2RKHA

Crystal structure of a putative apha-like transcription factor (zp_00208345.1) from magnetospirillum magnetotacticum ms-1 at 2.00 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
164
Chain Sequence
TLTPKEAVRLCALGTIASQPMRYSELAGSVRHFTSRIMGPSLELMGISIELLRYEGLVEAVDAMLAISAAGRRELHSLLTARLRPGSDLSKLVVALKMRFLGLMEAEERAHQIDLLIEGVDSELARLADLRGGEGGSALAAWLDHDMALLESRLAWLEDFRARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative AphA-like transcription factor
publication title Crystal structure of a putative AphA-like transcription factor (ZP_00208345.1) from Magnetospirillum magnetotacticum MS-1 at 2.00 A resolution
rcsb
source organism Magnetospirillum magnetotacticum
total genus 49
structure length 164
sequence length 174
ec nomenclature
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rkhA01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 2rkhA02
3WTSC 5ILVA 5BPIA 1YW9A 1P4AA 4KIBA 1JGSA 1O3TA 4CICA 3DXJF 1BI3A 3FMSA 1U5TC 2QUFA 2EJRA 2G9WA 4I0BA 1ZG5A 3FMQA 3GFLA 3BZ6A 4OMYA 2VE9A 1FYMA 3HRUA 1FSEA 5LBQA 4HZFA 3PQJA 3CTAA 2LKPA 3ZN0A 3E3VA 2IW5A 3EDPA 3TOBA 1PUEE 4Z2YA 5ICEA 1FY7A 5KVRA 1YQAA 3EYYA 3GVAA 1I1SA 1G3YA 1LJ9A 1R36A 2XASA 2OQGA 4OMZA 1KU7A 2IA2A 2F5EA 4G6DA 5K5RA 4I98B 4EJWA 2FMYA 2TDXA 3KCCA 2EK5A 2M8EA 4A12A 2PN6A 3ZP5A 3T0YA 1O57A 3VOEA 4IHSA 1N1CA 1TW3A 4YFKF 3E6BA 1O3SA 3BROA 5DDGA 3M8EA 1G3WA 4L0YB 1FOKA 1Y0UA 3I5UA 1MDMA 3KP6A 4A0XA 1SFXA 3E6MA 3LAPA 2UZKA 1YS7A 2BE5F 3JTHA 3KP7A 4KYWA 2B0LA 2PBIA 1L3LA 1IN7A 1ZREA 1ZGJA 3KLOA 1R23A 4R8HA 2DPDA 1FPOA 3CJNA 4XBFA 2P4WA 3KE2A 1SD6A 2QQBA 1QNTA 1GVJA 1XGNA 2F5CA 4AWXB 1IRGA 1TQMA 2FRHA 5EEHA 2EFQA 4MTEA 3JAMK 3KEOA 1LEAA 4XSXF 2L4MA 4CZZA 3GWZA 1E2XA 2M45A 5ERIA 3K1PA 5FO5A 3ZQ7A 5D4RA 2RDPA 3V7RA 4G7ZF 3SHFA 1K6OA 5LHIA 5F6FA 4CHUA 1P92A 3K69A 2NS0A 3CLOA 5HOOA 5JI6A 1LB2A 3V8JA 3R6SA 3GLXA 1FT9A 2XHKA 1ZHFA 3BPVA 1Z91A 1U8RA 1XSXA 3N97A 4KUMA 4UVBA 4KN7X 1XMKA 2QQAA 2YX7A 3CUOA 1KYZA 3F8BA 2BBYA 3LWFA 3E5UA 4I0AA 3F23A 1ZLJA 1OYYA 1DDNA 4P96A 5E1WA 2KIUA 4OIRF 4CO8A 1J2XA 3U2RA 5L3EA 1YTYA 2XVCA 4PDKA 2WC2A 3FXQA 3FWEA 4I7HA 5CJ9A 3RTRA 2WWYA 5CVUA 3V8KA 1G3TA 3GX4X 4HLXA 2RNJA 5K5QA 2ZNZA 1U2WA 3Q5FA 3V4GA 1SD5A 5F1RA 1HW5A 3MCZA 3ZMSA 2ESHA 1HXDA 1EH7A 3ZMDA 2L02A 5E18F 1BC8C 2CG4A 4KIFA 5BMZA 1XSDA 2V1UA 2H6CA 3U9GA 3ERED 2P5VA 1FX7A 1SMYF 4N9HA 5DD8A 3O3KA 1J7KA 2DK5A 1F5TA 2O3FA 3D0SA 3L09A 1JHHA 2A61A 4KMUX 3SZTA 2J5OA 3COAC 2D45A 4ESBA 4HDVA 1BM9A 2HGCA 1WSUA 1KU2A 4Q47A 4EM2A 4N9IA 3DF8A 3WTUC 4ENMA 1K78A 3HSEA 1IN5A 4ZH4F 3IRRA 1YO5C 2STWA 4GYIA 3K9TA 2PI0A 3CUQC 3K0LA 2MC3A 2EFOA 3JSPA 5H20A 3JW4A 3HTSB 3RDIA 4ZYGA 3LSTA 3F22A 1FPQA 3HRMA 4P55A 2YX4A 2QBYB 2M1BA 1Z6TA 2M87A 4BHCA 3TDZC 3J7AO 4HDUA 4ON0A 3QPTA 2FNAA 3QPHA 1G3SA 4DQ2A 4GCVA 3OOPA 4PZJA 4IPAA 4FT8A 4L9VA 2WTEA 1FP2A 2M5WA 4WK8F 2MLGA 1MJ9A 5ICCA 2IT0A 3C7JA 2GXGA 1IAWA 3SQNA 3M1EA 3IRQA 2DI3A 2ZFWA 5AIPA 1Z6RA 4FHTA 2VOPA 3B02A 4U0WA 2VBWA 5FGMA 4OU0A 5FFXA 4ZYDA 4HAMA 5K1YA 1ONVA 1XCVA 4XLNF 4FX0A 3F6VA 3TOAA 1RNLA 2QENA 4L18B 5H6QA 4AIJA 2OQRA 4IT5A 3N4MA 3I71A 2UWMA 3F8FA 1TLHB 1G6NA 1R1TA 2DQRA 2K7LA 5CVIA 1BIBA 4BHPA 1CF7A 3TO9A 2FU4A 3GYHX 1IZ1A 1S6LA 5D5UB 3DPLC 2VBXA 3F72A 1W5SA 4A2UA 4KNYA 1WRJA 3LA3A 5DCMA 4LLGF 4KN4X 3QRFF 3FXUA 5FB2A 1STZA 2FNPA 1SD7A 4BH9A 2H27A 2H94A 1YIOA 4GGGA 4B8XA 3LFKA 1FSHA 1KQ9A 1YFHA 1OMIA 2HR3A 2FXAA 3IWFA 2ZMEA 3LA2A 2XUBA 2XAFA 3BJAA 3HHHA 4UNOA 4EJUA 4P5OA 2QBYA 3HUGA 4Q48A 3BJ6A 4RAZA 1MJBA 3RKYA 3RIRA 3F8MA 4IXAA 4HV5A 1K7AA 1TBXA 1UCRA 4EJTA 4YG2F 4GO1A 1E17A 1HBXG 1RZ4A 2O6GE 1SFEA 1R5GA 5L3DA 2Z3YA 2Z9OA 1QPMA 3ROUA 4BXUA 2FF4A 2YU3A 3VFZA 5D8KB 1KYWA 4IHTA 4HX8A 1BBYA 2CSOA 3F8CA 5HS8A 1U78A 4YFXF 4M6YA 4P9FA 2V79A 4RGUA 3I4PA 4UUVA 2FMLA 1U5TB 2O61A 2DBBA 3HOTA 4WCGA 1G4DA 5LLQA 5LHHA 3GFMA 4ESFA 2HTJA 1S8NA 3WE3A 1RUOA 1ZG1A 1ON2A 1O3QA 1K79A 2EV6A 1WWXA 2EFPA 3I58A 3TO7A 3F21A 5HVQC 2D1HA 2D1VA 1FLIA 4A0YA 3R60A 3IKTA 5ICGA 2PLYA 3WTYC 2VT2A 1XN7A 2W57A 3EETA 1U3EM 2ZNYA 2FQ3A 1Q1HA 4BNCA 1IXSB 1T2KA 2QM3A 5L3BA 2A68F 5JFRA 2DFIA 4R1HA 2V6CA 5IT9Z 2JSCA 3G73A 2HZTA 2ZCWA 1Z1DA 2EWNA 2HS5A 5JHUA 4MTDA 1FBQA 1VTNC 1QQIA 1KU3A 2GZWA 1REPC 2DPUA 4IRIA 1XGMA 2ADUA 2NNYA 4R79A 2L01A 5D8LB 1IXRC 1WI9A 3LAJA 3TO6A 2RVCA 2CW0F 1S3JA 2FSWA 2J5PA 3GUDA 2VXZA 5IT3A 3QU3A 4NB5A 2IP2A 1ZLKA 2HYFA 4QLCU 2XAHA 4EM1A 4JBAA 3Q9SA 1FWZA 4KMFA 2W24A 3RKWA 4ZZDA 1EH8A 4Y13A 5DD4A 1HKTA 3IL2A 3ECOA 1J75A 2EB7A 2P8TA 4OIOF 2KIFA 3P9KA 4UV8A 2FOKA 4XRFA 5HS9A 2ISZA 3T5XA 4ZZLA 1KU9A 1KGSA 3GW2A 3WGHA 5HLIA 3UO3A 3I64A 1MD0A 2VBZA 1FNNA 1U5TA 4U7DA 4EQQA 3MAJA 3FXRA 5AONA 2YSRA 1DP7P 4M74A 4PGHA 2PQ8A 2Z33A 1ZG3A 4YIFA 3D5LA 1ZYRF 3CDHA 1TW2A 4F7ZA 3HSRA 3M8FA 2ZO4A 3BWGA 2DW4A 3P9IA 5L3GA 3KETA 5ILSA 2K4BA 5FFZA 1IW7F 1ODDA 2FE3A 2ZKZA 1C0WA 2GA1A 4M71A 4UVAA 5FLXZ 2F5FA 1EH6A 1K78B 3SZPA 2MH2A 3EUHA 4L9NA 3J80K 2FBKA 3QOPA 3ISPA 4AIKA 2HYGD 4O5VA 5D5WB 4S04A 3FMRA 1D3YA 1WKMA 3GZ5A 5DEQA 2L3DA 3GXOA 