4JX4A 1NG6A 2L7FP 4I01A 2ETHA 5LRSA 3Q9SA 5AIPA 1FTZA 3RKQA 4GCVA 4L9VA 2NAZA 4M9SA 1HDPA 2YU9J 4A3GJ 1K4SA 2QF7A 4GFBA 5IYDJ 1ZARA 1XMAA 3O8GA 3JRBA 3HOYJ 2P1PB 1GLNA 2IRFG 2RQQA 2FMLA 1YW7A 1VQ8I 2L7ZA 1T8IA 5JVTA 1S9HA 3GTLJ 2V1DA 2ZSIB 2JHCA 3C6NB 1U0JA 2MFZA 1BR1A 1MBFA 4KI6A 3BR2A 2GXGA 1HKQA 1T56A 2JHAA 1JUMA 4AD9A 3GO5A 4L5EA 3SDBA 4LIVA 2R5ZA 2P5VA 4IO9F 3P9KA 4M3ZA 3WHBA 3BZKA 5BNGA 2ISZA 2Q2EB 2KZVA 2VBWA 5HVQC 2HPIA 4Y4RA 1WVRA 3TL8B 1Z6RA 2GXAA 2KL4A 1YS6A 3B6CA 4MHGA 4J2EA 4IRIA 2P5OA 1ZRFA 3E3VA 3EQLF 3JRGA 2DT5A 3J27A 3W6VA 3AG3H 4IL6C 1JGGA 2MW8A 4LLLA 1SVLA 2ZMEC 4RB0A 3WTWC 2VJ4A 3CF5F 5KAIC 1GV2A 4LG0A 1KU3A 5B5EC 2ZMEB 4KMFA 4Z2YA 3LFKA 1LUJB 5LHHA 4XKBA 2XSJC 5IT9Z 2P7VB 4A69C 2IGOA 2WY7Q 2VKVA 4XKVA 1U6GA 2H09A 1IV6A 2VT3A 3FKJA 2NS0A 1IN6A 2OUMA 4EM0B 3LMMA 1MJBA 3I4MJ 3HDDA 4HNTA 2XSDC 3H5AA 1YQAA 4JX5A 4UVCA 3VWBA 4S04A 1APLC 3GUDA 3U9GA 2MLKA 2Z2SB 3RTRA 3OGKB 4XOTA 2TCTA 2L0KA 1G4DA 3L0MA 4CICA 2QSFX 1G6NA 3LD8A 5CPRB 4BHBA 1QU3A 1Z9CA 1KU2A 4UUSA 3E5XA 5DD8A 2VKEA 3F8BA 3FXLA 2VASA 5DYMA 1HF0A 5JLWA 1I27A 3QP5A 3J80K 4G7OF 2MGQA 2OF7A 3QPLA 4AYBA 5F1JA 1SFOJ 3O6BB 2OV7A 4NBQA 5HODA 4PGGA 1UFMA 3NDKA 4E7JA 3NHGA 5ERIA 4F92B 3V7RA 2W57A 2HKOA 2X4HA 4B4CA 3IKTA 2B8IA 4HCBA 2RC4A 4I6ZA 2KIUA 3DWLE 2E7WA 2P4WA 4NC7A 3A4CA 1X1CA 2HVQA 3BG7A 2IPQX 2XDVA 2O7OA 2GIZA 3L09A 2ZCWA 3FM5A 2WBMA 3H3VK 2WC2A 2VB6A 1YS7A 3E6BA 2K5SA 2HZDA 3NEUA 4EJVA 1ZHFA 3UR3C 3ZQHA 4DBQA 2QBYB 3UKGA 3WHCA 3GCMA 4B08A 3S1QJ 2M9HA 4RAFA 5HLHA 4F93B 4J00A 2E7XA 2IP2A 4DTJA 1OKRA 2DDBA 2DYSH 3I53A 5DD4A 3S16J 4WXHA 2X6YA 2CFOA 2XV4S 4V19K 4HCCA 1T0FA 4A3LJ 1EV7A 3ELKA 4A5NA 2G0EA 2CQQA 4A3EJ 4DU4A 2KDOA 1BC8C 2YUSA 2DT7B 2JT1A 3F8CA 1IDZA 2P6SA 1MMNA 2EA2A 4I98B 4FTHA 1TC3C 3DBHB 1D0ZA 4L5IA 4N0BA 4I9LA 3I58A 2XB0X 1ZG3A 4EP9A 2EH3A 1USSA 2EQRA 1LVAA 2HS5A 3ZN1A 3IKVA 2EJRA 3SEQA 5GAHJ 3C18A 3TP0A 1V54H 3JSPA 3FBIB 1DQUA 2VODA 4CZZA 3QYFA 2V1NA 1Z7UA 1NK3P 1FZ4E 3HKZA 4FISA 1T6SA 3RI4A 1VF9A 4B3AA 2V6EA 1MHZG 1K78A 4DTMA 4BL0B 2P0WA 3ZPLA 1AHDP 1FOKA 4M73A 4D5CA 1BW5A 3VPRA 1LEBA 3CCUI 1B72A 4AWXB 2AXLA 3J7ZI 2LF6A 3O8HA 2W84A 3BPVA 2Z3YA 3ZR8X 4HF2A 3SPYA 5K7ZA 2CWEA 1YIOA 3HOVJ 3R4KA 4Y3OA 3K70D 4HW0A 2VBZA 5DV5A 3HGYA 4C9YA 1XMKA 1OYIA 2FU4A 2P6TA 1XCBA 1MMOG 2ZJ2A 3QNNA 2BGCA 4G12A 4JBAA 2CJJA 2BE5F 4MEYF 1WSUA 1UHSA 3CJQB 1MMSA 3PSFA 4C2MJ 2MZWB 2ZJQF 1XG1A 2XPVA 1QZZA 3HZJA 1O4XA 4JP0A 2V9PA 1IF1A 3BDDA 5EGOB 1QPMA 2H6CA 3SQ0A 4AVPA 5FFZA 1B9NA 1L0OC 3AAFA 2UZKA 2MH9A 1MNDA 3TL4X 5LGNA 4XQFA 2EFWA 1XDSA 3ECOA 3NAUA 1O7FA 3S1RJ 3CESA 3A2KA 2QM3A 3KP5A 3P5JA 1OR7A 2JH9A 2CO5A 5D6EA 4BBSJ 4A3FJ 1X1DA 4LGWA 4IEJA 3C6OB 3LOCA 1Y1VJ 3KP3A 2P1OB 5L3BA 3KIOA 3OYNA 2ZXWH 3WTXC 2P1NB 1QZEA 2P81A 3HEFA 1D1BA 5C3EJ 5A2QK 2XHKA 2OQRA 4LOCA 3KYCB 2Y48A 1UG2A 4KIFA 5DCFA 3FHNA 2HOAA 4M3EA 3CC2I 1XMXA 1J9IA 4A93J 3PFYA 4XRMA 2PJRB 1BJAA 1TT5B 2HQ5A 5LEJA 3OWTA 4CO8A 3DKYA 3BLYA 3M1EA 6PAXA 4XN3A 1D8KA 1O3SA 3CCJI 5TGTA 3K4CA 4UXNA 1K6OA 3RPQA 4DW6A 1IRGA 3SUOA 1P92A 3OYGA 2JUGA 4R79A 3OS0A 1RETA 2AHQA 4DIQA 1XGMA 3BY6A 1IC8A 3OYMA 1W7PA 1E2XA 3G2BA 2HXIA 2DA3A 3HB9A 1F1ZA 3J7AO 1YJ9I 3CMEI 5F64A 2HTSA 5F1RA 5DS9A 1XGSA 2BBYA 1J0RA 4GGGA 4PFPA 4C2TA 2A05A 4B3XA 2I10A 1J75A 3GFMA 1JT0A 4QWQA 1IZ1A 3PL8A 1K61A 1IN4A 1YJNI 2VLAA 2G9WA 4FK4A 4DNCA 4HNUA 3Q0VA 2BY3A 3V8LA 4AIHA 4HF1A 3IUOA 2M0CA 3W6JB 5FGMA 4FJMA 3MN2A 3BR6A 3SI6A 2DO7A 5H6RA 2P7CB 4Y7NJ 4J2AA 4HX4A 2XF5A 2CUJA 3LQQA 2GAUA 5HLTA 4B43A 4BJTA 4FJXA 1UELB 3I3LA 1ONVA 2QZ8A 3OYHA 1S3JA 3F8NA 1VQPI 4FASD 1F36A 1GV5A 3QYBA 3VSLA 2OAZA 2H94A 2R7WA
chains in the Genus database with same CATH topology
2M5WA 2PFBA 2L01A 3WGGA 3IL2A 5LGTA 1SAXA 3KLNA 2DLLA 5ILUA 1ZGJA 1FT9A 1P4AA 2NNYA 2KRFA 4UVBA 3ZQ7A 2FSWA 3HHHA 1HKTA 1OMIA 5F6FA 3E6DA 4CGZA 3HUGA 3BROA 3KP4A 3KP6A 3FMQA 5JI6A 4LLGF 5L3CA 4Y13A 3FWEA 3GWZA 1R7JA 3TQNA 1ZLKA 4LG0B 4U7DA 1BI2A 2BEOA 1S8NA 4EVIA 5HS7A 1TQIA 4UVAA 3EDPA 2CQKA 4ASNA 1FPOA 3RDIA 3F72A 1ZAOA 2FRHA 1ZN2A 2OQGA 4YIIA 2O61A 4ZYHA 1X3UA 2GXBA 2MBFA 3QAHA 1XB4A 1YG2A 3LA2A 2ESNA 3KE2A 4G7ZF 4I09A 4YFXF 1RUNA 3MEXA 2A69F 4ZYEA 5LGUA 3JSOA 3HRUA 2L54A 4EJOA 1XSDA 2PLYA 5L3GA 5HS9A 4OOIA 3GF2A 4G8XA 3L00A 3BPXA 4G94A 3QU3A 4FX0A 4MQ9F 3I64A 1TNTA 2IJLA 3MFKA 3DEUA 1BC7C 4EJUA 2V6CA 2OU2A 2VE9A 3KZZA 2HQRA 3IRQA 3BZ6A 3DV8A 2KJBA 2OZUA 2FQ3A 1XCVA 1Q1HA 1G3SA 4BXUA 2PI0A 2ZNYA 5D4SA 1UHMA 4U0VA 3I71A 1BI0A 3H92A 1K78B 1F5TA 2Z99A 3EYYA 4U0YA 1STZA 2PQ8A 5CVUA 1T98A 1PP7U 4ZH4F 2XAJA 5TJJA 4RAYA 1YLFA 3LA3A 2RV8A 1W5SA 4WX9A 4ESFA 5HOOA 4RGXA 2ZKZA 1RNLA 1U2WA 3ZMVA 1TLHB 3T8TA 4BQAA 1GVJA 1R58A 3RIRA 1DDNA 1FPQA 4U0WA 4NB5A 1B1BA 2HZTA 2PG4A 2G7HA 3OOPA 1U5TA 3EUHA 2RGVA 5HDGA 3CUQA 2DU9A 5E17F 5D5UB 5FB2A 2F2EA 1A04A 1FC3A 2FBHA 3F8MA 1U78A 2OD5A 2ZNZA 2K4JA 4HX8A 4Y15A 1B9MA 2PBIA 1W7PB 4AIKA 3I5UA 5JHUA 1XSVA 4L0ZB 4G9YA 4I0BA 1O57A 2NYXA 4HV6A 3R0JA 1ZYRF 1QZYA 5D6FA 2MC3A 4A6DA 3BP8A 2XKOA 3HOSA 2DTRA 2F5FA 5HS8A 3COAC 3EETA 3ML6A 5JR3A 3CUOA 1BI3A 2GZWA 5J6XA 1UB9A 2R7DA 3GVAA 5DUKA 1TW3A 4IVNA 5KK1A 3K1NA 4HQEA 3RKWA 2CSOA 2HTJA 4KFCA 2IVMA 3L9FA 4BNCA 1FZPB 5CVJA 1U3EM 1Z91A 5ICEA 4A5MA 1WWXA 3WTZA 1JGSA 1H9GA 2PEXA 4P9UA 3VOEA 1E17A 2HYGD 4ESJA 3M7GA 2O3FA 2KIMA 3DP7A 3F3XA 3ECHA 4KNYA 5DEQA 1J2XA 3LSTA 4R8HA 2WV0A 2IA2A 2BYVE 2FEZA 3JAMK 4CXFA 4I02A 5H20A 2IW5A 1F9NA 2HQNA 2QQAA 4I2OA 5D4RA 1IXCA 2YX7A 4ZYDA 2IA1A 3K1PA 2FOKA 3HHGA 4M71A 2VBYA 2K7LA 3DF8A 3HRMA 4ETSA 4HF0A 1LDJA 4HOBA 3WTVC 2XAQA 3BJ6A 3FXUA 3T1BA 1YW8A 1MKMA 5HLIA 5LHGA 2XROA 3I0TA 3CDHA 1RI7A 3IHUA 3M8EA 2YSRA 1EH7A 3GEZA 4KICA 2DI3A 3R6SA 1O7LA 1SD4A 1IRFA 2QLZA 3DFGA 4RGRA 1MD0A 1V4RA 4KIGA 4EGYA 2XAHA 3RYPA 1EH6A 1HSTA 3ZP5A 2O6GE 3ZMTA 2Y0MA 3QPHA 4WXDA 5AIQA 3ZMZA 3FZVA 2DK8A 3EYIA 3M9AA 2F5EA 1IN8A 3K0LA 4UHTA 5IT9K 5FFXA 3G73A 3ABUA 1V3FA 1TNSA 3TOAA 2ELHA 1CF7A 1KQ9A 3F6OA 4OIQF 1MJAA 3I54A 3WTSC 2OA4A 3K1MA 2G7UA 4IRHA 4YFKF 1O3QA 2LSOA 3RKYA 3CLOA 1IAWA 3B02A 4M9XA 3DKWA 2EV5A 2YR2A 3JTHA 3PFIA 4BAYA 2EFOA 4P55A 4N9IA 2XAFA 3P9CA 1ZLJA 4YIFA 3C1DA 1XN7A 2K27A 5ICCA 5L3DA 4IRGA 3TKYA 1LQ1A 4WK8F 4U88A 3ZMDA 3U2RA 5LRRA 1U5TC 3KEOA 2FBKA 1BIBA 4EQQA 2K86A 1U5TB 3CUQC 2EB7A 1R23A 1USTA 2LKPA 2P5KA 1Y0UA 5L3EA 1ZG5A 2TDXA 2R3SA 3CUQB 1TBXA 2O0YA 1FP2A 2P8TA 4Q47A 2RDPA 3D0SA 4O3MA 3K9TA 1SMTA 4L5JA 4KMUX 4HYEA 1T38A 1FYMA 1R1VA 5L3FA 3T8RA 4HDUA 2QENA 2LF8A 1ZRCA 4WXCA 4ZZDA 2J5PA 1LDDA 2DQRA 2XRNA 1L3LA 3MAJA 5ICFA 3UO2A 2Q8KA 2OBPA 2D2WA 1FBUA 1TTYA 3CTAA 1YTYA 1Z05A 3D5LA 4BYYA 4RAZA 2QVOA 2PMUA 4ON0A 1QBJA 5FLXZ 4PDKA 3W6KB 4KN7X 3V7CA 2HKXA 4TV7A 4ZYGA 3R60A 4F7ZA 3E5UA 4G6DA 4ENJA 2HYFA 3GZ5A 4ENKA 2FE3A 2NRAC 4KUMA 3G3ZA 1R5GA 3BWGA 4KA4A 3SZTA 1AWCA 1QO0D 4A0YA 1JHFA 2Q2EA 2EV0A 5CVRA 3L2CA 3LQRA 1ZREA 4B09A 2VT2A 4L9NA 5ED4A 3T5XA 3K69A 2UXXA 1HSJA 4RB2C 1W5TA 2XKPA 