2RKHA

Crystal structure of a putative apha-like transcription factor (zp_00208345.1) from magnetospirillum magnetotacticum ms-1 at 2.00 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
164
Chain Sequence
TLTPKEAVRLCALGTIASQPMRYSELAGSVRHFTSRIMGPSLELMGISIELLRYEGLVEAVDAMLAISAAGRRELHSLLTARLRPGSDLSKLVVALKMRFLGLMEAEERAHQIDLLIEGVDSELARLADLRGGEGGSALAAWLDHDMALLESRLAWLEDFRARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative AphA-like transcription factor
publication title Crystal structure of a putative AphA-like transcription factor (ZP_00208345.1) from Magnetospirillum magnetotacticum MS-1 at 2.00 A resolution
rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Transcription
total genus 49
structure length 164
sequence length 174
ec nomenclature
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rkhA01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 2rkhA02
2Q2EA 4EM0B 3F6VA 1U5TC 5HDGA 5H6RA 2A3SA 1FOKA 3UO2A 5FO5A 1ZGJA 3QU6A 4CZZA 2M1BA 4HYEA 3IKTA 3MZYA 2YSRA 1G3TA 5CVRA 1LDJA 4A6EA 2BE5F 4S04A 3DFGA 3LAJA 4PGHA 3GFIA 3KLNA 4HX7A 3GF2A 4G8XA 3I64A 3P9KA 1T38A 1FPQA 3F6OA 1G3WA 1HBXG 1KGSA 5LBQA 1RUOA 1XB4A 3HRMA 1XMAA 2O61A 2P5LC 2O6GE 1IZ1A 1BBYA 1VTNC 1YYVA 4U7DA 1BC7C 4BHCA 1Y0UA 3SQNA 1S7AA 1FP1D 1I6XA 1B6AA 2HYGD 4MEYF 3L2CA 3WGGA 2FBHA 1SFEA 3HIFA 1PDNC 3WGHA 1QZZA 2ZXJA 1FT9A 5FB2A 3QOPA 1ZG5A 1BI1A 4UUVA 3RYPA 3KP4A 2UZKA 2MC3A 2GIVA 4U0WA 5CLSA 3BY6A 2QZ8A 1IN7A 2P5VA 3CLOA 2V9VA 4QWQA 2KJCA 1H9TA 2KKOA 2CSOA 1DPUA 4HA8A 3KP3A 3EETA 1XMKA 4O3MA 5EEGA 3RJPA 1HSJA 4WXCA 4YIFA 4IRGA 3RKXA 2EFQA 3S2WA 1CF7B 4AIKA 2B0LA 2GZWA 2XROA 4OIRF 3E6DA 1ZRCA 4N0BA 3BOQA 2K4JA 3BWGA 4ZH4F 2PMUA 3JTGA 3E6BA 2FA5A 2XAJA 5L3FA 1T0FA 4NHJA 2ESNA 4HAMA 2CO5A 2CWEA 2ELHA 3DPTA 3F22A 5HVQC 5D4SA 2ZNYA 4PDKA 3IL2A 3I4PA 2A6HF 2VBZA 2JT1A 2LKPA 4Q47A 2DBBA 4KDPA 4KIGA 3ZN0A 5E1XA 3JAMK 2FSWA 4LD5A 1G4DA 1XSVA 1F5TA 1B59A 2D1HA 2RKHA 2VE9A 2CYYA 1KQ8A 2XKPA 5L3DA 2V1UA 1BI0A 3NEUA 2E7WA 4R1HA 4KMFA 3CDHA 1BOAA 3HSRA 4EJOA 1D8KA 5FLXZ 3QPTA 2RV8A 4WCGA 1YG2A 4HV6A 3VOEA 5HLIA 5AIQA 4ZZLA 3NQOA 1T39A 2ZMEB 4G94A 3KP7A 4HLXA 4L9TA 5E17F 2UXXA 5J8CA 2FNPA 4JQFA 5CJ9A 2QENA 3WTUC 5K5QA 2HYFA 3BVOA 2RDPA 4YFNF 1LQ1A 2M8EA 1Z05A 2VOPA 1BC8C 2G7UA 2HTJA 3BP8A 2XASA 1FYKA 1YS7A 3MCZA 3IRQA 1SFXA 4IXAA 1J75A 2NYXA 1MJAA 2H94A 2DFIA 5HS9A 1HKSA 4A0YA 5TRDA 1Z9CA 4HF2A 3LA3A 4ON0A 2MH2A 2COMA 3I59A 4IF4A 2DK5A 4XLPF 3LA7A 4F7ZA 4MEXF 3T0YA 3EUHA 1O7FA 4I0AA 4L5IA 5JR3A 5LGTA 3RI4A 1J0RA 2YPRA 4I02A 1FY7A 1R7JA 4MHGA 2O8XA 1SAXA 2IVMA 1KU3A 1G6NA 4G7HF 3P9IA 1UFMA 1KA8A 4EQQA 2P6TA 1WKMA 3FX3A 3WTYC 4HBLA 2HFHA 2GA1A 3QP5A 5HLGA 2L3DA 3G73A 1ZLKA 1CGPA 3E5QA 2QBYA 1O57A 5LEKA 5K5RA 3TDZC 3D5LA 3DP7A 3VODA 3R0AA 4HQEA 2QM3A 5DDGA 4BXUA 1S29A 3C1DA 4LG0A 4P96A 3LQQA 2Z5UA 2A61A 3DEUA 4G6QA 4BHPA 4U0YA 1QGPA 3EYIA 4IRIA 1IF1A 3ZMZA 2FU4A 5DD8A 2XAQA 2E7XA 2PEXA 3ULQB 1HKQA 5ILVA 2Q0OA 3GEZA 4TV7A 5D8KB 3RTRA 1B1BA 2F5FA 4XBFA 2IW5A 1TQMA 2NAZA 3LQRA 3K1MA 2E1NA 1ZRFA 1T98A 4A5MA 4Q5SF 1UHWA 3WGIA 4KUMA 3CUOA 4IJAA 3K1PA 1ZGAA 2QQ9A 1HW2A 3SFZA 2CGPA 2NNNA 1MD0A 3E6CC 1TNTA 3H3UA 1X3UA 2FOKA 1I5ZA 3L09A 1RUNA 3F8NA 3HRUA 1OYIA 1SD4A 1XDSA 1FSHA 4M9ZA 2R7FA 1U8RA 4ZYGA 4ETSA 4I09A 5FGMA 1XN7A 4A6DA 4KNYA 2FRHA 3I5UA 4EGYA 2V1XA 1A04A 2EWNA 1KU9A 3QU3A 4WX9A 2O03A 4I7HA 3J7AO 3B73A 4LLGF 4YFXF 1LDDA 2JPCA 3BJ6A 2EV5A 1U5TA 4G7ZF 4BHBA 4IPAA 5L3EA 2TDXA 4ENNA 4LGWA 4ASNA 2Y0MA 1HW1A 1N1CA 4OIPF 2DTRA 4HV5A 1FPOA 5DEQA 3L00A 5D5XB 3HHGA 4AIHA 3M9AA 4PCQA 3T5XA 3K0LA 3GXOA 1ZLJA 2W57A 3TDUC 1YW8A 1TW3A 4WWCA 4XSXF 4RGXA 5IT9K 1P92A 3REOA 5LHGA 2L4MA 1HSTA 2VC1A 3WTVC 5KK1A 1RI7A 1P4AA 3MFKA 1W7PB 5LEJA 3T1BA 1RZ4A 2ETHA 3H92A 4ESJA 1R1UA 2DI3A 2FE3A 2EB7A 3PFIA 1YW9A 2A6EF 2M87A 1O3QA 2O3FA 4L5JA 2L54A 2PFBA 4IHSA 3HRSA 4ZZDA 3L7WA 3AAFA 2ZKZA 3QP6A 1Z1DA 1KU7A 2PI0A 5HDNA 4KT5C 4RAZA 1WWXA 2ZO4A 3ZMDA 1PP7U 5D5WB 2H6BA 5ICGA 3JAMZ 4IVNA 1MGTA 4O5VA 2F5CA 2Q8KA 3WE3A 1UCRA 4M9XA 5D4RA 2MD5A 3TOBA 1K78B 1U2WA 1B9NA 1FZPB 4KN7X 1JE8A 2UWMA 3R6SA 1K6OA 2CG4A 1XD7A 3M7GA 3GWZA 4NQWA 3CUQA 2V1DA 1FBUA 1IRGA 2NRAC 1S8NA 4HW0A 4HZFA 3PQKA 3MEXA 3ZQ7A 5EEHA 2STWA 1BIBA 3U2RA 2WC2A 4AWXB 4EJTA 5CVJA 3DXJF 2VODA 1MJ9A 2QVOA 3TGNA 3ZMUA 2BV6A 1XGNA 2F2EA 4M6YA 2OQGA 2OBPA 4M73A 3TO6A 3LA2A 2CFXA 2DLLA 2OA4A 3HSFA 1K79A 2ZBKA 2D45A 3DQVC 2JZYA 4N9HA 5DCMA 2KJBA 5JI6A 3W6JB 1BI2A 5J6XA 1U78A 1LEAA 2RC4A 3F72A 4AIJA 2BGCA 2OAZA 2XAGA 4G7OF 1LDKB 5TJJA 1F4KA 5LHHA 5LHIA 3HOTA 4HOBA 6PAXA 4WXHA 4RB2C 4S05A 5JVTA 2OQRA 1YFHA 3F8CA 3R4KA 4UVCA 4P5OA 1YQAA 3V7RA 4GO1A 1GXQA 2KRFA 3M8EA 2JSCA 4PZJA 5D5UB 2MH9A 2VE8A 1ZRDA 3DV8A 3U1DA 3JSPA 1R58A 4EJWA 2OZUA 3T8RA 1HKTA 3FM5A 3ABTA 2VN2A 3ZN1A 1T6SA 3HSEA 5LGNA 4EJVA 2KIUA 2ZCWA 2D1VA 3KP6A 1IXRC 5F64A 1MDMB 1LEBA 4WXDA 1G3SA 3QPHA 4B8XA 3O6BB 2IJLA 1GXPA 1U6GA 3OOPA 2BEOA 1QZYA 3GVAA 3LAPA 4HQMA 3CTAA 2K4BA 2UXNA 3GW2A 3GZ6A 2RN7A 2ADUA 2YU3A 2M30A 1B9MA 2LSOA 3FF5A 1YIOA 2BBYA 2HEOA 3BDDA 3ROUA 4LFUA 1WRJA 1SMYF 1TLHB 1FLIA 2EA4A 3NRVA 1F9NA 3SZTA 1QPMA 1OPCA 2CQKA 4R79A 3C3WA 4I0BA 1BN5A 1UHMA 1IUYA 4O6JA 3E5XA 3FXQA 3I0TA 3CO6C 2DO7A 3GO5A 3LFKA 2WWYA 2M5WA 3V7SA 1FSEA 2JTVA 5L3GA 1JHHA 4KIBA 4EVIA 3I71A 5LLQA 4I2OA 1BM9A 2A69F 1UB9A 1R00A 4A2UA 1LJ9A 3IHUA 1QO0D 2DPUA 2K02A 3HTUA 2HWVA 4Y15A 1ZH5A 1P6RA 4WF2A 3R60A 1XCBA 2X0LA 2GXGA 1JHFA 3JW4A 3ZPLA 4B09A 4GGGA 3EQLF 3WTWC 3KETA 1DP7P 2W84A 3K2ZA 3ISPA 4YG2F 5AONA 1HQCA 5ILUA 2QQBA 4CXFA 2VOOA 4P55A 4K2EA 3J80K 1JGSA 4R8HA 4MQVA 1KYWA 1R36A 4OMZA 1TQPA 4LMYA 2FMYA 1WI9A 3TKYA 2ISZA 4H0EA 1ZG1A 2YX7A 1IN5A 1DPRA 3WG9A 4ENKA 4GYIA 2CW0F 3G3ZA 2Z33A 2IT0A 3LSTA 4G9YA 2HZTA 3TO9A 2IRFG 4LJZF 1TBXA 3UO3A 3GX4X 5K1YA 1IXSB 2C6YA 2E1CA 2RNJA 3HTSB 2DU9A 5CVIA 4ZYEA 2L4AA 2XGXA 2LNBA 1BI3A 2P6SA 1FP2A 4XLNF 4OINF 2FMLA 2EA2A 2Z99A 1ZYRF 1IRFA 4DQ2A 5IT9Z 3B02A 4MNUA 1ZREA 3U9GA 5ERIA 4DNCA 2J5OA 3DKWA 2NS0A 4RGRA 4AVPA 5FFXA 4OU0A 5HS7A 1AWCA 1NHAA 3FXUA 1GHCA 3WTZA 3KZYA 4YIIA 2MLKA 1IN8A 2K86A 2AS5F 3E6MA 2AXLA 5CVUA 4GYGA 5BOXA 4Q4ZF 3V8JA 2ACJA 2H27A 1J5YA 3SZPA 3ABUA 1YO5C 3KCCA 3BPXA 3QRFF 1PP8F 1ZAOA 1ZARA 5LRRA 3WODF 3CO7C 2HS5A 1W7PD 4RAYA 3JSOA 5BPDA 2JRTA 3Q9SA 2A07F 4HX8A 5ILSA 2HKXA 3KFWX 2W25A 3ERED 1I1SA 4LK1F 4I98B 2Z9OA 2EV0A 3EYYA 4LLNA 4A12A 2ZFWA 1KQ9A 3I58A 2LDUA 5DUIA 5JFRA 3DF8A 4P9FA 1OKRA 1OMIA 4EM1A 1SD6A 1B4AA 4MTEA 3RYRA 1H0MA 5D5VB 4OOIA 1S6LA 2R7DA 4ESBA 2QYOA 4HLYA 3M8FA 2HOEA 4PGGA 4UV9A 1ONVA 1DDNA 1XSXA 3BJOA 5LRSA 1USTA 4UV8A 3C18A 5DUKA 2PN6A 3KLOA 4IRHA 1CF7A 2HQNA 1TNSA 1O3TA 3IKVA 4HF0A 1R22A 3I59B 5FFZA 3SXYA 4I01A 3J81K 1BIAA 3DPLC 3LWFA 1USSA 1YW7A 1IW7F 2L02A 1QQIA 4P9UA 2HQRA 1R23A 3E3VA 3ZP5A 2EJRA 1OYYA 1FC3A 2H6CA 1LVAA 2PLYA 4L0YB 2IPQX 5H20A 4BNCA 4LB5A 2ISYA 2KIFA 1SD7A 2QBYB 3GFLA 3MAJA 4EGZA 1P2FA 1WSUA 5E18F 5A2QK 3SHFA 1I27A 2RVCA 4CICA 4RB1A 3F8BA 1KYZA 2Y75A 5ICEA 4E70A 4LG0B 1KU2A 3E5UA 1XDUA 2W24A 4RGUA 5IT3A 1K7AA 2QUFA 2V6CA 4M6XA 4RB0A 2MA3A 5H6QA 1JXSA 3L9FA 3I54A 2HKOA 4OMYA 1T2KA 2PBIA 1D8JA 4L0ZB 1QBJA 2ZMEA 5DYMA 2F5DA 3RPUA 2XAHA 3GLXA 3HUGA 4JK1X 3FMSA 3GUDA 4N9IA 1E17A 2IA1A 1HXDA 3IWZA 5HOOA 2NNYA 3V7CA 5F1RA 2L01A 3M1EA 1W5TA 1GVJA 1TW2A 1IN4A 4M72A 5E1ZB 1AOYA 3KEOA 2RGVA 3FMRA 1SD5A 4WK8F 3GZ5A 2HGCA 1EV7A 1ZG3A 3FWEA 4BAYA 4LK0F 2ZJ2A 2FF4A 1R1VA 2JPBA 5ICCA 3FHZA 2OU2A 1E2XA 2FNAA 4OIOF 3D0SA 2EK5A 3K69A 4FX0A 1U5TB 1Q1HA 4ENMA 1SMTA 3WU1B 1FX7A 2GXBA 3K1NA 3MZHA 1MKMA 2Y48A 2LF7A 2A68F 3IRRA 3FZVA 2ESHA 3J80Z 3WTSC 3VFZA 2OZ6A 2P5KA 5AIPA 1FYLA 1IAWA 4XSZF 3P7NA 3O2PE 3CUQC 2DQRA 5CVVA 1WQ2A 2DT5A 4EJUA 3H3ZA 1ZHFA 1LNWA 3MWMA 1FWZA 3ZMTA 4U88A 1TQIA 5LGUA 1XGOA 1O3SA 2DW4A 3PQJA 1U3EM 1P4XA 4CHUA 3KP2A 4M74A 3VEPA 3TOAA 3W6KB 1R1TA 5D6FA 1EH8A 4IT5A 2PG4A 3WTXC 1QNTA 1RIOH 2Z3YA 1W5SA 5FD6A 2VXZA 3FMQA 2M45A 3K9TA 1IN6A 4KN4X 4A5NA 3COAC 4UVBA 4KYWA 4A0XA 2HDCA 2XKOA 1YS6A 3O3KA 5L3BA 4NB5A 3HHHA 5HDKA 2P8TA 2P4WA 3FM3A 2BYVE 2P7CB 4L9NA 2XHKA 4GXOA 5BS6A 2PQ8A 3BJAA 5J8FA 1J7KA 3JTHA 2VBWA 2O0YA 3RKYA 2X4HA 2VONA 5FD5A 3ELKA 1F1ZA 3WU0A 1L3LA 1R5HA 1ON2A 5E1WA 3QAHA 5BPIA 4LB6B 5K5OA 1OR7A 1KQ0A 5BQTA 3MQ0A 2K7LA 3ECHA 3TO7A 3KEQA 4JBAA 1ZN2A 4FHTA 2R3SA 2D2WA 1BJAA 4EM2A 4BH9A 1FNNA 1EH6A 5DD4A 4ZYDA 2DAOA 2XRNA 1XCVA 1XGMA 3CUQB 2FBKA 4U0VA 4ZYHA 5HS8A 4RS8A 2H09A 2XUBA 5ED4A 3GFMA 3FXRA 5E8IA 4ESFA 4M9SA 2HR3A 2GQQA 3BROA 3ZMSA 2VT2A 3Q5FA 3E97A 2PJPA 1H9GA 1J2XA 3F21A 1I1GA 4HX4A 3KE2A 4CYDA 3F8FA 2FBIA 2QWWA 4UNOA 1ULYA 1P4WA 3CJNA 4Y13A 2W85A 2GA2A 5E8GA 4RB3C 4HDUA 1IXCA 4FT8A 3RKWA 3R61A 4UXNA 4KICA 5DCMB 2MBFA 1W7PA 3V8KA 4KA4A 2G9WA 1S3JA 4CDGA 5D6EA 4A0ZA 3KZZA 3ML6A 3RDIA 2FXAA 4HDVA 3J81Z 4BQAA 3N97A 2DK8A 1J9IA 1Z6RA 2EFOA 3HOSA 5L3CA 4EMSA 1XGSA 2G7HA 2STTA 2WTEA 3BPVA 2FEZA 1C0WA 1R5GA 3KP5A 4GCVA 1MZBA 5BMZA 1ODDA 4FX4A 3BZ6A 1STZA 2VBYA 4YFKF 4RGSA 4KIFA 2FQ3A 5HLHA 3ZMVA 1D3YA 5A2QZ 1DUXC 4LLLA 2MLGA 3GYHX 2EFPA 2EV6A 2YX4A 3F23A 3C7JA 1K78A 2IP2A 1G3YA 3ECOA 5FLXK 4M71A 4CO8A 2IA2A 2EFWA 2VBXA 4KMUX 4U7BA 3RIRA 4KFCA 1Z6TA 1V4RA 3VB2A 2QQAA 2WV0A 2IA0A 1L0OC 2A5YB 3OV8A 3N4MA 1J59A 4D0PA 2XIGA 1LB2A 1EH7A 1O7LA 2P7VB 1FYMA 4AD9A 2LF8A 2QLZA 1RNLA 4HF1A 1YLFA 3I53A 2XV4S 4QLCU 2RQPA 2VC0A 5CYVA 2HTSA 1OYWA 4Q48A 5D8LB 3TQNA 1PUEE 4CGZA 3R0JA 1TTYA 1REPC 2VT3A 4L9VA 5F6FA 1ON1A 4EV0A 1HW5A 3V8LA 3IWFA 2GWRA 3HRTA 4G6DA 4ENJA 1SFUA 2V79A 1D5VA 1W4MA 3Q9VA 4MTDA 2EFNA 2F5EA 4UVAA 3F8MA 3RPQA 1YTYA 1Z7UA 3HYIA 3WE2A 3V4GA 3EDPA 5JHUA 5E20A 4L9JA 4MQ9F 1FBQA 2K27A 2J5PA 4OIQF 2ZNZA 3F3XA 3WTTC 2OD5A 5DCFA 2YR2A 4BYYA 1S7OA 4UHTA 4MGRA 4L18B 4Y17A 4XRFA 3T8TA 2DPDA 1XSDA 2PMHA 3IC7A 1O3RA 3P9CA 1MJBA 5DV5A 2XVCA 1Z91A 2XAFA 4IHTA 4Z2YA 1FBSA 2DQLA 1MDMA 3GFJA 5ICFA 5KVRA 1V3FA 2GAUA 2KIMA
chains in the Genus database with same CATH superfamily