4L9JA 2VONA 1DUXC 2ELHA 5ILUA 3O2PE 2LDUA 1R7JA 4Q5SF 4A5NA 1XD7A 1QZZA 2JT1A 4MEYF 2K27A 3L2CA 2FA5A 5DYMA 2Q8KA 1H9TA 4UXNA 4AVPA 2R7DA 3LA7A 2AXLA 5K5OA 2VOOA 3GEZA 3BVOA 4S05A 3ML6A 2HQNA 2E7WA 1BI2A 2O0YA 2HWVA 3MFKA 4IVNA 2MA3A 4NQWA 2PG4A 5CLSA 1FBUA 5DUIA 5E20A 1GHCA 4KA4A 1XDUA 1JE8A 2XV4S 1AOYA 3WTZA 4Y17A 4YIIA 4DNCA 4HW0A 2O8XA 3F8NA 2GXBA 2OD5A 5J6XA 1FC3A 1V3FA 2A69F 3DFGA 3LQQA 4HF1A 4EGYA 4LLNA 1TNTA 4G7HF 1FYLA 4EMSA 5DV5A 2R3SA 1R00A 3WTXC 1SD4A 3R0JA 3V7CA 1CF7B 4IRHA 2VT3A 5DCMB 2BYVE 4LLLA 1RI7A 2CQKA 2Z99A 1X3UA 4G7OF 4LB5A 5J8FA 4XLPF 2XKPA 5D6FA 4B09A 3KP4A 3IHUA 1ZH5A 5D6EA 3PFIA 4RB0A 3E5QA 5D4SA 3DV8A 2P5LC 2DO7A 2HQRA 4I2OA 1BI1A 1QZYA 2ZMEB 3DPTA 2XIGA 4JK1X 1LDJA 1R5HA 3I0TA 1OPCA 1XMAA 2K4JA 1GXPA 5E17F 2P5KA 4LB6B 4M6XA 3T8TA 3WODF 3ZMUA 1I5ZA 3HIFA 3W6KB 3FM5A 3WU1B 4UV9A 2X4HA 2BGCA 5LGNA 4A6DA 1UB9A 1YLFA 2EV5A 1WQ2A 1B1BA 3ELKA 3R0AA 2LSOA 3WGIA 1IUYA 2HTSA 3KP5A 5D5VB 1LEBA 4G8XA 2BV6A 5BPDA 2HFHA 4MNUA 3MZHA 1KA8A 5FLXK 3E5XA 3C18A 2XAGA 4OINF 5H6RA 2PMUA 3GO5A 4I01A 3MEXA 4ENJA 3REOA 1YW8A 2GA2A 3WU0A 2JTVA 4RS8A 4JQFA 3CUQA 3M9AA 1BN5A 4K2EA 2RN7A 4HF2A 4LK0F 3K2ZA 5CVRA 3IC7A 3RYRA 4CDGA 1USSA 2KKOA 3TKYA 4A6EA 4NHJA 4EGZA 3MQ0A 3KZYA 3OV8A 3VODA 2H09A 2G7UA 3QAHA 3SXYA 3RJPA 1R1VA 3DP7A 5HDKA 2CFXA 4YFNF 4HQEA 2L4AA 5CYVA 2STTA 4ASNA 2XROA 5F64A 4A0ZA 4I02A 2NYXA 1I6XA 3BY6A 3WTVC 1B9NA 5TRDA 2XGXA 2PFBA 2QZ8A 1V4RA 3JTGA 1R1UA 1IN6A 3E6DA 4LG0A 5D5XB 4RGXA 2OAZA 3FF5A 3ULQB 1MZBA 2Z5UA 4HA8A 3Q9VA 4L5IA 2ZJ2A 2ETHA 3KEQA 1LDKB 4RGSA 4WWCA 3H3ZA 3S2WA 1ZRCA 4O6JA 1QBJA 4G9YA 3ABUA 2JRTA 2HKOA 2MBFA 1MGTA 1EV7A 3DKWA 3I59A 3BDDA 2QWWA 4PCQA 5LHGA 5HLHA 1SAXA 3MZYA 2QLZA 3ECHA 3H3UA 3I54A 2A07F 5FD5A 1P6RA 2IPQX 1J5YA 2X0LA 1I1GA 4LK1F 1T98A 3UO2A 3NEUA 4HQMA 5L3FA 1O7LA 2XAQA 4Y15A 1HQCA 3ZMTA 5LEJA 5E1ZB 1B4AA 2LF7A 1D5VA 3F6OA 5HDGA 1T39A 1H0MA 1KQ0A 4FX4A 1F4KA 2QVOA 1B9MA 5E8GA 3H92A 2UXXA 5HS7A 1T38A 2COMA 4KIGA 1LDDA 5JR3A 1OR7A 3J81Z 1HW1A 2P6TA 2FBHA 1DPRA 3QU6A 5A2QZ 4H0EA 4BYYA 1P4WA 4KFCA 3FX3A 3EQLF 2JPCA 3FZVA 2DT5A 1U6GA 2XAJA 1R58A 1DPUA 3V7SA 3RPUA 4Q4ZF 1SFUA 5FD6A 3VEPA 5DCFA 2K02A 1PP7U 3MWMA 3K1NA 1OYWA 2E7XA 5EEGA 2OU2A 4RB2C 1ZRFA 2G7HA 3BOQA 4M9XA 1PP8F 2YR2A 3EYIA 3T8RA 2IA0A 1TNSA 4HV6A 4EVIA 1R22A 4LFUA 1XGOA 2XRNA 2EA4A 5AIQA 2RKHA 5BQTA 4MHGA 3C3WA 1W7PA 4I09A 2OZ6A 1MKMA 3BPXA 4M73A 2GWRA 1ZN2A 1BJAA 2A6HF 1JHFA 2MH9A 4RAYA 2NNNA 5E8IA 4LD5A 2M30A 1W7PD 1JXSA 4L5JA 1OKRA 2DLLA 4XSZF 3IKVA 3K1MA 3R4KA 4UVCA 4TV7A 2ISYA 2VC0A 2C6YA 3RKXA 3ABTA 4U0YA 1F9NA 4IRGA 3B73A 4G6QA 2LF8A 4QWQA 3KZZA 3W6JB 1FYKA 3G3ZA 1D8KA 2IJLA 4EJVA 5LRRA 1QGPA 5BS6A 2RV8A 2IVMA 3WGGA 3HTUA 4IF4A 5L3CA 5J8CA 2DQLA 3KFWX 1OYIA 2VN2A 4AIHA 2FBIA 1FP1D 1Z9CA 1HW2A 2KRFA 3WG9A 2PMHA 3V8LA 4BHBA 1IXCA 3GFIA 1F1ZA 3R61A 1PDNC 2W85A 2UXNA 2VC1A 2W25A 1IN8A 2JPBA 2H6BA 3GFJA 4LMYA 1ZGAA 4HLYA 2A3SA 3GF2A 1ON1A 1RUNA 4M72A 1ZARA 1Z7UA 3LQRA 2PJPA 4RGRA 4HOBA 5LRSA 2F5DA 2GIVA 2IA1A 2DTRA 2MD5A 2IRFG 4MQ9F 1W5TA 1CGPA 4CGZA 2OA4A 2LNBA 5LGUA 3DQVC 4WXCA 4GYGA 3RI4A 2NRAC 2RGVA 1UHWA 2EFWA 2EV0A 2QYOA 1HKSA 1T0FA 2VBYA 4EJOA 4MEXF 1YS6A 4P9UA 3J81K 1LQ1A 3VB2A 3I53A 5A2QK 2DK8A 4HBLA 1TQPA 2Y75A 1T6SA 1RIOH 3DEUA 4GXOA 5IT9K 2GAUA 3WTWC 4O3MA 3C1DA 3CUQB 1XB4A 1HSJA 2PEXA 4M9SA 1BC7C 4E70A 5TJJA 3T1BA 1YYVA 1BI0A 5KK1A 2RC4A 3WTTC 3SFZA 4WF2A 3QP5A 2E1NA 2CO5A 4MQVA 4ENKA 4L9TA 5DUKA 1Z05A 3L9FA 5CVJA 4CXFA 1XCBA 5JVTA 2D2WA 4ENNA 3E6CC 4EM0B 4OOIA 4LGWA 2P7VB 3IWZA 5LGTA 3TGNA 4LG0B 1UFMA 3ZN1A 1IF1A 4BAYA 3NRVA 3HSFA 2NAZA 4U7BA 1KQ8A 3GZ6A 2HKXA 2HEOA 4ZYEA 2K86A 2CGPA 1B6AA 1BOAA 2A6EF 2F2EA 3WE2A 3AAFA 3ZMVA 1I27A 3CO7C 3E97A 3O6BB 5ED4A 3I59B 4ZYHA 2VE8A 3JSOA 1XDSA 4HYEA 2HOEA 2L54A 4AD9A 4L0ZB 2OZUA 2EFNA 1ZRDA 3BJOA 2ACJA 1ZAOA 3RPQA 2ESNA 5E1XA 4KICA 1XGSA 2O03A 3FM3A 2P6SA 1LVAA 2RQPA 1P2FA 1GXQA 3NQOA 4HX7A 2DAOA 1S7AA 2BEOA 2P7CB 2JZYA 2DU9A 3BP8A 1O7FA 2FEZA 3HRSA 1FZPB 3TQNA 3CO6C 3HYIA 1SMTA 2WV0A 4WXDA 2OBPA 1J59A 2Q2EA 4G94A 4U88A 4WX9A 3P9CA 4UHTA 4OIQF 1QO0D 3FHZA 1TTYA 2V1DA 2KJBA 4A5MA 1YW7A 4RB1A 3HHGA 4D0PA 1NHAA 2W84A 1UHMA 5ICFA 1FBSA 1AWCA 1D8JA 3HRTA 2R7FA 1USTA 1HKQA 2V9VA 3QP6A 1LNWA 3JAMZ 3F3XA 6PAXA 3PQKA 1J9IA 1YG2A 1O3RA 4EV0A 2KIMA 2KJCA 4LJZF 4OIPF 2Y0MA 3U1DA 1TQIA 1BIAA 3KP2A 1A04A 3HOSA 4PGGA 3P7NA 4KDPA 2CYYA 3J80Z 2EA2A 3KLNA 3ZMZA 1IN4A 1MJAA 1P4XA 1S7OA 1W7PB 2MLKA 3M7GA 3RYPA 2CWEA 2ZBKA 2YPRA 3L7WA 2QQ9A 2AS5F 4M9ZA 4KT5C 2HDCA 4MGRA 5LEKA 2V1XA 2GQQA 1HSTA 1J0RA 1W4MA 4BQAA 1ULYA 4IJAA 5HDNA 1MDMB 4HF0A 4HX4A 5BOXA 1L0OC 4N0BA 2A5YB 4U0VA 1B59A 4RB3C 5HLGA 4ETSA 4WXHA 3ZPLA 4ESJA 3TDUC 3L00A 1S29A 2VODA 1IRFA 4CYDA 5CVVA 2XKOA 2ZXJA 3KP3A 2E1CA 1H9GA 1XSVA 2Y48A 2Q0OA
chains in the Genus database with same CATH superfamily