2ZMEA 5FD6A 2P5LC 3MZYA 1WRJA 2DPUA 1IW7F 1DPRA 4FHTA 5K5QA 3Q5FA 3TGNA 2HWVA 3PQJA 5D5XB 1SD6A 4S05A 1SD7A 4OMYA 3FXQA 3JW4A 1S7OA 4XRFA 3V4GA 4HA8A 2B0LA 3I59A 1RZ4A 4A0ZA 1FSEA 2JRTA 2FMYA 2FXAA 4JK1X 2A3SA 3HSEA 1ULYA 2O8XA 4A2UA 1BOAA 2LF7A 2O03A 1LEAA 2UWMA 2QBYA 4EJTA 2GA1A 1JXSA 1ZG1A 3F23A 3SXYA 3TO9A 2KIFA 2A6HF 1R00A 5FO5A 3QPTA 1TQMA 2H27A 3WU0A 5BPIA 2QWWA 5E8GA 2DPDA 4MTDA 1T2KA 1R1TA 3KETA 3O2PE 2A5YB 3SZPA 3HRSA 4P9FA 4O6JA 1KU9A 1XGOA 1FBSA 1DUXC 1DP7P 1IXRC 2XAGA 1S7AA 3M8FA 2CGPA 3ABTA 4EV0A 3BJOA 2FF4A 2XIGA 1KGSA 2FA5A 3H3ZA 4KT5C 1FX7A 1QQIA 5TRDA 3WTUC 4ZZLA 1FWZA 1FSHA 5K1YA 3TDUC 2GIVA 2W24A 5ILVA 4OMZA 2V79A 2XVCA 1W7PD 2DK5A 2ZFWA 4XBFA 4EGZA 4L9TA 2YU3A 1HBXG 1XD7A 3PQKA 4MNUA 3JTGA 2DQLA 4L18B 1IN5A 1R36A 1MGTA 4XSXF 3ZN0A 4MTEA 3GW2A 1AOYA 2KKOA 5CLSA 2W25A 3MZHA 4NQWA 1J59A 4KDPA 3FF5A 3CO6C 4AIJA 1REPC 3WTYC 3I4PA 3RPUA 4OINF 2PN6A 4LJZF 4MGRA 1OYYA 2CG4A 4N9HA 1T39A 1SFEA 5IT3A 2F5DA 1R1UA 1MDMA 2M8EA 3J80Z 2HR3A 1ODDA 3E5QA 3R61A 4QLCU 4CYDA 1B6AA 2JPCA 3CJNA 1SMYF 4P5OA 1P6RA 2EA4A 3WODF 4A0XA 1NHAA 2ESHA 4OU0A 2EK5A 1UCRA 1I1GA 2E1NA 2IT0A 4I7HA 1SFUA 3FXRA 3VB2A 4HBLA 3C3WA 3QRFF 1SD5A 2XUBA 5BOXA 5J8FA 3SQNA 3DPTA 2BV6A 2OZ6A 4RS8A 1I5ZA 4LB6B 2WWYA 1OYWA 3OV8A 4KYWA 1QGPA 1F4KA 1HW1A 1H9TA 3GX4X 1I1SA 3ZMUA 4BH9A 1XSXA 2NNNA 2EFQA 3V8KA 3QOPA 4GYGA 5CVVA 1J7KA 1IN7A 5AONA 4OIRF 2L02A 5DCMA 4KN4X 3KZYA 1U8RA 4P96A 4ENMA 2LDUA 2M30A 2EFPA 4WF2A 3VFZA 1FBQA 1PDNC 5JFRA 3TO6A 1HW2A 5E8IA 2YPRA 3ZMSA 3ISPA 1O3RA 3FX3A 1G3YA 2Z9OA 3GXOA 4Y17A 5E1WA 1LB2A 4M6XA 4BHPA 1PP8F 4ENNA 3UO3A 1KA8A 3E6CC 3WGIA 5DUIA 1Z1DA 2Z33A 1B59A 1P4XA 3IWZA 1IXSB 3S2WA 3I59B 1MZBA 2L3DA 4HQMA 4IPAA 2A68F 3RYRA 2X0LA 2QUFA 3V8JA 2Y75A 3F21A 4HLYA 1FNNA 3R0AA 5E20A 4LK1F 3HYIA 1HW5A 5HLGA 1LJ9A 5E1XA 2HGCA 5DDGA 5HDNA 5A2QZ 4EM2A 1YFHA 2V9VA 3C7JA 1LDKB 3IC7A 3DPLC 4FX4A 1D5VA 1GXPA 2VC1A 2DFIA 4HDVA 1WQ2A 1PUEE 2HEOA 1KQ0A 4DQ2A 5BS6A 5E18F 4XLNF 4MQVA 2J5OA 1ON1A 2RVCA 4M6YA 1G3WA 4U7BA 2UXNA 5BPDA 2PMHA 5H6QA 4Q5SF 1WI9A 4RB3C 5CJ9A 4Q4ZF 5LBQA 1ON2A 3LAPA 2D45A 4IF4A 4G6QA 2VOOA 2MLGA 1BM9A 3HRTA 2V1UA 1ZGAA 3N4MA 1UHWA 3KP2A 2R7FA 5LLQA 1FP1D 4UV9A 2XASA 3BJAA 4XSZF 4E70A 2VXZA 2COMA 1YYVA 4HLXA 3GLXA 2ZO4A 3ULQB 2D1HA 4GO1A 4CHUA 2A6EF 3WU1B 4KIBA 3E6MA 3O3KA 4LFUA 2M87A 3N97A 4D0PA 3DQVC 1XDUA 4UNOA 3F8FA 2ADUA 1P4WA 4GXOA 5HDKA 1Z6TA 5ILSA 3GFLA 3P7NA 1WKMA 4JQFA 4IHSA 5KVRA 4IJAA 1K7AA 4EMSA 2HFHA 1CGPA 2VC0A 2DW4A 1S29A 2F5CA 1DPUA 2YX4A 1HXDA 1EH8A 2RQPA 4HV5A 1GHCA 2QQ9A 2RN7A 2GQQA 2MH2A 1D3YA 4IXAA 4EM1A 1G3TA 1MDMB 2ZBKA 4ESBA 3VODA 1RUOA 2HOEA 2EV6A 2RNJA 3GFIA 2C6YA 2AS5F 4M74A 2H6BA 2V1XA 2D1VA 2VOPA 3HSFA 2EFNA 1JE8A 3KLOA 3IWFA 1XGNA 4MEXF 2K02A 1R5HA 5D5WB 4I0AA 4HAMA 2MD5A 1B4AA 1MJ9A 1LNWA 3WE3A 3F22A 2ACJA 3REOA 4PGHA 2JZYA 2FNPA 3MQ0A 3K2ZA 2VONA 4WWCA 2QQBA 4O5VA 1J5YA 2WTEA 1O3TA 4IT5A 2A61A 5K5OA 1R22A 3E97A 5K5RA 1BIAA 2STTA 5DCMB 3J81Z 2ZXJA 5D8KB 1KQ8A 3LA7A 2GA2A 2QYOA 2VE8A 4OIOF 3WTTC 5J8CA 2RKHA 3QU6A 1P2FA 3VEPA 1I6XA 4YFNF 4A12A 3HTUA 1ZH5A 2KJCA 1H0MA 1HQCA 5LEKA 2LNBA 1BI1A 3MWMA 4PZJA 3RJPA 3QP6A 3HOTA 4RGSA 3BVOA 5ICGA 3P9IA 5BQTA 4GYIA 2PJPA 1VTNC 3HTSB 3DXJF 5CVIA 3V7SA 1FYKA 4LK0F 2FBIA 3RKXA 3BOQA 2Q0OA 5D8LB 1S6LA 4EJWA 1BN5A 2E1CA 3B73A 3GFJA 3HSRA 1QNTA 4UUVA 3MCZA 2DAOA 5E1ZB 5FLXK 4XLPF 3NQOA 2CW0F 4BHCA 3GZ6A 1TQPA 1K79A 3KCCA 1TW2A 2GWRA 1FLIA 3KP7A 1N1CA 3Q9VA 3KFWX 1BBYA 3H3UA 4YG2F 1KYWA 4UV8A 4Q48A 1OPCA 1YW9A 3FHZA 5LHIA 4RGUA 3J81K 3SFZA 3TOBA 4LMYA 4L0YB 2CYYA 1CF7B 4IHTA 3TDZC 5FD5A 1FY7A 4HX7A 3WG9A 1JHHA 2VN2A 3LAJA 1GXQA 3NRVA 2K4BA 2Z5UA 2MA3A 3L7WA 4OIPF 3LWFA 4CDGA 1SFXA 4LB5A 3CO7C 3HIFA 1FYLA 4H0EA 1ZRDA 3KEQA 4LLNA 2M45A 3WE2A 4L9JA 4HZFA 2DBBA 4WCGA 4M9ZA 1RIOH 5D5VB 1HKSA 5EEGA 2CFXA 3U1DA 2VBXA 1IUYA 3F6VA 2ISYA 4M72A 3T0YA 5BMZA 2HDCA 2W85A 5EEHA 4K2EA 4A6EA 2STWA 4NHJA 2A07F 2FNAA 2IA0A 3IRRA 1KYZA 2M1BA 3FMSA 3ROUA 4G7HF 4B8XA 4LD5A 1W4MA 2JSCA 2EWNA 5CYVA 3JAMZ 1KU7A 3FMRA 2JPBA 3TO7A 3FM3A 2L4MA 4FT8A 4R1HA 3WGHA 4PCQA 2XGXA 3ERED 4RB1A 1D8JA 3GYHX 3SHFA 2JTVA 2L4AA 1YO5C 4I01A 2ETHA 5LRSA 3Q9SA 5AIPA 4GCVA 4L9VA 2NAZA 4M9SA 1ZARA 1XMAA 2IRFG 2FMLA 1YW7A 5JVTA 2V1DA 2GXGA 1HKQA 4AD9A 3GO5A 2P5VA 3P9KA 2ISZA 2VBWA 5HVQC 1Z6RA 1YS6A 4MHGA 4IRIA 1ZRFA 3E3VA 3EQLF 2DT5A 4LLLA 4RB0A 3WTWC 4LG0A 1KU3A 2ZMEB 4KMFA 4Z2YA 3LFKA 5LHHA 5IT9Z 2P7VB 1U6GA 2H09A 2VT3A 2NS0A 1IN6A 4EM0B 1MJBA 1YQAA 4UVCA 4S04A 3GUDA 3U9GA 2MLKA 3RTRA 1G4DA 4CICA 1G6NA 4BHBA 1Z9CA 1KU2A 3E5XA 5DD8A 3F8BA 5DYMA 1I27A 3QP5A 3J80K 4G7OF 3O6BB 4PGGA 1UFMA 5ERIA 3V7RA 2W57A 2HKOA 2X4HA 3IKTA 2RC4A 2KIUA 2E7WA 2P4WA 2IPQX 3L09A 2ZCWA 3FM5A 2WC2A 1YS7A 3E6BA 3NEUA 4EJVA 1ZHFA 2QBYB 5HLHA 2E7XA 2IP2A 1OKRA 3I53A 5DD4A 4WXHA 2XV4S 1T0FA 1EV7A 3ELKA 4A5NA 1BC8C 2JT1A 3F8CA 2P6SA 2EA2A 4I98B 4L5IA 4N0BA 3I58A 1ZG3A 1USSA 1LVAA 2HS5A 3ZN1A 3IKVA 2EJRA 3C18A 3JSPA 2VODA 4CZZA 1Z7UA 1T6SA 3RI4A 1K78A 3ZPLA 1FOKA 4M73A 1LEBA 4AWXB 2AXLA 2W84A 3BPVA 2Z3YA 4HF2A 2CWEA 1YIOA 3R4KA 4HW0A 2VBZA 5DV5A 1XMKA 1OYIA 2FU4A 2P6TA 1XCBA 2ZJ2A 2BGCA 4JBAA 2BE5F 4MEYF 1WSUA 1QZZA 1IF1A 3BDDA 1QPMA 2H6CA 4AVPA 5FFZA 1B9NA 3AAFA 1L0OC 2UZKA 2MH9A 5LGNA 2EFWA 1XDSA 3ECOA 1O7FA 2QM3A 3KP5A 1OR7A 2CO5A 5D6EA 4LGWA 3KP3A 5L3BA 3WTXC 5A2QK 2XHKA 2OQRA 2Y48A 4KIFA 5DCFA 1J9IA 1BJAA 5LEJA 4CO8A 3M1EA 6PAXA 1D8KA 1O3SA 4UXNA 1K6OA 3RPQA 1IRGA 1P92A 4R79A 1XGMA 3BY6A 1W7PA 1E2XA 1F1ZA 3J7AO 5F64A 2HTSA 5F1RA 1XGSA 2BBYA 1J0RA 4GGGA 1J75A 3GFMA 4QWQA 1IZ1A 1IN4A 2G9WA 4DNCA 3V8LA 4HF1A 4AIHA 3W6JB 5FGMA 2DO7A 5H6RA 2P7CB 4HX4A 3LQQA 2GAUA 1ONVA 2QZ8A 1S3JA 3F8NA 1C0WA 2OAZA 2H94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5W A;  2PFB A;  2L01 A;  3WGG A;  3IL2 A;  5LGT A;  1SAX A;  3KLN A;  2DLL A;  5ILU A;  1ZGJ A;  1FT9 A;  1P4A A;  2NNY A;  2KRF A;  4UVB A;  3ZQ7 A;  2FSW A;  3HHH A;  1HKT A;  1OMI A;  5F6F A;  3E6D A;  4CGZ A;  3HUG A;  3BRO A;  3KP4 A;  3KP6 A;  3FMQ A;  5JI6 A;  4LLG F;  5L3C A;  4Y13 A;  3FWE A;  3GWZ A;  1R7J A;  3TQN A;  1ZLK A;  4LG0 B;  4U7D A;  1BI2 A;  2BEO A;  1S8N A;  4EVI A;  5HS7 A;  1TQI A;  4UVA A;  3EDP A;  2CQK A;  4ASN A;  1FPO A;  3RDI A;  3F72 A;  1ZAO A;  2FRH A;  1ZN2 A;  2OQG A;  4YII A;  2O61 A;  4ZYH A;  1X3U A;  2GXB A;  2MBF A;  3QAH A;  1XB4 A;  1YG2 A;  3LA2 A;  2ESN A;  3KE2 A;  4G7Z F;  4I09 A;  4YFX F;  1RUN A;  3MEX A;  2A69 F;  4ZYE A;  5LGU A;  3JSO A;  3HRU A;  2L54 A;  4EJO A;  1XSD A;  2PLY A;  5L3G A;  5HS9 A;  4OOI A;  3GF2 A;  4G8X A;  3L00 A;  3BPX A;  4G94 A;  3QU3 A;  4FX0 A;  4MQ9 F;  3I64 A;  1TNT A;  2IJL A;  3MFK A;  3DEU A;  1BC7 C;  4EJU A;  2V6C A;  2OU2 A;  2VE9 A;  3KZZ A;  2HQR A;  3IRQ A;  3BZ6 A;  3DV8 A;  2KJB A;  2OZU A;  2FQ3 A;  1XCV A;  1Q1H A;  1G3S A;  4BXU A;  2PI0 A;  2ZNY A;  5D4S A;  1UHM A;  4U0V A;  