2Q2EA 2M0MA 4EM0B 5KCMA 2P1QB 4PSXA 3F6VA 1U5TC 5HDGA 5H6RA 2A3SA 1Q9YA 1FOKA 3UO2A 5FO5A 2A6TA 3CQZJ 1ZGJA 1YJNI 3QU6A 4CZZA 4F93B 2M1BA 4HYEA 3IKTA 3MZYA 1OCPA 2YSRA 3I4MJ 2B63J 1G3TA 3AG1H 2DDAA 3QPLA 1ZELA 1TWHJ 2TRTA 5CVRA 3ABMH 1LDJA 4A6EA 5IYDJ 3HPHA 1K61A 4CCNA 2BE5F 3S14J 4S04A 3SUPA 3DFGA 3LAJA 1FMVA 2KRHA 4AM3A 4PGHA 1MMOG 4E7SA 1SVLA 3GFIA 3K6GA 3KLNA 4JX6A 1W1WE 2JN6A 3L1PA 3MKSB 4A93J 3SUNA 3RZOJ 2M4GA 4HX7A 1JJ8C 3GF2A 4G8XA 4DTRA 3I64A 2K9SA 3P9KA 1T38A 1FPQA 2W1OA 4V19K 4A3EJ 3S17J 2AQFA 4IQJA 1WJDA 3F6OA 4EYWA 1G3WA 3L8BA 1X1AA 3CCLI 1UHSA 1HBXG 1KGSA 1X1DA 5LBQA 1FZ7E 2M7BA 1RUOA 1XB4A 4DTPA 3HRMA 4OAYA 1XMAA 3CFOA 2O61A 2P5LC 1R5ID 2O6GE 1IZ1A 1BBYA 3HGLA 3A02A 3ABLH 2LD5A 2DFFA 3CP8A 3C6NB 1K4SA 1MMGA 3BZKA 1VTNC 1YYVA 4U7DA 1LE8A 5GAGJ 3PNYA 2VQGA 1Z21A 1BC7C 5EJCA 2KP6A 3MD2A 4BHCA 1Y0UA 3SQNA 1IJWC 3BC8A 3PIOF 1S7AA 5FROA 1FP1D 1I6XA 3OYKA 1B6AA 2GOXB 2NS8A 3ZCOA 5EF6A 2P81A 2HYGD 4MEYF 2HOTA 3L2CA 1BR4A 4IO9F 3WGGA 1R49A 2FBHA 1SFEA 5J1UA 2KZGA 3HIFA 1PDNC 2WA0A 3HL2A 2GOMA 1WAJA 3WGHA 1QZZA 2ZXJA 1FT9A 3K10A 1RC9A 2Y9ZA 1GV5A 1MBFA 1V5FA 5FB2A 1ZGWA 3QOPA 1ZG5A 1BI1A 2WAEA 5FJ8J 2DN0A 1JKOC 1GV2A 1XC5A 3TP3A 3SPYA 2BVMA 4UUVA 4FJ5A 3RYPA 3HG9A 1ENHA 1SVMA 3KP4A 3JRAA 2EBIA 3PSFA 2VJIA 2UZKA 2MC3A 4ZJZA 2GIVA 2OYQA 5FKMA 4U0WA 3BCAA 3GTGJ 5CLSA 3BY6A 2VQHA 4XKBA 1RESA 2JH9A 3BR3A 4DBQA 2FYOA 3M4OJ 2CV0A 3M07A 2QZ8A 1IN7A 2P5VA 5IY5H 3CLOA 3A4CA 2V9VA 4QWQA 1TZLA 2KJCA 3W2AA 1FZ5E 3CFPA 3QEIA 1H9TA 4XLFA 2KKOA 2ECBA 3OL3A 2CSOA 2HQAA 4XLCA 5F27A 1DPUA 2L2OA 3IH2A 3EPZA 1V55H 2FUG2 2MW2A 4HA8A 3KP3A 2VJ4A 3SQ0A 5F04A 3J7ZI 3EETA 1A35A 1XMKA 4O3MA 3S16J 1TWAJ 3FBNB 5EEGA 3RJPA 1HSJA 2JMWA 3OYBA 1T8IA 3TMOA 3HKZA 3LOCA 4WXCA 4E6KG 4YIFA 4IRGA 2OV7A 3QERA 3RKXA 2EFQA 3S2WA 5JHFA 2LBFA 4X5MA 1CF7B 3JREA 1IV6A 4AIKA 2B0LA 1EKEA 2GZWA 2Z2SB 2XROA 4OIRF 1ETKA 4DTJA 4RAFA 3E6DA 4BGDA 1OQYA 3VPRA 2DTZA 4N0BA 1ZRCA 3BOQA 3S1MJ 2K4JA 1OCTC 3BWGA 4ZH4F 2PMUA 3SDGA 4DYRA 4GRIA 3JTGA 2UUZA 3E6BA 2FA5A 2CQ7A 2XAJA 5L3FA 1T0FA 1VQ8I 1ZK8A 3CD6I 4NHJA 2ESNA 4W97A 2EZLA 4BBSJ 2JQ7A 2ICWG 4HAMA 1RKTA 4RLQA 2CO5A 2CRGA 2CWEA 2FX0A 2ELHA 3DPTA 2QXFA 1EJ9A 3F22A 5HVQC 2OVPB 5D4SA 2ZNYA 2HXOA 2X48A 4PDKA 3IL2A 3I4PA 3F0CA 2A6HF 2VBZA 2JT1A 2AHQA 2OVQB 2LKPA 4Q47A 2DBBA 4XL9A 2IXSA 2COBA 3AKZA 4AKIA 1Y8QB 4KDPA 4I6JB 2H1LA 4J2EA 4IZZA 1P22A 4KIGA 4DTUA 3ZN0A 1W5CC 5E1XA 3JAMK 2FJ1A 4CUGA 2FSWA 1MMAA 4LD5A 3OYMA 1G4DA 3PJRA 3HOWJ 3QWLA 1MBJA 3OYLA 1XSVA 2R7ZJ 1FZHE 4F3QA 1FZIE 1F5TA 1HA8A 2P5GA 1B59A 2JH8A 4S0HB 3S3OA 4ZTJA 2D1HA 1PVEA 1X2NA 2GBYA 2VPRA 1BW5A 2RKHA 1WCMJ 5DS9A 2VE9A 3SNNA 4C2TA 2CYYA 1KQ8A 4CCKA 2XKPA 2V4JC 4JX5A 2EIKH 2P0WA 2R7UA 5L3DA 2V1UA 2KDZA 1BI0A 3NEUA 2E7WA 5GTIC 4RDUA 4R1HA 3LNQA 3ONQA 4KMFA 3CDHA 1BOAA 4LIVA 2R0QC 3HSRA 2L5QA 4EJOA 1P7IA 4D5CA 2QCOA 3JRIA 4BJ6C 2FD5A 3OWTA 1VQNI 4AU7A 1D8KA 5FLXZ 3QPTA 2RV8A 3HOZJ 4WCGA 4FJKA 2I8DA 1YG2A 5KNLA 2LLKA 5FRNA 4HV6A 1PJRA 3VOEA 1YHQI 3OOUA 5HLIA 4II3A 4BJ5C 5AIQA 4ABZA 4ZZLA 3NQOA 1T39A 1HF0A 3K2OA 4ADNA 4DTMA 2ZMEB 5EZHA 3RKQA 2E2IJ 3HUGB 1YI2I 2MD0A 4G94A 3G6EI 2Y0SA 3KP7A 3QYFA 3PIPF 4MLOA 4HLXA 4L9TA 5E17F 2UXXA 3CDLA 5J8CA 2FNPA 4JQFA 1Q1VA 4B08A 1WJEA 5CJ9A 3TL4X 3NWTA 2QENA 3WTUC 3EUKL 5K5QA 2HYFA 3BVOA 2LKXA 3A0BC 2KL4A 2RDPA 5HLTA 3LSHA 2NOGA 1QHGA 4DW6A 4A3KJ 2R5YB 1RKWA 3K4MA 1N77A 4YFNF 4B44A 1LQ1A 3H3VK 2M8EA 2DOFA 1Z05A 2VOPA 1BC8C 1IO2A 2G7UA 2HTJA 3BP8A 5C44J 2XASA 2OVRB 1FYKA 4BBRJ 1YS7A 1UZCA 3MCZA 3AFHA 1S9HA 3IRQA 2B8IA 4AYBN 1SFXA 4IXAA 2P1MB 3M3YJ 1J75A 2LY2A 2NYXA 3JR9A 1MJAA 2JK3A 1A6QA 2H94A 2DFIA 5HS9A 1RETA 3SFIA 1HKSA 4A0YA 5TRDA 1Z9CA 3OIQA 4HF2A 4IEJA 3LA3A 4ON0A 1IRZA 4HPQA 3HGKE 2MH2A 2VKHA 1MBGA 2R7XA 2COMA 3I59A 4IF4A 2DK5A 4XLPF 3LA7A 4F7ZA 4MEXF 3T0YA 2LG4A 3W2WA 3EUHA 4M3ZA 1O7FA 4I0AA 4L5IA 5JR3A 4EEFG 4XOPA 4J2AA 5LGTA 2VLAA 1B72B 4KHSA 3GBGA 1J0RA 2YPRA 3RI4A 4I02A 1FY7A 2QQ8A 1R7JA 4MHGA 1OISA 2O8XA 2DA6A 1SAXA 2IVMA 3FXJA 1KU3A 4RA2A 3QETA 1G6NA 5J1RA 2IS2A 2BW3B 1TC3C 4G7HF 3RSNA 3P9IA 4A3DJ 2PFTA 1UFMA 1KA8A 4EQQA 2P6TA 1WKMA 3CMEI 3S3MA 3FX3A 3WTYC 4CCOA 4HBLA 2HFHA 2GA1A 3QP5A 3RQ4A 1ETXA 4V2GA 5HLGA 2L3DA 1ETQA 3G73A 1ZLKA 1SVOA 3IAM2 2X85A 2XSJC 2BHYA 1CGPA 3DTKA 1XMFE 3E5QA 3OYDA 4IOCF 3TBIA 3GTJJ 2QBYA 3ZQIA 1O57A 5LEKA 5K5RA 3TDZC 3D5LA 4B48A 1AU7A 4XNFA 3DP7A 2DODA 1VQ7I 3VODA 3R0AA 5DTDA 3L2OB 2VKDA 4A3LJ 4HQEA 1IRXA 2QM3A 1QRYA 5DDGA 1MW7A 4BXUA 4DYCA 1S29A 3C1DA 4LG0A 4P96A 3LQQA 2DDBA 2Z5UA 2NVUB 2K9QA 3SVIA 2A61A 5DM7F 3DEUA 4G6QA 1YJWI 3OGMB 4BHPA 4U0YA 2WY8Q 1YRNA 1QGPA 3EYIA 3OYFA 2LY1A 1IG9A 1S7EA 4PJMA 1AKHA 2B7MA 3GTOJ 4IRIA 2M2EA 2XB0X 1IF1A 3BG9A 4JP0A 4NNJA 3SCXA 2N8GA 3ZMZA 3GLLA 2FU4A 4PFOA 3AL0C 5DD8A 2XAQA 1G2HA 2IGMA 4M3RA 2E7XA 2PEXA 4M3EA 2LYCA 3ULQB 3SEZA 2R5ZA 1HKQA 1PUFB 4AUXA 2BVLA 5ILVA 2Q0OA 1LFPA 2QSFX 2DA2A 3GEZA 4IX7A 4TV7A 5D8KB 2JSPA 3RTRA 4HNUA 2JA6J 3LSGA 1B1BA 3S15J 2F5FA 4XBFA 5KHDA 4N4OB 3E1SA 2IW5A 1GVDA 2CUFA 1X1BA 1TQMA 2ZJRF 3GTLJ 2NAZA 4M3XA 3LQRA 3K1MA 1WAFA 2E1NA 1ZRFA 2VL8A 4M42A 1T98A 4A5MA 2YB5A 1NK3P 3KX2A 4Q5SF 2VXDA 1UHWA 4KUMA 3WGIA 1E3HA 2DFEA 3CUOA 3K1PA 1ZGAA 2QQ9A 4IJAA 4CSWA 1HW2A 3CC2I 3SFZA 2CGPA 2O9LA 2NNNA 1MD0A 1E0EA 3E6CC 1TNTA 3H3UA 1W0UA 3FK6A 4X5NA 1X3UA 5FLMJ 1X1CA 1LVKA 4EP9A 1RR7A 3SQ1A 2QEXI 4JRPA 2FOKA 1I5ZA 2Y69H 4J01A 5EGOB 3UKGA 2L9SA 4DYQA 3L09A 1RUNA 3F8NA 3HRUA 4P1WA 4OAZA 1OYIA 1SD4A 1XDSA 2AXTC 1XVCE 2IEKA 1FSHA 4M9ZA 2R7FA 2GLOA 1U8RA 4ZYGA 4ETSA 4I09A 4CZCA 5IP6A 3OYGA 5FGMA 1XN7A 5HNHA 4A6DA 2L9VA 1I6HJ 4E7IA 2FRHA 3I5UA 4KNYA 4DOZA 4EGYA 2V1XA 3FISA 4IL6C 3QYBA 1A04A 2EWNA 1KU9A 1Z77A 2CUJA 3QU3A 5IP7J 4F92B 1XVBE 1JUMA 4WX9A 3FIWA 3ABKH 2O03A 1SFKA 4KT6A 4FJNA 5GPCA 5EG0A 2XAUA 3OR1C 3QEVA 2L0KA 4I7HA 3J7AO 3B73A 4LLGF 2JA7J 5B1BH 1M1EB 2L7KA 2OC6A 4YFXF 1LDDA 2JPCA 1YX3A 4KHQA 3S1QJ 4NDLA 2DJIA 3U21A 1U0JA 2VJJA 2EV5A 3BJ6A 1U5TA 4G7ZF 2E19A 3OL4A 4BHBA 1Y1VJ 2JJ7A 4IPAA 5L3EA 2LFBA 3FXKA 1H8AC 2TDXA 4ENNA 4LGWA 4ASNA 2Y0MA 1HW1A 1N1CA 4OIPF 1QHHD 4Y4RA 2DTRA 4HV5A 1MH3A 4A3BJ 1FPOA 1VQLI 5M3MJ 2VODA 4CYCB 1R71A 2WBMA 5DEQA 3LSPA 3L00A 5D5XB 3HHGA 4AIHA 3E7LA 3M9AA 4RLFA 4PCQA 3TJYA 3T5XA 3K0LA 2X1CA 2XPVA 3KPHA 2IAIA 2EH3A 3GXOA 2K40A 4FASD 1HOMA 1FMWA 3HDDA 4JS5A 1ZLJA 2LH9A 2WAQA 3A03A 2DMTA 5F1JA 3DKXA 1ETWA 2W57A 4XK4A 2FW3A 4FJLA 4NC8A 1I39A 2EILH 4C3IJ 2X1EA 2VUMJ 4J19A 3LD8A 1XU3E 2DT6A 3CP2A 1RR8C 3C6PB 4F52A 4C30A 3TDUC 3CLQA 4Y3OA 1JTXA 2DEBA 5KAIC 1YW8A 4DTXA 1WJFA 1IDYA 1TW3A 2F4IA 4WWCA 3TAGA 4J2BA 5IPAA 4A3CJ 3BG7A 4XSXF 1BL0A 4RGXA 2A5WA 2LTPA 1SAUA 1X4PA 5HODA 5IT9K 1MMNA 4C3JJ 1P92A 3DBHB 3REOA 5FRMA 5LHGA 1FOXA 2L4MA 1HSTA 3B6AA 2VC1A 2CUEA 4PJJA 3WTVC 2MSYA 1RI7A 5KK1A 1P4AA 3MFKA 1MNEA 4UUSB 3DTIA 1W7PB 3T1BA 4E7ZA 5LEJA 3CJQB 3QPSA 1RZ4A 3OY9A 4E7KA 3HXLA 2ETHA 4FK4A 3H92A 4FE4A 4ESJA 4L5EA 1R1UA 3BTJA 2DI3A 2FE3A 3NARA 2HVQA 2EB7A 2RQQA 4KHUA 3PFIA 1YW9A 2A6EF 3G1LA 2M8GX 3A2KA 2VKEA 2M87A 1TWGJ 3ZR8X 1O3QA 2H1KA 2JRMA 2O3FA 4L5JA 3S1RJ 5C4XJ 1SANA 2L54A 2PFBA 4RM2A 1TWFJ 4IHSA 3H35A 1XG1A 2FOWA 3HRSA 4ZZDA 3O8GA 3L7WA 4M3YA 1ZTRA 3AAFA 2ZKZA 2K9LA 3Q0WA 1BA5A 1V5GA 3QP6A 3KYDB 4EPHA 1Z1DA 1KU7A 4FJXA 2DMPA 4IHXA 5C4JJ 2PI0A 5HDNA 3NAEA 4IQ4A 4KT5C 2JHAA 1X2MA 4RAZA 4YRVA 2CQNA 1WWXA 5DM6F 1H88C 3E4YA 4HG2A 4IKFA 2BY3A 5IP9J 4PJ0C 3E0JB 4DTNA 1LKXA 3HL8A 2ZO4A 3ZMDA 1PP7U 1JUSA 5D5WB 2H6BA 5F0CA 5ICGA 3JAMZ 4IVNA 1XVEE 1MGTA 1WI3A 2F5CA 4O5VA 2Q8KA 1YIJI 3WE3A 2HU9A 5TGTA 3OYAA 1QPIA 2X6WA 3MZ8A 5J47A 1UCRA 4M9XA 2ME6A 5D4RA 1QA6A 2MD5A 3TOBA 3CFRA 1K78B 3BR1A 2EIJH 1U2WA 3S93A 2O7OA 1B9NA 1FZPB 5FLVA 4KN7X 1JE8A 4Z6YA 2UWMA 3R6SA 4BE2A 1K6OA 2CG4A 1VQOI 3L2VA 1XD7A 3M7GA 3BQZA 3HEFA 3GWZA 4NQWA 2HPIA 3CUQA 2V1DA 1FBUA 1B8IB 3W2VA 3CESA 1P9QC 2LOOA 1IRGA 1TT0A 3ZQQA 1XVGE 2NRAC 1S8NA 4N4NB 4HW0A 1I3AA 4BDZA 4HZFA 3PQKA 4D7MA 3MEXA 4UB6C 2IS6A 2XGCA 4FJGA 4E7JA 3ZQ7A 5EEHA 2STWA 1BIBA 3U2RA 5B3SH 3SUOA 3WU2C 3ESWB 3C95A 2ZXWH 3FXLA 1VF9A 2WC2A 4AWXB 4EJTA 1OJLA 5CVJA 3DXJF 2ZJPF 1MJ9A 3BTCA 2QVOA 3TGNA 3ZMUA 2HVRA 1BOBA 3HBLA 4M3FA 2VPLA 4JS4A 2BV6A 9ANTA 1XGNA 4XN0A 4G6TB 2F2EA 1TT5B 3MN2A 4M6VA 4B43A 3H9JA 4V2FA 4XRMA 4A3MJ 4M6YA 4PUSA 5FKOA 3I9V2 3M8JA 4XLEA 3L2RA 2OQGA 2LC2A 4U87A 2OBPA 1JKQC 2E2JJ 2DMNA 4M73A 3DLLF 3TO6A 4JRQA 4FJ7A 3BR6A 1IG7A 3LA2A 2CFXA 3G71I 2JA2A 2R92J 2DLLA 1IDZA 2OA4A 3HSFA 1K79A 3SYTA 3ZQCA 2ZBKA 4XRSG 2D45A 3DQVC 4ICGC 2JZYA 3A0HC 3IH3A 4N9HA 5DCMA 3N1EA 2XF5A 5HNFA 1AHDP 1R6RA 2KJBA 5JI6A 2XSDC 2ZMEC 2CQXA 3C2BA 3W6JB 3DPUA 5E3MA 1BI2A 5J6XA 1U78A 3CCRI 1LEAA 2RC4A 3F72A 4AIJA 2BGCA 2MG4A 2OAZA 2XAGA 4G7OF 1LDKB 5IBKB 3G1MA 5TJJA 3PUFA 1K4TA 4BQOA 1F4KA 2KDOA 1WVRA 4BL0B 5LHHA 5LHIA 1OCZH 2EZIA 3HOTA 4HOBA 3HOXJ 6PAXA 2MGQA 4WXHA 4RB2C 4BY1J 4S05A 5JVTA 3A01A 3J7AY 2K5SA 1QZEA 2OQRA 1U9NA 1YFHA 3F8CA 1P7JA 3W6VA 3Q0VA 2ME0A 1HLVA 3R4KA 4UVCA 2AO9A 2YUSA 3OS2A 4P5OA 1YQAA 4HSTA 3V7RA 4GO1A 2PJRA 3S8PA 1GXQA 2KRFA 3M8EA 4BEHB 2JSCA 2LREA 3CF5F 2L9RA 3IAS2 3P5JA 3OYNA 4PZJA 2KQRA 5LD2C 1Y1WJ 4MIMA 5D5UB 2MH9A 2VE8A 1GT0C 2ID3A 3OYEA 1ZRDA 3DV8A 2DY4A 1OCRH 3HGGA 4D7NA 4NC7A 3U1DA 2CS3A 2HD0A 3JSPA 1UMQA 1R58A 2EZHA 2OZUA 4EJWA 3T8RA 1HKTA 3FM5A 4HCBA 3ABTA 2VN2A 3ZN1A 1T6SA 1GDTA 1XPXA 3HSEA 2CUZA 5LGNA 4EJVA 2KIUA 2ZCWA 2D1VA 3KP6A 1IXRC 5F64A 1MDMB 2ZXHA 1LEBA 4WXDA 1G3SA 3QPHA 4B8XA 3O6BB 2IJLA 1GXPA 3QNNA 3M1CA 2LKSA 4IHVA 1XMHE 1U6GA 2Q2EB 2BEOA 3OOPA 1QZYA 3V7DB 3QEWA 2YS9A 4LG3A 4ZTFA 1NG7A 2LY9A 3GVAA 1MNDA 3LAPA 2HDWA 4HQMA 5H2FC 3CTAA 2HOAA 2HPMA 4XKCA 1R4MB 2WV1A 4C2MJ 2KIQA 4XQFA 1FOYA 2K4BA 2UXNA 2VQCA 3GW2A 3GZ6A 4UUTA 2RN7A 3OSFA 2ADUA 2YU3A 3B6CA 2M30A 4XORA 1D5YA 1B9MA 5CQEA 3L2WA 2LSOA 3FF5A 4X6AJ 1YIOA 3ZQHA 2BBYA 2HEOA 3BDDA 3ROUA 4LFUA 3CCMI 3S3NA 2Z1DA 1WRJA 2HXIA 1SMYF 1TLHB 3DEWA 2W00A 1FLIA 3QEPA 1K6YA 2EA4A 1VQKI 3NRVA 4YEJA 2H4TA 1F9NA 3SZTA 1QPMA 1OPCA 2CQKA 3DLAA 2JWTA 4R79A 3LDBA 3FXOA 3C3WA 4I0BA 1J09A 1BN5A 2W7NA 1UHMA 1IUYA 3ZQLA 4RMNA 2XRLA 2K9MA 2UV1A 2F6CA 4O6JA 4DU1A 1EA3A 1XMXA 3E5XA 3FXQA 3I0TA 2JHPA 2OZSA 5EDNA 3CO6C 2IS1A 2DO7A 3GO5A 2X1DA 3LFKA 2WWYA 2M5WA 1X58A 3V7SA 1DU0A 4RNGA 3PNVA 1FSEA 2JTVA 5L3GA 4F55A 3LMMA 5EYRA 1IUFA 4DU4A 4FJIA 3RMCA 5J1YA 4AYBA 1JHHA 2V7FA 3BTIA 4KIBA 4EVIA 4GFBA 3I71A 2CJJA 3GZNB 5LLQA 2V26A 4FCYA 4NUBA 4I2OA 1BM9A 2A69F 1UB9A 2RREA 1R00A 4A2UA 4DTSA 1LJ9A 3IHUA 1QO0D 1YOVB 2K02A 2DPUA 3HTUA 2HVSA 3CC4I 2HWVA 4Y15A 1ZH5A 2F48A 2Y0SN 1P6RA 3BTLA 3MMYB 4WF2A 3R60A 4ZDLA 4FTHA 1XCBA 3BT9A 2X0LA 1Z3XA 2GXGA 1JHFA 5F0HA 1XU5E 3JW4A 4LITA 3ZPLA 2CU7A 3H5NA 4B09A 4GGGA 5IOZA 