2VQHA 1XPXA 2H4TA 4RNGA 3CCYA 3WTSC 5ILVA 5BPIA 4UY8I 1YW9A 1P4AA 4KIBA 1NK2P 1T95A 4RA2A 3PO2J 2DT7B 3L2VA 3BQZA 1JGSA 4GRIA 4IO9F 1ZR2A 1O3TA 4JS4A 4CICA 3OYGA 3DXJF 1BI3A 2DTZA 3FMSA 1U5TC 2QUFA 2EJRA 2G9WA 4XIDA 3BR3A 4I0BA 1ZG5A 2MG4A 3FMQA 2IEKA 3GFLA 3DBLB 3JRFA 3BZ6A 4CUGA 3HPGA 2W48A 4AI6A 4C2MJ 4OMYA 3CCSI 2VUMJ 2VE9A 4II2A 1WFXA 3HRUA 1FYMA 1FSEA 2RCUA 4AYBN 5LBQA 4DYQA 1QA6A 3UIQA 4DTOA 4HZFA 4B3XA 3PQJA 3CTAA 2LKPA 5JHFA 3ZN0A 1IRZA 4RG8A 4KI6A 1YHQI 1RESA 3E3VA 5GPCA 2IW5A 3AG1H 3EDPA 4M45A 3ERMA 1QRYA 3Q0WA 3TOBA 1PUEE 3AL0C 1IDYA 4Z2YA 1X2NA 1FY7A 5ICEA 3HGLA 4BDYA 5F08A 5KVRA 3SJMA 1IUFA 1YQAA 3EYYA 1W0UA 2F4IA 1FIAA 1WH5A 2VXDA 3GVAA 1VQ6I 3Q0UA 1WJEA 1I1SA 3TP3A 3GMEA 1G3YA 2KIQA 1LJ9A 4IQ4A 1LVKA 5GPAA 1R36A 3CF2A 2XASA 3PNYA 2OQGA 3A2KA 4OMZA 4XRMA 2IA2A 1KU7A 1WVRA 1OCZH 2F5EA 4B47A 1U9OA 4G6DA 3EUHC 3K7AJ 4FCYA 1A6IA 4B44A 3CQ8A 5K5RA 4I98B 4EJWA 3HXLA 4HSRA 2FMYA 3W3CA 3SDBA 3DLLF 2TDXA 3KCCA 2JVHA 4J2BA 2EK5A 2M8EA 3CCUI 4A12A 4E7IA 3BR0A 2QGUA 3K4MA 2PN6A 1T33A 3ZP5A 3T0YA 3HOWJ 1O57A 3VOEA 4IHSA 2BY1A 2JUCA 1N1CA 1TW3A 2NXNB 1ITYA 4YFKF 1PJRA 3E6BA 2DFFA 1O3SA 3BCBA 4HRIA 4LOCA 3S32A 2O9LA 3BROA 5DDGA 5E79C 3M8EA 1QHGA 1G3WA 4L0YB 5J1RA 1JW2A 3ASNH 5KHDA 2R7ZJ 1EA3A 1FOKA 1Y0UA 4XRSA 3FHNA 1FZ9E 3I5UA 1MDMA 3KP6A 1IV8A 2IS2A 1X1BA 4A0XA 1SFXA 4YEJA 4BBRJ 3E6MA 5GTIC 3LAPA 2UZKA 3K70D 1YS7A 2WAEA 2WV1A 3NWSA 2BE5F 3JTHA 3K4BA 3KP7A 4DYRA 3C2BA 4KYWA 3OGLB 2B0LA 2PBIA 2R93J 3LSGA 1L3LA 1IN7A 1ZREA 2ZJQF 1ZGJA 3KLOA 1R23A 4R8HA 2DPDA 1RRJA 3SQ1A 1FPOA 5DS9A 3D5RC 1D1BA 2IGOA 3CJNA 4XBFA 2L7FP 2P4WA 4N4NB 3KE2A 1V54H 1SD6A 2QQBA 2CS3A 2N8GA 1QNTA 1R6RA 3OYFA 1GVJA 1XGNA 2GIZA 1KZHA 2F5CA 4AWXB 1IRGA 1TQMA 2FRHA 5EEHA 2EFQA 4MTEA 3JAMK 3KEOA 2VKHA 1LEAA 4CCOA 4UUSB 1XVEE 5FRMA 4XSXF 3TW6A 2L4MA 4CZZA 5FKKA 4PJNA 4XLCA 3GWZA 1A35A 1E2XA 3VSKA 4KJZA 2X6WA 3H5AA 2M45A 4W97A 2EIKH 1RKWA 3U1KA 5ERIA 4A3LJ 2B8IA 3K1PA 5FO5A 3ZQ7A 1X2MA 5D4RA 2RDPA 5BNGA 3V7RA 4G7ZF 3SHFA 1K6OA 2P1OB 3OYJA 2QA4I 3Q3SA 5LHIA 3L0MA 2HVQA 5F6FA 3AKZA 4CHUA 2RNGA 1P92A 4EP9A 2DA2A 2BZTA 3K69A 2NS0A 2E1MC 2K85A 3V42A 3CLOA 5HOOA 5JI6A 1LB2A 3NGIA 3V8JA 2E2HJ 3R6SA 3GLXA 1FT9A 4XKBA 2XHKA 1ZHFA 3K6GA 3LFUA 3OL3A 3BPVA 3IAS2 1Z91A 2KT0A 4FJNA 2Y2ZA 3PIPF 1U8RA 3C2GA 4M42A 1XG1A 2VJIA 1XSXA 3N97A 3IH2A 2X6OA 1ETWA 4KUMA 4UVBA 5FLVA 1G59A 4KN7X 3A0HC 3VYRB 1XMKA 2EIJH 1FZHE 3IH3A 2JVGA 1MBGA 2QQAA 2YX7A 3CUOA 1FTZA 1KYZA 3F8BA 2BBYA 3LWFA 5B66C 2DMTA 3E5UA 4I0AA 3ABKH 3F23A 1ZLJA 1OYYA 4QPQA 2BXZA 5F04A 4FJ5A 4HNTA 1GV2A 2E35A 1DDNA 4P96A 2L9SA 3VDXA 5E1WA 2KIUA 1YJNI 1A31A 4KHWA 4OIRF 4CO8A 1J2XA 4IL6C 2QKMB 1U0JA 3U2RA 5L3EA 1YTYA 1A36A 3SQ2A 2XPWA 2XVCA 5FJ8J 4J19A 4PDKA 4D5CA 2X6YA 2WC2A 1FOWA 3A01A 4JRPA 1T56A 3FXQA 3SUPA 1FMWA 4BDZA 3FWEA 4I7HA 5CJ9A 4YIRX 3MKZA 2JHAA 3RTRA 4GAMC 2WWYA 5CVUA 5B1BH 3V8KA 1Z3XA 5EZGA 1G3TA 3GX4X 4HLXA 4ZC3A 2RNJA 2VKEA 3QOEA 5K5QA 2M34A 2DA3A 1U2WA 2NOGA 2ZNZA 3Q5FA 2HI3A 2M8GX 1Y8QB 3V4GA 1SD5A 2DFHA 5F1RA 1HW5A 1TWHJ 1SFKA 3HOXJ 3MCZA 3ZMSA 2ESHA 1HXDA 1EH7A 3ZMDA 2W7NA 2L02A 3CMEI 2KPMA 2L0KA 5J4YA 4AYBA 3OYHA 5E18F 2FW3A 1BC8C 1XTAA 3BTJA 4M3GA 2CG4A 4KIFA 5BMZA 1XSDA 2V1UA 2H6CA 3U9GA 3HGKE 3ERED 4J2EA 2P5VA 2PFTA 2M0CA 1TWGJ 4ZJZA 4CSWA 1FX7A 4AKHA 1SMYF 3CDIA 3BG7A 4N9HA 1H88C 2VQLA 4B48A 5DD8A 1LFPA 3O3KA 3D1NI 3HM5A 2Q2EB 1J7KA 3BTLA 1IGNA 1WZ2A 3L2WA 4FJJA 2DK5A 3RMAA 1F5TA 2O3FA 3LMMA 3D0SA 3L09A 1JHHA 2A61A 4KMUX 3SZTA 1MMGA 2J5OA 3COAC 3S17J 3TBIA 2D45A 1ETQA 4M6VA 4ESBA 4C2UA 1U9NA 2EINH 4HDVA 1BM9A 2ZSHB 2HGCA 5FKNA 2V9KA 1KU2A 2M9HA 3C2HA 1WSUA 3MKSB 4XKWA 1K4SA 2DJNA 4Q47A 4EM2A 4N9IA 3DF8A 4BQNA 3WTUC 4XOTA 4ENMA 3HP9A 1K78A 1VQ7I 3HSEA 2Z1DA 1IN5A 4ZH4F 2H8RA 1MBFA 3IRRA 2LOOA 3HBLA 1YO5C 3GLLA 2STWA 4GYIA 3K9TA 4QSHA 2PI0A 2Y69H 2RAEA 3CUQC 3K0LA 2MC3A 3NARA 3CMAI 2EFOA 3JSPA 3HJEA 5H20A 3JW4A 3HTSB 1WJFA 3RDIA 1T08B 1JT6A 4ZYGA 3LSTA 3HZJA 2EZKA 3OS0A 5M3FJ 3HOUJ 3UNGC 4XLEA 5J4VA 3F22A 1FPQA 1M1EB 3HRMA 4P55A 2QEXI 2YX4A 3PJRA 2QBYB 2ZC2A 2M1BA 1Z6TA 3HUGB 2M87A 4RAGA 4BHCA 3NDKA 3TDZC 2AHQA 3DEWA 1YJWI 3J7AO 3TP0A 4HDUA 3HGGA 4ON0A 3I55I 3QPTA 1XVCE 3Q0VA 1XU5E 2FNAA 1MSEC 1P7IA 3BG6A 3QPHA 1G3SA 2OVQB 4DQ2A 2XGEA 1QVTA 3OOPA 4GCVA 4MIMA 4IPAA 4PZJA 4FT8A 4IOAF 4L9VA 3ONQA 2WTEA 1FP2A 3FIWA 4XOPA 2M5WA 3BR1A 4WK8F 1OQYA 1N25A 1TWAJ 2KP6A 2MLGA 1JKPC 1MJ9A 5ICCA 2IT0A 3DPUA 2KZGA 3C7JA 2GXGA 4V2GA 4CA0A 1P7JA 1LE8A 1IAWA 3SQNA 3M1EA 3IRQA 1SVOA 2DI3A 3G4SI 1AHDP 1GVDA 2ZFWA 2OCCH 3W2VA 1WAJA 5AIPA 1Z6RA 4FHTA 4M3DA 4CCJA 3A0BC 2VOPA 3B02A 4U0WA 4A3IJ 2VBWA 5FGMA 2KDZA 1FZ6E 4BEHB 2BY2A 2HNHA 4OU0A 5FFXA 4CCNA 4ZYDA 3C6OB 4HAMA 5K1YA 3HL8A 3F9KA 3H36A 4XKCA 1ONVA 2B7MA 1XCVA 4BY1J 4BE0A 4II3A 1MMAA 4XLNF 4FX0A 3F6VA 1EKEA 1FIPA 2YB5A 3TOAA 5GAEJ 1B72A 2KDOA 4X5MA 3S8PA 3RZOJ 3RWUA 1RNLA 2QENA 4L18B 5IZ7A 2LBFB 5H6QA 2F48A 4AIJA 2OQRA 4IT5A 1MW7A 3PUFA 3N4MA 3HOZJ 3I71A 1N78A 4QNCA 2UWMA 3F8FA 4A3KJ 1R4MB 2HOTA 5B5EC 3HOVJ 1WJ5A 1TLHB 1G6NA 4BJ6C 1R1TA 2DQRA 2HYJA 2EQRA 2K7LA 3GTLJ 1JKOC 5CVIA 4DTRA 1BIBA 1Z0XA 3WU2C 4BHPA 1CF7A 2HQAA 2K9SA 2FU4A 3TO9A 3GYHX 3TMOA 1IZ1A 1S6LA 5D5UB 2ZJPF 3DPLC 3S1QJ 2VBXA 3F72A 1W5SA 4A2UA 