3I71 A;  1BI0 A;  3H92 A;  1K78 B;  1F5T A;  2Z99 A;  3EYY A;  4U0Y A;  1STZ A;  2PQ8 A;  5CVU A;  1T98 A;  1PP7 U;  4ZH4 F;  2XAJ A;  5TJJ A;  4RAY A;  1YLF A;  3LA3 A;  2RV8 A;  1W5S A;  4WX9 A;  4ESF A;  5HOO A;  4RGX A;  2ZKZ A;  1RNL A;  1U2W A;  3ZMV A;  1TLH B;  3T8T A;  4BQA A;  1GVJ A;  1R58 A;  3RIR A;  1DDN A;  1FPQ A;  4U0W A;  4NB5 A;  1B1B A;  2HZT A;  2PG4 A;  2G7H A;  3OOP A;  1U5T A;  3EUH A;  2RGV A;  5HDG A;  3CUQ A;  2DU9 A;  5E17 F;  5D5U B;  5FB2 A;  2F2E A;  1A04 A;  1FC3 A;  2FBH A;  3F8M A;  1U78 A;  2OD5 A;  2ZNZ A;  2K4J A;  4HX8 A;  4Y15 A;  1B9M A;  2PBI A;  1W7P B;  4AIK A;  3I5U A;  5JHU A;  1XSV A;  4L0Z B;  4G9Y A;  4I0B A;  1O57 A;  2NYX A;  4HV6 A;  3R0J A;  1ZYR F;  1QZY A;  5D6F A;  2MC3 A;  4A6D A;  3BP8 A;  2XKO A;  3HOS A;  2DTR A;  2F5F A;  5HS8 A;  3COA C;  3EET A;  3ML6 A;  5JR3 A;  3CUO A;  1BI3 A;  2GZW A;  5J6X A;  1UB9 A;  2R7D A;  3GVA A;  5DUK A;  1TW3 A;  4IVN A;  5KK1 A;  3K1N A;  4HQE A;  3RKW A;  2CSO A;  2HTJ A;  4KFC A;  2IVM A;  3L9F A;  4BNC A;  1FZP B;  5CVJ A;  1U3E M;  1Z91 A;  5ICE A;  4A5M A;  1WWX A;  3WTZ A;  1JGS A;  1H9G A;  2PEX A;  4P9U A;  3VOE A;  1E17 A;  2HYG D;  4ESJ A;  3M7G A;  2O3F A;  2KIM A;  3DP7 A;  3F3X A;  3ECH A;  4KNY A;  5DEQ A;  1J2X A;  3LST A;  4R8H A;  2WV0 A;  2IA2 A;  2BYV E;  2FEZ A;  3JAM K;  4CXF A;  4I02 A;  5H20 A;  2IW5 A;  1F9N A;  2HQN A;  2QQA A;  4I2O A;  5D4R A;  1IXC A;  2YX7 A;  4ZYD A;  2IA1 A;  3K1P A;  2FOK A;  3HHG A;  4M71 A;  2VBY A;  2K7L A;  3DF8 A;  3HRM A;  4ETS A;  4HF0 A;  1LDJ A;  4HOB A;  3WTV C;  2XAQ A;  3BJ6 A;  3FXU A;  3T1B A;  1YW8 A;  1MKM A;  5HLI A;  5LHG A;  2XRO A;  3I0T A;  3CDH A;  1RI7 A;  3IHU A;  3M8E A;  2YSR A;  1EH7 A;  3GEZ A;  4KIC A;  2DI3 A;  3R6S A;  1O7L A;  1SD4 A;  1IRF A;  2QLZ A;  3DFG A;  4RGR A;  1MD0 A;  1V4R A;  4KIG A;  4EGY A;  2XAH A;  3RYP A;  1EH6 A;  1HST A;  3ZP5 A;  2O6G E;  3ZMT A;  2Y0M A;  3QPH A;  4WXD A;  5AIQ A;  3ZMZ A;  3FZV A;  2DK8 A;  3EYI A;  3M9A A;  2F5E A;  1IN8 A;  3K0L A;  4UHT A;  5IT9 K;  5FFX A;  3G73 A;  3ABU A;  1V3F A;  1TNS A;  3TOA A;  2ELH A;  1CF7 A;  1KQ9 A;  3F6O A;  4OIQ F;  1MJA A;  3I54 A;  3WTS C;  2OA4 A;  3K1M A;  2G7U A;  4IRH A;  4YFK F;  1O3Q A;  2LSO A;  3RKY A;  3CLO A;  1IAW A;  3B02 A;  4M9X A;  3DKW A;  2EV5 A;  2YR2 A;  3JTH A;  3PFI A;  4BAY A;  2EFO A;  4P55 A;  4N9I A;  2XAF A;  3P9C A;  1ZLJ A;  4YIF A;  3C1D A;  1XN7 A;  2K27 A;  5ICC A;  5L3D A;  4IRG A;  3TKY A;  1LQ1 A;  4WK8 F;  4U88 A;  3ZMD A;  3U2R A;  5LRR A;  1U5T C;  3KEO A;  2FBK A;  1BIB A;  4EQQ A;  2K86 A;  1U5T B;  3CUQ C;  2EB7 A;  1R23 A;  1UST A;  2LKP A;  2P5K A;  1Y0U A;  5L3E A;  1ZG5 A;  2TDX A;  2R3S A;  3CUQ B;  1TBX A;  2O0Y A;  1FP2 A;  2P8T A;  4Q47 A;  2RDP A;  3D0S A;  4O3M A;  3K9T A;  1SMT A;  4L5J A;  4KMU X;  4HYE A;  1T38 A;  1FYM A;  1R1V A;  5L3F A;  3T8R A;  4HDU A;  2QEN A;  2LF8 A;  1ZRC A;  4WXC A;  4ZZD A;  2J5P A;  1LDD A;  2DQR A;  2XRN A;  1L3L A;  3MAJ A;  5ICF A;  3UO2 A;  2Q8K A;  2OBP A;  2D2W A;  1FBU A;  1TTY A;  3CTA A;  1YTY A;  1Z05 A;  3D5L A;  4BYY A;  4RAZ A;  2QVO A;  2PMU A;  4ON0 A;  1QBJ A;  5FLX Z;  4PDK A;  3W6K B;  4KN7 X;  3V7C A;  2HKX A;  4TV7 A;  4ZYG A;  3R60 A;  4F7Z A;  3E5U A;  4G6D A;  4ENJ A;  2HYF A;  3GZ5 A;  4ENK A;  2FE3 A;  2NRA C;  4KUM A;  3G3Z A;  1R5G A;  3BWG A;  4KA4 A;  3SZT A;  1AWC A;  1QO0 D;  4A0Y A;  1JHF A;  2Q2E A;  2EV0 A;  5CVR A;  3L2C A;  3LQR A;  1ZRE A;  4B09 A;  2VT2 A;  4L9N A;  5ED4 A;  3T5X A;  3K69 A;  2UXX A;  1HSJ A;  4RB2 C;  1W5T A;  2XKP A;  2ZME A;  5FD6 A;  2P5L C;  3MZY A;  1WRJ A;  2DPU A;  1IW7 F;  1DPR A;  4FHT A;  5K5Q A;  3Q5F A;  3TGN A;  2HWV A;  3PQJ A;  5D5X B;  1SD6 A;  4S05 A;  1SD7 A;  4OMY A;  3FXQ A;  3JW4 A;  1S7O A;  4XRF A;  3V4G A;  4HA8 A;  2B0L A;  3I59 A;  1RZ4 A;  4A0Z A;  1FSE A;  2JRT A;  2FMY A;  2FXA A;  4JK1 X;  2A3S A;  3HSE A;  1ULY A;  2O8X A;  4A2U A;  1BOA A;  2LF7 A;  2O03 A;  1LEA A;  2UWM A;  2QBY A;  4EJT A;  2GA1 A;  1JXS A;  1ZG1 A;  3F23 A;  3SXY A;  3TO9 A;  2KIF A;  2A6H F;  1R00 A;  5FO5 A;  3QPT A;  1TQM A;  2H27 A;  3WU0 A;  5BPI A;  2QWW A;  5E8G A;  2DPD A;  4MTD A;  1T2K A;  1R1T A;  3KET A;  3O2P E;  2A5Y B;  3SZP A;  3HRS A;  4P9F A;  4O6J A;  1KU9 A;  1XGO A;  1FBS A;  1DUX C;  1DP7 P;  1IXR C;  2XAG A;  1S7A A;  3M8F A;  2CGP A;  3ABT A;  4EV0 A;  3BJO A;  2FF4 A;  2XIG A;  1KGS A;  2FA5 A;  3H3Z A;  4KT5 C;  1FX7 A;  1QQI A;  5TRD A;  3WTU C;  4ZZL A;  1FWZ A;  1FSH A;  5K1Y A;  3TDU C;  2GIV A;  2W24 A;  5ILV A;  4OMZ A;  2V79 A;  2XVC A;  1W7P D;  2DK5 A;  2ZFW A;  4XBF A;  4EGZ A;  4L9T A;  2YU3 A;  1HBX G;  1XD7 A;  3PQK A;  4MNU A;  3JTG A;  2DQL A;  4L18 B;  1IN5 A;  1R36 A;  1MGT A;  4XSX F;  3ZN0 A;  4MTE A;  3GW2 A;  1AOY A;  2KKO A;  5CLS A;  2W25 A;  3MZH A;  4NQW A;  1J59 A;  4KDP A;  3FF5 A;  3CO6 C;  4AIJ A;  1REP C;  3WTY C;  3I4P A;  3RPU A;  4OIN F;  2PN6 A;  4LJZ F;  4MGR A;  1OYY A;  2CG4 A;  4N9H A;  1T39 A;  1SFE A;  5IT3 A;  2F5D A;  1R1U A;  1MDM A;  2M8E A;  3J80 Z;  2HR3 A;  1ODD A;  3E5Q A;  3R61 A;  4QLC U;  4CYD A;  1B6A A;  2JPC A;  3CJN A;  1SMY F;  4P5O A;  1P6R A;  2EA4 A;  3WOD F;  4A0X A;  1NHA A;  2ESH A;  4OU0 A;  2EK5 A;  1UCR A;  1I1G A;  2E1N A;  2IT0 A;  4I7H A;  1SFU A;  3FXR A;  3VB2 A;  4HBL A;  3C3W A;  3QRF F;  1SD5 A;  2XUB A;  5BOX A;  5J8F A;  3SQN A;  3DPT A;  2BV6 A;  2OZ6 A;  4RS8 A;  1I5Z A;  4LB6 B;  2WWY A;  1OYW A;  3OV8 A;  4KYW A;  1QGP A;  1F4K A;  1HW1 A;  1H9T A;  3GX4 X;  1I1S A;  3ZMU A;  4BH9 A;  1XSX A;  2NNN A;  2EFQ A;  3V8K A;  3QOP A;  4GYG A;  5CVV A;  1J7K A;  1IN7 A;  5AON A;  4OIR F;  2L02 A;  5DCM A;  4KN4 X;  3KZY A;  1U8R A;  4P96 A;  4ENM A;  2LDU A;  2M30 A;  2EFP A;  4WF2 A;  3VFZ A;  1FBQ A;  1PDN C;  5JFR A;  3TO6 A;  1HW2 A;  5E8I A;  2YPR A;  3ZMS A;  3ISP A;  1O3R A;  3FX3 A;  1G3Y A;  2Z9O A;  3GXO A;  4Y17 A;  5E1W A;  1LB2 A;  4M6X A;  4BHP A;  1PP8 F;  4ENN A;  3UO3 A;  1KA8 A;  3E6C C;  3WGI A;  5DUI A;  1Z1D A;  2Z33 A;  1B59 A;  1P4X A;  3IWZ A;  1IXS B;  3S2W A;  3I59 B;  1MZB A;  2L3D A;  4HQM A;  4IPA A;  2A68 F;  3RYR A;  2X0L A;  2QUF A;  3V8J A;  2Y75 A;  3F21 A;  4HLY A;  1FNN A;  3R0A A;  5E20 A;  4LK1 F;  3HYI A;  1HW5 A;  5HLG A;  1LJ9 A;  5E1X A;  2HGC A;  5DDG A;  5HDN A;  5A2Q Z;  4EM2 A;  1YFH A;  2V9V A;  3C7J A;  1LDK B;  3IC7 A;  3DPL C;  4FX4 A;  1D5V A;  1GXP A;  2VC1 A;  2DFI A;  4HDV A;  1WQ2 A;  1PUE E;  2HEO A;  1KQ0 A;  4DQ2 A;  5BS6 A;  5E18 F;  4XLN F;  4MQV A;  2J5O A;  1ON1 A;  2RVC A;  4M6Y A;  1G3W A;  4U7B A;  2UXN A;  5BPD A;  2PMH A;  5H6Q A;  4Q5S F;  1WI9 A;  4RB3 C;  5CJ9 A;  4Q4Z F;  5LBQ A;  1ON2 A;  3LAP A;  2D45 A;  4IF4 A;  4G6Q A;  2VOO A;  2MLG A;  1BM9 A;  3HRT A;  2V1U