3IH4A 3EQLF 3WTWC 3KETA 2GM4A 1DP7P 1UG2A 4QNCA 3GCMA 2W84A 3UIQA 2BY2A 3K2ZA 3ISPA 2LP0A 4II2A 2DA5A 5AONA 4YG2F 1MBEA 1BW6A 1HQCA 3TP0A 1XVDE 5ILUA 2QQBA 4CXFA 2VOOA 3NAUA 4P55A 3CQ8A 5CKTA 3MKZA 4K2EA 4GDFA 5IREA 1UJ8A 1JGSA 4R8HA 4MQVA 3J80K 1KYWA 1R36A 4OMZA 1TQPA 2P1OB 4LMYA 5BNGA 2KZVA 2FMYA 1WI9A 3KEYA 4BU2A 3WSOA 1N75A 1I50J 3TKYA 1AA7A 3UNGC 3H0DA 2XPUA 2ISZA 1YJ9I 4H0EA 2E31A 1ZG1A 2YX7A 1OR7C 3PO3J 1IN5A 1DPRA 2R7SA 3WG9A 4ENKA 3G2BA 4GYIA 2CW0F 1WJ5A 3GTPJ 1D0ZA 3G3ZA 4QIWN 2Z33A 3TAFA 1D1AA 4I9LA 2HI3A 2IT0A 3LSTA 4G9YA 3SJMA 2HZTA 3TO9A 1JJ6C 2Y31A 2R7QA 3FXMA 3SEQA 4LJZF 2IRFG 1TBXA 4I9QA 4DJAA 3UO3A 3GX4X 3S32A 5K1YA 1G59A 3LSJA 1IXSB 2GIZA 2C6YA 1ERDA 1FJLA 4CCLA 4M3GA 1FYZE 5FKNA 2E1CA 3OYHA 2RNJA 1BR1A 1S5LC 3HTSB 2LBFB 2DU9A 2L7FP 5CVIA 4ZYEA 3BG6A 1PYVA 3QEXA 1Y6IA 2L4AA 2XGXA 2LNBA 5IZ7A 1BI3A 2P6SA 1FP2A 4XLNF 4OINF 4BUPA 1LFUP 2HNHA 2FMLA 3K2AA 2EA2A 3BLYA 2Z99A 1ZYRF 4E3SA 1IRFA 4DQ2A 2W48A 5IT9Z 1OCCH 2WAFA 1TP4A 3B02A 4MNUA 1ZREA 3U9GA 2LF3A 5ERIA 2OTJI 4DNCA 2J5OA 3DKWA 3KYCB 1MMDA 2NS0A 3H9QA 4M41A 5GPAA 4RGRA 4AVPA 5FFXA 4OU0A 5HS7A 1AWCA 2K85A 4ZDOA 3IUOA 1UG0A 1NHAA 3FXUA 2PX9A 3FK7A 1GHCA 3WTZA 1Z0XA 3C2GA 3ZXSA 3KZYA 2WY7Q 4YIIA 3K4CA 2MLKA 4MFDA 2XB5A 4DZJA 4AI6A 2QSHX 3S2HJ 2D5VA 1IN8A 2K86A 2AS5F 1APLC 3E6MA 1N78A 2AXLA 2CW8A 2ZFUA 5CVUA 4GYGA 5BOXA 1FZ4E 4KHWA 3NHGA 1WGXA 2PMZN 2NVYJ 4Q4ZF 3V8JA 5CPRB 2K5CA 1J5YA 4BKXA 2ACJA 2H27A 3SZPA 3GMEA 1FZ2E 3ABUA 1YO5C 3KCCA 3BPXA 4BQNA 3QRFF 3Q3SA 2M4KA 1ZAOA 2V9KA 1PP8F 3KD1E 1ZARA 5LRRA 3WODF 3CO7C 2HS5A 3TABA 2JUGA 1FZ1E 4OWRB 2W4SA 4I99C 4XMYA 1W7PD 4RAYA 1FIPA 1XVFE 1FS1A 1CLQA 3BCBA 3JSOA 1W36D 1ITYA 1MBKA 3PNTA 5BPDA 2JRTA 3Q9SA 3H1CA 2A07F 3RWUA 3D1NI 3H5AA 4HX8A 5ILSA 2E5ZA 2HKXA 3KFWX 2W25A 3ERED 1R4NB 4Y33A 3QESA 1I1SA 1W36C 4LK1F 3V42A 2JQTA 1X1PA 1JI8A 3L2QA 3LZJA 4QSHA 3D5SC 2XF7A 3JRCA 2ZXIA 1D0XA 4I98B 2Z9OA 2V6EA 3N1BA 4PJLA 1RRJA 2EV0A 2XC7A 2JA8J 3EYYA 4LLNA 4A12A 2WB1N 2ZFWA 5GTHC 1SEUA 1KQ9A 3I58A 2LDUA 5B66C 3L2UA 1VQPI 5DUIA 1QU3A 5JFRA 3DF8A 4P9FA 2B7EA 1OKRA 3O8HA 5J4VA 1OMIA 1ORKA 2Q1ZB 5E3OA 4EM1A 1SD6A 2DXIA 2LRDA 1ZR2A 1B4AA 4MTEA 3RYRA 1LPQA 3RMDA 5IOYA 1H0MA 4CCMA 5D5VB 3X2QH 4A3FJ 4DTOA 4BE1A 4OOIA 1S6LA 2R7DA 4ESBA 3RMAA 5H37A 2QYOA 3K4JA 4FJ9A 4FJHA 1ZQ3P 4AKHA 2NVXJ 4KI6A 3OMYA 1V54H 3M8FA 4HLYA 2HOEA 1WFXA 4PGGA 4UV9A 3VSLA 2ZJQF 2Y30A 1ONVA 1DDNA 1XSXA 2AQEA 3BJOA 3QYEA 4BXFA 5LRSA 2CW7A 1USTA 4RG8A 1ZR4A 2JVHA 4UV8A 3C18A 5DUKA 2PN6A 2BOLA 3KLOA 5GAHJ 4IRHA 1CF7A 2E1MB 2HQNA 1FZ0E 1TNSA 1O3TA 4JX4A 3NGIA 3OIOA 3IKVA 1ETYA 2DYSH 1R22A 1Y8RB 4HF0A 4C3HJ 3I59B 3BR0A 3DTEA 5FFZA 4BACA 3SXYA 4I01A 1F36A 2MYSA 1BIAA 3J81K 3TEDA 4M3UA 1MH4A 4BS9A 1ZKGA 2OPTA 3DPLC 4MO7A 3LWFA 1NK2P 5K7ZA 1USSA 1IH7A 1N25A 1YW7A 4AKGA 1IW7F 3DKYA 2L02A 1QQIA 4P9UA 2HQRA 5E3NA 1I3QJ 3CJRB 1R23A 3E3VA 2G0EA 3ZP5A 4IHWA 2A05A 2EJRA 3LSKA 1OYYA 2M0CA 4ZDPA 4PJNA 2X6XA 2XGEA 1TL8A 1FC3A 1HDDC 2HQ5A 2H6CA 2WAQN 1A36A 1LVAA 4ANJA 2PLYA 2QSGX 2V9PA 4XKVA 3CCJI 4L0YB 2IPQX 5H20A 2Z16A 4KHNA 3VSKA 4BNCA 4LB5A 2ISYA 2KIFA 3SDBA 4B1RA 1SD7A 2VIXA 5FKKA 1FZ8E 1POGA 2ATQA 4M3TA 2QBYB 3GFLA 1WZ2A 3CDIA 1E3PA 1P2FA 3MAJA 4EGZA 1WSUA 3BG5A 3RCOA 5E18F 5A2QK 3OYIA 3SHFA 1I27A 1MHYG 2RVCA 4CICA 1TWCJ 2E35A 3BG3A 4RB1A 2R7WA 1V5EA 3EUAA 3F8BA 1KYZA 2Y75A 2XF6A 1U8BA 3TL8B 1YE9A 5ICEA 2O8KA 3NWSA 4E70A 4LG0B 3K4KA 1KU2A 3E5UA 2NS7A 1XDUA 2W24A 4RGUA 4QPQA 3ZRGA 5IT3A 3CF2A 3F9KA 1YRNB 2DMQA 4KHYA 1K7AA 3AG2H 2QUFA 2V6CA 4M6XA 4RB0A 1AKHB 2MA3A 1VQ9I 3KIOA 4UB8C 4CA0A 5H6QA 3S9HA 2MFZA 2ZB9A 1JXSA 1UAAA 3L9FA 1KONA 2QA4I 3I54A 2HKOA 4OMYA 1T2KA 2I5UA 3OGLB 4BQQA 4AIDA 2PBIA 1D8JA 1Y0NA 4L0ZB 2ID6A 2R5ZB 2KPMA 2KFDA 3OGKB 4C2UA 2MZWB 3C94A 1X3ZB 2BXZA 1QBJA 2LF6A 1WPKA 2ZMEA 5DYMA 3VWBA 2F5DA 3RPUA 2XAHA 3NCIA 3GLXA 3HUGA 4JK1X 3FMSA 3GUDA 2LK2A 2RNGA 1T33A 2BZTA 2VB6A 5IYCJ 5M3FJ 4N9IA 3CCUI 1E17A 3SJJA 2IA1A 2VKVA 3D5RC 2VI6A 3I4NJ 1HXDA 3IWZA 3C6OB 5HOOA 4FE7A 3L0MA 2ECCA 3K4LA 2NNYA 2VJ5A 3GTKJ 1Q9XA 2DA4A 3V7CA 3FDYA 5F1RA 2IBDA 2L01A 4YELA 4FETA 4RL5A 3M1EA 1W5TA 1G8XA 1Y56A 2B9SA 1BJZA 1GVJA 2M34A 1TW2A 2KMUA 1IN4A 3IV5A 4M72A 5E1ZB 3CCEI 2R5YA 3DU6A 3VYTB 3J27A 3PUBA 2KLOA 4CH7A 1JUPA 1AOYA 3KEOA 2IGOA 4XLAA 3J7YJ 3LSMA 1FEXA 2RGVA 2XGDA 3FMRA 1SD5A 4WK8F 3GZ5A 2HGCA 1MTYG 3HZJA 1EV7A 1ZG3A 3FWEA 4BAYA 3CMYA 4LK0F 3HGYA 2ZJ2A 1FTZA 1H89C 2FF4A 5JVGF 1R1VA 2R93J 2JPBA 2MMBA 3Q0UA 1FZ9E 1F43A 5ICCA 3FHZA 2OU2A 3RMBA 4E7HA 2KISA 1E2XA 5EG0B 2FNAA 2MW8A 4OIOF 2W82A 2K3FA 1DP3A 2EZKA 1JGGA 3RPUD 3D0SA 2EK5A 2CQQA 2R7OA 1B72A 4FK2A 3K69A 1VQ6I 1MIJA 4FX0A 3J2PA 2EIMH 5M5WJ 1U5TB 1OFCX 3WHCA 1Q1HA 4ENMA 3DU5A 1SMTA 3WU1B 1FX7A 3CMMA 4AC0A 1XL3C 1GUUA 5F0FA 3ZQFA 2GXBA 2BW3A 4A3GJ 2NXNB 3AG4H 2FQ4A 3K1NA 3QQAA 3HC7A 3G1OA 1JT0A 3MZHA 4I6ZA 1MKMA 2Y48A 2LF7A 2A68F 2M3AA 1IGNA 2ELKA 3I3LA 3FZVA 3IRRA 2ESHA 3H9GA 3KZIC 3J80Z 3WTSC 4J2DA 3VFZA 5GAEJ 2OZ6A 2P5KA 1Z3YA 2LMDA 3QODA 5AIPA 1X3WB 2NOJB 1FYLA 3BR5A 5J4YA 2HDDA 1IAWA 4X0GA 2R4GA 4XSZF 5B1AH 3P7NA 2JA5J 3SPZA 3O2PE 3CUQC 2DQRA 3CJTB 5CVVA 1WQ2A 3JRDA 1D0YA 5B5EC 3LSIA 2DT5A 5F08A 3BQYA 3QNOA 4EJUA 4BE0A 3H3ZA 1YITI 3DEEA 1ZHFA 3HKZN 3SZGA 2NVTJ 1VQMI 4B47A 1LNWA 3MWMA 1FWZA 3ZMTA 2R7TA 4PFPA 1MSFC 4U88A 4NC6A 1TQIA 5LGUA 1XGOA 4B3AA 1O3SA 2DW4A 3PQJA 1U3EM 1P4XA 1T56A 2MC4A 3KP2A 4M74A 5IYBJ 1X4OA 3VEPA 2HOSA 3DWLE 3GTQJ 4XONA 3TOAA 2VQLA 3W6KB 4KJZA 1R1TA 5D6FA 3E4WA 1EH8A 4IT5A 1OLTA 2PG4A 3WTXC 3CCYA 3VYSB 4HNVA 1WJAA 1QNTA 1PUFA 1RIOH 2Z3YA 1W5SA 5FD6A 2VXZA 3FMQA 4D9JA 4H4KC 4F91B 2M45A 2L9NA 4XR6A 3K9TA 4IHYA 4Y52J 2Y2ZA 1IN6A 4KN4X 4A5NA 3COAC 4UVBA 3L1NA 4KYWA 4A0XA 2HDCA 2XKOA 3PM1A 1YS6A 2V1NA 3OR2C 3O3KA 4RAGA 2QF7A 4CCJA 5L3BA 3OYCA 4NB5A 4A3IJ 1IV8A 3HHHA 3KD5E 5HDKA 3IP4B 2P8TA 1DGRM 4B4CA 2P4WA 3FM3A 1FIAA 2BYVE 3FBIB 2P7CB 4DGWB 1A5JA 3SQ4A 4A69C 2P1NB 4L9NA 1GLNA 2XHKA 3ASOH 4GXOA 2OJED 5BS6A 5LFAA 3PFYA 3HP9A 2PQ8A 3BJAA 2OUMA 4G12A 1J7KA 4HSRA 4XM3A 5J8FA 3JTHA 1LDKE 2VBWA 2HZDA 4D5FA 2O0YA 2K9NA 3RKYA 2X4HA 2VONA 4RBOA 1SFOJ 1FOWA 5FD5A 3ELKA 1F1ZA 5EGOA 3WU0A 1T95A 4B3XA 1A31A 2WADA 1L3LA 1R5HA 1ON2A 5E1WA 3QAHA 5BPIA 4LB6B 2ZC2A 5K5OA 1OR7A 3MKYB 1ETOA 1KQ0A 2B1EA 1UELB 5M5XJ 3QOEA 5BQTA 3MQ0A 2K7LA 3ECHA 4MFEA 4NBQA 3TO7A 3CZ6A 2E32A 3VYUB 3KEQA 1MSEC 4JBAA 2DMUA 1JTYA 3LDSA 1ZN2A 4XIDA 1DGWY 5EEAA 4FHTA 2R3SA 3CCSI 4FJMA 2D2WA 2LVSA 1K83J 1T0FC 3OS0A 1BJAA 4EM2A 4RM3A 4BH9A 1LE8B 1FNNA 2KRCA 1EH6A 3DBRB 5DD4A 4ZYDA 2P5OA 2DAOA 1WH5A 2XRNA 4NQWB 1XCVA 1MMSA 1XGMA 3CUQB 2FBKA 4U0VA 2OCEA 4ZYHA 4QPOA 5HS8A 2CFOA 1X19A 3W3CA 2R7RA 2DJNA 4HCCA 4YIRX 4RS8A 2H09A 2XUBA 3HPGA 5ED4A 3GFMA 3FXRA 2JVGA 2CMPA 5E8IA 4ESFA 1FXXA 3I56I 1VI0A 1ETVA 1NG6A 4CYCA 1NH3A 4M9SA 5C3EJ 3JRFA 2HR3A 2GQQA 3TW7A 3BROA 3ZMSA 1WH7A 4XKWA 3OYJA 2VT2A 3Q5FA 4ZC3A 3E97A 4AVZA 2PJPA 1H9GA 4PSWA 4ZYAA 1J2XA 3I55I 3K70D 3CCVI 3F21A 1I1GA 2X6YA 4D1QA 1HDPA 3BZCA 4HX4A 1DQUA 5GP9A 2CH0A 2IGKA 4X1EA 4XICA 3KE2A 3LZIA 4CYDA 5K7HA 4UY8I 3N05A 3K70C 3F8FA 2FBIA 2QWWA 3H0GJ 1Y39A 1MNMC 3JRGA 4UNOA 3OSGA 2IGNA 1ULYA 1P4WA 2CV1A 3CJNA 5EZGA 4XRSA 4Y13A 2W85A 2GA2A 5E8GA 3LL7A 3ZOBA 2VASA 3LSRA 1XTAA 4RB3C 2NVQJ 1WHUA 4ITVA 4HDUA 1IXCA 4FT8A 3RKWA 3HOUJ 2XDVA 4HEA2 3R61A 4UXNA 2QGUA 1HC8A 1XS9A 1RPWA 4KICA 5DCMB 2BY1A 4DIQA 2GXAA 4HRIA 1W0TA 4XOTA 2MBFA 2X51A 3RZDJ 2EQRA 1VNDA 3JRHA 4XN3A 2K3PA 4UUSA 1W7PA 3A1YA 1A6IA 5J3LA 4M3WA 3V8KA 4KA4A 2G9WA 1VQ5I 2DOEA 1S3JA 4CDGA 2JHCA 4EATA 4DU3A 5D6EA 4A0ZA 1E3OC 2DTUA 3FHNA 1VZ0A 3KZZA 3ML6A 3RDIA 2FXAA 4HDVA 3S2DJ 3J81Z 4GAMC 4BQAA 4JYKA 2DA3A 2EINH 2DK8A 3N97A 2P1PB 1J9IA 1Z6RA 3FKIJ 3A01B 2EFOA 3MKWB 3HOSA 1LUJB 3MKLA 2M9HA 2L7ZA 5L3CA 3JCUC 2OZMA 4FVMA 1XX5A 4EMSA 3OS1A 2PJRB 1XGSA 2G7HA 2PFVA 4E4HA 4BXXJ 4QTRA 2DT7B 2ELJA 4M3BA 3JRBA 2STTA 2WTEA 3BPVA 2FEZA 2RAEA 1C0WA 2IS4A 2PMZA 4HNTA 3S1NJ 1R5GA 3KP5A 2JPNA 4GCVA 1MZBA 2BY0A 5BMZA 2DOAA 3SI6A 1ODDA 1Z7LA 2E60A 2O5RA 4FX4A 3BZ6A 1STZA 4DZPA 2VBYA 3OIPA 4YFKF 4RGSA 4KIFA 1KZHA 2E1MC 2FQ3A 1FZ6E 5HLHA 3ZMVA 4E4BA 1D3YA 5A2QZ 1DUXC 2L7MP 4LLLA 2MLGA 3GYHX 4I76A 2EFPA 2EV6A 2YX4A 3HOVJ 3F23A 3C7JA 3UR3C 1K78A 2IP2A 2F5VA 1G3YA 1QVTA 2BHZA 3ECOA 3EUHC 5FLXK 4M71A 4CO8A 4BDYA 2H8WA 5GADJ 2ZSIB 4FJJA 1XMGE 2IA2A 2EFWA 4C9YA 3VDXA 3ERMA 1O4XA 3CMAI 2JUCA 2VBXA 3K4NA 4KMUX 3HJEA 4U7BA 1S72I 3AG3H 3KYLA 3RIRA 2R7VA 4KFCA 1Z6TA 1V4RA 5TISC 2F4OB 2QQAA 2WV0A 3HB9A 3VB2A 1B8IA 2IA0A 1L0OC 2E71A 5M5YJ 2A5YB 2E2HJ 1NTCA 3OV8A 3N4MA 2DCEA 3GTMJ 1WJCA 1DU6A 2WB1A 2DFHA 3SQ2A 4PK4A 5JLWA 1J59A 4D0PA 2XIGA 4ADOA 1LB2A 1EH7A 1O7LA 3NE6A 2P7VB 1VFCA 4DBRA 1NEXB 5KAFC 3G4SI 1FYMA 3ZGKA 4KISA 4AD9A 2LF8A 4FJ8A 2QLZA 3WHBA 4M45A 1RNLA 4HF1A 5JLXA 1YLFA 4BY7J 1U9OA 3WG7H 3TAEA 3I53A 2XV4S 4FK0A 2H8RA 5CQGA 4QLCU 1MBHA 3PL8A 2RQPA 2VC0A 2OTLI 1LFBA 5CYVA 4KITB 2HTSA 1OYWA 5J40A 3HOYJ 4W1UA 4Q48A 1WJBA 1FTTA 5D8LB 2X9DA 3TQNA 2YU9J 4FQGA 3H5RA 3BR2A 1PUEE 4CHUA 4CGZA 1FZ3E 2X6OA 3DCFA 4KI4A 4M3DA 2Y9YA 3VYRB 1CQTA 2DYRH 2MABA 3R0JA 1TTYA 1REPC 4FISA 1YX5A 2VT3A 1OCOH 4L9VA 5F6FA 2LR8A 4J00A 3TW6A 3PO2J 1ON1A 3LFUA 4EV0A 1HW5A 3V8LA 3IWFA 2GWRA 3HRTA 3RQIA 4Y7NJ 4BJTA 1HCRA 2E36A 1QVUA 1Z67A 4G6DA 3FKJA 1T08B 2M7AA 4JOMA 4ENJA 2TCTA 2V79A 1SFUA 1JKPC 5FKLA 1D5VA 1W4MA 1VQ4I 3ZQGA 1BR2A 3DBLB 3Q9VA 2DA7A 4MTDA 4QNDA 2HYJA 2EFNA 2F5EA 4UVAA 3F8MA 2F4MB 3RPQA 1R9TJ 3AL0B 5K7FA 2RCUA 1EF4A 1YTYA 3ASNH 1Z7UA 3HYIA 2QKMB 3WE2A 3V4GA 3EDPA 2OCCH 2ZSHB 5JHUA 2E5NA 1JKRC 3U1KA 5E20A 2KT0A 4L9JA 4MQ9F 2E1OA 4A3JJ 1FBQA 2K27A 1MHZG 2XPWA 2J5PA 3SUQA 4OIQF 2ZNZA 4LIUA 3F3XA 3K7AJ 1D1BA 2EPFA 4BEHA 3NDKA 3WTTC 2OD5A 4XLHA 1SC7A 5DCFA 2YR2A 2I10A 4BYYA 1S7OA 4UHTA 4LOCA 3CC7I 4MGRA 4L18B 1D1CA 4Y17A 4XRFA 2BXYA 3T8TA 2DPDA 1XSDA 2PMHA 3IC7A 1O3RA 3P9CA 1JT6A 2OF7A 2KHMA 1MJBA 1ACIA 5DV5A 2XVCA 1Z91A 3PSIA 2XAFA 1JW2A 2CV2A 2QKLB 4IHTA 2DA1A 4Z2YA 4E7LA 4IOAF 3H36A 1FBSA 2DQLA 2E34A 3C2HA 1MDMA 3GFJA 5ICFA 3MVPA 5E3LA 3CCQI 5KVRA 1V3FA 3HM5A 3K4BA 5E79C 2GAUA 2KIMA 1IC8A
chains in the Genus database with same CATH topology