4XORA 1OFCX 2MFZA 2E2JJ 4KNYA 1WRJA 3LA3A 5DCMA 4LLGF 4KN4X 3QYBA 3QRFF 3FXUA 1SFOJ 2R7VA 4D7NA 3FBNB 2R7OA 5FB2A 1STZA 2FNPA 2FX0A 1UG2A 4DU4A 1SD7A 5HLTA 1IH7A 1XMHE 4X1EA 1QHHD 2JUGA 3O8GA 3I56I 4BH9A 2XSJC 2H94A 2H27A 1YIOA 2M2EA 4GGGA 4M3FA 3KZIC 4HG2A 4C30A 4B8XA 1RPWA 2X51A 5E3NA 3LFKA 4X0GA 3MZ8A 1FSHA 1KQ9A 1VQMI 3BC8A 1YFHA 3E1SA 2ZB9A 1OMIA 2CUZA 1HOMA 2HR3A 2V7FA 2WA0A 2FXAA 4I9LA 1MBEA 3OL4A 1VNDA 3IWFA 2ZMEA 3LA2A 4MO7A 2XUBA 2QSFX 2NS7A 2XAFA 2XB0X 1X4PA 3BJAA 3L2RA 3HHHA 3BZKA 4UNOA 3G2BA 4EJUA 3PNVA 4M3UA 4P5OA 3JR9A 2QBYA 3HUGA 4Q48A 3S93A 3BJ6A 4RAZA 4ZDLA 1MJBA 3RKYA 4GDFA 3RIRA 4X5NA 1U8BA 1WPKA 2P5GA 5M5WJ 3F8MA 4HCBA 4IXAA 2KISA 4HV5A 4I76A 1K7AA 1TBXA 1UCRA 2PX9A 3CP2A 1ERDA 1D0ZA 3B6CA 1RC9A 4EJTA 3WHBA 4YG2F 4GO1A 1E17A 1MH4A 1V5FA 1HBXG 1RZ4A 2O6GE 3AFHA 3PSFA 1OCTC 1SFEA 3SCXA 1R5GA 5L3DA 2Z3YA 2Z9OA 1QPMA 3ROUA 4XN0A 4BXUA 2YU9J 2FF4A 1LDKE 2YU3A 3VFZA 5D8KB 4XRSG 1KYWA 5TGTA 3SFIA 4XL9A 4IHTA 4HX8A 4E7SA 4HPQA 3B6AA 2MW2A 3QESA 4RLQA 1BBYA 5IYDJ 3LNQA 2CSOA 3F8CA 5HS8A 1U78A 1W1WE 1Y1WJ 3KYLA 2L9RA 4YFXF 4M6YA 1SAUA 4PK4A 4BEHA 4P9FA 2V79A 4RGUA 3CP8A 4F3QA 5E3OA 3I4PA 4QPOA 4UUVA 3ZCOA 2FMLA 1U5TB 2O61A 2HOSA 1YRNB 4Y7NJ 4DTNA 2DBBA 1MMNA 1ZKGA 2NVYJ 3HOTA 4WCGA 1G4DA 2TCTA 5LLQA 5LHHA 1IDZA 2O7OA 3GFMA 4ESFA 2HTJA 1S8NA 4ZTJA 3WE3A 3OSFA 1RUOA 3H3VK 4CYCB 4NDLA 4HNUA 3VYUB 1ZG1A 3CFOA 1ON2A 2LBFA 3HL2A 2A6TA 1O3QA 1K79A 2EV6A 4BQOA 5FKMA 1WWXA 1KONA 2EFPA 1YIJI 3I58A 1JTYA 2CUJA 3TO7A 3F21A 5HVQC 3NE6A 4A3BJ 2D1HA 2D1VA 3VYSB 2H8WA 3E0JB 4A69C 3GTOJ 3JRAA 2CV1A 1FLIA 3SPZA 4A0YA 1MSFC 3HC7A 3R60A 2R7QA 4BL0B 1CLQA 3IKTA 5ICGA 1RKTA 2PLYA 3F0CA 3WTYC 1OISA 4B43A 2VT2A 1XN7A 2OC6A 2W57A 2L7KA 3EETA 1U3EM 3ZOBA 5IP9J 4G12A 1MHZG 2ZNYA 2FQ3A 2VIXA 3C6NB 1G8XA 3ESWB 1Q1HA 4BNCA 1IXSB 2CRGA 1T2KA 3CFPA 4B4CA 1W36D 3CMMA 2MMBA 2QM3A 3ZQGA 2A68F 5L3BA 5J1YA 2R4GA 5JFRA 1ZGWA 2DFIA 4R1HA 4B08A 2V6CA 1BW5A 1JGGA 5IT9Z 1JI8A 2JSCA 3G73A 2HZTA 2ZCWA 3LSMA 1Z1DA 1FOXA 2EWNA 2HS5A 2HD0A 5JHUA 3CCLI 4FJMA 4DTMA 3GTJJ 3VSLA 5FRNA 4MTDA 1FBQA 1VTNC 1QQIA 3OOUA 1KU3A 2GZWA 1REPC 1MBJA 1X1PA 3ZQFA 2DPUA 1WHUA 4KHNA 5FKOA 4IRIA 1XGMA 2ADUA 3OS2A 4R79A 2NNYA 1Y0NA 4DBQA 2DEBA 2L01A 2K5SA 2P5OA 1K61A 1FZ2E 4EPHA 4RAFA 5D8LB 1IXRC 2CW7A 1OCOH 3CCQI 1WI9A 1WJCA 2XF7A 3EUAA 4F52A 2Y31A 3TO6A 3LAJA 2RVCA 1B8IB 1S3JA 2CW0F 3SZGA 2FSWA 3CFRA 2J5PA 3GUDA 2FUG2 2F5VA 1EF4A 2VXZA 2KHMA 5IT3A 3OGMB 3QU3A 3OYNA 2HXIA 3FKJA 1GLNA 2EZIA 4NB5A 2IP2A 4Y3OA 1HA8A 5FKLA 1ZLKA 2HYFA 4QIWN 4QLCU 2XAHA 4EM1A 2DT6A 4BKXA 4JBAA 4NC8A 3Q9SA 5B3SH 1FWZA 4DGWB 4KMFA 2W24A 4DTSA 3RKWA 4ZZDA 1EH8A 2M7BA 1LFBA 2LRDA 4C3HJ 4E7JA 1E3OC 3OYLA 4Y13A 4ADOA 5DD4A 3DCFA 5EJCA 4B1RA 2HDDA 1HKTA 3IL2A 3A01B 2R5YB 3ECOA 1J75A 1I6HJ 2EB7A 1QU3A 1MNEA 2P8TA 4EATA 4OIOF 2P1NB 2OVRB 2P1PB 1NG6A 2L7MP 5M3MJ 2X1DA 4DIQA 2KIFA 3OYBA 2WY8Q 2XGDA 3P9KA 4UV8A 2FOKA 4A3JJ 4XRFA 5E3LA 2Q1ZB 5HS9A 2ISZA 3SUQA 2HZDA 3T5XA 4ZZLA 1KU9A 1X19A 3MVPA 3CCVI 3A03A 1KGSA 3GW2A 4A3EJ 3IAM2 3WGHA 1AU7A 3S1RJ 5HLIA 5H2FC 1IV6A 3H0DA 3K2AA 1MIJA 2K9MA 1FTTA 3UO3A 2XPVA 3I64A 1MD0A 2HPIA 4Y33A 2VBZA 1FNNA 4FJXA 1U5TA 1ZTRA 4U7DA 1YRNA 4XM3A 4EQQA 3QYEA 4M3RA 1SVMA 4C2TA 3MAJA 3FXRA 3PM1A 5AONA 5J40A 4M41A 2X1CA 3BR6A 2YSRA 2CMPA 1MNDA 1DP7P 5KAFC 1TC3C 2HVRA 4M74A 4CYCA 2DMUA 4PGHA 3QETA 2PQ8A 2DA4A 4XR6A 2Z33A 3S1NJ 1ZG3A 4YIFA 2DYRH 4XLFA 3I9V2 3D5LA 1TWFJ 3CCEI 3DTEA 1ZYRF 2XDVA 3CDHA 1TW2A 3GBGA 4F7ZA 2CW8A 3LSRA 4J01A 3HSRA 3K10A 3M8FA 3BLYA 2ZO4A 2E1MB 4EEFG 2IS4A 1IO2A 3BWGA 1T0FC 2DW4A 3J27A 4BJ5C 2Y9ZA 3P9IA 2H1KA 5L3GA 3S15J 2KQRA 1ZR4A 1AA7A 5DM7F 2EILH 4LIVA 2OJED 3KETA 2LKSA 5ILSA 2K4BA 5FFZA 1IW7F 1ODDA 2FE3A 2F4OB 2ZKZA 3BTIA 2JQTA 4UB8C 1C0WA 2GA1A 4DTUA 1LPQA 3W6VA 1TT5B 4M71A 3C94A 4UVAA 1JUMA 5FLXZ 2XF5A 2F5FA 1EH6A 3E4YA 3TEDA 1K78B 3SZPA 3SYTA 1YITI 2MH2A 3EUHA 2X48A 4L9NA 3J80K 4JX5A 3OYMA 5GP9A 2BW3B 4YELA 2BHZA 1SC7A 2LY2A 3GTMJ 4NNJA 3MD2A 2MABA 2FBKA 3QOPA 3ISPA 4DU3A 4AIKA 2HYGD 5HODA 1VQ4I 2YS9A 4O5VA 5D5WB 2ELJA 5F0CA 2V6EA 3FK7A 4KISA 4RMNA 3QEVA 4S04A 4J2DA 3GTKJ 3FMRA 3IV5A 1D3YA 1JUPA 3UKGA 1HCRA 1WKMA 3GZ5A 4BJTA 5DEQA 4XKVA 2L3DA 2JPNA 3GXOA 4L9JA 4A3GJ 2QXFA 2VONA 4ZTFA 1DUXC 2KRCA 3A4CA 2LG4A 3BT9A 2DXIA 1B8IA 2ELHA 2JA2A 5ILUA 3O2PE 2Y9YA 4I9QA 3CJTB 1S72I 4QNDA 2LDUA 1R7JA 4Q5SF 2O8KA 3SUNA 4A5NA 1XD7A 1QZZA 1TWCJ 2CUEA 2JT1A 4MEYF 4DZJA 2K27A 4AVZA 5C44J 4W1UA 4FJHA 3L2CA 2FA5A 4IZZA 1JKRC 3GCMA 3W2WA 5GTHC 4U87A 5DYMA 2Q8KA 2VJJA 4JOMA 2XF6A 4UXNA 1PUFA 4AVPA 2R7DA 4MLOA 1H9TA 2A05A 3PNTA 3LA7A 2AXLA 5K5OA 2VOOA 3GEZA 2R5YA 1LE8B 4CCMA 2CUFA 4PUSA 3BVOA 5DTDA 1ACIA 4S05A 1S5LC 3ML6A 1E3HA 1R71A 4RM2A 2HQNA 1R9TJ 2PMZN 3OIOA 2E7WA 1BI2A 4UB6C 2O0YA 2HWVA 3MFKA 4IVNA 1N77A 2MA3A 1VQNI 3OS1A 4NQWA 5M5YJ 2ZFUA 1YI2I 1VQOI 2PG4A 5CLSA 1FBUA 3BCAA 4BGDA 3V7DB 4JP0A 2MW8A 5DUIA 1R49A 5E20A 1GHCA 3OWTA 4DW6A 4XN3A 3J7YJ 1SANA 1XDUA 4KA4A 3CZ6A 1JE8A 5GAGJ 2DA5A 2XV4S 1AOYA 1FZ7E 3WTZA 5IP7J 4Y17A 2GLOA 