A;  1ZGA A;  3N4M A;  1UHW A;  3KP2 A;  2R7F A;  5LLQ A;  1FP1 D;  4UV9 A;  2XAS A;  3BJA A;  4XSZ F;  4E70 A;  2VXZ A;  2COM A;  1YYV A;  4HLX A;  3GLX A;  2ZO4 A;  3ULQ B;  2D1H A;  4GO1 A;  4CHU A;  2A6E F;  3WU1 B;  4KIB A;  3E6M A;  3O3K A;  4LFU A;  2M87 A;  3N97 A;  4D0P A;  3DQV C;  1XDU A;  4UNO A;  3F8F A;  2ADU A;  1P4W A;  4GXO A;  5HDK A;  1Z6T A;  5ILS A;  3GFL A;  3P7N A;  1WKM A;  4JQF A;  4IHS A;  5KVR A;  4IJA A;  1K7A A;  4EMS A;  2HFH A;  1CGP A;  2VC0 A;  2DW4 A;  1S29 A;  2F5C A;  1DPU A;  2YX4 A;  1HXD A;  1EH8 A;  2RQP A;  4HV5 A;  1GHC A;  2QQ9 A;  2RN7 A;  2GQQ A;  2MH2 A;  1D3Y A;  4IXA A;  4EM1 A;  1G3T A;  1MDM B;  2ZBK A;  4ESB A;  3VOD A;  1RUO A;  2HOE A;  2EV6 A;  2RNJ A;  3GFI A;  2C6Y A;  2AS5 F;  4M74 A;  2H6B A;  2V1X A;  2D1V A;  2VOP A;  3HSF A;  2EFN A;  1JE8 A;  3KLO A;  3IWF A;  1XGN A;  4MEX F;  2K02 A;  1R5H A;  5D5W B;  4I0A A;  4HAM A;  2MD5 A;  1B4A A;  1MJ9 A;  1LNW A;  3WE3 A;  3F22 A;  2ACJ A;  3REO A;  4PGH A;  2JZY A;  2FNP A;  3MQ0 A;  3K2Z A;  2VON A;  4WWC A;  2QQB A;  4O5V A;  1J5Y A;  2WTE A;  1O3T A;  4IT5 A;  2A61 A;  5K5O A;  1R22 A;  3E97 A;  5K5R A;  1BIA A;  2STT A;  5DCM B;  3J81 Z;  2ZXJ A;  5D8K B;  1KQ8 A;  3LA7 A;  2GA2 A;  2QYO A;  2VE8 A;  4OIO F;  3WTT C;  5J8C A;  2RKH A;  3QU6 A;  1P2F A;  3VEP A;  1I6X A;  4YFN F;  4A12 A;  3HTU A;  1ZH5 A;  2KJC A;  1H0M A;  1HQC A;  5LEK A;  2LNB A;  1BI1 A;  3MWM A;  4PZJ A;  3RJP A;  3QP6 A;  3HOT A;  4RGS A;  3BVO A;  5ICG A;  3P9I A;  5BQT A;  4GYI A;  2PJP A;  1VTN C;  3HTS B;  3DXJ F;  5CVI A;  3V7S A;  1FYK A;  4LK0 F;  2FBI A;  3RKX A;  3BOQ A;  2Q0O A;  5D8L B;  1S6L A;  4EJW A;  1BN5 A;  2E1C A;  3B73 A;  3GFJ A;  3HSR A;  1QNT A;  4UUV A;  3MCZ A;  2DAO A;  5E1Z B;  5FLX K;  4XLP F;  3NQO A;  2CW0 F;  4BHC A;  3GZ6 A;  1TQP A;  1K79 A;  3KCC A;  1TW2 A;  2GWR A;  1FLI A;  3KP7 A;  1N1C A;  3Q9V A;  3KFW X;  1BBY A;  3H3U A;  4YG2 F;  1KYW A;  4UV8 A;  4Q48 A;  1OPC A;  1YW9 A;  3FHZ A;  5LHI A;  4RGU A;  3J81 K;  3SFZ A;  3TOB A;  4LMY A;  4L0Y B;  2CYY A;  1CF7 B;  4IHT A;  3TDZ C;  5FD5 A;  1FY7 A;  4HX7 A;  3WG9 A;  1JHH A;  2VN2 A;  3LAJ A;  1GXQ A;  3NRV A;  2K4B A;  2Z5U A;  2MA3 A;  3L7W A;  4OIP F;  3LWF A;  4CDG A;  1SFX A;  4LB5 A;  3CO7 C;  3HIF A;  1FYL A;  4H0E A;  1ZRD A;  3KEQ A;  4LLN A;  2M45 A;  3WE2 A;  4L9J A;  4HZF A;  2DBB A;  4WCG A;  4M9Z A;  1RIO H;  5D5V B;  1HKS A;  5EEG A;  2CFX A;  3U1D A;  2VBX A;  1IUY A;  3F6V A;  2ISY A;  4M72 A;  3T0Y A;  5BMZ A;  2HDC A;  2W85 A;  5EEH A;  4K2E A;  4A6E A;  2STW A;  4NHJ A;  2A07 F;  2FNA A;  2IA0 A;  3IRR A;  1KYZ A;  2M1B A;  3FMS A;  3ROU A;  4G7H F;  4B8X A;  4LD5 A;  1W4M A;  2JSC A;  2EWN A;  5CYV A;  3JAM Z;  1KU7 A;  3FMR A;  2JPB A;  3TO7 A;  3FM3 A;  2L4M A;  4FT8 A;  4R1H A;  3WGH A;  4PCQ A;  2XGX A;  3ERE D;  4RB1 A;  1D8J A;  3GYH X;  3SHF A;  2JTV A;  2L4A A;  1YO5 C;  4I01 A;  2ETH A;  5LRS A;  3Q9S A;  5AIP A;  4GCV A;  4L9V A;  2NAZ A;  4M9S A;  1ZAR A;  1XMA A;  2IRF G;  2FML A;  1YW7 A;  5JVT A;  2V1D A;  2GXG A;  1HKQ A;  4AD9 A;  3GO5 A;  2P5V A;  3P9K A;  2ISZ A;  2VBW A;  5HVQ C;  1Z6R A;  1YS6 A;  4MHG A;  4IRI A;  1ZRF A;  3E3V A;  3EQL F;  2DT5 A;  4LLL A;  4RB0 A;  3WTW C;  4LG0 A;  1KU3 A;  2ZME B;  4KMF A;  4Z2Y A;  3LFK A;  5LHH A;  5IT9 Z;  2P7V B;  1U6G A;  2H09 A;  2VT3 A;  2NS0 A;  1IN6 A;  4EM0 B;  1MJB A;  1YQA A;  4UVC A;  4S04 A;  3GUD A;  3U9G A;  2MLK A;  3RTR A;  1G4D A;  4CIC A;  1G6N A;  4BHB A;  1Z9C A;  1KU2 A;  3E5X A;  5DD8 A;  3F8B A;  5DYM A;  1I27 A;  3QP5 A;  3J80 K;  4G7O F;  3O6B B;  4PGG A;  1UFM A;  5ERI A;  3V7R A;  2W57 A;  2HKO A;  2X4H A;  3IKT A;  2RC4 A;  2KIU A;  2E7W A;  2P4W A;  2IPQ X;  3L09 A;  2ZCW A;  3FM5 A;  2WC2 A;  1YS7 A;  3E6B A;  3NEU A;  4EJV A;  1ZHF A;  2QBY B;  5HLH A;  2E7X A;  2IP2 A;  1OKR A;  3I53 A;  5DD4 A;  4WXH A;  2XV4 S;  1T0F A;  1EV7 A;  3ELK A;  4A5N A;  1BC8 C;  2JT1 A;  3F8C A;  2P6S A;  2EA2 A;  4I98 B;  4L5I A;  4N0B A;  3I58 A;  1ZG3 A;  1USS A;  1LVA A;  2HS5 A;  3ZN1 A;  3IKV A;  2EJR A;  3C18 A;  3JSP A;  2VOD A;  4CZZ A;  1Z7U A;  1T6S A;  3RI4 A;  1K78 A;  3ZPL A;  1FOK A;  4M73 A;  1LEB A;  4AWX B;  2AXL A;  2W84 A;  3BPV A;  2Z3Y A;  4HF2 A;  2CWE A;  1YIO A;  3R4K A;  4HW0 A;  2VBZ A;  5DV5 A;  1XMK A;  1OYI A;  2FU4 A;  2P6T A;  1XCB A;  2ZJ2 A;  2BGC A;  4JBA A;  2BE5 F;  4MEY F;  1WSU A;  1QZZ A;  1IF1 A;  3BDD A;  1QPM A;  2H6C A;  4AVP A;  5FFZ A;  1B9N A;  3AAF A;  1L0O C;  2UZK A;  2MH9 A;  5LGN A;  2EFW A;  1XDS A;  3ECO A;  1O7F A;  2QM3 A;  3KP5 A;  1OR7 A;  2CO5 A;  5D6E A;  4LGW A;  3KP3 A;  5L3B A;  3WTX C;  5A2Q K;  2XHK A;  2OQR A;  2Y48 A;  4KIF A;  5DCF A;  1J9I A;  1BJA A;  5LEJ A;  4CO8 A;  3M1E A;  6PAX A;  1D8K A;  1O3S A;  4UXN A;  1K6O A;  3RPQ A;  1IRG A;  1P92 A;  4R79 A;  1XGM A;  3BY6 A;  1W7P A;  1E2X A;  1F1Z A;  3J7A O;  5F64 A;  2HTS A;  5F1R A;  1XGS A;  2BBY A;  1J0R A;  4GGG A;  1J75 A;  3GFM A;  4QWQ A;  1IZ1 A;  1IN4 A;  2G9W A;  4DNC A;  3V8L A;  4HF1 A;  4AIH A;  3W6J B;  5FGM A;  2DO7 A;  5H6R A;  2P7C B;  4HX4 A;  3LQQ A;  2GAU A;  1ONV A;  2QZ8 A;  1S3J A;  3F8N A;  1C0W A;  2OAZ A;  2H94 A; 
#chains in the Genus database with same CATH topology
 2M5W A;  2HOT A;  4XM3 A;  1LFB A;  2DA7 A;  2L01 A;  2PFB A;  3WGG A;  3IL2 A;  4D7M A;  1ETK A;  5LGT A;  1R4N B;  1SAX A;  3KLN A;  2DLL A;  5IP6 A;  1N75 A;  5ILU A;  2EIK H;  1ZGJ A;  1ETX A;  1FT9 A;  1P4A A;  1Q9Y A;  2NNY A;  2KRF A;  4UVB A;  2R7Q A;  2FSW A;  3HHH A;  3H36 A;  3ZQ7 A;  4F91 B;  1HKT A;  2HVS A;  2X9D A;  3SQ1 A;  2DMP A;  3D1N I;  2O8K A;  2VJ5 A;  2HOS A;  2K40 A;  1FOW A;  5E3N A;  1OMI A;  5F6F A;  3CQ8 A;  3E6D A;  2K9N A;  3FXJ A;  5M5X J;  2V26 A;  4CGZ A;  2JA2 A;  2W4S A;  1MBH A;  1LE8 A;  2DMN A;  3HUG A;  3BRO A;  3KP4 A;  3KP6 A;  3FMQ A;  2XF7 A;  5JI6 A;  2XC7 A;  2IBD A;  2Y30 A;  2R4G A;  4LLG F;  5L3C A;  4Y13 A;  3FWE A;  2KRH A;  3L2U A;  3GWZ A;  2MC4 A;  1R7J A;  1CLQ A;  3TQN A;  1ZLK A;  2JMW A;  4LG0 B;  1PUF A;  3TW7 A;  2L7K A;  3K2O A;  4U7D A;  1BI2 A;  3PO3 J;  2BEO A;  1S8N A;  1SFK A;  2X6X A;  3FXO A;  5HS7 A;  4EVI A;  1TQI A;  4UVA A;  3EDP A;  2VQC A;  5JHF A;  2CQK A;  1IDY A;  4ASN A;  1FPO A;  4CUG A;  3RDI A;  3LNQ A;  3F72 A;  5CKT A;  1ZAO A;  2R92 J;  1VQ5 I;  2NVX J;  3HOZ J;  2FRH A;  1ZN2 A;  3QEI A;  1E3P A;  3KYD B;  2VPL A;  2OQG A;  3S2D J;  4M3G A;  4IHY A;  4M3R A;  3SJJ A;  4YII A;  2O61 A;  4ZYH A;  4UUS B;  1X3U A;  2LRD A;  2JHP A;  2GXB A;  2MBF A;  3QAH A;  2LF3 A;  3MKW B;  5FKM A;  1XB4 A;  1YG2 A;  3LA2 A;  2BHZ A;  2ESN A;  3MVP A;  3N05 A;  3KE2 A;  4G7Z F;  4I09 A;  4YFX F;  1ZTR A;  1RUN A;  2L9R A;  2A69 F;  3MEX A;  2R7T A;  2HU9 A;  1MW7 A;  5EJC