2Q2EA 4EM0B 3F6VA 1U5TC 5HDGA 5H6RA 2A3SA 1FOKA 3UO2A 5FO5A 1ZGJA 3QU6A 4CZZA 2M1BA 4HYEA 3IKTA 3MZYA 2YSRA 1G3TA 5CVRA 1LDJA 4A6EA 2BE5F 4S04A 3DFGA 3LAJA 4PGHA 3GFIA 3KLNA 4HX7A 3GF2A 4G8XA 3I64A 3P9KA 1T38A 1FPQA 3F6OA 1G3WA 1HBXG 1KGSA 5LBQA 1RUOA 1XB4A 3HRMA 1XMAA 2O61A 2P5LC 2O6GE 1IZ1A 1BBYA 1VTNC 1YYVA 4U7DA 1BC7C 4BHCA 1Y0UA 3SQNA 1S7AA 1FP1D 1I6XA 1B6AA 2HYGD 4MEYF 3L2CA 3WGGA 2FBHA 1SFEA 3HIFA 1PDNC 3WGHA 1QZZA 2ZXJA 1FT9A 5FB2A 3QOPA 1ZG5A 1BI1A 4UUVA 3RYPA 3KP4A 2UZKA 2MC3A 2GIVA 4U0WA 5CLSA 3BY6A 2QZ8A 1IN7A 2P5VA 3CLOA 2V9VA 4QWQA 2KJCA 1H9TA 2KKOA 2CSOA 1DPUA 4HA8A 3KP3A 3EETA 1XMKA 4O3MA 5EEGA 3RJPA 1HSJA 4WXCA 4YIFA 4IRGA 3RKXA 2EFQA 3S2WA 1CF7B 4AIKA 2B0LA 2GZWA 2XROA 4OIRF 3E6DA 1ZRCA 4N0BA 3BOQA 2K4JA 3BWGA 4ZH4F 2PMUA 3JTGA 3E6BA 2FA5A 2XAJA 5L3FA 1T0FA 4NHJA 2ESNA 4HAMA 2CO5A 2CWEA 2ELHA 3DPTA 3F22A 5HVQC 5D4SA 2ZNYA 4PDKA 3IL2A 3I4PA 2A6HF 2VBZA 2JT1A 2LKPA 4Q47A 2DBBA 4KDPA 4KIGA 3ZN0A 5E1XA 3JAMK 2FSWA 4LD5A 1G4DA 1XSVA 1F5TA 1B59A 2D1HA 2RKHA 2VE9A 2CYYA 1KQ8A 2XKPA 5L3DA 2V1UA 1BI0A 3NEUA 2E7WA 4R1HA 4KMFA 3CDHA 1BOAA 3HSRA 4EJOA 1D8KA 5FLXZ 3QPTA 2RV8A 4WCGA 1YG2A 4HV6A 3VOEA 5HLIA 5AIQA 4ZZLA 3NQOA 1T39A 2ZMEB 4G94A 3KP7A 4HLXA 4L9TA 5E17F 2UXXA 5J8CA 2FNPA 4JQFA 5CJ9A 2QENA 3WTUC 5K5QA 2HYFA 3BVOA 2RDPA 4YFNF 1LQ1A 2M8EA 1Z05A 2VOPA 1BC8C 2G7UA 2HTJA 3BP8A 2XASA 1FYKA 1YS7A 3MCZA 3IRQA 1SFXA 4IXAA 1J75A 2NYXA 1MJAA 2H94A 2DFIA 5HS9A 1HKSA 4A0YA 5TRDA 1Z9CA 4HF2A 3LA3A 4ON0A 2MH2A 2COMA 3I59A 4IF4A 2DK5A 4XLPF 3LA7A 4F7ZA 4MEXF 3T0YA 3EUHA 1O7FA 4I0AA 4L5IA 5JR3A 5LGTA 3RI4A 1J0RA 2YPRA 4I02A 1FY7A 1R7JA 4MHGA 2O8XA 1SAXA 2IVMA 1KU3A 1G6NA 4G7HF 3P9IA 1UFMA 1KA8A 4EQQA 2P6TA 1WKMA 3FX3A 3WTYC 4HBLA 2HFHA 2GA1A 3QP5A 5HLGA 2L3DA 3G73A 1ZLKA 1CGPA 3E5QA 2QBYA 1O57A 5LEKA 5K5RA 3TDZC 3D5LA 3DP7A 3VODA 3R0AA 4HQEA 2QM3A 5DDGA 4BXUA 1S29A 3C1DA 4LG0A 4P96A 3LQQA 2Z5UA 2A61A 3DEUA 4G6QA 4BHPA 4U0YA 1QGPA 3EYIA 4IRIA 1IF1A 3ZMZA 2FU4A 5DD8A 2XAQA 2E7XA 2PEXA 3ULQB 1HKQA 5ILVA 2Q0OA 3GEZA 4TV7A 5D8KB 3RTRA 1B1BA 2F5FA 4XBFA 2IW5A 1TQMA 2NAZA 3LQRA 3K1MA 2E1NA 1ZRFA 1T98A 4A5MA 4Q5SF 1UHWA 3WGIA 4KUMA 3CUOA 4IJAA 3K1PA 1ZGAA 2QQ9A 1HW2A 3SFZA 2CGPA 2NNNA 1MD0A 3E6CC 1TNTA 3H3UA 1X3UA 2FOKA 1I5ZA 3L09A 1RUNA 3F8NA 3HRUA 1OYIA 1SD4A 1XDSA 1FSHA 4M9ZA 2R7FA 1U8RA 4ZYGA 4ETSA 4I09A 5FGMA 1XN7A 4A6DA 4KNYA 2FRHA 3I5UA 4EGYA 2V1XA 1A04A 2EWNA 1KU9A 3QU3A 4WX9A 2O03A 4I7HA 3J7AO 3B73A 4LLGF 4YFXF 1LDDA 2JPCA 3BJ6A 2EV5A 1U5TA 4G7ZF 4BHBA 4IPAA 5L3EA 2TDXA 4ENNA 4LGWA 4ASNA 2Y0MA 1HW1A 1N1CA 4OIPF 2DTRA 4HV5A 1FPOA 5DEQA 3L00A 5D5XB 3HHGA 4AIHA 3M9AA 4PCQA 3T5XA 3K0LA 3GXOA 1ZLJA 2W57A 3TDUC 1YW8A 1TW3A 4WWCA 4XSXF 4RGXA 5IT9K 1P92A 3REOA 5LHGA 2L4MA 1HSTA 2VC1A 3WTVC 5KK1A 1RI7A 1P4AA 3MFKA 1W7PB 5LEJA 3T1BA 1RZ4A 2ETHA 3H92A 4ESJA 1R1UA 2DI3A 2FE3A 2EB7A 3PFIA 1YW9A 2A6EF 2M87A 1O3QA 2O3FA 4L5JA 2L54A 2PFBA 4IHSA 3HRSA 4ZZDA 3L7WA 3AAFA 2ZKZA 3QP6A 1Z1DA 1KU7A 2PI0A 5HDNA 4KT5C 4RAZA 1WWXA 2ZO4A 3ZMDA 1PP7U 5D5WB 2H6BA 5ICGA 3JAMZ 4IVNA 1MGTA 4O5VA 2F5CA 2Q8KA 3WE3A 1UCRA 4M9XA 5D4RA 2MD5A 3TOBA 1K78B 1U2WA 1B9NA 1FZPB 4KN7X 1JE8A 2UWMA 3R6SA 1K6OA 2CG4A 1XD7A 3M7GA 3GWZA 4NQWA 3CUQA 2V1DA 1FBUA 1IRGA 2NRAC 1S8NA 4HW0A 4HZFA 3PQKA 3MEXA 3ZQ7A 5EEHA 2STWA 1BIBA 3U2RA 2WC2A 4AWXB 4EJTA 5CVJA 3DXJF 2VODA 1MJ9A 2QVOA 3TGNA 3ZMUA 2BV6A 1XGNA 2F2EA 4M6YA 2OQGA 2OBPA 4M73A 3TO6A 3LA2A 2CFXA 2DLLA 2OA4A 3HSFA 1K79A 2ZBKA 2D45A 3DQVC 2JZYA 4N9HA 5DCMA 2KJBA 5JI6A 3W6JB 1BI2A 5J6XA 1U78A 1LEAA 2RC4A 3F72A 4AIJA 2BGCA 2OAZA 2XAGA 4G7OF 1LDKB 5TJJA 1F4KA 5LHHA 5LHIA 3HOTA 4HOBA 6PAXA 4WXHA 4RB2C 4S05A 5JVTA 2OQRA 1YFHA 3F8CA 3R4KA 4UVCA 4P5OA 1YQAA 3V7RA 4GO1A 1GXQA 2KRFA 3M8EA 2JSCA 4PZJA 5D5UB 2MH9A 2VE8A 1ZRDA 3DV8A 3U1DA 3JSPA 1R58A 4EJWA 2OZUA 3T8RA 1HKTA 3FM5A 3ABTA 2VN2A 3ZN1A 1T6SA 3HSEA 5LGNA 4EJVA 2KIUA 2ZCWA 2D1VA 3KP6A 1IXRC 5F64A 1MDMB 1LEBA 4WXDA 1G3SA 3QPHA 4B8XA 3O6BB 2IJLA 1GXPA 1U6GA 3OOPA 2BEOA 1QZYA 3GVAA 3LAPA 4HQMA 3CTAA 2K4BA 2UXNA 3GW2A 3GZ6A 2RN7A 2ADUA 2YU3A 2M30A 1B9MA 2LSOA 3FF5A 1YIOA 2BBYA 2HEOA 3BDDA 3ROUA 4LFUA 1WRJA 1SMYF 1TLHB 1FLIA 2EA4A 3NRVA 1F9NA 3SZTA 1QPMA 1OPCA 2CQKA 4R79A 3C3WA 4I0BA 1BN5A 1UHMA 1IUYA 4O6JA 3E5XA 3FXQA 3I0TA 3CO6C 2DO7A 3GO5A 3LFKA 2WWYA 2M5WA 3V7SA 1FSEA 2JTVA 5L3GA 1JHHA 4KIBA 4EVIA 3I71A 5LLQA 4I2OA 1BM9A 2A69F 1UB9A 1R00A 4A2UA 1LJ9A 3IHUA 1QO0D 2DPUA 2K02A 3HTUA 2HWVA 4Y15A 1ZH5A 1P6RA 4WF2A 3R60A 1XCBA 2X0LA 2GXGA 1JHFA 3JW4A 3ZPLA 4B09A 4GGGA 3EQLF 3WTWC 3KETA 1DP7P 2W84A 3K2ZA 3ISPA 4YG2F 5AONA 1HQCA 5ILUA 2QQBA 4CXFA 2VOOA 4P55A 4K2EA 3J80K 1JGSA 4R8HA 4MQVA 1KYWA 1R36A 4OMZA 1TQPA 4LMYA 2FMYA 1WI9A 3TKYA 2ISZA 4H0EA 1ZG1A 2YX7A 1IN5A 1DPRA 3WG9A 4ENKA 4GYIA 2CW0F 3G3ZA 2Z33A 2IT0A 3LSTA 4G9YA 2HZTA 3TO9A 2IRFG 4LJZF 1TBXA 3UO3A 3GX4X 5K1YA 1IXSB 2C6YA 2E1CA 2RNJA 3HTSB 2DU9A 5CVIA 4ZYEA 2L4AA 2XGXA 2LNBA 1BI3A 2P6SA 1FP2A 4XLNF 4OINF 2FMLA 2EA2A 2Z99A 1ZYRF 1IRFA 4DQ2A 5IT9Z 3B02A 4MNUA 1ZREA 3U9GA 5ERIA 4DNCA 2J5OA 3DKWA 2NS0A 4RGRA 4AVPA 5FFXA 4OU0A 5HS7A 1AWCA 1NHAA 3FXUA 1GHCA 3WTZA 3KZYA 4YIIA 2MLKA 1IN8A 2K86A 2AS5F 3E6MA 2AXLA 5CVUA 4GYGA 5BOXA 4Q4ZF 3V8JA 2ACJA 2H27A 1J5YA 3SZPA 3ABUA 1YO5C 3KCCA 3BPXA 3QRFF 1PP8F 1ZAOA 1ZARA 5LRRA 3WODF 3CO7C 2HS5A 1W7PD 4RAYA 3JSOA 5BPDA 2JRTA 3Q9SA 2A07F 4HX8A 5ILSA 2HKXA 3KFWX 2W25A 3ERED 1I1SA 4LK1F 4I98B 2Z9OA 2EV0A 3EYYA 4LLNA 4A12A 2ZFWA 1KQ9A 3I58A 2LDUA 5DUIA 5JFRA 3DF8A 4P9FA 1OKRA 1OMIA 4EM1A 1SD6A 1B4AA 4MTEA 3RYRA 1H0MA 5D5VB 4OOIA 1S6LA 2R7DA 4ESBA 2QYOA 4HLYA 3M8FA 2HOEA 4PGGA 4UV9A 1ONVA 1DDNA 1XSXA 3BJOA 5LRSA 1USTA 4UV8A 3C18A 5DUKA 2PN6A 3KLOA 4IRHA 1CF7A 2HQNA 1TNSA 1O3TA 3IKVA 4HF0A 1R22A 3I59B 5FFZA 3SXYA 4I01A 3J81K 1BIAA 3DPLC 3LWFA 1USSA 1YW7A 1IW7F 2L02A 1QQIA 4P9UA 2HQRA 1R23A 3E3VA 3ZP5A 2EJRA 1OYYA 1FC3A 2H6CA 1LVAA 2PLYA 4L0YB 2IPQX 5H20A 4BNCA 4LB5A 2ISYA 2KIFA 1SD7A 2QBYB 3GFLA 3MAJA 4EGZA 1P2FA 1WSUA 5E18F 5A2QK 3SHFA 1I27A 2RVCA 4CICA 4RB1A 3F8BA 1KYZA 2Y75A 5ICEA 4E70A 4LG0B 1KU2A 3E5UA 1XDUA 2W24A 4RGUA 5IT3A 1K7AA 2QUFA 2V6CA 4M6XA 4RB0A 2MA3A 5H6QA 1JXSA 3L9FA 3I54A 2HKOA 4OMYA 1T2KA 2PBIA 1D8JA 4L0ZB 1QBJA 2ZMEA 5DYMA 2F5DA 3RPUA 2XAHA 3GLXA 3HUGA 4JK1X 3FMSA 3GUDA 4N9IA 1E17A 2IA1A 1HXDA 3IWZA 5HOOA 2NNYA 3V7CA 5F1RA 2L01A 3M1EA 1W5TA 1GVJA 1TW2A 1IN4A 4M72A 5E1ZB 1AOYA 3KEOA 2RGVA 3FMRA 1SD5A 4WK8F 3GZ5A 2HGCA 1EV7A 1ZG3A 3FWEA 4BAYA 4LK0F 2ZJ2A 2FF4A 1R1VA 2JPBA 5ICCA 3FHZA 2OU2A 1E2XA 2FNAA 4OIOF 3D0SA 2EK5A 3K69A 4FX0A 1U5TB 1Q1HA 4ENMA 1SMTA 3WU1B 1FX7A 2GXBA 3K1NA 3MZHA 1MKMA 2Y48A 2LF7A 2A68F 3IRRA 3FZVA 2ESHA 3J80Z 3WTSC 3VFZA 2OZ6A 2P5KA 5AIPA 1FYLA 1IAWA 4XSZF 3P7NA 3O2PE 3CUQC 2DQRA 5CVVA 1WQ2A 2DT5A 4EJUA 3H3ZA 1ZHFA 1LNWA 3MWMA 1FWZA 3ZMTA 4U88A 1TQIA 5LGUA 1XGOA 1O3SA 2DW4A 3PQJA 1U3EM 1P4XA 4CHUA 3KP2A 4M74A 3VEPA 3TOAA 3W6KB 1R1TA 5D6FA 1EH8A 4IT5A 2PG4A 3WTXC 1QNTA 1RIOH 2Z3YA 1W5SA 5FD6A 2VXZA 3FMQA 2M45A 3K9TA 1IN6A 4KN4X 4A5NA 3COAC 4UVBA 4KYWA 4A0XA 2HDCA 2XKOA 1YS6A 3O3KA 5L3BA 4NB5A 3HHHA 5HDKA 2P8TA 2P4WA 3FM3A 2BYVE 2P7CB 4L9NA 2XHKA 4GXOA 5BS6A 2PQ8A 3BJAA 5J8FA 1J7KA 3JTHA 2VBWA 2O0YA 3RKYA 2X4HA 2VONA 5FD5A 3ELKA 1F1ZA 3WU0A 1L3LA 1R5HA 1ON2A 5E1WA 3QAHA 5BPIA 4LB6B 5K5OA 1OR7A 1KQ0A 5BQTA 3MQ0A 2K7LA 3ECHA 3TO7A 3KEQA 4JBAA 1ZN2A 4FHTA 2R3SA 2D2WA 1BJAA 4EM2A 4BH9A 1FNNA 1EH6A 5DD4A 4ZYDA 2DAOA 2XRNA 1XCVA 1XGMA 3CUQB 2FBKA 4U0VA 4ZYHA 5HS8A 4RS8A 2H09A 2XUBA 5ED4A 3GFMA 3FXRA 5E8IA 4ESFA 4M9SA 2HR3A 2GQQA 3BROA 3ZMSA 2VT2A 3Q5FA 3E97A 2PJPA 1H9GA 1J2XA 3F21A 1I1GA 4HX4A 3KE2A 4CYDA 3F8FA 2FBIA 2QWWA 4UNOA 1ULYA 1P4WA 3CJNA 4Y13A 2W85A 2GA2A 5E8GA 4RB3C 4HDUA 1IXCA 4FT8A 3RKWA 3R61A 4UXNA 4KICA 5DCMB 2MBFA 1W7PA 3V8KA 4KA4A 2G9WA 1S3JA 4CDGA 5D6EA 4A0ZA 3KZZA 3ML6A 3RDIA 2FXAA 4HDVA 3J81Z 4BQAA 3N97A 2DK8A 1J9IA 1Z6RA 2EFOA 3HOSA 5L3CA 4EMSA 1XGSA 2G7HA 2STTA 2WTEA 3BPVA 2FEZA 1C0WA 1R5GA 3KP5A 4GCVA 1MZBA 5BMZA 1ODDA 4FX4A 3BZ6A 1STZA 2VBYA 4YFKF 4RGSA 4KIFA 2FQ3A 5HLHA 3ZMVA 1D3YA 5A2QZ 1DUXC 4LLLA 2MLGA 3GYHX 2EFPA 2EV6A 2YX4A 3F23A 3C7JA 1K78A 2IP2A 1G3YA 3ECOA 5FLXK 4M71A 4CO8A 2IA2A 2EFWA 2VBXA 4KMUX 4U7BA 3RIRA 4KFCA 1Z6TA 1V4RA 3VB2A 2QQAA 2WV0A 2IA0A 1L0OC 2A5YB 3OV8A 3N4MA 1J59A 4D0PA 2XIGA 1LB2A 1EH7A 1O7LA 2P7VB 1FYMA 4AD9A 2LF8A 2QLZA 1RNLA 4HF1A 1YLFA 3I53A 2XV4S 4QLCU 2RQPA 2VC0A 5CYVA 2HTSA 1OYWA 4Q48A 5D8LB 3TQNA 1PUEE 4CGZA 3R0JA 1TTYA 1REPC 2VT3A 4L9VA 5F6FA 1ON1A 4EV0A 1HW5A 3V8LA 3IWFA 2GWRA 3HRTA 4G6DA 4ENJA 1SFUA 2V79A 1D5VA 1W4MA 3Q9VA 4MTDA 2EFNA 2F5EA 4UVAA 3F8MA 3RPQA 1YTYA 1Z7UA 3HYIA 3WE2A 3V4GA 3EDPA 5JHUA 5E20A 4L9JA 4MQ9F 1FBQA 2K27A 2J5PA 4OIQF 2ZNZA 3F3XA 3WTTC 2OD5A 5DCFA 2YR2A 4BYYA 1S7OA 4UHTA 4MGRA 4L18B 4Y17A 4XRFA 3T8TA 2DPDA 1XSDA 2PMHA 3IC7A 1O3RA 3P9CA 1MJBA 5DV5A 2XVCA 1Z91A 2XAFA 4IHTA 4Z2YA 1FBSA 2DQLA 1MDMA 3GFJA 5ICFA 5KVRA 1V3FA 2GAUA 2KIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2E A;  4EM0 B;  3F6V A;  1U5T C;  5HDG A;  5H6R A;  2A3S A;  1FOK A;  3UO2 A;  5FO5 A;  1ZGJ A;  3QU6 A;  4CZZ A;  2M1B A;  4HYE A;  3IKT A;  3MZY A;  2YSR A;  1G3T A;  5CVR A;  1LDJ A;  4A6E A;  2BE5 F;  4S04 A;  3DFG A;  3LAJ A;  4PGH A;  3GFI A;  3KLN A;  4HX7 A;  3GF2 A;  4G8X A;  3I64 A;  3P9K A;  1T38 A;  1FPQ A;  3F6O A;  1G3W A;  1HBX G;  1KGS A;  5LBQ A;  1RUO A;  1XB4 A;  3HRM A;  1XMA A;  2O61 A;  2P5L C;  2O6G E;  1IZ1 A;  1BBY A;  1VTN C;  1YYV A;  4U7D A;  1BC7 C;  4BHC A;  1Y0U A;  3SQN A;  1S7A A;  1FP1 D;  1I6X A;  1B6A A;  2HYG D;  4MEY F;  3L2C A;  3WGG A;  2FBH A;  1SFE A;  3HIF A;  1PDN C;  3WGH A;  1QZZ A;  2ZXJ A;  1FT9 A;  5FB2 A;  3QOP A;  1ZG5 A;  1BI1 A;  4UUV A;  3RYP A;  3KP4 A;  2UZK A;  2MC3 A;  2GIV A;  4U0W A;  5CLS A;  3BY6 A;  2QZ8 A;  1IN7 A;  2P5V A;  3CLO A;  2V9V A;  4QWQ A;  2KJC A;  1H9T A;  2KKO A;  2CSO A;  1DPU A;  4HA8 A;  3KP3 A;  3EET A;  1XMK A;  4O3M A;  5EEG A;  3RJP A;  1HSJ A;  4WXC A;  4YIF A;  4IRG A;  3RKX A;  2EFQ A;  3S2W A;  1CF7 B;  4AIK A;  2B0L A;  2GZW A;  2XRO A;  4OIR F;  3E6D A;  1ZRC A;  4N0B A;  3BOQ A;  2K4J A;  3BWG A;  4ZH4 F;  2PMU A;  3JTG A;  3E6B A;  2FA5 A;  2XAJ A;  5L3F A;  1T0F A;  4NHJ A;  2ESN A;  4HAM A;  2CO5 A;  2CWE A;  2ELH A;  3DPT A;  3F22 A;  5HVQ C;  5D4S A;  2ZNY A;  4PDK A;  3IL2 A;  3I4P A;  2A6H F;  2VBZ A;  2JT1 A;  2LKP A;  4Q47 A;  2DBB A;  4KDP A;  4KIG A;  3ZN0 A;  5E1X A;  3JAM K;  2FSW