2LFBA 1SVLA 1B72B 4YIIA 1MBKA 4JX4A 4DNCA 4HW0A 2DDBA 2O8XA 3F8NA 2GXBA 5EDNA 3JREA 2OD5A 5J6XA 4E7KA 1FC3A 1V3FA 2A69F 3DFGA 3LQQA 4HF1A 3U21A 2EBIA 4EGYA 2CQ7A 4LLNA 3OYDA 1TNTA 4ANJA 4G7HF 1FYLA 4EMSA 3LD8A 5DV5A 2COBA 3TL8B 4V19K 2R3SA 3SJJA 2IGKA 3EUKL 3GTGJ 1R00A 3WTXC 1R5ID 1SD4A 3BG9A 2IBDA 3R0JA 1HLVA 2R7UA 3V7CA 1CF7B 4IRHA 4F91B 2JA6J 2JWTA 3AG3H 2XC7A 2VT3A 3CCJI 2LTPA 3K2OA 3QEWA 2L9VA 3S3OA 2NVTJ 2BY3A 3L1NA 3OYEA 3M8JA 3TW7A 5DCMB 2BYVE 4LLLA 1RI7A 2CQKA 4IHXA 3ZGKA 5TISC 1UHSA 2Z99A 2P1MB 1X3UA 4G7OF 4LB5A 3OR2C 4HNVA 5J8FA 4XLPF 3LDSA 2XKPA 2MGQA 5D6FA 4B09A 3KP4A 3IHUA 1ZH5A 5D6EA 4YRVA 4A93J 3PFIA 2BW3A 1XL3C 4RB0A 1BR2A 3E5QA 4L5EA 5D4SA 3DV8A 3QNNA 2JH8A 2P5LC 2DO7A 1JTXA 2ICWG 2XSDC 2R92J 2HQRA 4I2OA 1BI1A 1WI3A 1VQ9I 1QZYA 4V2FA 2ZMEB 3DPTA 2LK2A 1XMGE 2XIGA 4C9YA 3ABMH 4ICGC 4JK1X 5FROA 2CH0A 2OTLI 1LDJA 1R5HA 3I0TA 3RQIA 1SEUA 2OTJI 4CCLA 2WY7Q 2VPLA 1OPCA 1D1CA 1XMAA 2K4JA 4Z6YA 1GXPA 4BXXJ 1DU6A 4DBRA 5E17F 2P5KA 1PVEA 3TAGA 2XAUA 4LB6B 3RZDJ 4M6XA 2VLAA 2LVSA 4FK0A 1JJ8C 2HU9A 2E34A 3T8TA 3WODF 1FZ1E 3ZMUA 5IREA 1OJLA 1I5ZA 3HIFA 3DBRB 3D5SC 4AIDA 3W6KB 2AQFA 2CQNA 3FM5A 2DFEA 1RETA 2GOMA 3WU1B 4FJ7A 1ETOA 3DU5A 3OIPA 2ZXIA 1UG0A 5K7ZA 3FKIJ 4UV9A 2W00A 1V5EA 1POGA 2X4HA 2BGCA 1AKHA 5LGNA 2DA6A 4A6DA 3G6EI 1VQ8I 5C4XJ 1A5JA 1MTYG 2K9NA 1APLC 5LD2C 1UB9A 1ETYA 1YLFA 4M3WA 2EV5A 2E5NA 1H8AC 1T8IA 1WQ2A 1B1BA 2B1EA 3ELKA 3R0AA 5EEAA 2LSOA 3QYFA 3BR2A 3WGIA 1EJ9A 1IUYA 2HTSA 2IS6A 3KP5A 4DTJA 1S7EA 1FZ8E 1Z21A 5D5VB 1TL8A 3GTPJ 1LEBA 4MFDA 4G8XA 2BV6A 5BPDA 3I4MJ 1E3PA 2HFHA 3M1CA 4MNUA 2FD5A 4LG3A 1Y56A 1KA8A 3MZHA 5FLXK 2WADA 1VF9A 3CCRI 4E3SA 3E5XA 3C18A 5IY5H 3DU6A 2XAGA 4OINF 4BBSJ 4IEJA 5H6RA 1ETVA 2MZWB 3ZXSA 4F93B 2NVXJ 2PMUA 3GO5A 4I01A 3MEXA 4ENJA 3REOA 1YW8A 2JJ7A 2GA2A 3WU0A 5J47A 2ZJRF 3KD5E 1FZIE 2KLOA 3L8BA 2JTVA 2X6XA 2E36A 4RS8A 3HG9A 1D0YA 4JQFA 3CUQA 2JHPA 3M9AA 3JRDA 1DP3A 3QEPA 4ADNA 1BN5A 1NG7A 4K2EA 2RN7A 2WAFA 3JRBA 4HF2A 1WJBA 4LK0F 3K2ZA 1D0XA 2K3PA 5CVRA 1JKQC 3IC7A 4XLAA 3RYRA 1IRXA 4CDGA 3LSHA 1USSA 2KKOA 3TKYA 4A6EA 3MMYB 2BVMA 1DU0A 4NHJA 4EGZA 2FOWA 1MMDA 3MQ0A 3KZYA 3OV8A 2IXSA 2X85A 2IGMA 3VODA 2H09A 4IKFA 1FZ0E 1VQ5I 2G7UA 5IP6A 3QAHA 3SXYA 2V9PA 2JHCA 2ME0A 2LR8A 5J1UA 5F27A 3RJPA 5FLMJ 2LKXA 4X6AJ 3FXKA 3PFYA 4KITB 2IAIA 3OY9A 1R1VA 3DP7A 4FE4A 2OZMA 3ZQQA 2YUSA 5HDKA 2CFXA 4YFNF 4HQEA 2L4AA 4IHYA 5CYVA 2DJIA 2STTA 2QF7A 1IC8A 4ASNA 1MMSA 2EZLA 1W36C 2XROA 2ECBA 1YE9A 2LF3A 5F64A 4A0ZA 4I02A 2NYXA 1I6XA 3BY6A 3WTVC 5JLWA 1Y39A 3C6PB 2Z2SB 1B9NA 2PMZA 4DZPA 5TRDA 3KYDB 2XGXA 2LMDA 2PFBA 1V4RA 2QZ8A 3JRHA 2CV0A 3JTGA 1R1UA 3H0GJ 4KT6A 1IN6A 2E2IJ 2ATQA 2RQQA 3E6DA 2DOFA 4JX6A 4LG0A 5D5XB 2ZSIB 1FEXA 4RGXA 2OAZA 3FF5A 3KIOA 1Q1VA 4E4HA 1ZQ3P 3H9JA 3UR3C 2OZSA 3RKQA 3H9QA 3E4WA 3ULQB 1MZBA 2VL8A 2ID3A 2Z5UA 3CJQB 4HA8A 3Q9VA 4L5IA 1W5CC 2ZJ2A 1FZ5E 2ETHA 3CJRB 3KEQA 3OYAA 1LDKB 3KPHA 2MSYA 2ZXWH 4RGSA 1VI0A 4WWCA 3H3ZA 4G6TB 3S2WA 1ZRCA 4O6JA 1QBJA 4G9YA 2JQ7A 3ABUA 2JRTA 2HKOA 3BZCA 2MBFA 2LY1A 3JRGA 4JS5A 1MGTA 4PSWA 5EF6A 1EV7A 3DKWA 3RMBA 3I59A 3VPRA 3ZQLA 3BDDA 1K83J 2QWWA 4PCQA 4PJ0C 3OYCA 3ABLH 3ZQHA 5LHGA 2HXOA 1RR8C 5HLHA 1SAXA 1MMOG 3RMDA 3MZYA 1NK3P 2QQ8A 2QLZA 3KEYA 3ECHA 3H3UA 3I54A 3MN2A 2CV2A 4HEA2 2A07F 5FD5A 4M3ZA 4AKIA 1P6RA 2IPQX 1J5YA 1WCMJ 3OGKB 2X0LA 1FOYA 1Z77A 1I1GA 4LK1F 5IBKB 1X58A 1XVDE 3DTIA 1T98A 3UO2A 3NEUA 3G71I 2QCOA 4HQMA 5L3FA 4D7MA 1O7LA 2XAQA 3WSOA 2I8DA 3K70C 5K7HA 1G2HA 4Y15A 1HQCA 3ZMTA 5EGOB 2W4SA 5LEJA 3LSKA 5E1ZB 3LSPA 1B4AA 2LF7A 1D5VA 2W1OA 3F6OA 5HDGA 2EIMH 3AL0B 2BHYA 4ZDOA 1T39A 1H0MA 1KQ0A 4XICA 4FX4A 4A3FJ 1ZELA 1F4KA 2QVOA 2XGCA 2MC4A 1B9MA 5E8GA 1E0EA 3H92A 1XMFE 2UXXA 3SEQA 5HS7A 1T38A 2COMA 4KIGA 1GT0C 1LDDA 4A3CJ 1S9HA 3AG4H 3G1LA 5HNFA 5JR3A 4KI4A 1OR7A 3J81Z 5EYRA 1F43A 4RDUA 1HW1A 4E6KG 1Z3YA 2P6TA 1JT0A 2FBHA 1DPRA 3QU6A 5A2QZ 4H0EA 5DM6F 4BE1A 4AM3A 1YX3A 3S1MJ 2K9LA 2NVUB 4BYYA 1P4WA 4IOCF 3HEFA 4KFCA 2BY0A 4E4BA 4DYCA 1BW6A 3FX3A 3EQLF 2LC2A 3CCMI 2AQEA 2JPCA 3FZVA 2DT5A 1U6GA 2XAJA 4FJ8A 5CPRB 1R58A 5IOYA 5IPAA 2R7RA 1DPUA 4ITVA 3V7SA 1JUSA 2Y0SN 3WHCA 3RPUA 4Q4ZF 1SFUA 5FD6A 2VQGA 3SQ4A 3GZNB 3CC2I 4IHWA 1N75A 3VEPA 4FVMA 5DCFA 2K02A 2R7TA 3N1BA 3NAUA 1PP7U 2DMPA 3MWMA 3K1NA 2OCEA 1OYWA 2E7XA 5GADJ 5EEGA 2E31A 4FJLA 2LLKA 2OU2A 1FJLA 4RB2C 3QERA 4FASD 1ZRFA 2PJRB 4FJGA 2G7HA 2L2OA 1VQPI 3BOQA 2JRMA 3LL7A 4XNFA 1BL0A 4M9XA 3RPUD 1PP8F 2YR2A 3BR5A 3SPYA 2OV7A 2ID6A 2KRHA 3X2QH 4PFOA 3TABA 2DY4A 1PUFB 1OCPA 2LY9A 3T8RA 2IA0A 3EYIA 2K5CA 1XS9A 3VYTB 1TNSA 4HV6A 4KHSA 4EVIA 4AC0A 1XVGE 1YOVB 3DKYA 1R22A 4LFUA 1YX5A 4A3DJ 3J2PA 1RR7A 2P0WA 1XGOA 5M5XJ 1WGXA 2XRNA 3L2QA 3HPHA 2EA4A 1IG9A 5AIQA 2V26A 2RKHA 2VKDA 3QWLA 4NQWB 4KHYA 5EG0A 3PO3J 5BQTA 3S3NA 3MKYB 4MHGA 1X4OA 2EH3A 2L5QA 2R7XA 2DMNA 3C3WA 1W7PA 3CLQA 3LSJA 4PJJA 4I09A 3EPZA 2OZ6A 1MKMA 3FBIB 3H9GA 1O4XA 3BPXA 4M73A 4UUTA 2GWRA 1ZN2A 3SDGA 1ETXA 4M3YA 2EZHA 2JK3A 1A6QA 4PFPA 1BJAA 1V55H 2NS8A 2A6HF 2H1LA 2R5ZB 