A;  4ZYE A;  3HRU A;  2L54 A;  5LGU A;  3JSO A;  4J19 A;  4W1U A;  1TT0 A;  4EJO A;  1XSD A;  1KZH A;  2PLY A;  1WJF A;  3A1Y A;  3J7Y J;  5L3G A;  1H88 C;  1UG0 A;  5HS9 A;  1G8X A;  4OOI A;  1LVK A;  3GF2 A;  4XLC A;  5IOY A;  1J09 A;  4YRV A;  3AFH A;  5M5W J;  4G8X A;  3L00 A;  2E32 A;  3BPX A;  3TMO A;  4KI4 A;  2PFT A;  4G94 A;  1FYZ E;  3QU3 A;  4FX0 A;  4KHN A;  2JQT A;  4MQ9 F;  3HGL A;  1U8B A;  4BU2 A;  3I64 A;  1TNT A;  3GTJ J;  1ETY A;  2IJL A;  3MFK A;  3VYS B;  1G2H A;  2JVH A;  2LBF A;  3DEU A;  4AM3 A;  1JKQ C;  1BC7 C;  3HXL A;  4EJU A;  1X3Z B;  3H5N A;  3HC7 A;  2WAD A;  5E3M A;  1T0F C;  2NVY J;  2DJN A;  2V6C A;  2OU2 A;  1UJ8 A;  2EIJ H;  2AQE A;  2FOW A;  3KZZ A;  5GTI C;  2XGD A;  2HQR A;  2VE9 A;  1QHG A;  2X85 A;  3IRQ A;  3BZ6 A;  2R0Q C;  3DV8 A;  5DM7 F;  4KT6 A;  3G6E I;  2KJB A;  2NOG A;  2FQ3 A;  2OZU A;  1XCV A;  4BQN A;  4NC8 A;  2KFD A;  1Q1H A;  1SVO A;  3WU2 C;  1A36 A;  3HL8 A;  1G3S A;  4BXU A;  5CQE A;  2PI0 A;  3E1S A;  3CCV I;  1RPW A;  2ZNY A;  2CS3 A;  2X1C A;  4B47 A;  1I50 J;  4BXX J;  2MYS A;  4NNJ A;  5D4S A;  1UHM A;  3VDX A;  1WJA A;  4U0V A;  3I71 A;  1BI0 A;  3OYF A;  1QRY A;  1MBG A;  3H92 A;  1C0W A;  1K78 B;  4RLQ A;  1A31 A;  1F5T A;  2M8G X;  2Z99 A;  1FZ0 E;  3EYY A;  4U0Y A;  4Z6Y A;  1B72 B;  5GPA A;  1STZ A;  2PQ8 A;  5CVU A;  3SCX A;  3ERM A;  3G1L A;  2B9S A;  1JJ8 C;  4GDF A;  1T98 A;  4E4H A;  4KHY A;  1PP7 U;  2BHY A;  3ZXS A;  4ZH4 F;  1LFP A;  3OYC A;  4M42 A;  3SQ4 A;  2XAJ A;  4E7Z A;  5TJJ A;  2WAQ A;  1YX3 A;  1YLF A;  3LA3 A;  3IAM 2;  4JX6 A;  4RAY A;  2GLO A;  2RV8 A;  1W5S A;  4WX9 A;  4ESF A;  1GUU A;  1K83 J;  5HOO A;  3ABM H;  3HPG A;  4RGX A;  4C3I J;  2ZKZ A;  1RNL A;  4KHW A;  1U2W A;  3ZMV A;  1TLH B;  3T8T A;  3AL0 B;  4BQA A;  4AKI A;  1GVJ A;  3OY9 A;  1R58 A;  4MLO A;  4PJL A;  3RIR A;  1DDN A;  1XPX A;  2LOO A;  4JOM A;  2PMZ N;  4HG2 A;  1FPQ A;  1OR7 C;  4A3C J;  3H1C A;  1MNM C;  2E2H J;  4U0W A;  5FKO A;  4NDL A;  4NB5 A;  3QER A;  4ABZ A;  2XB5 A;  1RES A;  4HEA 2;  1B1B A;  1QHH D;  2DFE A;  2HZT A;  2PG4 A;  2HYJ A;  2G7H A;  2IGN A;  4V2G A;  3OOP A;  3RSN A;  5C44 J;  1U5T A;  2ZSH B;  3DEE A;  3EUH A;  1FZ9 E;  2RGV A;  4QND A;  5HDG A;  5GTH C;  1ZEL A;  3CMA I;  3RQI A;  2OCE A;  1HA8 A;  4XKC A;  3CUQ A;  3K4B A;  2DU9 A;  2WAF A;  5E17 F;  4DZP A;  5D5U B;  3QEP A;  4FJN A;  5FB2 A;  2DA2 A;  2F2E A;  5B66 C;  1A04 A;  4RBO A;  1FC3 A;  4JS5 A;  2FBH A;  3ABL H;  3F8M A;  5DTD A;  1U78 A;  1MHY G;  5F27 A;  2OD5 A;  2ZNZ A;  5FKK A;  4JYK A;  5C4J J;  4DTS A;  3PIO F;  2OZM A;  2K4J A;  4HX8 A;  2KMU A;  1IH7 A;  2WAE A;  4Y15 A;  3SPZ A;  4GRI A;  2JVG A;  1B9M A;  2PBI A;  1X1A A;  1W7P B;  4AIK A;  4IHV A;  3C95 A;  3I5U A;  4BE0 A;  4FJL A;  5JHU A;  3DCF A;  1XSV A;  4L0Z B;  1W5C C;  3L2O B;  1D1A A;  3ZOB A;  3CCE I;  1VI0 A;  3OYE A;  4G9Y A;  4I0B A;  1O57 A;  2ZC2 A;  3OYB A;  2NYX A;  3PNY A;  4HV6 A;  3R0J A;  1V5E A;  2FW3 A;  5KHD A;  1ZYR F;  4M3X A;  1OCC H;  3CQZ J;  1VQO I;  2E60 A;  2CU7 A;  1QZY A;  5D6F A;  2MC3 A;  4A6D A;  3BP8 A;  2XKO A;  4QIW N;  5FLM J;  3HOS A;  2DTR A;  2QGU A;  2F5F A;  3M8J A;  5HS8 A;  5J40 A;  3EET A;  3ML6 A;  3COA C;  1YIJ I;  2R93 J;  5JR3 A;  3K6G A;  1R71 A;  4PJN A;  2GBY A;  3GTG J;  3J7A Y;  2LY1 A;  3CUO A;  1BI3 A;  2GZW A;  2LY9 A;  2H1L A;  2EIM H;  1S5L C;  4RNG A;  5J6X A;  2OVR B;  2N8G A;  1UB9 A;  3UNG C;  2R7D A;  3GVA A;  2EBI A;  1R9T J;  1JTY A;  5DUK A;  1TW3 A;  2JJ7 A;  4X5N A;  4RM3 A;  4IVN A;  3U21 A;  2QSH X;  4PSX A;  4J2B A;  5KK1 A;  4IX7 A;  1X19 A;  4BAC A;  1TZL A;  4IHX A;  3K1N A;  4HQE A;  3RKW A;  4BS9 A;  3K2A A;  3PSI A;  3OSG A;  2DA5 A;  4UUT A;  1RKT A;  4N4N B;  1IO2 A;  2CSO A;  2HTJ A;  4KFC A;  1FEX A;  5EEA A;  2IVM A;  2K5C A;  3HUG B;  3OS2 A;  2K9L A;  1LE8 B;  1YRN A;  3SJM A;  3ZQL A;  1ZGW A;  3SUN A;  3L9F A;  4BNC A;  3C2B A;  3RMD A;  2LTP A;  1FZP B;  2JH8 A;  1MH3 A;  1SAN A;  4HRI A;  1S7E A;  5CVJ A;  4IZZ A;  3QEV A;  1D1C A;  1U3E M;  1Z91 A;  2RRE A;  3FKI J;  5ICE A;  4A5M A;  1WWX A;  1SEU A;  3WTZ A;  1JGS A;  2VJJ A;  3J2P A;  1H9G A;  2PEX A;  4P9U A;  3VOE A;  1PUF B;  3GTQ J;  5EF6 A;  3OS1 A;  1E17 A;  1WZ2 A;  2HYG D;  4ESJ A;  3OYA A;  3M7G A;  1ETW A;  2GOM A;  2CQX A;  2KIM A;  2O3F A;  2W48 A;  3DP7 A;  3F3X A;  3ECH A;  3JR9 A;  3HL2 A;  4KNY A;  2CW7 A;  5B1B H;  3C2H A;  1WPK A;  2DOF A;  2VQH A;  5DEQ A;  1J2X A;  3LST A;  4R8H A;  5J1Y A;  1QPI A;  2WV0 A;  2LYC A;  2IA2 A;  2BYV E;  2FEZ A;  2PFV A;  5M3M J;  3PJR A;  1JKP C;  3JAM K;  4CXF A;  4CYC A;  3MMY B;  4I02 A;  2E2I J;  5H20 A;  2IW5 A;  1F9N A;  1R4M B;  4JS4 A;  1UZC A;  2HQN A;  4ADN A;  2QQA A;  3S3M A;  3TBI A;  1W0U A;  4I2O A;  5D4R A;  1IXC A;  2YX7 A;  4BQQ A;  4ZYD A;  2DN0 A;  3DBR B;  2IA1 A;  3FK7 A;  1JI8 A;  1XMG E;  1P22 A;  5IYC J;  3K1P A;  2FOK A;  4E4B A;  1WFX A;  3HHG A;  4ITV A;  2IS1 A;  4X5M A;  3DTK A;  4M71 A;  4ANJ A;  1FOX A;  2VBY A;  2K7L A;  3DF8 A;  1RC9 A;  2JK3 A;  3HRM A;  1IRZ A;  1S72 I;  2Y2Z A;  4ETS A;  1I3A A;  4HF0 A;  1LDJ A;  1MNE A;  2CUF A;  4HOB A;  2ZXH A;  3WTV C;  2XAQ A;  3BJ6 A;  3K4K A;  4FK0 A;  3FXU A;  1FZ3 E;  1ENH A;  3S1N J;  2B1E A;  2JA7 J;  3T1B A;  1YW8 A;  1MKM A;  3SUP A;  4I9Q A;  2LG4 A;  5HLI A;  5LHG A;  9ANT A;  3I4N J;  1ETO A;  2XRO A;  3I0T A;  3ZRG A;  1E3H A;  1MMA A;  4AKH A;  4QPO A;  1FIA A;  2MD0 A;  3CDH A;  1RI7 A;  3RMA A;  3IHU A;  3M8E A;  5F0H A;  2YSR A;  1EH7 A;  1FMW A;  3GEZ A;  4M41 A;  2CRG A;  1WJ5 A;  2Y9Z A;  4KIC A;  1V5G A;  1EF4 A;  4M45 A;  3CJT B;  1FZ1 E;  2DI3 A;  3R6S A;  3OYL A;  3TED A;  5J1R A;  1O7L A;  1ETQ A;  1AKH A;  3GTM J;  1SD4 A;  2DY4 A;  1IRF A;  2QLZ A;  2KQR A;  2Y31 A;  3DFG A;  3IP4 B;  4HPQ A;  4D7N A;  2JQ7 A;  3N1B A;  3KD5 E;  4RGR A;  4DBR A;  1MD0 A;  1V4R A;  1G59 A;  4X6A J;  1ZR4 A;  4UY8 I;  3S3O A;  3TW6 A;  4KIG A;  4XL9 A;  1EKE A;  2XAH A;  4EGY A;  3RYP A;  4CCL A;  4KHU A;  1EH6 A;  1HST A;  1JUP A;  3ZP5 A;  2O6G E;  3ZMT A;  2Y0M A;  4EEF G;  1YX5 A;  4E6K G;  4XOP A;  2E1O A;  1H8A C;  1FZH E;  3SQ2 A;  3QNO A;  2RCU A;  3OR2 C;  3QPH A;  4WXD A;  5AIQ A;  3ZMZ A;  3FZV A;  2LKX A;  2DK8 A;  5GP9 A;  3H9G A;  1VQ7 I;  3EYI A;  3M9A A;  2F5E A;  1IN8 A;  3K0L A;  4UHT A;  5IT9 K;  2E35 A;  1V5F A;  5FFX A;  3G73 A;  3KYL A;  2DA4 A;  3TJY A;  4N4O B;  5B3S H;  2Z1D A;  3ABU A;  1V3F A;  1TNS A;  3DLA A;  3TOA A;  5FRM A;  2ELH A;  1CF7 A;  4FE4 A;  1KQ9 A;  3F6O A;  4OIQ F;  3EPZ A;  4FJK A;  2DDA A;  1MJA A;  1AA7 A;  3I54 A;  4ZTJ A;  2WB1 A;  3WTS C;  3RPU D;  2OA4 A;  1PYV A;  1JW2 A;  3K1M A;  4IOA F;  2G7U A;  4IRH A;  3G4S I;  2MW2 A;  4BEH A;  4YFK F;  1O3Q A;  1MBK A;  2LSO A;  