A;  4LD5 A;  1G4D A;  1XSV A;  1F5T A;  1B59 A;  2D1H A;  2RKH A;  2VE9 A;  2CYY A;  1KQ8 A;  2XKP A;  5L3D A;  2V1U A;  1BI0 A;  3NEU A;  2E7W A;  4R1H A;  4KMF A;  3CDH A;  1BOA A;  3HSR A;  4EJO A;  1D8K A;  5FLX Z;  3QPT A;  2RV8 A;  4WCG A;  1YG2 A;  4HV6 A;  3VOE A;  5HLI A;  5AIQ A;  4ZZL A;  3NQO A;  1T39 A;  2ZME B;  4G94 A;  3KP7 A;  4HLX A;  4L9T A;  5E17 F;  2UXX A;  5J8C A;  2FNP A;  4JQF A;  5CJ9 A;  2QEN A;  3WTU C;  5K5Q A;  2HYF A;  3BVO A;  2RDP A;  4YFN F;  1LQ1 A;  2M8E A;  1Z05 A;  2VOP A;  1BC8 C;  2G7U A;  2HTJ A;  3BP8 A;  2XAS A;  1FYK A;  1YS7 A;  3MCZ A;  3IRQ A;  1SFX A;  4IXA A;  1J75 A;  2NYX A;  1MJA A;  2H94 A;  2DFI A;  5HS9 A;  1HKS A;  4A0Y A;  5TRD A;  1Z9C A;  4HF2 A;  3LA3 A;  4ON0 A;  2MH2 A;  2COM A;  3I59 A;  4IF4 A;  2DK5 A;  4XLP F;  3LA7 A;  4F7Z A;  4MEX F;  3T0Y A;  3EUH A;  1O7F A;  4I0A A;  4L5I A;  5JR3 A;  5LGT A;  3RI4 A;  1J0R A;  2YPR A;  4I02 A;  1FY7 A;  1R7J A;  4MHG A;  2O8X A;  1SAX A;  2IVM A;  1KU3 A;  1G6N A;  4G7H F;  3P9I A;  1UFM A;  1KA8 A;  4EQQ A;  2P6T A;  1WKM A;  3FX3 A;  3WTY C;  4HBL A;  2HFH A;  2GA1 A;  3QP5 A;  5HLG A;  2L3D A;  3G73 A;  1ZLK A;  1CGP A;  3E5Q A;  2QBY A;  1O57 A;  5LEK A;  5K5R A;  3TDZ C;  3D5L A;  3DP7 A;  3VOD A;  3R0A A;  4HQE A;  2QM3 A;  5DDG A;  4BXU A;  1S29 A;  3C1D A;  4LG0 A;  4P96 A;  3LQQ A;  2Z5U A;  2A61 A;  3DEU A;  4G6Q A;  4BHP A;  4U0Y A;  1QGP A;  3EYI A;  4IRI A;  1IF1 A;  3ZMZ A;  2FU4 A;  5DD8 A;  2XAQ A;  2E7X A;  2PEX A;  3ULQ B;  1HKQ A;  5ILV A;  2Q0O A;  3GEZ A;  4TV7 A;  5D8K B;  3RTR A;  1B1B A;  2F5F A;  4XBF A;  2IW5 A;  1TQM A;  2NAZ A;  3LQR A;  3K1M A;  2E1N A;  1ZRF A;  1T98 A;  4A5M A;  4Q5S F;  1UHW A;  3WGI A;  4KUM A;  3CUO A;  4IJA A;  3K1P A;  1ZGA A;  2QQ9 A;  1HW2 A;  3SFZ A;  2CGP A;  2NNN A;  1MD0 A;  3E6C C;  1TNT A;  3H3U A;  1X3U A;  2FOK A;  1I5Z A;  3L09 A;  1RUN A;  3F8N A;  3HRU A;  1OYI A;  1SD4 A;  1XDS A;  1FSH A;  4M9Z A;  2R7F A;  1U8R A;  4ZYG A;  4ETS A;  4I09 A;  5FGM A;  1XN7 A;  4A6D A;  4KNY A;  2FRH A;  3I5U A;  4EGY A;  2V1X A;  1A04 A;  2EWN A;  1KU9 A;  3QU3 A;  4WX9 A;  2O03 A;  4I7H A;  3J7A O;  3B73 A;  4LLG F;  4YFX F;  1LDD A;  2JPC A;  3BJ6 A;  2EV5 A;  1U5T A;  4G7Z F;  4BHB A;  4IPA A;  5L3E A;  2TDX A;  4ENN A;  4LGW A;  4ASN A;  2Y0M A;  1HW1 A;  1N1C A;  4OIP F;  2DTR A;  4HV5 A;  1FPO A;  5DEQ A;  3L00 A;  5D5X B;  3HHG A;  4AIH A;  3M9A A;  4PCQ A;  3T5X A;  3K0L A;  3GXO A;  1ZLJ A;  2W57 A;  3TDU C;  1YW8 A;  1TW3 A;  4WWC A;  4XSX F;  4RGX A;  5IT9 K;  1P92 A;  3REO A;  5LHG A;  2L4M A;  1HST A;  2VC1 A;  3WTV C;  5KK1 A;  1RI7 A;  1P4A A;  3MFK A;  1W7P B;  5LEJ A;  3T1B A;  1RZ4 A;  2ETH A;  3H92 A;  4ESJ A;  1R1U A;  2DI3 A;  2FE3 A;  2EB7 A;  3PFI A;  1YW9 A;  2A6E F;  2M87 A;  1O3Q A;  2O3F A;  4L5J A;  2L54 A;  2PFB A;  4IHS A;  3HRS A;  4ZZD A;  3L7W A;  3AAF A;  2ZKZ A;  3QP6 A;  1Z1D A;  1KU7 A;  2PI0 A;  5HDN A;  4KT5 C;  4RAZ A;  1WWX A;  2ZO4 A;  3ZMD A;  1PP7 U;  5D5W B;  2H6B A;  5ICG A;  3JAM Z;  4IVN A;  1MGT A;  4O5V A;  2F5C A;  2Q8K A;  3WE3 A;  1UCR A;  4M9X A;  5D4R A;  2MD5 A;  3TOB A;  1K78 B;  1U2W A;  1B9N A;  1FZP B;  4KN7 X;  1JE8 A;  2UWM A;  3R6S A;  1K6O A;  2CG4 A;  1XD7 A;  3M7G A;  3GWZ A;  4NQW A;  3CUQ A;  2V1D A;  1FBU A;  1IRG A;  2NRA C;  1S8N A;  4HW0 A;  4HZF A;  3PQK A;  3MEX A;  3ZQ7 A;  5EEH A;  2STW A;  1BIB A;  3U2R A;  2WC2 A;  4AWX B;  4EJT A;  5CVJ A;  3DXJ F;  2VOD A;  1MJ9 A;  2QVO A;  3TGN A;  3ZMU A;  2BV6 A;  1XGN A;  2F2E A;  4M6Y A;  2OQG A;  2OBP A;  4M73 A;  3TO6 A;  3LA2 A;  2CFX A;  2DLL A;  2OA4 A;  3HSF A;  1K79 A;  2ZBK A;  2D45 A;  3DQV C;  2JZY A;  4N9H A;  5DCM A;  2KJB A;  5JI6 A;  3W6J B;  1BI2 A;  5J6X A;  1U78 A;  1LEA A;  2RC4 A;  3F72 A;  4AIJ A;  2BGC A;  2OAZ A;  2XAG A;  4G7O F;  1LDK B;  5TJJ A;  1F4K A;  5LHH A;  5LHI A;  3HOT A;  4HOB A;  6PAX A;  4WXH A;  4RB2 C;  4S05 A;  5JVT A;  2OQR A;  1YFH A;  3F8C A;  3R4K A;  4UVC A;  4P5O A;  1YQA A;  3V7R A;  4GO1 A;  1GXQ A;  2KRF A;  3M8E A;  2JSC A;  4PZJ A;  5D5U B;  2MH9 A;  2VE8 A;  1ZRD A;  3DV8 A;  3U1D A;  3JSP A;  1R58 A;  4EJW A;  2OZU A;  3T8R A;  1HKT A;  3FM5 A;  3ABT A;  2VN2 A;  3ZN1 A;  1T6S A;  3HSE A;  5LGN A;  4EJV A;  2KIU A;  2ZCW A;  2D1V A;  3KP6 A;  1IXR C;  5F64 A;  1MDM B;  1LEB A;  4WXD A;  1G3S A;  3QPH A;  4B8X A;  3O6B B;  2IJL A;  1GXP A;  1U6G A;  3OOP A;  2BEO A;  1QZY A;  3GVA A;  3LAP A;  4HQM A;  3CTA A;  2K4B A;  2UXN A;  3GW2 A;  3GZ6 A;  2RN7 A;  2ADU A;  2YU3 A;  2M30 A;  1B9M A;  2LSO A;  3FF5 A;  1YIO A;  2BBY A;  2HEO A;  3BDD A;  3ROU A;  4LFU A;  1WRJ A;  1SMY F;  1TLH B;  1FLI A;  2EA4 A;  3NRV A;  1F9N A;  3SZT A;  1QPM A;  1OPC A;  2CQK A;  4R79 A;  3C3W A;  4I0B A;  1BN5 A;  1UHM A;  1IUY A;  4O6J A;  3E5X A;  3FXQ A;  3I0T A;  3CO6 C;  2DO7 A;  3GO5 A;  3LFK A;  2WWY A;  2M5W A;  3V7S A;  1FSE A;  2JTV A;  5L3G A;  1JHH A;  4KIB A;  4EVI A;  3I71 A;  5LLQ A;  4I2O A;  1BM9 A;  2A69 F;  1UB9 A;  1R00 A;  4A2U A;  1LJ9 A;  3IHU A;  1QO0 D;  2DPU A;  2K02 A;  3HTU A;  2HWV A;  4Y15 A;  1ZH5 A;  1P6R A;  4WF2 A;  3R60 A;  1XCB A;  2X0L A;  2GXG A;  1JHF A;  3JW4 A;  3ZPL A;  4B09 A;  4GGG A;  3EQL F;  3WTW C;  3KET A;  1DP7 P;  2W84 A;  3K2Z A;  3ISP A;  4YG2 F;  5AON A;  1HQC A;  5ILU A;  2QQB A;  4CXF A;  2VOO A;  4P55 A;  4K2E A;  3J80 K;  1JGS A;  4R8H A;  4MQV A;  1KYW A;  1R36 A;  4OMZ A;  1TQP A;  4LMY A;  2FMY A;  1WI9 A;  3TKY A;  2ISZ A;  4H0E A;  1ZG1 A;  2YX7 A;  1IN5 A;  1DPR A;  3WG9 A;  4ENK A;  4GYI A;  2CW0 F;  3G3Z A;  2Z33 A;  2IT0 A;  3LST A;  4G9Y A;  2HZT A;  3TO9 A;  2IRF G;  4LJZ F;  1TBX A;  3UO3 A;  3GX4 X;  5K1Y A;  1IXS B;  2C6Y A;  2E1C A;  2RNJ A;  3HTS B;  2DU9 A;  5CVI A;  4ZYE A;  2L4A A;  2XGX A;  2LNB A;  1BI3 A;  2P6S A;  1FP2 A;  4XLN F;  4OIN F;  2FML A;  2EA2 A;  2Z99 A;  1ZYR F;  1IRF A;  4DQ2 A;  5IT9 Z;  3B02 A;  4MNU A;  1ZRE A;  3U9G A;  5ERI A;  4DNC A;  2J5O A;  3DKW A;  2NS0 A;  4RGR A;  4AVP A;  5FFX A;  4OU0 A;  5HS7 A;  1AWC A;  1NHA A;  3FXU A;  1GHC A;  3WTZ A;  3KZY A;  4YII A;  2MLK A;  1IN8 A;  2K86 A;  2AS5 F;  3E6M A;  2AXL A;  5CVU A;  4GYG A;  5BOX A;  4Q4Z F;  3V8J A;  2ACJ A;  2H27 A;  1J5Y A;  3SZP A;  3ABU A;  1YO5 C;  3KCC A;  3BPX A;  3QRF F;  1PP8 F;  1ZAO A;  1ZAR A;  5LRR A;  3WOD F;  3CO7 C;  2HS5 A;  1W7P D;  4RAY A;  3JSO A;  5BPD A;  2JRT A;  3Q9S A;  2A07 F;  4HX8 A;  5ILS A;  2HKX A;  3KFW X;  2W25 A;  3ERE D;  1I1S A;  4LK1 F;  4I98 B;  2Z9O A;  2EV0 A;  3EYY A;  4LLN A;  4A12 A;  2ZFW A;  1KQ9 A;  3I58 A;  2LDU A;  5DUI A;  5JFR A;  3DF8 A;  4P9F A;  1OKR A;  1OMI A;  4EM1 A;  1SD6 A;  1B4A A;  4MTE A;  3RYR A;  1H0M A;  5D5V B;  4OOI A;  1S6L A;  2R7D A;  4ESB A;  2QYO A;  4HLY A;  3M8F A;  2HOE A;  4PGG A;  4UV9 A;  1ONV A;  1DDN A;  1XSX A;  3BJO A;  5LRS A;  1UST A;  4UV8 A;  3C18 A;  5DUK A;  2PN6 A;  3KLO A;  4IRH A;  1CF7 A;  2HQN A;  1TNS A;  1O3T A;  3IKV A;  4HF0 A;  1R22 A;  3I59 B;  5FFZ A;  3SXY A;  4I01 A;  3J81 K;  1BIA A;  3DPL C;  3LWF A;  1USS A;  1YW7 A;  1IW7 F;  2L02 A;  1QQI A;  4P9U A;  2HQR A;  1R23 A;  3E3V A;  3ZP5 A;  2EJR A;  1OYY A;  1FC3 A;  2H6C A;  1LVA A;  2PLY A;  4L0Y B;  2IPQ X;  5H20 A;  4BNC A;  4LB5 A;  2ISY A;  2KIF A;  1SD7 A;  2QBY B;  3GFL A;  3MAJ A;  4EGZ A;  1P2F A;  1WSU A;  5E18 F;  5A2Q K;  3SHF A;  1I27 A;  2RVC A;  4CIC A;  4RB1 A;  3F8B A;  1KYZ A;  2Y75 A;  5ICE A;  4E70 A;  4LG0 B;  1KU2 A;  3E5U A;  1XDU A;  2W24 A;  4RGU A;  5IT3 A;  1K7A A;  2QUF A;  2V6C A;  4M6X A;  4RB0 A;  2MA3 A;  5H6Q A;  1JXS A;  3L9F A;  3I54 A;  2HKO A;  4OMY A;  1T2K A;  2PBI A;  1D8J A;  4L0Z B;  1QBJ A;  2ZME A;  5DYM A;  2F5D A;  3RPU A;  2XAH A;  3GLX A;  3HUG A;  4JK1 X;  3FMS A;  3GUD A;  4N9I A;  1E17 A;  2IA1 A;  1HXD A;  3IWZ A;  5HOO A;  2NNY A;  3V7C A;  5F1R A;  2L01 A;  3M1E A;  1W5T A;  1GVJ A;  1TW2 A;  1IN4 A;  4M72 A;  5E1Z B;  1AOY A;  3KEO A;  2RGV A;  3FMR A;  1SD5 A;  4WK8 F;  3GZ5 A;  2HGC A;  1EV7 A;  1ZG3 A;  3FWE A;  4BAY A;  4LK0 F;  2ZJ2 A;  2FF4 A;  1R1V A;  2JPB A;  5ICC A;  3FHZ A;  2OU2 A;  1E2X A;  2FNA A;  4OIO F;  3D0S A;  2EK5 A;  3K69 A;  4FX0 A;  1U5T B;  1Q1H A;  4ENM A;  1SMT A;  3WU1 B;  1FX7 A;  2GXB A;  3K1N A;  3MZH A;  1MKM A;  2Y48 A;  2LF7 A;  2A68 F;  3IRR A;  3FZV A;  2ESH A;  3J80 Z;  3WTS C;  3VFZ A;  2OZ6 A;  2P5K A;  5AIP A;  1FYL A;  1IAW A;  4XSZ F;  3P7N A;  3O2P E;  3CUQ C;  2DQR A;  5CVV A;  1WQ2 A;  2DT5 A;  4EJU A;  3H3Z A;  1ZHF A;  1LNW A;  3MWM A;  1FWZ A;  3ZMT A;  4U88 A;  1TQI A;  5LGU A;  1XGO A;  1O3S A;  2DW4 A;  3PQJ A;  1U3E M;  1P4X A;  4CHU A;  3KP2 A;  4M74 A;  3VEP A;  3TOA A;  3W6K B;  1R1T A;  5D6F A;  1EH8 A;  4IT5 A;  2PG4 A;  3WTX C;  1QNT A;  1RIO H;  2Z3Y A;  1W5S A;  5FD6 A;  2VXZ A;  3FMQ A;  2M45 A;  3K9T A;  1IN6 A;  4KN4 X;  4A5N A;  3COA C;  4UVB A;  4KYW A;  4A0X A;  2HDC A;  2XKO A;  1YS6 A;  3O3K A;  5L3B A;  4NB5 A;  3HHH A;  5HDK A;  2P8T A;  2P4W A;  3FM3 A;  2BYV E;  2P7C B;  4L9N A;  2XHK A;  4GXO A;  5BS6 A;  2PQ8 A;  3BJA A;  5J8F A;  1J7K A;  3JTH A;  2VBW A;  2O0Y A;  3RKY A;  2X4H A;  2VON A;  5FD5 A;  3ELK A;  1F1Z A;  3WU0 A;  1L3L A;  1R5H A;  1ON2 A;  5E1W A;  3QAH A;  5BPI A;  4LB6 B;  5K5O A;  1OR7 A;  1KQ0 A;  5BQT A;  3MQ0 A;  2K7L A;  3ECH A;  3TO7 A;  3KEQ A;  4JBA A;  1ZN2 A;  4FHT A;  2R3S A;  2D2W A;  1BJA A;  4EM2 A;  4BH9 A;  1FNN A;  1EH6 A;  5DD4 A;  4ZYD A;  2DAO A;  2XRN A;  1XCV A;  1XGM A;  3CUQ B;  2FBK A;  4U0V A;  4ZYH A;  5HS8 A;  4RS8 A;  2H09 A;  2XUB A;  5ED4 A;  3GFM A;  3FXR A;  5E8I A;  4ESF A;  4M9S A;  2HR3 A;  2GQQ A;  3BRO A;  3ZMS A;  2VT2 A;  3Q5F A;  3E97 A;  2PJP A;  1H9G A;  1J2X A;  3F21 A;  1I1G A;  4HX4 A;  3KE2 A;  4CYD A;  3F8F A;  2FBI A;  2QWW A;  4UNO A;  1ULY A;  1P4W A;  3CJN A;  4Y13 A;  2W85 A;  2GA2 A;  5E8G A;  4RB3 C;  4HDU A;  1IXC A;  4FT8 A;  3RKW A;  3R61 A;  4UXN A;  4KIC A;  5DCM B;  2MBF A;  1W7P A;  3V8K A;  4KA4 A;  2G9W A;  1S3J A;  4CDG A;  5D6E A;  4A0Z A;  3KZZ A;  3ML6 A;  3RDI A;  2FXA A;  4HDV A;  3J81 Z;  4BQA A;  3N97 A;  2DK8 