2BXYA 1JHFA 1TZLA 2MH9A 4DTPA 4AU7A 3TJYA 4RAYA 2NNNA 5KAIC 2F4MB 3J7AY 5E8IA 4LD5A 4QTRA 3K4JA 1MNMC 1XU3E 1DGWY 2M30A 3HGYA 2WAQN 1W7PD 2GBYA 1HDDC 3VWBA 1JXSA 4L5JA 3QPSA 1OKRA 4Y52J 3NAEA 2DCEA 2DLLA 2OYQA 4XSZF 3IKVA 4KHQA 2ELKA 3K1MA 3R4KA 4UVCA 5EGOA 4TV7A 2ISYA 2VC0A 2C6YA 3HKZN 3RKXA 3HOYJ 1Q9YA 3ABTA 3M3YJ 1Y6IA 4U0YA 1F9NA 4D1QA 4IRGA 3B73A 4FJIA 4G6QA 3DBHB 2L7ZA 2LF8A 4BQQA 3DTKA 3G1MA 4QWQA 3KZZA 3W6JB 3QEXA 1FYKA 3G3ZA 3HDDA 1D8KA 2IJLA 2P1QB 3FDYA 5LRRA 4EJVA 2IGNA 1QGPA 4FE7A 1ETKA 3FK6A 4FK4A 5BS6A 2RV8A 1MH3A 3A02A 3K4NA 2W82A 2IVMA 4FETA 4OAZA 3IH4A 2UUZA 3WGGA 3HTUA 1FMVA 4IF4A 5L3CA 4D5FA 5J8CA 2DTUA 1UELB 1PYVA 2DQLA 3KFWX 1OYIA 2VN2A 3OR1C 4AIHA 1UAAA 2FBIA 1ZK8A 4MFEA 1FP1D 5KNLA 1Z9CA 2B9SA 4EYWA 2DDAA 3DWLE 4B3AA 2KRFA 3WG9A 1HW2A 4I99C 2DYSH 2PMHA 3V8LA 4BHBA 1IXCA 3GFIA 1F1ZA 2BVLA 3R61A 4A3MJ 1GUUA 1IG7A 2G0EA 1PDNC 1DQUA 2CU7A 4HCCA 2W85A 3G1OA 5IYBJ 4FJ9A 3MKLA 1UMQA 2HDWA 2UXNA 2VC1A 2DMQA 1W0TA 2D5VA 5CKTA 1K6YA 2DODA 2A5WA 2W25A 1IN8A 2JPBA 2H6BA 3GFJA 4C3IJ 2PJRA 2R7SA 1J09A 4LMYA 1ZGAA 2VB6A 4HLYA 2A3SA 3GF2A 4IQJA 1ON1A 1RUNA 1D5YA 3H35A 1WJDA 2DN0A 4OWRB 3CC7I 1X1AA 1R4NB 4M72A 1ZARA 1Z7UA 2XB5A 2I10A 4XLHA 1QVUA 4NC6A 3LQRA 2GM4A 1OCRH 3JRIA 4KHUA 2M7AA 1XVBE 2PJPA 1VQLI 4RGRA 4HOBA 5LRSA 2Y30A 2F5DA 3DEEA 1AKHB 1JJ6C 2GIVA 3J7ZI 3CD6I 5B1AH 2IA1A 2VQCA 2KZVA 1HF0A 2DTRA 2MD5A 2IRFG 4MQ9F 4NC7A 1W5TA 1CGPA 4CGZA 2OA4A 4M3BA 5J3LA 3CC4I 4HSTA 2LNBA 3BG5A 3TL4X 5LGUA 4M3TA 2LF6A 3LDBA 3DQVC 2GOXB 1BR1A 4GYGA 4WXCA 3RI4A 2NRAC 1MBHA 3JRCA 3H1CA 4ABZA 2RGVA 1UHWA 2M3AA 5KCMA 2EV0A 5JLXA 1Y8RB 4ZDPA 4BXFA 2QYOA 4NUBA 2EFWA 1HKSA 2LD5A 1FXXA 3S2HJ 1T0FA 2VBYA 4EJOA 4IX7A 4PJLA 4MEXF 1YS6A 3K4KA 2R5ZA 4P9UA 4M3XA 3J81K 3SEZA 1LQ1A 1F36A 3VB2A 2JSPA 3CESA 3I53A 2UV1A 2K40A 5A2QK 2GXAA 2DK8A 2O5RA 2K9QA 1I3QJ 5E3MA 3K4LA 4HBLA 1TQPA 1X3WB 2KFDA 2Y75A 3ZQIA 1T6SA 1RIOH 2JA7J 4NBQA 3DEUA 4GXOA 5IT9K 3BTCA 4BACA 3W2AA 4XQFA 1V5GA 2OPTA 2GAUA 3E7LA 5K7FA 3OIQA 1X1DA 4IHVA 2Y0SA 4C3JJ 3WTWC 4O3MA 3C1DA 1X3ZB 3CUQB 1GV5A 4DOZA 1Z67A 1XB4A 3K4CA 3QQAA 1HSJA 4FQGA 3OSGA 2VKVA 3BG3A 2PEXA 2WB1N 3QODA 2OF7A 3NHGA 2V4JC 3N05A 4M9SA 4I6ZA 1BC7C 2CQQA 4E70A 5TJJA 1XX5A 4UUSA 2M0MA 3T1BA 2XRLA 2BOLA 1UJ8A 4CCKA 2JH9A 1YYVA 1BI0A 2VJ5A 3FXOA 4JYKA 5KK1A 9ANTA 1FYZE 2RC4A 1LFUP 5LFAA 3P5JA 2ECCA 2VI6A 1IJWC 4PJMA 2VJ4A 3WTTC 5JVGF 5C3EJ 3SFZA 4WF2A 4I6JB 3QP5A 2E1NA 2CO5A 2DOAA 4MQVA 4ENKA 1NH3A 3SUOA 4L9TA 4P1WA 1QZEA 3TAFA 1OCCH 5DUKA 1Z05A 3L9FA 5CVJA 2R0QC 4CXFA 3S9HA 1I39A 1XCBA 2P81A 2D2WA 5JVTA 4ENNA 1GDTA 2QSGX 3E6CC 4EM0B 4OOIA 4LGWA 2P7VB 3IWZA 4BUPA 2NVQJ 5LGTA 1BA5A 4CH7A 3TGNA 3DKXA 2IS1A 4AKGA 2E60A 4LG0B 1UFMA 3RMCA 1OLTA 1BJZA 4FJKA 2B7EA 3ZN1A 1IF1A 4BAYA 3NRVA 3ZRGA 3NCIA 3PSIA 3HSFA 2NAZA 4U7BA 2DA7A 2AO9A 1UZCA 1KQ8A 2OUMA 3GZ6A 2HKXA 2HEOA 4E7ZA 3RCOA 4ZYEA 3CF5F 2K86A 4RL5A 2CGPA 1B6AA 3CDLA 1H89C 2B63J 1BOAA 4PSXA 4D9JA 3GTQJ 3FXLA 1FZ4E 2A6EF 2WAQA 2F2EA 2RREA 2FQ4A 3WE2A 4BE2A 3AAFA 3ZMVA 2QSHX 1I27A 3CO7C 5IOZA 1XC5A 3E97A 3PIOF 3O6BB 3S16J 2HOAA 2KL4A 3HKZA 5ED4A 2ZMEC 3I59B 4ZYHA 2VE8A 1QPIA 3JCUC 3JSOA 3BQYA 2EPFA 1K4TA 1XDSA 4HYEA 2I5UA 2VPRA 1WJAA 2HOEA 4BY7J 3L2OB 2Z16A 4F92B 1TT0A 4DTXA 4S0HB 2L54A 3PL8A 4AD9A 4L0ZB 2OZUA 3H5RA 1D1AA 4DU1A 2EFNA 4RLFA 3S3MA 1ZRDA 3N1EA 2JMWA 3BJOA 2ACJA 1ZAOA 2VASA 4XK4A 3M07A 2M4KA 2ESNA 4ZYAA 3RPQA 5E1XA 3TAEA 4KICA 1XGSA 1XMXA 5F0FA 5C4JJ 2O03A 1VQKI 3ZQCA 3S14J 3FM3A 2P6SA 1YJ9I 2WBMA 2JN6A 1TP4A 4GFBA 1LVAA 2RQPA 1P2FA 3FISA 1GXQA 2ME6A 3WG7H 4FTHA 2HPMA 3NQOA 4JRQA 3LZIA 2X9DA 4HX7A 5GAHJ 1Z7LA 2DAOA 1S7AA 2MD0A 1P22A 2BEOA 3AG2H 2P7CB 2JZYA 2DU9A 3BP8A 1O7FA 2FEZA 3HRSA 1FZPB 3TQNA 3KX2A 3OYIA 2HQ5A 2CJJA 3NWTA 3CO6C 3HYIA 1SMTA 1LUJB 2DA1A 4BU2A 2WV0A 2K3FA 2V1NA 5H37A 1LKXA 2E1OA 3ASOH 1ORKA 4H4KC 2KMUA 2MYSA 4WXDA 4FK2A 2OBPA 3SQ0A 3L1PA 1J59A 2Q2EA 4G94A 4XONA 5F0HA 1FS1A 4CZCA 3RQ4A 5EZHA 2XPUA 3PUBA 1WH7A 2NOJB 4U88A 1BR4A 4WX9A 4J00A 1I50J 3P9CA 3S2DJ 1P9QC 5F1JA 2CQXA 4UHTA 4OIQF 1QO0D 3FHZA 1TTYA 1Y1VJ 2V1DA 2KJBA 3LSIA 4RBOA 4A5MA 4E7LA 1YW7A 4OAYA 4RB1A 3RSNA 3HHGA 4LIUA 2E19A 4D0PA 1NHAA 2W84A 1UHMA 5ICFA 1VFCA 1FBSA 3ZR8X 1AWCA 1D8JA 3HRTA 2R7FA 3QPLA 1USTA 2LH9A 2HVSA 3LZJA 1NTCA 3H5NA 3FXJA 2F6CA 3KYCB 4RM3A 2FYOA 1HKQA 2L9NA 3QEIA 2V9VA 3SI6A 1DGRM 3SNNA 3QP6A 1LNWA 3JAMZ 3F3XA 5HNHA 6PAXA 4BS9A 3PQKA 1J9IA 2JA5J 1YG2A 1OR7C 1O3RA 4EV0A 1XVFE 1BOBA 2KIMA 2KJCA 3M4OJ 2R7WA 4LJZF 4OIPF 3CMYA 1CQTA 1Q9XA 2FJ1A 1TQIA 2Y0MA 1BIAA 3KP2A 3U1DA 2E71A 1A04A 1I3AA 3HOSA 4PGGA 3P7NA 1VZ0A 1FZ3E 3FXMA 1X1CA 3OMYA 4Y4RA 4F55A 4KDPA 2AXTC 2CYYA 3J80Z 2EA2A 4XMYA 3KLNA 1WAFA 2QKLB 3ZMZA 1IN4A 1MJAA 1P4XA 1S7OA 4DJAA 1HC8A 5EG0B 3DLAA 5CQGA 1W7PB 2MLKA 3M7GA 3RYPA 2CWEA 3L2UA 3I3LA 2LYCA 4LITA 2E32A 2LP0A 3CQZJ 3IP4B 5CQEA 2PFVA 2ZBKA 2YPRA 3L7WA 2QQ9A 2TRTA 4J2AA 2AS5F 4M9ZA 4KT5C 2E5ZA 2M4GA 3OYKA 2HDCA 1HDPA 4MGRA 5LEKA 2V1XA 2GQQA 2JA8J 1MHYG 1HSTA 2ZXHA 2WB1A 1J0RA 1W4MA 3SVIA 4BQAA 1ULYA 4IJAA 5HDNA 1MDMB 4HF0A 3HB9A 4HX4A 5BOXA 1L0OC 4N0BA 2A5YB 4M3EA 4U0VA 1B59A 4RB3C 4FISA 3A1YA 4ETSA 5HLGA 3QNOA 2DOEA 4WXHA 3ZPLA 4ESJA 4E7HA 3LOCA 3I4NJ 3TDUC 3L00A 1S29A 3IUOA 1ENHA 2LREA 3MKWB 1IRFA 4CYDA 2VODA 5CVVA 2XKOA 2ZXJA 3KD1E 3O8HA 3KP3A 3C95A 2OVPB 2CFOA 4AUXA 1NEXB 2X1EA 5IYCJ 2E1CA 4N4OB 1H9GA 1XSVA 2Y48A 2Q0OA