3BCA A;  2OTL I;  2CQN A;  4XLF A;  3RKY A;  3CLO A;  2WA0 A;  1BR2 A;  1IAW A;  3GTK J;  1CQT A;  3B02 A;  4M9X A;  3DKW A;  2EV5 A;  2YR2 A;  3JTH A;  4HNV A;  3PFI A;  4BAY A;  2EFO A;  4P55 A;  4XRS A;  4N9I A;  5FLV A;  4DTR A;  4FVM A;  2OCC H;  2XAF A;  3BTC A;  1XVE E;  4J2D A;  3P9C A;  1YI2 I;  1ZLJ A;  4QTR A;  1W36 C;  2UUZ A;  4YIF A;  2X48 A;  3A01 A;  3C1D A;  1DP3 A;  1XN7 A;  2K27 A;  4AID A;  4P1W A;  1VFC A;  4XN0 A;  5ICC A;  5L3D A;  5J4V A;  3AKZ A;  4IRG A;  3TKY A;  2E36 A;  1LQ1 A;  4WK8 F;  4U88 A;  3ZMD A;  4KJZ A;  3U2R A;  5LRR A;  1U5T C;  3BG6 A;  3KEO A;  2FBK A;  1BIB A;  4EQQ A;  2EZK A;  1K6Y A;  2K86 A;  5GAE J;  1QVU A;  1U5T B;  3CUQ C;  4W97 A;  2EB7 A;  1R23 A;  5IPA A;  1UST A;  4FJ7 A;  1XL3 C;  2LKP A;  2P5K A;  1Y0U A;  5L3E A;  1TWC J;  2TDX A;  2R3S A;  3CUQ B;  1ZG5 A;  4AYB N;  1TBX A;  2O0Y A;  1I6H J;  3CD6 I;  2K9S A;  2IS4 A;  3TAB A;  1FP2 A;  1POG A;  4U87 A;  2DMQ A;  2P8T A;  3EUA A;  4Y52 J;  4Q47 A;  2RDP A;  3D0S A;  3L2R A;  4O3M A;  3BQY A;  4DU1 A;  3K9T A;  1SMT A;  3HBL A;  4L5J A;  4KMU X;  4HYE A;  1T38 A;  1FYM A;  2Y0S A;  4BJ5 C;  2DXI A;  1X4O A;  2BZT A;  1XVC E;  4DTO A;  1R1V A;  3LSG A;  3LSM A;  2ID3 A;  5L3F A;  3T8R A;  3GTP J;  3TAG A;  2LP0 A;  4HDU A;  3LSR A;  2QEN A;  2LF8 A;  3W3C A;  1ZRC A;  4WXC A;  2LKS A;  4ZZD A;  2J5P A;  1LDD A;  2CV2 A;  2DQR A;  2XRN A;  1LFU P;  1L3L A;  4I99 C;  2KHM A;  3MAJ A;  5ICF A;  3UO2 A;  2Q8K A;  2OBP A;  1LPQ A;  2D2W A;  1FBU A;  1TTY A;  5JVG F;  2X1E A;  3CTA A;  1OFC X;  1YTY A;  1X58 A;  2EPF A;  2HDW A;  4IKF A;  1Z05 A;  3D5L A;  5FRO A;  3OYJ A;  2VL8 A;  4EAT A;  4BYY A;  2RNG A;  4RAZ A;  2L9S A;  1Z0X A;  2QVO A;  2PMU A;  4ON0 A;  1QBJ A;  2E71 A;  2R7X A;  3NWS A;  1ERD A;  3JRH A;  4FE7 A;  4DYR A;  5FLX Z;  4XKW A;  4PDK A;  2I8D A;  2IS6 A;  3WSO A;  4PJ0 C;  3K7A J;  5IRE A;  5IP9 J;  1VQK I;  3W6K B;  3K4J A;  1GT0 C;  3TAF A;  4KN7 X;  1TWA J;  3V7C A;  2NVT J;  1HCR A;  2HKX A;  1FJL A;  4TV7 A;  4ZYG A;  4DYC A;  3R60 A;  1Z7L A;  4F7Z A;  4FET A;  3I56 I;  4ZTF A;  4AC0 A;  3E5U A;  3A02 A;  4ZDP A;  4G6D A;  4ENJ A;  3AG1 H;  4RG8 A;  3HGK E;  2ZJP F;  2HYF A;  2XPU A;  2M2E A;  2R5Z B;  3GZ5 A;  4ENK A;  2FE3 A;  2HDD A;  3BCB A;  3HKZ N;  1FMV A;  2NRA C;  3ONQ A;  4KUM A;  3G3Z A;  2H8R A;  3CCL I;  1R5G A;  3BWG A;  1HC8 A;  2M0M A;  4KA4 A;  3SZT A;  4E7S A;  1FIP A;  1PVE A;  1AWC A;  3BR5 A;  4FK2 A;  2HD0 A;  1X3W B;  1T95 A;  1XTA A;  1VQM I;  1HLV A;  2DTU A;  1QO0 D;  4A0Y A;  2L9V A;  3IV5 A;  5J1U A;  3CFR A;  1JHF A;  1WJC A;  2Q2E A;  5KNL A;  2EV0 A;  4XNF A;  5CVR A;  3L2C A;  1YRN B;  2L2O A;  3LQR A;  1ZRE A;  4B09 A;  2VT2 A;  4L9N A;  2M7A A;  3T5X A;  5ED4 A;  3JRF A;  1VQ9 I;  3ZQC A;  5M3F J;  1NG7 A;  3I9V 2;  3K69 A;  5IYB J;  5IY5 H;  2UXX A;  5KCM A;  1HSJ A;  4S0H B;  4RB2 C;  1KON A;  2LFB A;  1W5T A;  2XKP A;  2ZME A;  5FD6 A;  4YEJ A;  2ZFU A;  2P5L C;  3MZY A;  1WRJ A;  2DPU A;  2JSP A;  3IH4 A;  1IW7 F;  1DPR A;  3LZJ A;  2E31 A;  2ECB A;  1IGN A;  4FHT A;  5K5Q A;  3Q5F A;  2F4O B;  1T08 B;  3TGN A;  1AU7 A;  2HWV A;  2F4M B;  3PQJ A;  3E7L A;  5D5X B;  1JUS A;  4DU3 A;  4Y33 A;  3CDL A;  2MMB A;  1SD6 A;  1X4P A;  2X1D A;  4S05 A;  4CH7 A;  1SD7 A;  4CSW A;  4OMY A;  3S17 J;  3FXQ A;  2QA4 I;  3JW4 A;  4A3K J;  2FX0 A;  1WH7 A;  2NVU B;  2QXF A;  1S7O A;  3H9J A;  4II3 A;  4XRF A;  4F3Q A;  2YB5 A;  3V4G A;  4HA8 A;  2QCO A;  2B0L A;  3ESW B;  3G1O A;  4MFE A;  3I59 A;  1RZ4 A;  4A0Z A;  1FSE A;  2JRT A;  2KT0 A;  2DJI A;  5J47 A;  4BDZ A;  2NOJ B;  2FMY A;  3OL3 A;  2FUG 2;  2FXA A;  4ZJZ A;  4JK1 X;  5H37 A;  2A3S A;  3HSE A;  2JN6 A;  5K7F A;  1XVF E;  1ULY A;  2O8X A;  2XRL A;  1TL8 A;  2R7V A;  2BXZ A;  3F0C A;  3RCO A;  3PO2 J;  1IG9 A;  3H0D A;  4A2U A;  1BOA A;  1XMH E;  2IEK A;  5IZ7 A;  2VPR A;  2LF7 A;  2O03 A;  2F6C A;  3NAE A;  1T33 A;  1LEA A;  2UWM A;  3FDY A;  2QBY A;  4EJT A;  2GA1 A;  1JXS A;  3CZ6 A;  1ZG1 A;  3F23 A;  3SXY A;  2K9M A;  1IJW C;  1DU0 A;  3TO9 A;  4ZYA A;  3RZO J;  1TP4 A;  2KIF A;  2A6H F;  4MO7 A;  1M1E B;  1R00 A;  2L7M P;  2W1O A;  3I55 I;  2ICW G;  4DJA A;  2HXO A;  5FO5 A;  3OR1 C;  2HNH A;  3H9Q A;  2DOD A;  1D0Y A;  2XF6 A;  5FRN A;  2VKH A;  3QPT A;  4FCY A;  1TQM A;  3OIP A;  1JKO C;  1Y39 A;  4MFD A;  3BTJ A;  2H4T A;  1AKH B;  3QET A;  2H27 A;  3Q0U A;  2NS7 A;  1FZI E;  3WU0 A;  2I5U A;  5BPI A;  1DGR M;  2QWW A;  3D5R C;  5E8G A;  2LD5 A;  2DPD A;  4XMY A;  4MTD A;  1T2K A;  3HP9 A;  1R1T A;  1ZQ3 P;  5IOZ A;  3KET A;  3H5R A;  3L8B A;  4AU7 A;  2VKD A;  2XAU A;  2ID6 A;  3O2P E;  3S32 A;  3ZQI A;  2A5Y B;  2QKM B;  3SZP A;  1NEX B;  2DFF A;  3HRS A;  4P9F A;  2DTZ A;  4O6J A;  3OGL B;  1D5Y A;  1Z3Y A;  2CUE A;  2IGK A;  3FXK A;  1KU9 A;  1XGO A;  2KPM A;  1FBS A;  1DUX C;  1DP7 P;  2FD5 A;  4PSW A;  1IXR C;  4RA2 A;  4E7H A;  2VXD A;  1A5J A;  2CMP A;  2XAG A;  3UIQ A;  1S7A A;  3M8F A;  2CGP A;  1ACI A;  2DMU A;  3ABT A;  4EV0 A;  5FKN A;  3BJO A;  4C2U A;  1FZ2 E;  3AL0 C;  1Y8R B;  2FF4 A;  1HDD C;  2XIG A;  3FXM A;  1VQ4 I;  1KGS A;  2FA5 A;  4DTP A;  1Y56 A;  2P1Q B;  5F08 A;  3H3Z A;  4KT5 C;  1FX7 A;  3Q0W A;  3EUK L;  1R49 A;  3K4M A;  3CLQ A;  1QQI A;  4XR6 A;  1SAU A;  1U9N A;  4ZZL A;  3WTU C;  1FWZ A;  2KIQ A;  5TRD A;  1FSH A;  1Y6I A;  5K1Y A;  3TDU C;  1XU3 E;  1E3O C;  2GIV A;  2W24 A;  5ILV A;  3SDG A;  4OMZ A;  5TIS C;  4CCM A;  2V79 A;  2XVC A;  1W7P D;  2DK5 A;  2ZFW A;  5HNF A;  1RR8 C;  3LSH A;  4XOR A;  4HST A;  4XBF A;  4EGZ A;  4L9T A;  2YU3 A;  1ZK8 A;  1HBX G;  3N1E A;  1XD7 A;  3BR1 A;  1OLT A;  3PQK A;  4MNU A;  3JTG A;  4OWR B;  2DQL A;  4L18 B;  1IN5 A;  1R36 A;  1OQY A;  1MGT A;  2QQ8 A;  4XSX F;  3ZN0 A;  3ZCO A;  4RLF A;  3FIW A;  4MTE A;  1OCO H;  1A35 A;  5K7H A;  3GW2 A;  2FJ1 A;  1YHQ I;  2GOX B;  3L2Q A;  2JRM A;  1AOY A;  1U9O A;  2KKO A;  5CLS A;  4UB8 C;  2W25 A;  3MZH A;  2ATQ A;  2CV0 A;  4NQW A;  1J59 A;  2E5N A;  3JCU C;  3NGI A;  4KDP A;  3FF5 A;  3LSK A;  3CO6 C;  4AIJ A;  1REP C;  3WTY C;  3I4P A;  3RPU A;  4OIN F;  4BKX A;  2PN6 A;  4LJZ F;  4MGR A;  1OYY A;  2CG4 A;  4N9H A;  1T39 A;  1BJZ A;  2XPW A;  2ELK A;  2IGM A;  1LKX A;  2R7U A;  3DKX A;  1SFE A;  5IT3 A;  2D5V A;  4A3D J;  2F5D A;  4F52 A;  4E7K A;  1R1U A;  1MDM A;  2KRC A;  1BW6 A;  1B8I A;  2A5W A;  2M8E A;  3J80 Z;  2HR3 A;  1ODD A;  4IQJ A;  1WAJ A;  3D5S C;  5J3L A;  3E5Q A;  3R61 A;  4QLC U;  1QA6 A;  4CYD A;  1B6A A;  2JWT A;  2JPC A;  2ZJR F;  3CJN A;  3GTO J;  1SMY F;  4P5O A;  1P6R A;  5IP7 J;  2EA4 A;  2QSG X;  3BTI A;  3LSJ A;  3WOD F;  3QOD A;  4A0X A;  4OAZ A;  1UMQ A;  1NHA A;  2ESH A;  4OU0 A;  2EK5 A;  1UCR A;  1I1G A;  1TWG J;  2JA8 J;  2E1N A;  2IT0 A;  