A;  1J9I A;  1Z6R A;  2EFO A;  3HOS A;  5L3C A;  4EMS A;  1XGS A;  2G7H A;  2STT A;  2WTE A;  3BPV A;  2FEZ A;  1C0W A;  1R5G A;  3KP5 A;  4GCV A;  1MZB A;  5BMZ A;  1ODD A;  4FX4 A;  3BZ6 A;  1STZ A;  2VBY A;  4YFK F;  4RGS A;  4KIF A;  2FQ3 A;  5HLH A;  3ZMV A;  1D3Y A;  5A2Q Z;  1DUX C;  4LLL A;  2MLG A;  3GYH X;  2EFP A;  2EV6 A;  2YX4 A;  3F23 A;  3C7J A;  1K78 A;  2IP2 A;  1G3Y A;  3ECO A;  5FLX K;  4M71 A;  4CO8 A;  2IA2 A;  2EFW A;  2VBX A;  4KMU X;  4U7B A;  3RIR A;  4KFC A;  1Z6T A;  1V4R A;  3VB2 A;  2QQA A;  2WV0 A;  2IA0 A;  1L0O C;  2A5Y B;  3OV8 A;  3N4M A;  1J59 A;  4D0P A;  2XIG A;  1LB2 A;  1EH7 A;  1O7L A;  2P7V B;  1FYM A;  4AD9 A;  2LF8 A;  2QLZ A;  1RNL A;  4HF1 A;  1YLF A;  3I53 A;  2XV4 S;  4QLC U;  2RQP A;  2VC0 A;  5CYV A;  2HTS A;  1OYW A;  4Q48 A;  5D8L B;  3TQN A;  1PUE E;  4CGZ A;  3R0J A;  1TTY A;  1REP C;  2VT3 A;  4L9V A;  5F6F A;  1ON1 A;  4EV0 A;  1HW5 A;  3V8L A;  3IWF A;  2GWR A;  3HRT A;  4G6D A;  4ENJ A;  1SFU A;  2V79 A;  1D5V A;  1W4M A;  3Q9V A;  4MTD A;  2EFN A;  2F5E A;  4UVA A;  3F8M A;  3RPQ A;  1YTY A;  1Z7U A;  3HYI A;  3WE2 A;  3V4G A;  3EDP A;  5JHU A;  5E20 A;  4L9J A;  4MQ9 F;  1FBQ A;  2K27 A;  2J5P A;  4OIQ F;  2ZNZ A;  3F3X A;  3WTT C;  2OD5 A;  5DCF A;  2YR2 A;  4BYY A;  1S7O A;  4UHT A;  4MGR A;  4L18 B;  4Y17 A;  4XRF A;  3T8T A;  2DPD A;  1XSD A;  2PMH A;  3IC7 A;  1O3R A;  3P9C A;  1MJB A;  5DV5 A;  2XVC A;  1Z91 A;  2XAF A;  4IHT A;  4Z2Y A;  1FBS A;  2DQL A;  1MDM A;  3GFJ A;  5ICF A;  5KVR A;  1V3F A;  2GAU A;  2KIM A; 
#chains in the Genus database with same CATH topology
 2Q2E A;  2M0M A;  4EM0 B;  5KCM A;  2P1Q B;  4PSX A;  3F6V A;  1U5T C;  5HDG A;  5H6R A;  2A3S A;  1Q9Y A;  1FOK A;  3UO2 A;  5FO5 A;  2A6T A;  3CQZ J;  1ZGJ A;  1YJN I;  3QU6 A;  4CZZ A;  4F93 B;  2M1B A;  4HYE A;  3IKT A;  3MZY A;  1OCP A;  2YSR A;  3I4M J;  2B63 J;  1G3T A;  3AG1 H;  2DDA A;  3QPL A;  1ZEL A;  1TWH J;  2TRT A;  5CVR A;  3ABM H;  1LDJ A;  4A6E A;  5IYD J;  3HPH A;  1K61 A;  4CCN A;  2BE5 F;  3S14 J;  4S04 A;  3SUP A;  3DFG A;  3LAJ A;  1FMV A;  2KRH A;  4AM3 A;  4PGH A;  1MMO G;  4E7S A;  1SVL A;  3GFI A;  3K6G A;  3KLN A;  4JX6 A;  1W1W E;  2JN6 A;  3L1P A;  3MKS B;  4A93 J;  3SUN A;  3RZO J;  2M4G A;  4HX7 A;  1JJ8 C;  3GF2 A;  4G8X A;  4DTR A;  3I64 A;  2K9S A;  3P9K A;  1T38 A;  1FPQ A;  2W1O A;  4V19 K;  4A3E J;  3S17 J;  2AQF A;  4IQJ A;  1WJD A;  3F6O A;  4EYW A;  1G3W A;  3L8B A;  1X1A A;  3CCL I;  1UHS A;  1HBX G;  1KGS A;  1X1D A;  5LBQ A;  1FZ7 E;  2M7B A;  1RUO A;  1XB4 A;  4DTP A;  3HRM A;  4OAY A;  1XMA A;  3CFO A;  2O61 A;  2P5L C;  1R5I D;  2O6G E;  1IZ1 A;  1BBY A;  3HGL A;  3A02 A;  3ABL H;  2LD5 A;  2DFF A;  3CP8 A;  3C6N B;  1K4S A;  1MMG A;  3BZK A;  1VTN C;  1YYV A;  4U7D A;  1LE8 A;  5GAG J;  3PNY A;  2VQG A;  1Z21 A;  1BC7 C;  5EJC A;  2KP6 A;  3MD2 A;  4BHC A;  1Y0U A;  3SQN A;  1IJW C;  3BC8 A;  3PIO F;  1S7A A;  5FRO A;  1FP1 D;  1I6X A;  3OYK A;  1B6A A;  2GOX B;  2NS8 A;  3ZCO A;  5EF6 A;  2P81 A;  2HYG D;  4MEY F;  2HOT A;  3L2C A;  1BR4 A;  4IO9 F;  3WGG A;  1R49 A;  2FBH A;  1SFE A;  5J1U A;  2KZG A;  3HIF A;  1PDN C;  2WA0 A;  3HL2 A;  2GOM A;  1WAJ A;  3WGH A;  1QZZ A;  2ZXJ A;  1FT9 A;  3K10 A;  1RC9 A;  2Y9Z A;  1GV5 A;  1MBF A;  1V5F A;  5FB2 A;  1ZGW A;  3QOP A;  1ZG5 A;  1BI1 A;  2WAE A;  5FJ8 J;  2DN0 A;  1JKO C;  1GV2 A;  1XC5 A;  3TP3 A;  3SPY A;  2BVM A;  4UUV A;  4FJ5 A;  3RYP A;  3HG9 A;  1ENH A;  1SVM A;  3KP4 A;  3JRA A;  2EBI A;  3PSF A;  2VJI A;  2UZK A;  2MC3 A;  4ZJZ A;  2GIV A;  2OYQ A;  5FKM A;  4U0W A;  3BCA A;  3GTG J;  5CLS A;  3BY6 A;  2VQH A;  4XKB A;  1RES A;  2JH9 A;  3BR3 A;  4DBQ A;  2FYO A;  3M4O J;  2CV0 A;  3M07 A;  2QZ8 A;  1IN7 A;  2P5V A;  5IY5 H;  3CLO A;  3A4C A;  2V9V A;  4QWQ A;  1TZL A;  2KJC A;  3W2A A;  1FZ5 E;  3CFP A;  3QEI A;  1H9T A;  4XLF A;  2KKO A;  2ECB A;  3OL3 A;  2CSO A;  2HQA A;  4XLC A;  5F27 A;  1DPU A;  2L2O A;  3IH2 A;  3EPZ A;  1V55 H;  2FUG 2;  2MW2 A;  4HA8 A;  3KP3 A;  2VJ4 A;  3SQ0 A;  5F04 A;  3J7Z I;  3EET A;  1A35 A;  1XMK A;  4O3M A;  3S16 J;  1TWA J;  3FBN B;  5EEG A;  3RJP A;  1HSJ A;  2JMW A;  3OYB A;  1T8I A;  3TMO A;  3HKZ A;  3LOC A;  4WXC A;  4E6K G;  4YIF A;  4IRG A;  2OV7 A;  3QER A;  3RKX A;  2EFQ A;  3S2W A;  5JHF A;  2LBF A;  4X5M A;  1CF7 B;  3JRE A;  1IV6 A;  4AIK A;  2B0L A;  1EKE A;  2GZW A;  2Z2S B;  2XRO A;  4OIR F;  1ETK A;  4DTJ A;  4RAF A;  3E6D A;  4BGD A;  1OQY A;  3VPR A;  2DTZ A;  4N0B A;  1ZRC A;  3BOQ A;  3S1M J;  2K4J A;  1OCT C;  3BWG A;  4ZH4 F;  2PMU A;  3SDG A;  4DYR A;  4GRI A;  3JTG A;  2UUZ A;  3E6B A;  2FA5 A;  2CQ7 A;  2XAJ A;  5L3F A;  1T0F A;  1VQ8 I;  1ZK8 A;  3CD6 I;  4NHJ A;  2ESN A;  4W97 A;  2EZL A;  4BBS J;  2JQ7 A;  2ICW G;  4HAM A;  1RKT A;  4RLQ A;  2CO5 A;  2CRG A;  2CWE A;  2FX0 A;  2ELH A;  3DPT A;  2QXF A;  1EJ9 A;  3F22 A;  5HVQ C;  2OVP B;  5D4S A;  2ZNY A;  2HXO A;  2X48 A;  4PDK A;  3IL2 A;  3I4P A;  3F0C A;  2A6H F;  2VBZ A;  2JT1 A;  2AHQ A;  2OVQ B;  2LKP A;  4Q47 A;  2DBB A;  4XL9 A;  2IXS A;  2COB A;  3AKZ A;  4AKI A;  1Y8Q B;  4KDP A;  4I6J B;  2H1L A;  4J2E A;  4IZZ A;  1P22 A;  4KIG A;  4DTU A;  3ZN0 A;  1W5C C;  5E1X A;  3JAM K;  2FJ1 A;  4CUG A;  2FSW A;  1MMA A;  4LD5 A;  3OYM A;  1G4D A;  3PJR A;  3HOW J;  3QWL A;  1MBJ A;  3OYL A;  1XSV A;  2R7Z J;  1FZH E;  4F3Q A;  1FZI E;  1F5T A;  1HA8 A;  2P5G A;  1B59 A;  2JH8 A;  4S0H B;  3S3O A;  4ZTJ A;  2D1H A;  1PVE A;  1X2N A;  2GBY A;  2VPR A;  1BW5 A;  2RKH A;  1WCM J;  5DS9 A;  2VE9 A;  3SNN A;  4C2T A;  2CYY A;  1KQ8 A;  4CCK A;  2XKP A;  2V4J C;  4JX5 A;  2EIK H;  2P0W A;  2R7U A;  5L3D A;  2V1U A;  2KDZ A;  1BI0 A;  3NEU A;  2E7W A;  5GTI C;  4RDU A;  4R1H A;  3LNQ A;  3ONQ A;  4KMF A;  3CDH A;  1BOA A;  4LIV A;  2R0Q C;  3HSR A;  2L5Q A;  4EJO A;  1P7I A;  4D5C A;  2QCO A;  3JRI A;  4BJ6 C;  2FD5 A;  3OWT A;  1VQN I;  4AU7 A;  1D8K A;  5FLX Z;  3QPT A;  2RV8 A;  3HOZ J;  4WCG A;  4FJK A;  2I8D A;  1YG2 A;  5KNL A;  2LLK A;  5FRN A;  4HV6 A;  1PJR A;  3VOE A;  1YHQ I;  3OOU A;  5HLI A;  4II3 A;  4BJ5 C;  5AIQ A;  4ABZ A;  4ZZL A;  3NQO A;  1T39 A;  1HF0 A;  3K2O A;  4ADN A;  4DTM A;  2ZME B;  5EZH A;  3RKQ A;  2E2I J;  3HUG B;  1YI2 I;  2MD0 A;  4G94 A;  3G6E I;  2Y0S A;  3KP7 A;  3QYF A;  3PIP F;  4MLO A;  4HLX A;  4L9T A;  5E17 F;  2UXX A;  3CDL A;  5J8C A;  2FNP A;  4JQF A;  1Q1V A;  4B08 A;  1WJE A;  5CJ9 A;  3TL4 X;  3NWT A;  2QEN A;  3WTU C;  3EUK L;  5K5Q A;  2HYF A;  3BVO A;  2LKX A;  3A0B C;  2KL4 A;  2RDP A;  5HLT A;  3LSH A;  2NOG A;  1QHG A;  4DW6 A;  4A3K J;  2R5Y B;  1RKW A;  3K4M A;  1N77 A;  4YFN F;  4B44 A;  1LQ1 A;  3H3V K;  2M8E A;  2DOF A;  1Z05 A;  2VOP A;  1BC8 C;  1IO2 A;  2G7U A;  2HTJ A;  3BP8 A;  5C44 J;  2XAS A;  2OVR B;  1FYK A;  4BBR J;  1YS7 A;  1UZC A;  3MCZ A;  3AFH A;  1S9H A;  3IRQ A;  2B8I A;  4AYB N;  1SFX A;  4IXA A;  2P1M B;  3M3Y J;  1J75 A;  2LY2 A;  2NYX A;  3JR9 A;  1MJA A;  2JK3 A;  1A6Q A;  2H94 A;  2DFI A;  5HS9 A;  1RET A;  3SFI A;  1HKS A;  4A0Y A;  5TRD A;  1Z9C A;  3OIQ A;  4HF2 A;  4IEJ A;  3LA3 A;  4ON0 A;  1IRZ A;  4HPQ A;  3HGK E;  2MH2 A;  2VKH A;  1MBG A;  2R7X A;  2COM A;  3I59 A;  4IF4 A;  2DK5 A;  4XLP F;  3LA7 A;  4F7Z A;  4MEX F;  3T0Y A;  2LG4 A;  3W2W A;  3EUH A;  4M3Z A;  1O7F A;  4I0A A;  4L5I A;  5JR3 A;  4EEF G;  4XOP A;  4J2A A;  5LGT A;  2VLA A;  1B72 B;  4KHS A;  3GBG A;  1J0R A;  2YPR A;  3RI4 A;  4I02 A;  1FY7 A;  2QQ8 A;  1R7J A;  4MHG A;  1OIS A;  2O8X A;  2DA6 A;  1SAX A;  2IVM A;  3FXJ A;  1KU3 A;  4RA2 A;  3QET A;  1G6N A;  5J1R A;  2IS2 A;  2BW3 B;  1TC3 C;  4G7H F;  3RSN A;  3P9I A;  4A3D J;  2PFT A;  1UFM A;  1KA8 A;  4EQQ A;  2P6T A;  1WKM A;  3CME I;  3S3M A;  3FX3 A;  3WTY C;  4CCO A;  4HBL A;  2HFH A;  2GA1 A;  3QP5 A;  3RQ4 A;  1ETX A;  4V2G A;  5HLG A;  2L3D A;  1ETQ A;  3G73 A;  1ZLK A;  1SVO A;  3IAM 2;  2X85 A;  2XSJ C;  2BHY A;  1CGP A;  3DTK A;  1XMF E;  3E5Q A;  3OYD A;  4IOC F;  3TBI A;  3GTJ J;  2QBY A;  3ZQI A;  1O57 A;  5LEK A;  5K5R A;  3TDZ C;  3D5L A;  4B48 A;  1AU7 A;  4XNF A;  3DP7 A;  2DOD A;  1VQ7 I;  3VOD A;  3R0A A;  5DTD A;  3L2O B;  2VKD A;  4A3L J;  4HQE A;  1IRX A;  2QM3 A;  1QRY A;  5DDG A;  1MW7 A;  4BXU A;  4DYC A;  1S29 A;  3C1D A;  4LG0 A;  4P96 A;  3LQQ A;  2DDB A;  2Z5U A;  2NVU B;  2K9Q A;  3SVI A;  2A61 A;  5DM7 F;  3DEU A;  4G6Q A;  1YJW I;  3OGM B;  4BHP A;  4U0Y A;  2WY8 Q;  1YRN A;  1QGP A;  3EYI A;  3OYF A;  2LY1 A;  1IG9 A;  1S7E A;  4PJM A;  1AKH A;  2B7M A;  3GTO J;  4IRI A;  2M2E A;  2XB0 X;  1IF1 A;  3BG9 A;  4JP0 A;  4NNJ A;  3SCX A;  2N8G A;  3ZMZ A;  3GLL A;  2FU4 A;  4PFO A;  3AL0 C;  5DD8 A;  2XAQ A;  1G2H A;  2IGM A;  4M3R A;  2E7X A;  2PEX A;  4M3E A;  2LYC A;  3ULQ B;  3SEZ A;  2R5Z A;  1HKQ A;  1PUF B;  4AUX A;  2BVL A;  5ILV A;  2Q0O A;  1LFP A;  2QSF X;  2DA2 A;  3GEZ A;  4IX7 A;  4TV7 A;  5D8K B;  2JSP A;  3RTR A;  4HNU A;  2JA6 J;  3LSG A;  1B1B A;  3S15 J;  2F5F A;  4XBF A;  5KHD A;  4N4O B;  3E1S A;  2IW5 A;  1GVD A;  2CUF A;  1X1B A;  1TQM A;  2ZJR F;  3GTL J;  2NAZ A;  4M3X A;  3LQR A;  3K1M A;  1WAF A;  2E1N A;  1ZRF A;  2VL8 A;  4M42 A;  1T98 A;  4A5M A;  2YB5 A;  1NK3 P;  3KX2 A;  4Q5S F;  2VXD A;  1UHW A;  4KUM A;  3WGI A;  1E3H A;  2DFE A;  3CUO A;  3K1P A;  1ZGA A;  2QQ9 A;  4IJA A;  4CSW A;  1HW2 A;  3CC2 I;  3SFZ A;  2CGP A;  2O9L A;  2NNN A;  1MD0 A;  1E0E A;  3E6C C;  1TNT A;  3H3U A;  1W0U A;  3FK6 A;  4X5N A;  1X3U A;  5FLM J;  1X1C A;  1LVK A;  4EP9 A;  1RR7 A;  3SQ1 A;  2QEX I;  4JRP A;  2FOK A;  1I5Z A;  2Y69 H;  4J01 A;  5EGO B;  3UKG A;  2L9S A;  4DYQ A;  3L09 A;  1RUN A;  3F8N A;  3HRU A;  4P1W A;  4OAZ A;  1OYI A;  1SD4 A;  1XDS A;  2AXT C;  1XVC E;  2IEK A;  1FSH A;  4M9Z A;  2R7F A;  2GLO A;  1U8R A;  4ZYG A;  4ETS A;  4I09 A;  4CZC A;  5IP6 A;  3OYG A;  5FGM A;  1XN7 A;  5HNH A;  4A6D A;  2L9V A;  1I6H J;  4E7I A;  2FRH A;  3I5U A;  4KNY A;  4DOZ A;  4EGY A;  2V1X A;  3FIS A;  4IL6 C;  3QYB A;  1A04 A;  2EWN A;  1KU9 A;  1Z77 A;  2CUJ A;  3QU3 A;  5IP7 J;  4F92 B;  1XVB E;  1JUM A;  4WX9 A;  3FIW A;  3ABK H;  2O03 