chains in the Genus database with same CATH topology
3WTSC 5ILVA 5BPIA 1YW9A 1P4AA 4KIBA 1JGSA 1O3TA 4CICA 3DXJF 1BI3A 3FMSA 1U5TC 2QUFA 2EJRA 2G9WA 4I0BA 1ZG5A 3FMQA 3GFLA 3BZ6A 4OMYA 2VE9A 1FYMA 3HRUA 1FSEA 5LBQA 4HZFA 3PQJA 3CTAA 2LKPA 3ZN0A 3E3VA 2IW5A 3EDPA 3TOBA 1PUEE 4Z2YA 5ICEA 1FY7A 5KVRA 1YQAA 3EYYA 3GVAA 1I1SA 1G3YA 1LJ9A 1R36A 2XASA 2OQGA 4OMZA 1KU7A 2IA2A 2F5EA 4G6DA 5K5RA 4I98B 4EJWA 2FMYA 2TDXA 3KCCA 2EK5A 2M8EA 4A12A 2PN6A 3ZP5A 3T0YA 1O57A 3VOEA 4IHSA 1N1CA 1TW3A 4YFKF 3E6BA 1O3SA 3BROA 5DDGA 3M8EA 1G3WA 4L0YB 1FOKA 1Y0UA 3I5UA 1MDMA 3KP6A 4A0XA 1SFXA 3E6MA 3LAPA 2UZKA 1YS7A 2BE5F 3JTHA 3KP7A 4KYWA 2B0LA 2PBIA 1L3LA 1IN7A 1ZREA 1ZGJA 3KLOA 1R23A 4R8HA 2DPDA 1FPOA 3CJNA 4XBFA 2P4WA 3KE2A 1SD6A 2QQBA 1QNTA 1GVJA 1XGNA 2F5CA 4AWXB 1IRGA 1TQMA 2FRHA 5EEHA 2EFQA 4MTEA 3JAMK 3KEOA 1LEAA 4XSXF 2L4MA 4CZZA 3GWZA 1E2XA 2M45A 5ERIA 3K1PA 5FO5A 3ZQ7A 5D4RA 2RDPA 3V7RA 4G7ZF 3SHFA 1K6OA 5LHIA 5F6FA 4CHUA 1P92A 3K69A 2NS0A 3CLOA 5HOOA 5JI6A 1LB2A 3V8JA 3R6SA 3GLXA 1FT9A 2XHKA 1ZHFA 3BPVA 1Z91A 1U8RA 1XSXA 3N97A 4KUMA 4UVBA 4KN7X 1XMKA 2QQAA 2YX7A 3CUOA 1KYZA 3F8BA 2BBYA 3LWFA 3E5UA 4I0AA 3F23A 1ZLJA 1OYYA 1DDNA 4P96A 5E1WA 2KIUA 4OIRF 4CO8A 1J2XA 3U2RA 5L3EA 1YTYA 2XVCA 4PDKA 2WC2A 3FXQA 3FWEA 4I7HA 5CJ9A 3RTRA 2WWYA 5CVUA 3V8KA 1G3TA 3GX4X 4HLXA 2RNJA 5K5QA 2ZNZA 1U2WA 3Q5FA 3V4GA 1SD5A 5F1RA 1HW5A 3MCZA 3ZMSA 2ESHA 1HXDA 1EH7A 3ZMDA 2L02A 5E18F 1BC8C 2CG4A 4KIFA 5BMZA 1XSDA 2V1UA 2H6CA 3U9GA 3ERED 2P5VA 1FX7A 1SMYF 4N9HA 5DD8A 3O3KA 1J7KA 2DK5A 1F5TA 2O3FA 3D0SA 3L09A 1JHHA 2A61A 4KMUX 3SZTA 2J5OA 3COAC 2D45A 4ESBA 4HDVA 1BM9A 2HGCA 1WSUA 1KU2A 4Q47A 4EM2A 4N9IA 3DF8A 3WTUC 4ENMA 1K78A 3HSEA 1IN5A 4ZH4F 3IRRA 1YO5C 2STWA 4GYIA 3K9TA 2PI0A 3CUQC 3K0LA 2MC3A 2EFOA 3JSPA 5H20A 3JW4A 3HTSB 3RDIA 4ZYGA 3LSTA 3F22A 1FPQA 3HRMA 4P55A 2YX4A 2QBYB 2M1BA 1Z6TA 2M87A 4BHCA 3TDZC 3J7AO 4HDUA 4ON0A 3QPTA 2FNAA 3QPHA 1G3SA 4DQ2A 4GCVA 3OOPA 4PZJA 4IPAA 4FT8A 4L9VA 2WTEA 1FP2A 2M5WA 4WK8F 2MLGA 1MJ9A 5ICCA 2IT0A 3C7JA 2GXGA 1IAWA 3SQNA 3M1EA 3IRQA 2DI3A 2ZFWA 5AIPA 1Z6RA 4FHTA 2VOPA 3B02A 4U0WA 2VBWA 5FGMA 4OU0A 5FFXA 4ZYDA 4HAMA 5K1YA 1ONVA 1XCVA 4XLNF 4FX0A 3F6VA 3TOAA 1RNLA 2QENA 4L18B 5H6QA 4AIJA 2OQRA 4IT5A 3N4MA 3I71A 2UWMA 3F8FA 1TLHB 1G6NA 1R1TA 2DQRA 2K7LA 5CVIA 1BIBA 4BHPA 1CF7A 3TO9A 2FU4A 3GYHX 1IZ1A 1S6LA 5D5UB 3DPLC 2VBXA 3F72A 1W5SA 4A2UA 4KNYA 1WRJA 3LA3A 5DCMA 4LLGF 4KN4X 3QRFF 3FXUA 5FB2A 1STZA 2FNPA 1SD7A 4BH9A 2H27A 2H94A 1YIOA 4GGGA 4B8XA 3LFKA 1FSHA 1KQ9A 1YFHA 1OMIA 2HR3A 2FXAA 3IWFA 2ZMEA 3LA2A 2XUBA 2XAFA 3BJAA 3HHHA 4UNOA 4EJUA 4P5OA 2QBYA 3HUGA 4Q48A 3BJ6A 4RAZA 1MJBA 3RKYA 3RIRA 3F8MA 4IXAA 4HV5A 1K7AA 1TBXA 1UCRA 4EJTA 4YG2F 4GO1A 1E17A 1HBXG 1RZ4A 2O6GE 1SFEA 1R5GA 5L3DA 2Z3YA 2Z9OA 1QPMA 3ROUA 4BXUA 2FF4A 2YU3A 3VFZA 5D8KB 1KYWA 4IHTA 4HX8A 1BBYA 2CSOA 3F8CA 5HS8A 1U78A 4YFXF 4M6YA 4P9FA 2V79A 4RGUA 3I4PA 4UUVA 2FMLA 1U5TB 2O61A 2DBBA 3HOTA 4WCGA 1G4DA 5LLQA 5LHHA 3GFMA 4ESFA 2HTJA 1S8NA 3WE3A 1RUOA 1ZG1A 1ON2A 1O3QA 1K79A 2EV6A 1WWXA 2EFPA 3I58A 3TO7A 3F21A 5HVQC 2D1HA 2D1VA 1FLIA 4A0YA 3R60A 3IKTA 5ICGA 2PLYA 3WTYC 2VT2A 1XN7A 2W57A 3EETA 1U3EM 2ZNYA 2FQ3A 1Q1HA 4BNCA 1IXSB 1T2KA 2QM3A 5L3BA 2A68F 5JFRA 2DFIA 4R1HA 2V6CA 5IT9Z 2JSCA 3G73A 2HZTA 2ZCWA 1Z1DA 2EWNA 2HS5A 5JHUA 4MTDA 1FBQA 1VTNC 1QQIA 1KU3A 2GZWA 1REPC 2DPUA 4IRIA 1XGMA 2ADUA 2NNYA 4R79A 2L01A 5D8LB 1IXRC 1WI9A 3LAJA 3TO6A 2RVCA 2CW0F 1S3JA 2FSWA 2J5PA 3GUDA 2VXZA 5IT3A 3QU3A 4NB5A 2IP2A 1ZLKA 2HYFA 4QLCU 2XAHA 4EM1A 4JBAA 3Q9SA 1FWZA 4KMFA 2W24A 3RKWA 4ZZDA 1EH8A 4Y13A 5DD4A 1HKTA 3IL2A 3ECOA 1J75A 2EB7A 2P8TA 4OIOF 2KIFA 3P9KA 4UV8A 2FOKA 4XRFA 5HS9A 2ISZA 3T5XA 4ZZLA 1KU9A 1KGSA 3GW2A 3WGHA 5HLIA 3UO3A 3I64A 1MD0A 2VBZA 1FNNA 1U5TA 4U7DA 4EQQA 3MAJA 3FXRA 5AONA 2YSRA 1DP7P 4M74A 4PGHA 2PQ8A 2Z33A 1ZG3A 4YIFA 3D5LA 1ZYRF 3CDHA 1TW2A 4F7ZA 3HSRA 3M8FA 2ZO4A 3BWGA 2DW4A 3P9IA 5L3GA 3KETA 5ILSA 2K4BA 5FFZA 1IW7F 1ODDA 2FE3A 2ZKZA 1C0WA 2GA1A 4M71A 4UVAA 5FLXZ 2F5FA 1EH6A 1K78B 3SZPA 2MH2A 3EUHA 4L9NA 3J80K 2FBKA 3QOPA 3ISPA 4AIKA 2HYGD 4O5VA 5D5WB 4S04A 3FMRA 1D3YA 1WKMA 3GZ5A 5DEQA 2L3DA 3GXOA 4L9JA 2VONA 1DUXC 2ELHA 5ILUA 3O2PE 2LDUA 1R7JA 4Q5SF 4A5NA 1XD7A 1QZZA 2JT1A 4MEYF 2K27A 3L2CA 2FA5A 5DYMA 2Q8KA 1H9TA 4UXNA 4AVPA 2R7DA 3LA7A 2AXLA 5K5OA 2VOOA 3GEZA 3BVOA 4S05A 3ML6A 2HQNA 2E7WA 1BI2A 2O0YA 2HWVA 3MFKA 4IVNA 2MA3A 4NQWA 2PG4A 5CLSA 1FBUA 5DUIA 5E20A 1GHCA 4KA4A 1XDUA 1JE8A 2XV4S 1AOYA 3WTZA 4Y17A 4YIIA 4DNCA 4HW0A 2O8XA 3F8NA 2GXBA 2OD5A 5J6XA 1FC3A 1V3FA 2A69F 3DFGA 3LQQA 4HF1A 4EGYA 4LLNA 1TNTA 4G7HF 1FYLA 4EMSA 5DV5A 2R3SA 1R00A 3WTXC 1SD4A 3R0JA 3V7CA 1CF7B 4IRHA 