4I7H A;  4C30 A;  2OYQ A;  1SFU A;  3FXR A;  4F55 A;  3VB2 A;  2COB A;  3C3W A;  4HBL A;  4J01 A;  3CCM I;  4NUB A;  1GVD A;  3QRF F;  2JA5 J;  1SD5 A;  2XUB A;  4XID A;  2E5Z A;  5BOX A;  4AUX A;  5J8F A;  3KPH A;  3FBN B;  3DPT A;  2BV6 A;  2OZ6 A;  3SQN A;  4RS8 A;  1I5Z A;  3HG9 A;  1P7J A;  2TRT A;  3LDS A;  4LB6 B;  4FJJ A;  2WWY A;  1OYW A;  4FJ8 A;  3OMY A;  3OV8 A;  4KYW A;  3V42 A;  1QGP A;  4FJH A;  1F4K A;  1HW1 A;  2XGE A;  3MKZ A;  1H9T A;  1GDT A;  3K4L A;  3HJE A;  3GX4 X;  3GBG A;  1I1S A;  5J4Y A;  1BA5 A;  3M3Y J;  3OYI A;  1VQ6 I;  3ZMU A;  4BH9 A;  4FJG A;  3SZG A;  1XSX A;  2NNN A;  2EFQ A;  3V8K A;  3QOP A;  4DGW B;  1XC5 A;  3JRE A;  2R7Z J;  2FQ4 A;  4GYG A;  3L1P A;  1F43 A;  5CVV A;  3LFU A;  3PM1 A;  1J7K A;  3VSK A;  3FK6 A;  1IN7 A;  2DYR H;  5AON A;  2CQ7 A;  2M4G A;  4OIR F;  3H0G J;  2L02 A;  5DCM A;  2E19 A;  4KN4 X;  3X2Q H;  1YOV B;  3KZY A;  4E7I A;  2OC6 A;  1U8R A;  4P96 A;  2WAQ N;  4ENM A;  2LDU A;  2M30 A;  1N25 A;  2EFP A;  3AG2 H;  3SNN A;  4AVZ A;  3LSP A;  3DBL B;  4WF2 A;  1V55 H;  2W00 A;  3VFZ A;  1FBQ A;  4CCN A;  1NK2 P;  3VYU B;  1PDN C;  5JFR A;  3TO6 A;  3QEX A;  1HW2 A;  5E8I A;  1TWH J;  2YPR A;  3ZMS A;  4XLA A;  3ISP A;  3W2V A;  5GAG J;  1O3R A;  3FX3 A;  2QKL B;  1G3Y A;  1YJW I;  2L9N A;  2Z9O A;  3GXO A;  2DT6 A;  4Y17 A;  5E1W A;  1LB2 A;  4M6X A;  4G6T B;  1ZR2 A;  4NC6 A;  3BZC A;  1XU5 E;  2DA6 A;  2KIS A;  2KLO A;  3BT9 A;  4BHP A;  1PP8 F;  3DLL F;  4ENN A;  3UO3 A;  4BDY A;  1KA8 A;  3A03 A;  3E6C C;  2R7S A;  5EDN A;  1ETV A;  3WGI A;  5DUI A;  3NE6 A;  1Z1D A;  2OVP B;  2Z33 A;  4OAY A;  3PNT A;  2IXS A;  1B59 A;  3BTL A;  1P4X A;  1YIT I;  1X2N A;  3IWZ A;  1IXS B;  3S2W A;  3I59 B;  1MZB A;  5EYR A;  2L3D A;  4HQM A;  4IPA A;  2A68 F;  3RYR A;  1P9Q C;  1P7I A;  2X0L A;  5H2F C;  2QUF A;  4ICG C;  3V8J A;  2DOE A;  1RR7 A;  3SUQ A;  2Y75 A;  2Z16 A;  3VYT B;  3F21 A;  4HLY A;  1FNN A;  3R0A A;  5E20 A;  4LK1 F;  3HYI A;  1HW5 A;  5HLG A;  2DEB A;  1LJ9 A;  5E1X A;  2E1M C;  4C3J J;  2HGC A;  2LLK A;  5DDG A;  5HDN A;  3BG3 A;  5A2Q Z;  4EM2 A;  1YFH A;  3CJR B;  2HVR A;  1QVT A;  2V9V A;  2E1M B;  3C7J A;  2OTJ I;  4DTX A;  2LBF B;  1LDK B;  5E3L A;  3IC7 A;  5LD2 C;  3JRA A;  3DPL C;  4FX4 A;  2YS9 A;  1D5V A;  1GXP A;  5EG0 A;  2VC1 A;  4PUS A;  3OIQ A;  2DFI A;  4HDV A;  4I76 A;  1WQ2 A;  1PUE E;  1Y0N A;  2HEO A;  3C6P B;  5CQG A;  4ZDO A;  2BW3 A;  1KQ0 A;  4DQ2 A;  5BS6 A;  2M4K A;  3QWL A;  3ZGK A;  3BC8 A;  5E18 F;  4X0G A;  4XLN F;  2LVS A;  4E7L A;  3OYD A;  3CC4 I;  4MQV A;  2J5O A;  2AO9 A;  3DTI A;  1ON1 A;  3RZD J;  2RVC A;  4M6Y A;  1G3W A;  4U7B A;  2NVQ J;  2UXN A;  3PIP F;  2ME0 A;  5BPD A;  2PMH A;  5H6Q A;  3NAR A;  1Z3X A;  3IH3 A;  4Q5S F;  1VQN I;  1FZ6 E;  1WI9 A;  3W2W A;  4RB3 C;  3BR0 A;  2WY8 Q;  3KZI C;  5CJ9 A;  4Q4Z F;  5EZH A;  1D0X A;  5LBQ A;  1MTY G;  1ON2 A;  4BY1 J;  1HOM A;  4JRP A;  1W36 D;  3LAP A;  2D45 A;  4IF4 A;  3SYT A;  2WV1 A;  1OJL A;  1Q9X A;  4G6Q A;  3CP8 A;  3MKS B;  4ADO A;  4KHQ A;  4ZDL A;  3ZQQ A;  2VOO A;  4X1E A;  2OZS A;  2MLG A;  4CCO A;  1BM9 A;  2EZL A;  3HRT A;  2V1U A;  1ZGA A;  3N4M A;  2OJE D;  4M6V A;  2UV1 A;  3DPU A;  4XIC A;  1WJD A;  1UHW A;  1WGX A;  2EIN H;  2HI3 A;  3RQ4 A;  3KP2 A;  1MSF C;  1RRJ A;  3QEW A;  2R7F A;  2ZB9 A;  4YEL A;  5LLQ A;  2VQL A;  1FP1 D;  3L2W A;  3QYE A;  2XAS A;  3BJA A;  4UV9 A;  4XSZ F;  3M4O J;  3OIO A;  4E70 A;  2VXZ A;  3GME A;  5E3O A;  5F0C A;  2COM A;  2VI6 A;  1VZ0 A;  3NWT A;  1YYV A;  4M3F A;  3A0H C;  4HLX A;  3G71 I;  4DYQ A;  3C94 A;  3GLX A;  4GAM C;  4C3H J;  4FQG A;  5EZG A;  2ZO4 A;  3ULQ B;  2D1H A;  1JJ6 C;  4GO1 A;  2GM4 A;  2A6E F;  4CHU A;  3WU1 B;  4KIB A;  3E6M A;  4RDU A;  2E34 A;  4MIM A;  2LY2 A;  3O3K A;  3RWU A;  3EUH C;  4DTU A;  4A3J J;  4LFU A;  2M87 A;  3N97 A;  4D0P A;  1OCP A;  3DQV C;  1XDU A;  3K70 C;  4UNO A;  3V7D B;  3F8F A;  2ADU A;  1OCR H;  1MH4 A;  1P4W A;  2VIX A;  4GXO A;  5KAF C;  5HDK A;  1Z6T A;  2R5Y A;  1DU6 A;  5ILS A;  2HQA A;  3GFL A;  1WKM A;  3P7N A;  3QOE A;  4IOC F;  4JQF A;  3S93 A;  4BE1 A;  4IHS A;  1FZ5 E;  3S9H A;  5KVR A;  4IJA A;  1K7A A;  1WHU A;  1LDK E;  4EMS A;  2HFH A;  1CGP A;  3JRD A;  5HNH A;  4NQW B;  1BR4 A;  1WH5 A;  2VC0 A;  3CMY A;  1FXX A;  3TAE A;  1XS9 A;  2DW4 A;  1S29 A;  4BXF A;  2M3A A;  3DTE A;  2F5C A;  3OYK A;  1DPU A;  3KD1 E;  2YX4 A;  2BOL A;  1HXD A;  1EH8 A;  2RQP A;  4HV5 A;  4A3I J;  1GHC A;  2QQ9 A;  2RN7 A;  2GQQ A;  2H8W A;  2ECC A;  1MMD A;  1WJE A;  1D3Y A;  1R6R A;  2MH2 A;  4IXA A;  4EM1 A;  2IS2 A;  1G3T A;  4KHS A;  4D5F A;  3L1N A;  1MDM B;  3ASN H;  2ZBK A;  2AXT C;  1B8I B;  4ESB A;  1VND A;  1JKR C;  4PJM A;  4XLH A;  3VOD A;  1RUO A;  2RAE A;  4D9J A;  4PJJ A;  2HOE A;  2EV6 A;  2RNJ A;  4KIS A;  4I6J B;  1R5I D;  3W2A A;  2BXY A;  5FJ8 J;  3GFI A;  2C6Y A;  2Y9Y A;  1FZ7 E;  2AS5 F;  3SFI A;  3RMB A;  4A3M J;  4M74 A;  1JT6 A;  2H6B A;  2V1X A;  3Q3S A;  1XVB E;  2LC2 A;  2D1V A;  2VOP A;  4BBR J;  2KDZ A;  1BL0 A;  3C2G A;  3HSF A;  2F4I A;  2EFN A;  3JRC A;  1JE8 A;  3FIS A;  3KLO A;  3IWF A;  4ZC3 A;  3MZ8 A;  1XGN A;  3HOW J;  4MEX F;  2K02 A;  1R5H A;  2AQF A;  1I3Q J;  5D5W B;  3S2H J;  5GAD J;  4I0A A;  4HAM A;  2MD5 A;  1B4A A;  3DU5 A;  2B63 J;  2B7M A;  1MJ9 A;  3E0J B;  2M34 A;  1LNW A;  1BOB A;  2ZXI A;  2JUC A;  3MD2 A;  3WE3 A;  4B44 A;  4BJ6 C;  1TWF J;  2CUZ A;  2PX9 A;  3F22 A;  2ACJ A;  3IAS 2;  3REO A;  1N78 A;  3NCI A;  2R7R A;  4LIT A;  4PGH A;  2JZY A;  2FNP A;  4XON A;  4BE2 A;  3MQ0 A;  3K2Z A;  2VON A;  2P1M B;  4EYW A;  4RMN A;  4WWC A;  1XVD E;  3HPH A;  4PK4 A;  2ELJ A;  3G1M A;  1X1B A;  2QQB A;  3LSI A;  4O5V A;  2DCE A;  1J5Y A;  2WTE A;  1O3T A;  5F0F A;  4IT5 A;  1SC7 A;  2A61 A;  4RAG A;  5K5O A;  1R22 A;  3E97 A;  5IBK B;  1PJR A;  1IV8 A;  5K5R A;  1EJ9 A;  1UAA A;  4DTN A;  2L5Q A;  1BIA A;  2STT A;  1K4T A;  3AG4 H;  3DEW A;  5DCM B;  5DM6 F;  3J81 Z;  2ZXJ A;  1W0T A;  3LZI A;  2WB1 N;  5F04 A;  3ZQF A;  5D8K B;  2MSY A;  3MKY B;  1KQ8 A;  3CFP A;  3TP3 A;  2O9L A;  3LA7 A;  1ORK A;  4EPH A;  2GA2 A;  1FOY A;  2Q1Z B;  2QYO A;  3JRI A;  2VE8 A;  3CC7 I;  2JPN A;  2PMZ A;  4OIO F;  3WTT C;  3OSF A;  5J8C A;  2RKH A;  3QU6 A;  1P2F A;  1YE9 A;  2BY1 A;  3CCQ I;  2DMT A;  1XVG E;  4M3W A;  3VEP A;  1I6X A;  4M3U A;  4YFN F;  1RKW A;  1WI3 A;  4A12 A;  3CFO A;  3HTU A;  4QSH A;  1ZH5 A;  1VQL I;  3GZN B;  1Z21 A;  2X6W A;  4CYC B;  2KJC A;  3SEZ A;  1FS1 A;  1H0M A;  3E4Y A;  1IG7 A;  2K3F A;  1HQC A;  2E2J J;  1FTT A;  5LEK A;  2LNB A;  2LR8 A;  1BI1 A;  3MWM A;  4PZJ A;  1X2M A;  3RJP A;  3QES A;  2W7N A;  3QP6 A;  3OOU A;  3HOT A;  2CH0 A;  4RGS A;  3BVO A;  5E79 C;  5ICG A;  1ITY A;  3P9I A;  5BQT