A;  1SFK A;  4KT6 A;  4FJN A;  5GPC A;  5EG0 A;  2XAU A;  3OR1 C;  3QEV A;  2L0K A;  4I7H A;  3J7A O;  3B73 A;  4LLG F;  2JA7 J;  5B1B H;  1M1E B;  2L7K A;  2OC6 A;  4YFX F;  1LDD A;  2JPC A;  1YX3 A;  4KHQ A;  3S1Q J;  4NDL A;  2DJI A;  3U21 A;  1U0J A;  2VJJ A;  2EV5 A;  3BJ6 A;  1U5T A;  4G7Z F;  2E19 A;  3OL4 A;  4BHB A;  1Y1V J;  2JJ7 A;  4IPA A;  5L3E A;  2LFB A;  3FXK A;  1H8A C;  2TDX A;  4ENN A;  4LGW A;  4ASN A;  2Y0M A;  1HW1 A;  1N1C A;  4OIP F;  1QHH D;  4Y4R A;  2DTR A;  4HV5 A;  1MH3 A;  4A3B J;  1FPO A;  1VQL I;  5M3M J;  2VOD A;  4CYC B;  1R71 A;  2WBM A;  5DEQ A;  3LSP A;  3L00 A;  5D5X B;  3HHG A;  4AIH A;  3E7L A;  3M9A A;  4RLF A;  4PCQ A;  3TJY A;  3T5X A;  3K0L A;  2X1C A;  2XPV A;  3KPH A;  2IAI A;  2EH3 A;  3GXO A;  2K40 A;  4FAS D;  1HOM A;  1FMW A;  3HDD A;  4JS5 A;  1ZLJ A;  2LH9 A;  2WAQ A;  3A03 A;  2DMT A;  5F1J A;  3DKX A;  1ETW A;  2W57 A;  4XK4 A;  2FW3 A;  4FJL A;  4NC8 A;  1I39 A;  2EIL H;  4C3I J;  2X1E A;  2VUM J;  4J19 A;  3LD8 A;  1XU3 E;  2DT6 A;  3CP2 A;  1RR8 C;  3C6P B;  4F52 A;  4C30 A;  3TDU C;  3CLQ A;  4Y3O A;  1JTX A;  2DEB A;  5KAI C;  1YW8 A;  4DTX A;  1WJF A;  1IDY A;  1TW3 A;  2F4I A;  4WWC A;  3TAG A;  4J2B A;  5IPA A;  4A3C J;  3BG7 A;  4XSX F;  1BL0 A;  4RGX A;  2A5W A;  2LTP A;  1SAU A;  1X4P A;  5HOD A;  5IT9 K;  1MMN A;  4C3J J;  1P92 A;  3DBH B;  3REO A;  5FRM A;  5LHG A;  1FOX A;  2L4M A;  1HST A;  3B6A A;  2VC1 A;  2CUE A;  4PJJ A;  3WTV C;  2MSY A;  1RI7 A;  5KK1 A;  1P4A A;  3MFK A;  1MNE A;  4UUS B;  3DTI A;  1W7P B;  3T1B A;  4E7Z A;  5LEJ A;  3CJQ B;  3QPS A;  1RZ4 A;  3OY9 A;  4E7K A;  3HXL A;  2ETH A;  4FK4 A;  3H92 A;  4FE4 A;  4ESJ A;  4L5E A;  1R1U A;  3BTJ A;  2DI3 A;  2FE3 A;  3NAR A;  2HVQ A;  2EB7 A;  2RQQ A;  4KHU A;  3PFI A;  1YW9 A;  2A6E F;  3G1L A;  2M8G X;  3A2K A;  2VKE A;  2M87 A;  1TWG J;  3ZR8 X;  1O3Q A;  2H1K A;  2JRM A;  2O3F A;  4L5J A;  3S1R J;  5C4X J;  1SAN A;  2L54 A;  2PFB A;  4RM2 A;  1TWF J;  4IHS A;  3H35 A;  1XG1 A;  2FOW A;  3HRS A;  4ZZD A;  3O8G A;  3L7W A;  4M3Y A;  1ZTR A;  3AAF A;  2ZKZ A;  2K9L A;  3Q0W A;  1BA5 A;  1V5G A;  3QP6 A;  3KYD B;  4EPH A;  1Z1D A;  1KU7 A;  4FJX A;  2DMP A;  4IHX A;  5C4J J;  2PI0 A;  5HDN A;  3NAE A;  4IQ4 A;  4KT5 C;  2JHA A;  1X2M A;  4RAZ A;  4YRV A;  2CQN A;  1WWX A;  5DM6 F;  1H88 C;  3E4Y A;  4HG2 A;  4IKF A;  2BY3 A;  5IP9 J;  4PJ0 C;  3E0J B;  4DTN A;  1LKX A;  3HL8 A;  2ZO4 A;  3ZMD A;  1PP7 U;  1JUS A;  5D5W B;  2H6B A;  5F0C A;  5ICG A;  3JAM Z;  4IVN A;  1XVE E;  1MGT A;  1WI3 A;  2F5C A;  4O5V A;  2Q8K A;  1YIJ I;  3WE3 A;  2HU9 A;  5TGT A;  3OYA A;  1QPI A;  2X6W A;  3MZ8 A;  5J47 A;  1UCR A;  4M9X A;  2ME6 A;  5D4R A;  1QA6 A;  2MD5 A;  3TOB A;  3CFR A;  1K78 B;  3BR1 A;  2EIJ H;  1U2W A;  3S93 A;  2O7O A;  1B9N A;  1FZP B;  5FLV A;  4KN7 X;  1JE8 A;  4Z6Y A;  2UWM A;  3R6S A;  4BE2 A;  1K6O A;  2CG4 A;  1VQO I;  3L2V A;  1XD7 A;  3M7G A;  3BQZ A;  3HEF A;  3GWZ A;  4NQW A;  2HPI A;  3CUQ A;  2V1D A;  1FBU A;  1B8I B;  3W2V A;  3CES A;  1P9Q C;  2LOO A;  1IRG A;  1TT0 A;  3ZQQ A;  1XVG E;  2NRA C;  1S8N A;  4N4N B;  4HW0 A;  1I3A A;  4BDZ A;  4HZF A;  3PQK A;  4D7M A;  3MEX A;  4UB6 C;  2IS6 A;  2XGC A;  4FJG A;  4E7J A;  3ZQ7 A;  5EEH A;  2STW A;  1BIB A;  3U2R A;  5B3S H;  3SUO A;  3WU2 C;  3ESW B;  3C95 A;  2ZXW H;  3FXL A;  1VF9 A;  2WC2 A;  4AWX B;  4EJT A;  1OJL A;  5CVJ A;  3DXJ F;  2ZJP F;  1MJ9 A;  3BTC A;  2QVO A;  3TGN A;  3ZMU A;  2HVR A;  1BOB A;  3HBL A;  4M3F A;  2VPL A;  4JS4 A;  2BV6 A;  9ANT A;  1XGN A;  4XN0 A;  4G6T B;  2F2E A;  1TT5 B;  3MN2 A;  4M6V A;  4B43 A;  3H9J A;  4V2F A;  4XRM A;  4A3M J;  4M6Y A;  4PUS A;  5FKO A;  3I9V 2;  3M8J A;  4XLE A;  3L2R A;  2OQG A;  2LC2 A;  4U87 A;  2OBP A;  1JKQ C;  2E2J J;  2DMN A;  4M73 A;  3DLL F;  3TO6 A;  4JRQ A;  4FJ7 A;  3BR6 A;  1IG7 A;  3LA2 A;  2CFX A;  3G71 I;  2JA2 A;  2R92 J;  2DLL A;  1IDZ A;  2OA4 A;  3HSF A;  1K79 A;  3SYT A;  3ZQC A;  2ZBK A;  4XRS G;  2D45 A;  3DQV C;  4ICG C;  2JZY A;  3A0H C;  3IH3 A;  4N9H A;  5DCM A;  3N1E A;  2XF5 A;  5HNF A;  1AHD P;  1R6R A;  2KJB A;  5JI6 A;  2XSD C;  2ZME C;  2CQX A;  3C2B A;  3W6J B;  3DPU A;  5E3M A;  1BI2 A;  5J6X A;  1U78 A;  3CCR I;  1LEA A;  2RC4 A;  3F72 A;  4AIJ A;  2BGC A;  2MG4 A;  2OAZ A;  2XAG A;  4G7O F;  1LDK B;  5IBK B;  3G1M A;  5TJJ A;  3PUF A;  1K4T A;  4BQO A;  1F4K A;  2KDO A;  1WVR A;  4BL0 B;  5LHH A;  5LHI A;  1OCZ H;  2EZI A;  3HOT A;  4HOB A;  3HOX J;  6PAX A;  2MGQ A;  4WXH A;  4RB2 C;  4BY1 J;  4S05 A;  5JVT A;  3A01 A;  3J7A Y;  2K5S A;  1QZE A;  2OQR A;  1U9N A;  1YFH A;  3F8C A;  1P7J A;  3W6V A;  3Q0V A;  2ME0 A;  1HLV A;  3R4K A;  4UVC A;  2AO9 A;  2YUS A;  3OS2 A;  4P5O A;  1YQA A;  4HST A;  3V7R A;  4GO1 A;  2PJR A;  3S8P A;  1GXQ A;  2KRF A;  3M8E A;  4BEH B;  2JSC A;  2LRE A;  3CF5 F;  2L9R A;  3IAS 2;  3P5J A;  3OYN A;  4PZJ A;  2KQR A;  5LD2 C;  1Y1W J;  4MIM A;  5D5U B;  2MH9 A;  2VE8 A;  1GT0 C;  2ID3 A;  3OYE A;  1ZRD A;  3DV8 A;  2DY4 A;  1OCR H;  3HGG A;  4D7N A;  4NC7 A;  3U1D A;  2CS3 A;  2HD0 A;  3JSP A;  1UMQ A;  1R58 A;  2EZH A;  2OZU A;  4EJW A;  3T8R A;  1HKT A;  3FM5 A;  4HCB A;  3ABT A;  2VN2 A;  3ZN1 A;  1T6S A;  1GDT A;  1XPX A;  3HSE A;  2CUZ A;  5LGN A;  4EJV A;  2KIU A;  2ZCW A;  2D1V A;  3KP6 A;  1IXR C;  5F64 A;  1MDM B;  2ZXH A;  1LEB A;  4WXD A;  1G3S A;  3QPH A;  4B8X A;  3O6B B;  2IJL A;  1GXP A;  3QNN A;  3M1C A;  2LKS A;  4IHV A;  1XMH E;  1U6G A;  2Q2E B;  2BEO A;  3OOP A;  1QZY A;  3V7D B;  3QEW A;  2YS9 A;  4LG3 A;  4ZTF A;  1NG7 A;  2LY9 A;  3GVA A;  1MND A;  3LAP A;  2HDW A;  4HQM A;  5H2F C;  3CTA A;  2HOA A;  2HPM A;  4XKC A;  1R4M B;  2WV1 A;  4C2M J;  2KIQ A;  4XQF A;  1FOY A;  2K4B A;  2UXN A;  2VQC A;  3GW2 A;  3GZ6 A;  4UUT A;  2RN7 A;  3OSF A;  2ADU A;  2YU3 A;  3B6C A;  2M30 A;  4XOR A;  1D5Y A;  1B9M A;  5CQE A;  3L2W A;  2LSO A;  3FF5 A;  4X6A J;  1YIO A;  3ZQH A;  2BBY A;  2HEO A;  3BDD A;  3ROU A;  4LFU A;  3CCM I;  3S3N A;  2Z1D A;  1WRJ A;  2HXI A;  1SMY F;  1TLH B;  3DEW A;  2W00 A;  1FLI A;  3QEP A;  1K6Y A;  2EA4 A;  1VQK I;  3NRV A;  4YEJ A;  2H4T A;  1F9N A;  3SZT A;  1QPM A;  1OPC A;  2CQK A;  3DLA A;  2JWT A;  4R79 A;  3LDB A;  3FXO A;  3C3W A;  4I0B A;  1J09 A;  1BN5 A;  2W7N A;  1UHM A;  1IUY A;  3ZQL A;  4RMN A;  2XRL A;  2K9M A;  2UV1 A;  2F6C A;  4O6J A;  4DU1 A;  1EA3 A;  1XMX A;  3E5X A;  3FXQ A;  3I0T A;  2JHP A;  2OZS A;  5EDN A;  3CO6 C;  2IS1 A;  2DO7 A;  3GO5 A;  2X1D A;  3LFK A;  2WWY A;  2M5W A;  1X58 A;  3V7S A;  1DU0 A;  4RNG A;  3PNV A;  1FSE A;  2JTV A;  5L3G A;  4F55 A;  3LMM A;  5EYR A;  1IUF A;  4DU4 A;  4FJI A;  3RMC A;  5J1Y A;  4AYB A;  1JHH A;  2V7F A;  3BTI A;  4KIB A;  4EVI A;  4GFB A;  3I71 A;  2CJJ A;  3GZN B;  5LLQ A;  2V26 A;  4FCY A;  4NUB A;  4I2O A;  1BM9 A;  2A69 F;  1UB9 A;  2RRE A;  1R00 A;  4A2U A;  4DTS A;  1LJ9 A;  3IHU A;  1QO0 D;  1YOV B;  2K02 A;  2DPU A;  3HTU A;  2HVS A;  3CC4 I;  2HWV A;  4Y15 A;  1ZH5 A;  2F48 A;  2Y0S N;  1P6R A;  3BTL A;  3MMY B;  4WF2 A;  3R60 A;  4ZDL A;  4FTH A;  1XCB A;  3BT9 A;  2X0L A;  1Z3X A;  2GXG A;  1JHF A;  5F0H A;  1XU5 E;  3JW4 A;  4LIT A;  3ZPL A;  2CU7 A;  3H5N A;  4B09 A;  4GGG A;  5IOZ A;  3IH4 A;  3EQL F;  3WTW C;  3KET A;  2GM4 A;  1DP7 P;  1UG2 A;  4QNC A;  3GCM A;  2W84 A;  3UIQ A;  2BY2 A;  3K2Z A;  3ISP A;  2LP0 A;  4II2 A;  2DA5 A;  5AON A;  4YG2 F;  1MBE A;  1BW6 A;  1HQC A;  3TP0 A;  1XVD E;  5ILU A;  2QQB A;  4CXF A;  2VOO A;  3NAU A;  4P55 A;  3CQ8 A;  5CKT A;  3MKZ A;  4K2E A;  4GDF A;  5IRE A;  1UJ8 A;  1JGS A;  4R8H A;  4MQV A;  3J80 K;  1KYW A;  1R36 A;  4OMZ A;  1TQP A;  2P1O B;  4LMY A;  5BNG A;  2KZV A;  2FMY A;  1WI9 A;  3KEY A;  4BU2 A;  3WSO A;  1N75 A;  1I50 J;  3TKY A;  1AA7 A;  3UNG C;  3H0D A;  2XPU A;  2ISZ A;  1YJ9 I;  4H0E A;  2E31 A;  1ZG1 A;  2YX7 A;  1OR7 C;  3PO3 J;  1IN5 A;  1DPR A;  2R7S A;  3WG9 A;  4ENK A;  3G2B A;  4GYI A;  2CW0 F;  1WJ5 A;  3GTP J;  1D0Z A;  3G3Z A;  4QIW N;  2Z33 A;  3TAF A;  1D1A A;  4I9L A;  2HI3 A;  2IT0 A;  3LST A;  4G9Y A;  3SJM A;  2HZT A;  3TO9 A;  1JJ6 C;  2Y31 A;  2R7Q A;  3FXM A;  3SEQ A;  4LJZ F;  2IRF G;  1TBX A;  4I9Q A;  4DJA A;  3UO3 A;  3GX4 X;  3S32 A;  5K1Y A;  1G59 A;  3LSJ A;  1IXS B;  2GIZ A;  2C6Y A;  1ERD A;  1FJL A;  4CCL A;  4M3G A;  1FYZ E;  5FKN A;  2E1C A;  3OYH A;  2RNJ A;  1BR1 A;  1S5L C;  3HTS B;  2LBF B;  2DU9 A;  2L7F P;  5CVI A;  4ZYE A;  3BG6 A;  1PYV A;  3QEX A;  1Y6I A;  2L4A A;  2XGX A;  2LNB A;  5IZ7 A;  1BI3 A;  2P6S A;  1FP2 A;  4XLN F;  4OIN F;  4BUP A;  1LFU P;  2HNH A;  2FML A;  3K2A A;  2EA2 A;  3BLY A;  2Z99 A;  1ZYR F;  4E3S A;  1IRF A;  4DQ2 A;  2W48 A;  5IT9 Z;  1OCC H;  2WAF A;  1TP4 A;  3B02 A;  4MNU A;  1ZRE A;  3U9G A;  2LF3 A;  5ERI A;  2OTJ I;  4DNC A;  2J5O A;  3DKW A;  3KYC B;  1MMD A;  2NS0 A;  3H9Q A;  4M41 A;  5GPA A;  4RGR A;  4AVP A;  5FFX A;  4OU0 A;  5HS7 A;  1AWC A;  2K85 A;  4ZDO A;  3IUO A;  1UG0 A;  1NHA A;  3FXU A;  2PX9 A;  3FK7 A;  1GHC A;  3WTZ A;  1Z0X A;  3C2G A;  3ZXS A;  3KZY A;  2WY7 Q;  4YII A;  3K4C A;  2MLK A;  4MFD A;  2XB5 A;  4DZJ A;  4AI6 A;  2QSH X;  3S2H J;  2D5V A;  1IN8 A;  2K86 A;  2AS5 F;  1APL C;  3E6M A;  1N78 A;  2AXL A;  2CW8 A;  2ZFU A;  5CVU A;  4GYG A;  5BOX A;  1FZ4 E;  4KHW A;  3NHG A;  1WGX A;  2PMZ N;  2NVY J;  4Q4Z F;  3V8J A;  5CPR B;  2K5C A;  1J5Y A;  4BKX A;  2ACJ A;  2H27 A;  3SZP A;  3GME A;  1FZ2 E;  3ABU A;  1YO5 C;  3KCC A;  3BPX A;  4BQN A;  3QRF F;  3Q3S A;  2M4K A;  1ZAO A;  2V9K A;  1PP8 F;  3KD1 E;  1ZAR A;  5LRR A;  3WOD F;  3CO7 C;  2HS5 A;  3TAB A;  2JUG A;  1FZ1 E;  4OWR B;  2W4S A;  4I99 C;  4XMY A;  1W7P D;  4RAY A;  1FIP A;  1XVF E;  1FS1 A;  1CLQ A;  3BCB A;  3JSO A;  1W36 D;  1ITY A;  1MBK A;  3PNT A;  5BPD A;  2JRT A;  3Q9S A;  3H1C A;  2A07 F;  3RWU A;  3D1N I;  3H5A A;  4HX8 A;  5ILS A;  2E5Z A;  2HKX A;  3KFW X;  2W25 A;  3ERE D;  1R4N B;  4Y33 A;  3QES A;  1I1S A;  1W36 C;  4LK1 F;  3V42 A;  2JQT A;  1X1P A;  1JI8 A;  3L2Q A;  3LZJ A;  4QSH A;  3D5S C;  2XF7 A;  3JRC A;  2ZXI A;  1D0X A;  4I98 B;  2Z9O A;  2V6E A;  3N1B