A;  2BVM A;  4GYI A;  1W1W E;  2HPM A;  2PJP A;  1VTN C;  2DA1 A;  2X6O A;  3HTS B;  3DXJ F;  5CVI A;  1A6Q A;  3V7S A;  2DOA A;  3QQA A;  1I39 A;  1FYK A;  3S15 J;  2LRE A;  4LK0 F;  4CA0 A;  2FBI A;  4FJ9 A;  1Y8Q B;  3RKX A;  3BOQ A;  2VJI A;  4FJI A;  2F48 A;  4UB6 C;  3CF2 A;  3S3N A;  2Q0O A;  5D8L B;  1S6L A;  4EJW A;  4CCJ A;  1BN5 A;  3ASO H;  2Y69 H;  1OCZ H;  3B73 A;  3CDI A;  3GFJ A;  3HSR A;  4YIR X;  2E1C A;  1QNT A;  2XGC A;  4UUV A;  4D1Q A;  3MCZ A;  3U1K A;  2Y0S N;  2DAO A;  3S14 J;  2KZG A;  2MAB A;  5E1Z B;  5FLX K;  4XLP F;  1XX5 A;  3NQO A;  2BY0 A;  3SVI A;  1IUF A;  3F9K A;  3ZQG A;  3OGM B;  4DZJ A;  2FYO A;  2CW0 F;  2K85 A;  1Q1V A;  4RL5 A;  5EG0 B;  4BHC A;  3LL7 A;  4CCK A;  3GZ6 A;  1TQP A;  2O5R A;  3OL4 A;  2CW8 A;  1K79 A;  3KCC A;  1TW2 A;  2QEX I;  2OPT A;  1E0E A;  3PUF A;  4M3B A;  3L2V A;  2BW3 B;  3S8P A;  4V2F A;  5LFA A;  2GWR A;  2EZH A;  3BG9 A;  3KP7 A;  1FLI A;  1N1C A;  2CV1 A;  3HM5 A;  4LIU A;  3Q9V A;  3K10 A;  4LG3 A;  3KFW X;  2V9K A;  3K4N A;  5C4X J;  1BBY A;  3DU6 A;  3H3U A;  2BVL A;  4YG2 F;  1KYW A;  4UV8 A;  2V4J C;  1EA3 A;  4M3D A;  4XLE A;  1IRX A;  4Q48 A;  1NTC A;  1OPC A;  1ZKG A;  4HSR A;  4A3B J;  1YW9 A;  3CCY A;  3FHZ A;  2F5V A;  1A6I A;  5LHI A;  1OIS A;  3IH2 A;  2OVQ B;  4RGU A;  3J81 K;  3MKL A;  1X1P A;  3SFZ A;  3TOB A;  2NS8 A;  4LMY A;  4L0Y B;  2CYY A;  1CF7 B;  2MG4 A;  4IHT A;  3TDZ C;  1MIJ A;  3KEY A;  3KX2 A;  5FD5 A;  4E3S A;  4M3T A;  1FY7 A;  2A6T A;  4HX7 A;  1JHH A;  3WG9 A;  2VN2 A;  3LAJ A;  4BUP A;  1GXQ A;  3NRV A;  2P5G A;  4BEH B;  4JRQ A;  2K4B A;  1H89 C;  2X51 A;  2Z5U A;  2JA6 J;  2MA3 A;  3L7W A;  4OIP F;  4B48 A;  3LWF A;  4CDG A;  3PNV A;  1SFX A;  3S1M J;  3BG5 A;  1WCM J;  2LK2 A;  3M1C A;  5EGO A;  4LB5 A;  3CP2 A;  1SVM A;  2LMD A;  2EIL H;  4RM2 A;  3E4W A;  4IQ4 A;  3CO7 C;  3HIF A;  5FKL A;  2EZI A;  1FYL A;  4H0E A;  1ZRD A;  3KEQ A;  4LLN A;  4XRS G;  3CCR I;  2M45 A;  3WE2 A;  2K3P A;  3A01 B;  4M3Y A;  4L9J A;  4HZF A;  1Z77 A;  2DBB A;  4WCG A;  2R7O A;  4M9Z A;  1RIO H;  4QNC A;  2VQG A;  5JLX A;  5D5V B;  1MBE A;  1Z67 A;  1HKS A;  5EEG A;  2CFX A;  3U1D A;  3BR3 A;  2VBX A;  1WJB A;  1IUY A;  3F6V A;  4B1R A;  4XK4 A;  2ISY A;  4M72 A;  2V7F A;  1XMF E;  1NH3 A;  3T0Y A;  4DOZ A;  5BMZ A;  2H1K A;  4AKG A;  2HDC A;  2IAI A;  2W85 A;  3CMM A;  3VYR B;  3ABK H;  5EEH A;  5M5Y J;  2R5Y B;  4K2E A;  4A6E A;  3WG7 H;  1WAF A;  3M07 A;  3RMC A;  2STW A;  2PJR A;  4NHJ A;  2A07 F;  2FNA A;  3QPS A;  5GPC A;  3GLL A;  2IA0 A;  3IRR A;  1KYZ A;  2M1B A;  3FMS A;  4BY7 J;  3ROU A;  2BY2 A;  4G7H F;  4B8X A;  4LD5 A;  2K9Q A;  2KP6 A;  4BQO A;  1Y1W J;  1W4M A;  2JSC A;  2M7B A;  2EWN A;  5CYV A;  2NXN B;  1OCT C;  2ME6 A;  1JTX A;  3HGG A;  3BQZ A;  1N77 A;  3JAM Z;  2B7E A;  3LDB A;  1KU7 A;  3PUB A;  4KIT B;  4II2 A;  3FMR A;  3CCS I;  2JPB A;  3B6A A;  3TO7 A;  3FM3 A;  2DFH A;  2L4M A;  4FJ5 A;  4H4K C;  2VUM J;  1MBJ A;  4IHW A;  4FT8 A;  4R1H A;  3WGH A;  3HOX J;  4PCQ A;  5B1A H;  2XGX A;  2LH9 A;  3ERE D;  4RB1 A;  3A0B C;  4BGD A;  4PFO A;  4CZC A;  3H35 A;  1MMG A;  4QPQ A;  1MSE C;  4AI6 A;  3HOU J;  1D8J A;  3GYH X;  2W82 A;  2JTV A;  3SHF A;  2L4A A;  1YO5 C;  1FZ8 E;  1DGW Y;  4JX4 A;  1NG6 A;  2L7F P;  4I01 A;  2ETH A;  5LRS A;  3Q9S A;  5AIP A;  1FTZ A;  3RKQ A;  4GCV A;  4L9V A;  2NAZ A;  4M9S A;  1HDP A;  2YU9 J;  4A3G J;  1K4S A;  2QF7 A;  4GFB A;  5IYD J;  1ZAR A;  1XMA A;  3O8G A;  3JRB A;  3HOY J;  2P1P B;  1GLN A;  2IRF G;  2RQQ A;  2FML A;  1YW7 A;  1VQ8 I;  2L7Z A;  1T8I A;  5JVT A;  1S9H A;  3GTL J;  2V1D A;  2ZSI B;  2JHC A;  3C6N B;  1U0J A;  2MFZ A;  1BR1 A;  1MBF A;  4KI6 A;  3BR2 A;  2GXG A;  1HKQ A;  1T56 A;  2JHA A;  1JUM A;  4AD9 A;  3GO5 A;  4L5E A;  3SDB A;  4LIV A;  2R5Z A;  2P5V A;  4IO9 F;  3P9K A;  4M3Z A;  3WHB A;  3BZK A;  5BNG A;  2ISZ A;  2Q2E B;  2KZV A;  2VBW A;  5HVQ C;  2HPI A;  4Y4R A;  1WVR A;  3TL8 B;  1Z6R A;  2GXA A;  2KL4 A;  1YS6 A;  3B6C A;  4MHG A;  4J2E A;  4IRI A;  2P5O A;  1ZRF A;  3E3V A;  3EQL F;  3JRG A;  2DT5 A;  3J27 A;  3W6V A;  3AG3 H;  4IL6 C;  1JGG A;  2MW8 A;  4LLL A;  1SVL A;  2ZME C;  4RB0 A;  3WTW C;  2VJ4 A;  3CF5 F;  5KAI C;  1GV2 A;  4LG0 A;  1KU3 A;  5B5E C;  2ZME B;  4KMF A;  4Z2Y A;  3LFK A;  1LUJ B;  5LHH A;  4XKB A;  2XSJ C;  5IT9 Z;  2P7V B;  4A69 C;  2IGO A;  2WY7 Q;  2VKV A;  4XKV A;  1U6G A;  2H09 A;  1IV6 A;  2VT3 A;  3FKJ A;  2NS0 A;  1IN6 A;  2OUM A;  4EM0 B;  3LMM A;  1MJB A;  3I4M J;  3HDD A;  4HNT A;  2XSD C;  3H5A A;  1YQA A;  4JX5 A;  4UVC A;  3VWB A;  4S04 A;  1APL C;  3GUD A;  3U9G A;  2MLK A;  2Z2S B;  3RTR A;  3OGK B;  4XOT A;  2TCT A;  2L0K A;  1G4D A;  3L0M A;  4CIC A;  2QSF X;  1G6N A;  3LD8 A;  5CPR B;  4BHB A;  1QU3 A;  1Z9C A;  1KU2 A;  4UUS A;  3E5X A;  5DD8 A;  2VKE A;  3F8B A;  3FXL A;  2VAS A;  5DYM A;  1HF0 A;  5JLW A;  1I27 A;  3QP5 A;  3J80 K;  4G7O F;  2MGQ A;  2OF7 A;  3QPL A;  4AYB A;  5F1J A;  1SFO J;  3O6B B;  2OV7 A;  4NBQ A;  5HOD A;  4PGG A;  1UFM A;  3NDK A;  4E7J A;  3NHG A;  5ERI A;  4F92 B;  3V7R A;  2W57 A;  2HKO A;  2X4H A;  4B4C A;  3IKT A;  2B8I A;  4HCB A;  2RC4 A;  4I6Z A;  2KIU A;  3DWL E;  2E7W A;  2P4W A;  4NC7 A;  3A4C A;  1X1C A;  2HVQ A;  3BG7 A;  2IPQ X;  2XDV A;  2O7O A;  2GIZ A;  3L09 A;  2ZCW A;  3FM5 A;  2WBM A;  3H3V K;  2WC2 A;  2VB6 A;  1YS7 A;  3E6B A;  2K5S A;  2HZD A;  3NEU A;  4EJV A;  1ZHF A;  3UR3 C;  3ZQH A;  4DBQ A;  2QBY B;  3UKG A;  3WHC A;  3GCM A;  4B08 A;  3S1Q J;  2M9H A;  4RAF A;  5HLH A;  4F93 B;  4J00 A;  2E7X A;  2IP2 A;  4DTJ A;  1OKR A;  2DDB A;  2DYS H;  3I53 A;  5DD4 A;  3S16 J;  4WXH A;  2X6Y A;  2CFO A;  2XV4 S;  4V19 K;  4HCC A;  1T0F A;  4A3L J;  1EV7 A;  3ELK A;  4A5N A;  2G0E A;  2CQQ A;  4A3E J;  4DU4 A;  2KDO A;  1BC8 C;  2YUS A;  2DT7 B;  2JT1 A;  3F8C A;  1IDZ A;  2P6S A;  1MMN A;  2EA2 A;  4I98 B;  4FTH A;  1TC3 C;  3DBH B;  1D0Z A;  4L5I A;  4N0B A;  4I9L A;  3I58 A;  2XB0 X;  1ZG3 A;  4EP9 A;  2EH3 A;  1USS A;  2EQR A;  1LVA A;  2HS5 A;  3ZN1 A;  3IKV A;  2EJR A;  3SEQ A;  5GAH J;  3C18 A;  3TP0 A;  1V54 H;  3JSP A;  3FBI B;  1DQU A;  2VOD A;  4CZZ A;  3QYF A;  2V1N A;  1Z7U A;  1NK3 P;  1FZ4 E;  3HKZ A;  4FIS A;  1T6S A;  3RI4 A;  1VF9 A;  4B3A A;  2V6E A;  1MHZ G;  1K78 A;  4DTM A;  4BL0 B;  2P0W A;  3ZPL A;  1AHD P;  1FOK A;  4M73 A;  4D5C A;  1BW5 A;  3VPR A;  1LEB A;  3CCU I;  1B72 A;  4AWX B;  2AXL A;  3J7Z I;  2LF6 A;  3O8H A;  2W84 A;  3BPV A;  2Z3Y A;  3ZR8 X;  4HF2 A;  3SPY A;  5K7Z A;  2CWE A;  1YIO A;  3HOV J;  3R4K A;  4Y3O A;  3K70 D;  4HW0 A;  2VBZ A;  5DV5 A;  3HGY A;  4C9Y A;  1XMK A;  1OYI A;  2FU4 A;  2P6T A;  1XCB A;  1MMO G;  2ZJ2 A;  3QNN A;  2BGC A;  4G12 A;  4JBA A;  2CJJ A;  2BE5 F;  4MEY F;  1WSU A;  1UHS A;