A;  4PJL A;  1RRJ A;  2EV0 A;  2XC7 A;  2JA8 J;  3EYY A;  4LLN A;  4A12 A;  2WB1 N;  2ZFW A;  5GTH C;  1SEU A;  1KQ9 A;  3I58 A;  2LDU A;  5B66 C;  3L2U A;  1VQP I;  5DUI A;  1QU3 A;  5JFR A;  3DF8 A;  4P9F A;  2B7E A;  1OKR A;  3O8H A;  5J4V A;  1OMI A;  1ORK A;  2Q1Z B;  5E3O A;  4EM1 A;  1SD6 A;  2DXI A;  2LRD A;  1ZR2 A;  1B4A A;  4MTE A;  3RYR A;  1LPQ A;  3RMD A;  5IOY A;  1H0M A;  4CCM A;  5D5V B;  3X2Q H;  4A3F J;  4DTO A;  4BE1 A;  4OOI A;  1S6L A;  2R7D A;  4ESB A;  3RMA A;  5H37 A;  2QYO A;  3K4J A;  4FJ9 A;  4FJH A;  1ZQ3 P;  4AKH A;  2NVX J;  4KI6 A;  3OMY A;  1V54 H;  3M8F A;  4HLY A;  2HOE A;  1WFX A;  4PGG A;  4UV9 A;  3VSL A;  2ZJQ F;  2Y30 A;  1ONV A;  1DDN A;  1XSX A;  2AQE A;  3BJO A;  3QYE A;  4BXF A;  5LRS A;  2CW7 A;  1UST A;  4RG8 A;  1ZR4 A;  2JVH A;  4UV8 A;  3C18 A;  5DUK A;  2PN6 A;  2BOL A;  3KLO A;  5GAH J;  4IRH A;  1CF7 A;  2E1M B;  2HQN A;  1FZ0 E;  1TNS A;  1O3T A;  4JX4 A;  3NGI A;  3OIO A;  3IKV A;  1ETY A;  2DYS H;  1R22 A;  1Y8R B;  4HF0 A;  4C3H J;  3I59 B;  3BR0 A;  3DTE A;  5FFZ A;  4BAC A;  3SXY A;  4I01 A;  1F36 A;  2MYS A;  1BIA A;  3J81 K;  3TED A;  4M3U A;  1MH4 A;  4BS9 A;  1ZKG A;  2OPT A;  3DPL C;  4MO7 A;  3LWF A;  1NK2 P;  5K7Z A;  1USS A;  1IH7 A;  1N25 A;  1YW7 A;  4AKG A;  1IW7 F;  3DKY A;  2L02 A;  1QQI A;  4P9U A;  2HQR A;  5E3N A;  1I3Q J;  3CJR B;  1R23 A;  3E3V A;  2G0E A;  3ZP5 A;  4IHW A;  2A05 A;  2EJR A;  3LSK A;  1OYY A;  2M0C A;  4ZDP A;  4PJN A;  2X6X A;  2XGE A;  1TL8 A;  1FC3 A;  1HDD C;  2HQ5 A;  2H6C A;  2WAQ N;  1A36 A;  1LVA A;  4ANJ A;  2PLY A;  2QSG X;  2V9P A;  4XKV A;  3CCJ I;  4L0Y B;  2IPQ X;  5H20 A;  2Z16 A;  4KHN A;  3VSK A;  4BNC A;  4LB5 A;  2ISY A;  2KIF A;  3SDB A;  4B1R A;  1SD7 A;  2VIX A;  5FKK A;  1FZ8 E;  1POG A;  2ATQ A;  4M3T A;  2QBY B;  3GFL A;  1WZ2 A;  3CDI A;  1E3P A;  1P2F A;  3MAJ A;  4EGZ A;  1WSU A;  3BG5 A;  3RCO A;  5E18 F;  5A2Q K;  3OYI A;  3SHF A;  1I27 A;  1MHY G;  2RVC A;  4CIC A;  1TWC J;  2E35 A;  3BG3 A;  4RB1 A;  2R7W A;  1V5E A;  3EUA A;  3F8B A;  1KYZ A;  2Y75 A;  2XF6 A;  1U8B A;  3TL8 B;  1YE9 A;  5ICE A;  2O8K A;  3NWS A;  4E70 A;  4LG0 B;  3K4K A;  1KU2 A;  3E5U A;  2NS7 A;  1XDU A;  2W24 A;  4RGU A;  4QPQ A;  3ZRG A;  5IT3 A;  3CF2 A;  3F9K A;  1YRN B;  2DMQ A;  4KHY A;  1K7A A;  3AG2 H;  2QUF A;  2V6C A;  4M6X A;  4RB0 A;  1AKH B;  2MA3 A;  1VQ9 I;  3KIO A;  4UB8 C;  4CA0 A;  5H6Q A;  3S9H A;  2MFZ A;  2ZB9 A;  1JXS A;  1UAA A;  3L9F A;  1KON A;  2QA4 I;  3I54 A;  2HKO A;  4OMY A;  1T2K A;  2I5U A;  3OGL B;  4BQQ A;  4AID A;  2PBI A;  1D8J A;  1Y0N A;  4L0Z B;  2ID6 A;  2R5Z B;  2KPM A;  2KFD A;  3OGK B;  4C2U A;  2MZW B;  3C94 A;  1X3Z B;  2BXZ A;  1QBJ A;  2LF6 A;  1WPK A;  2ZME A;  5DYM A;  3VWB A;  2F5D A;  3RPU A;  2XAH A;  3NCI A;  3GLX A;  3HUG A;  4JK1 X;  3FMS A;  3GUD A;  2LK2 A;  2RNG A;  1T33 A;  2BZT A;  2VB6 A;  5IYC J;  5M3F J;  4N9I A;  3CCU I;  1E17 A;  3SJJ A;  2IA1 A;  2VKV A;  3D5R C;  2VI6 A;  3I4N J;  1HXD A;  3IWZ A;  3C6O B;  5HOO A;  4FE7 A;  3L0M A;  2ECC A;  3K4L A;  2NNY A;  2VJ5 A;  3GTK J;  1Q9X A;  2DA4 A;  3V7C A;  3FDY A;  5F1R A;  2IBD A;  2L01 A;  4YEL A;  4FET A;  4RL5 A;  3M1E A;  1W5T A;  1G8X A;  1Y56 A;  2B9S A;  1BJZ A;  1GVJ A;  2M34 A;  1TW2 A;  2KMU A;  1IN4 A;  3IV5 A;  4M72 A;  5E1Z B;  3CCE I;  2R5Y A;  3DU6 A;  3VYT B;  3J27 A;  3PUB A;  2KLO A;  4CH7 A;  1JUP A;  1AOY A;  3KEO A;  2IGO A;  4XLA A;  3J7Y J;  3LSM A;  1FEX A;  2RGV A;  2XGD A;  3FMR A;  1SD5 A;  4WK8 F;  3GZ5 A;  2HGC A;  1MTY G;  3HZJ A;  1EV7 A;  1ZG3 A;  3FWE A;  4BAY A;  3CMY A;  4LK0 F;  3HGY A;  2ZJ2 A;  1FTZ A;  1H89 C;  2FF4 A;  5JVG F;  1R1V A;  2R93 J;  2JPB A;  2MMB A;  3Q0U A;  1FZ9 E;  1F43 A;  5ICC A;  3FHZ A;  2OU2 A;  3RMB A;  4E7H A;  2KIS A;  1E2X A;  5EG0 B;  2FNA A;  2MW8 A;  4OIO F;  2W82 A;  2K3F A;  1DP3 A;  2EZK A;  1JGG A;  3RPU D;  3D0S A;  2EK5 A;  2CQQ A;  2R7O A;  1B72 A;  4FK2 A;  3K69 A;  1VQ6 I;  1MIJ A;  4FX0 A;  3J2P A;  2EIM H;  5M5W J;  1U5T B;  1OFC X;  3WHC A;  1Q1H A;  4ENM A;  3DU5 A;  1SMT A;  3WU1 B;  1FX7 A;  3CMM A;  4AC0 A;  1XL3 C;  1GUU A;  5F0F A;  3ZQF A;  2GXB A;  2BW3 A;  4A3G J;  2NXN B;  3AG4 H;  2FQ4 A;  3K1N A;  3QQA A;  3HC7 A;  3G1O A;  1JT0 A;  3MZH A;  4I6Z A;  1MKM A;  2Y48 A;  2LF7 A;  2A68 F;  2M3A A;  1IGN A;  2ELK A;  3I3L A;  3FZV A;  3IRR A;  2ESH A;  3H9G A;  3KZI C;  3J80 Z;  3WTS C;  4J2D A;  3VFZ A;  5GAE J;  2OZ6 A;  2P5K A;  1Z3Y A;  2LMD A;  3QOD A;  5AIP A;  1X3W B;  2NOJ B;  1FYL A;  3BR5 A;  5J4Y A;  2HDD A;  1IAW A;  4X0G A;  2R4G A;  4XSZ F;  5B1A H;  3P7N A;  2JA5 J;  3SPZ A;  3O2P E;  3CUQ C;  2DQR A;  3CJT B;  5CVV A;  1WQ2 A;  3JRD A;  1D0Y A;  5B5E C;  3LSI A;  2DT5 A;  5F08 A;  3BQY A;  3QNO A;  4EJU A;  4BE0 A;  3H3Z A;  1YIT I;  3DEE A;  1ZHF A;  3HKZ N;  3SZG A;  2NVT J;  1VQM I;  4B47 A;  1LNW A;  3MWM A;  1FWZ A;  3ZMT A;  2R7T A;  4PFP A;  1MSF C;  4U88 A;  4NC6 A;  1TQI A;  5LGU A;  1XGO A;  4B3A A;  1O3S A;  2DW4 A;  3PQJ A;  1U3E M;  1P4X A;  1T56 A;  2MC4 A;  3KP2 A;  4M74 A;  5IYB J;  1X4O A;  3VEP A;  2HOS A;  3DWL E;  3GTQ J;  4XON A;  3TOA A;  2VQL A;  3W6K B;  4KJZ A;  1R1T A;  5D6F A;  3E4W A;  1EH8 A;  4IT5 A;  1OLT A;  2PG4 A;  3WTX C;  3CCY A;  3VYS B;  4HNV A;  1WJA A;  1QNT A;  1PUF A;  1RIO H;  2Z3Y A;  1W5S A;  5FD6 A;  2VXZ A;  3FMQ A;  4D9J A;  4H4K C;  4F91 B;  2M45 A;  2L9N A;  4XR6 A;  3K9T A;  4IHY A;  4Y52 J;  2Y2Z A;  1IN6 A;  4KN4 X;  4A5N A;  3COA C;  4UVB A;  3L1N A;  4KYW A;  4A0X A;  2HDC A;  2XKO A;  3PM1 A;  1YS6 A;  2V1N A;  3OR2 C;  3O3K A;  4RAG A;  2QF7 A;  4CCJ A;  5L3B A;  3OYC A;  4NB5 A;  4A3I J;  1IV8 A;  3HHH A;  3KD5 E;  5HDK A;  3IP4 B;  2P8T A;  1DGR M;  4B4C A;  2P4W A;  3FM3 A;  1FIA A;  2BYV E;  3FBI B;  2P7C B;  4DGW B;  1A5J A;  3SQ4 A;  4A69 C;  2P1N B;  4L9N A;  1GLN A;  2XHK A;  3ASO H;  4GXO A;  2OJE D;  5BS6 A;  5LFA A;  3PFY A;  3HP9 A;  2PQ8 A;  3BJA A;  2OUM A;  4G12 A;  1J7K A;  4HSR A;  4XM3 A;  5J8F A;  3JTH A;  1LDK E;  2VBW A;  2HZD A;  4D5F A;  2O0Y A;  2K9N A;  3RKY A;  2X4H A;  2VON A;  4RBO A;  1SFO J;  1FOW A;  5FD5 A;  3ELK A;  1F1Z A;  5EGO A;  3WU0 A;  1T95 A;  4B3X A;  1A31 A;  2WAD A;  1L3L A;  1R5H A;  1ON2 A;  5E1W A;  3QAH A;  5BPI A;  4LB6 B;  2ZC2 A;  5K5O A;  1OR7 A;  3MKY B;  1ETO A;  1KQ0 A;  2B1E A;  1UEL B;  5M5X J;  3QOE A;  5BQT A;  3MQ0 A;  2K7L A;  3ECH A;  4MFE A;  4NBQ A;  3TO7 A;  3CZ6 A;  2E32 A;  3VYU B;  3KEQ A;  1MSE C;  4JBA A;  2DMU A;  1JTY A;  3LDS A;  1ZN2 A;  4XID A;  1DGW Y;  5EEA A;  4FHT A;  2R3S A;  3CCS I;  4FJM A;  2D2W A;  2LVS A;  1K83 J;  1T0F C;  3OS0 A;  1BJA A;  4EM2 A;  4RM3 A;  4BH9 A;  1LE8 B;  1FNN A;  2KRC A;  1EH6 A;  3DBR B;  5DD4 A;  4ZYD A;  2P5O A;  2DAO A;  1WH5 A;  2XRN A;  4NQW B;  1XCV A;  1MMS A;  1XGM A;  3CUQ B;  2FBK A;  4U0V A;  2OCE A;  4ZYH A;  4QPO A;  5HS8 A;  2CFO A;  1X19 A;  3W3C A;  2R7R A;  2DJN A;  4HCC A;  4YIR X;  4RS8 A;  2H09 A;  2XUB A;  3HPG A;  5ED4 A;  3GFM A;  3FXR A;  2JVG A;  2CMP A;  5E8I A;  4ESF A;  1FXX A;  3I56 I;  1VI0 A;  1ETV A;  1NG6 A;  4CYC A;  1NH3 A;  4M9S A;  5C3E J;  3JRF A;  2HR3 A;  2GQQ A;  3TW7 A;  3BRO A;  3ZMS A;  1WH7 A;  4XKW A;  3OYJ A;  2VT2 A;  3Q5F A;  4ZC3 A;  3E97 A;  4AVZ A;  2PJP A;  1H9G A;  4PSW A;  4ZYA A;  1J2X A;  3I55 I;  3K70 D;  3CCV I;  3F21 A;  1I1G A;  2X6Y A;  4D1Q A;  1HDP A;  3BZC A;  4HX4 A;  1DQU A;  5GP9 A;  2CH0 A;  2IGK A;  4X1E A;  4XIC A;  3KE2 A;  3LZI A;  4CYD A;  5K7H A;  4UY8 I;  3N05 A;  3K70 C;  3F8F A;  2FBI A;  2QWW A;  3H0G J;  1Y39 A;  1MNM C;  3JRG A;  4UNO A;  3OSG A;  2IGN A;  1ULY A;  1P4W A;  2CV1 A;  3CJN A;  5EZG A;  4XRS A;  4Y13 A;  2W85 A;  2GA2 A;  5E8G A;  3LL7 A;  3ZOB A;  2VAS A;  3LSR A;  1XTA A;  4RB3 C;  2NVQ J;  1WHU A;  4ITV A;  4HDU A;  1IXC A;  4FT8 A;  3RKW A;  3HOU J;  2XDV A;  4HEA 2;  3R61 A;  4UXN A;  2QGU A;  1HC8 A;  1XS9 A;  1RPW A;  4KIC A;  5DCM B;  2BY1 A;  4DIQ A;  2GXA A;  4HRI A;  1W0T A;  4XOT A;  2MBF A;  2X51 A;  3RZD J;  2EQR A;  1VND A;  3JRH A;  4XN3 A;  2K3P A;  4UUS A;  1W7P A;  3A1Y A;  1A6I A;  5J3L A;  4M3W A;  3V8K A;  4KA4 A;  2G9W A;  1VQ5 I;  2DOE A;  1S3J A;  4CDG A;  2JHC A;  4EAT A;  4DU3 A;  5D6E A;  4A0Z A;  1E3O C;  2DTU A;  3FHN A;  1VZ0 A;  3KZZ A;  3ML6 A;  3RDI A;  2FXA A;  4HDV A;  3S2D J;  3J81 Z;  4GAM C;  4BQA A;  4JYK A;  2DA3 A;  2EIN H;  2DK8 A;  3N97 A;  2P1P B;  1J9I A;  1Z6R A;  3FKI J;  3A01 B;  2EFO A;  3MKW B;  3HOS A;  1LUJ B;  3MKL A;  2M9H A;  2L7Z A;  5L3C A;  3JCU C;  2OZM A;  4FVM A;  1XX5 A;  4EMS A;  3OS1 A;  2PJR B;  1XGS A;  2G7H A;  2PFV A;  4E4H A;  4BXX J;  4QTR A;  2DT7 B;  2ELJ A;  4M3B A;  3JRB A;  2STT A;  2WTE A;  3BPV A;  2FEZ A;  2RAE A;  1C0W A;  2IS4 A;  2PMZ A;  4HNT A;  3S1N J;  1R5G A;  3KP5 A;  2JPN A;  4GCV A;  1MZB A;  2BY0 A;  5BMZ A;  2DOA A;  3SI6 A;  1ODD A;  1Z7L A;  2E60 A;  2O5R A;  4FX4 A;  3BZ6 A;  1STZ A;  4DZP A;  2VBY A;  3OIP A;  4YFK F;  4RGS A;  4KIF A;  1KZH A;  2E1M C;  2FQ3 A;  1FZ6 E;  5HLH A;  3ZMV A;  4E4B A;  1D3Y A;  5A2Q Z;  1DUX C;  2L7M P;  4LLL A;  2MLG A;  3GYH X;  4I76 A;  2EFP A;  2EV6 A;  2YX4 A;  3HOV J;  3F23 A;  3C7J A;  3UR3 C;  1K78 A;  2IP2 A;  2F5V A;  1G3Y A;  1QVT A;  2BHZ A;  3ECO A;  3EUH C;  5FLX K;  4M71 A;  4CO8 A;  4BDY A;  2H8W A;  5GAD J;  2ZSI B;  4FJJ A;  1XMG E;  2IA2 A;  2EFW A;  4C9Y A;  3VDX A;  3ERM A;  1O4X A;  3CMA I;  2JUC A;  2VBX A;  3K4N A;  4KMU X;  3HJE A;  4U7B A;  1S72 I;  3AG3 H;  3KYL A;  3RIR A;  2R7V A;  4KFC A;  1Z6T A;  1V4R A;  5TIS C;  2F4O B;  2QQA A;  2WV0 A;  3HB9 A;  3VB2 A;  1B8I A;  2IA0 A;  1L0O C;  2E71 A;  5M5Y J;  2A5Y B;  2E2H J;  1NTC A;  3OV8 A;  3N4M A;  2DCE A;  3GTM J;  1WJC A;  1DU6 A;  2WB1 A;  2DFH A;  3SQ2 A;  4PK4 A;  5JLW A;  1J59 A;  4D0P A;  2XIG A;  4ADO A;  1LB2 A;  1EH7 A;  1O7L A;  3NE6 A;  2P7V B;  1VFC A;  4DBR A;  1NEX B;  5KAF C;  3G4S I;  1FYM A;  3ZGK A;  4KIS A;  4AD9 A;  2LF8 A;  4FJ8 A;  2QLZ A;  3WHB A;  4M45 A;  1RNL A;  4HF1 A;  5JLX A;  1YLF A;  4BY7 J;  1U9O A;  3WG7 H;  3TAE A;  3I53 A;  2XV4 S;  4F