2VT3A 5DCMB 2BYVE 4LLLA 1RI7A 2CQKA 2Z99A 1X3UA 4G7OF 4LB5A 5J8FA 4XLPF 2XKPA 5D6FA 4B09A 3KP4A 3IHUA 1ZH5A 5D6EA 3PFIA 4RB0A 3E5QA 5D4SA 3DV8A 2P5LC 2DO7A 2HQRA 4I2OA 1BI1A 1QZYA 2ZMEB 3DPTA 2XIGA 4JK1X 1LDJA 1R5HA 3I0TA 1OPCA 1XMAA 2K4JA 1GXPA 5E17F 2P5KA 4LB6B 4M6XA 3T8TA 3WODF 3ZMUA 1I5ZA 3HIFA 3W6KB 3FM5A 3WU1B 4UV9A 2X4HA 2BGCA 5LGNA 4A6DA 1UB9A 1YLFA 2EV5A 1WQ2A 1B1BA 3ELKA 3R0AA 2LSOA 3WGIA 1IUYA 2HTSA 3KP5A 5D5VB 1LEBA 4G8XA 2BV6A 5BPDA 2HFHA 4MNUA 3MZHA 1KA8A 5FLXK 3E5XA 3C18A 2XAGA 4OINF 5H6RA 2PMUA 3GO5A 4I01A 3MEXA 4ENJA 3REOA 1YW8A 2GA2A 3WU0A 2JTVA 4RS8A 4JQFA 3CUQA 3M9AA 1BN5A 4K2EA 2RN7A 4HF2A 4LK0F 3K2ZA 5CVRA 3IC7A 3RYRA 4CDGA 1USSA 2KKOA 3TKYA 4A6EA 4NHJA 4EGZA 3MQ0A 3KZYA 3OV8A 3VODA 2H09A 2G7UA 3QAHA 3SXYA 3RJPA 1R1VA 3DP7A 5HDKA 2CFXA 4YFNF 4HQEA 2L4AA 5CYVA 2STTA 4ASNA 2XROA 5F64A 4A0ZA 4I02A 2NYXA 1I6XA 3BY6A 3WTVC 1B9NA 5TRDA 2XGXA 2PFBA 2QZ8A 1V4RA 3JTGA 1R1UA 1IN6A 3E6DA 4LG0A 5D5XB 4RGXA 2OAZA 3FF5A 3ULQB 1MZBA 2Z5UA 4HA8A 3Q9VA 4L5IA 2ZJ2A 2ETHA 3KEQA 1LDKB 4RGSA 4WWCA 3H3ZA 3S2WA 1ZRCA 4O6JA 1QBJA 4G9YA 3ABUA 2JRTA 2HKOA 2MBFA 1MGTA 1EV7A 3DKWA 3I59A 3BDDA 2QWWA 4PCQA 5LHGA 5HLHA 1SAXA 3MZYA 2QLZA 3ECHA 3H3UA 3I54A 2A07F 5FD5A 1P6RA 2IPQX 1J5YA 2X0LA 1I1GA 4LK1F 1T98A 3UO2A 3NEUA 4HQMA 5L3FA 1O7LA 2XAQA 4Y15A 1HQCA 3ZMTA 5LEJA 5E1ZB 1B4AA 2LF7A 1D5VA 3F6OA 5HDGA 1T39A 1H0MA 1KQ0A 4FX4A 1F4KA 2QVOA 1B9MA 5E8GA 3H92A 2UXXA 5HS7A 1T38A 2COMA 4KIGA 1LDDA 5JR3A 1OR7A 3J81Z 1HW1A 2P6TA 2FBHA 1DPRA 3QU6A 5A2QZ 4H0EA 4BYYA 1P4WA 4KFCA 3FX3A 3EQLF 2JPCA 3FZVA 2DT5A 1U6GA 2XAJA 1R58A 1DPUA 3V7SA 3RPUA 4Q4ZF 1SFUA 5FD6A 3VEPA 5DCFA 2K02A 1PP7U 3MWMA 3K1NA 1OYWA 2E7XA 5EEGA 2OU2A 4RB2C 1ZRFA 2G7HA 3BOQA 4M9XA 1PP8F 2YR2A 3EYIA 3T8RA 2IA0A 1TNSA 4HV6A 4EVIA 1R22A 4LFUA 1XGOA 2XRNA 2EA4A 5AIQA 2RKHA 5BQTA 4MHGA 3C3WA 1W7PA 4I09A 2OZ6A 1MKMA 3BPXA 4M73A 2GWRA 1ZN2A 1BJAA 2A6HF 1JHFA 2MH9A 4RAYA 2NNNA 5E8IA 4LD5A 2M30A 1W7PD 1JXSA 4L5JA 1OKRA 2DLLA 4XSZF 3IKVA 3K1MA 3R4KA 4UVCA 4TV7A 2ISYA 2VC0A 2C6YA 3RKXA 3ABTA 4U0YA 1F9NA 4IRGA 3B73A 4G6QA 2LF8A 4QWQA 3KZZA 3W6JB 1FYKA 3G3ZA 1D8KA 2IJLA 4EJVA 5LRRA 1QGPA 5BS6A 2RV8A 2IVMA 3WGGA 3HTUA 4IF4A 5L3CA 5J8CA 2DQLA 3KFWX 1OYIA 2VN2A 4AIHA 2FBIA 1FP1D 1Z9CA 1HW2A 2KRFA 3WG9A 2PMHA 3V8LA 4BHBA 1IXCA 3GFIA 1F1ZA 3R61A 1PDNC 2W85A 2UXNA 2VC1A 2W25A 1IN8A 2JPBA 2H6BA 3GFJA 4LMYA 1ZGAA 4HLYA 2A3SA 3GF2A 1ON1A 1RUNA 4M72A 1ZARA 1Z7UA 3LQRA 2PJPA 4RGRA 4HOBA 5LRSA 2F5DA 2GIVA 2IA1A 2DTRA 2MD5A 2IRFG 4MQ9F 1W5TA 1CGPA 4CGZA 2OA4A 2LNBA 5LGUA 3DQVC 4WXCA 4GYGA 3RI4A 2NRAC 2RGVA 1UHWA 2EFWA 2EV0A 2QYOA 1HKSA 1T0FA 2VBYA 4EJOA 4MEXF 1YS6A 4P9UA 3J81K 1LQ1A 3VB2A 3I53A 5A2QK 2DK8A 4HBLA 1TQPA 2Y75A 1T6SA 1RIOH 3DEUA 4GXOA 5IT9K 2GAUA 3WTWC 4O3MA 3C1DA 3CUQB 1XB4A 1HSJA 2PEXA 4M9SA 1BC7C 4E70A 5TJJA 3T1BA 1YYVA 1BI0A 5KK1A 2RC4A 3WTTC 3SFZA 4WF2A 3QP5A 2E1NA 2CO5A 4MQVA 4ENKA 4L9TA 5DUKA 1Z05A 3L9FA 5CVJA 4CXFA 1XCBA 5JVTA 2D2WA 4ENNA 3E6CC 4EM0B 4OOIA 4LGWA 2P7VB 3IWZA 5LGTA 3TGNA 4LG0B 1UFMA 3ZN1A 1IF1A 4BAYA 3NRVA 3HSFA 2NAZA 4U7BA 1KQ8A 3GZ6A 2HKXA 2HEOA 4ZYEA 2K86A 2CGPA 1B6AA 1BOAA 2A6EF 2F2EA 3WE2A 3AAFA 3ZMVA 1I27A 3CO7C 3E97A 3O6BB 5ED4A 3I59B 4ZYHA 2VE8A 3JSOA 1XDSA 4HYEA 2HOEA 2L54A 4AD9A 4L0ZB 2OZUA 2EFNA 1ZRDA 3BJOA 2ACJA 1ZAOA 3RPQA 2ESNA 5E1XA 4KICA 1XGSA 2O03A 3FM3A 2P6SA 1LVAA 2RQPA 1P2FA 1GXQA 3NQOA 4HX7A 2DAOA 1S7AA 2BEOA 2P7CB 2JZYA 2DU9A 3BP8A 1O7FA 2FEZA 3HRSA 1FZPB 3TQNA 3CO6C 3HYIA 1SMTA 2WV0A 4WXDA 2OBPA 1J59A 2Q2EA 4G94A 4U88A 4WX9A 3P9CA 4UHTA 4OIQF 1QO0D 3FHZA 1TTYA 2V1DA 2KJBA 4A5MA 1YW7A 4RB1A 3HHGA 4D0PA 1NHAA 2W84A 1UHMA 5ICFA 1FBSA 1AWCA 1D8JA 3HRTA 2R7FA 1USTA 1HKQA 2V9VA 3QP6A 1LNWA 3JAMZ 3F3XA 6PAXA 3PQKA 1J9IA 1YG2A 1O3RA 4EV0A 2KIMA 2KJCA 4LJZF 4OIPF 2Y0MA 3U1DA 1TQIA 1BIAA 3KP2A 1A04A 3HOSA 4PGGA 3P7NA 4KDPA 2CYYA 3J80Z 2EA2A 3KLNA 3ZMZA 1IN4A 1MJAA 1P4XA 1S7OA 1W7PB 2MLKA 3M7GA 3RYPA 2CWEA 2ZBKA 2YPRA 3L7WA 2QQ9A 2AS5F 4M9ZA 4KT5C 2HDCA 4MGRA 5LEKA 2V1XA 2GQQA 1HSTA 1J0RA 1W4MA 4BQAA 1ULYA 4IJAA 5HDNA 1MDMB 4HF0A 4HX4A 5BOXA 1L0OC 4N0BA 2A5YB 4U0VA 1B59A 4RB3C 5HLGA 4ETSA 4WXHA 3ZPLA 4ESJA 3TDUC 3L00A 1S29A 2VODA 1IRFA 4CYDA 5CVVA 2XKOA 2ZXJA 3KP3A 2E1CA 1H9GA 1XSVA 2Y48A 2Q0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTS C;  5ILV A;  5BPI A;  1YW9 A;  1P4A A;  4KIB A;  1JGS A;  1O3T A;  4CIC A;  3DXJ F;  1BI3 A;  3FMS A;  1U5T C;  2QUF A;  2EJR A;  2G9W A;  4I0B A;  1ZG5 A;  3FMQ A;  3GFL A;  3BZ6 A;  4OMY A;  2VE9 A;  1FYM A;  3HRU A;  1FSE A;  5LBQ A;  4HZF A;  3PQJ A;  3CTA A;  2LKP A;  3ZN0 A;  3E3V A;  2IW5 A;  3EDP A;  3TOB A;  1PUE E;  4Z2Y A;  5ICE A;  1FY7 A;  5KVR A;  1YQA A;  3EYY A;  3GVA A;  1I1S A;  1G3Y A;  1LJ9 A;  1R36 A;  2XAS A;  2OQG A;  4OMZ A;  1KU7 A;  2IA2 A;  2F5E A;  4G6D A;  5K5R A;  4I98 B;  4EJW A;  2FMY A;  2TDX A;  3KCC A;  2EK5 A;  2M8E A;  4A12 A;  2PN6 A;  3ZP5 A;  3T0Y A;  1O57 A;  3VOE A;  4IHS A;  1N1C A;  1TW3 A;  4YFK F;  3E6B A;  1O3S A;  3BRO A;  5DDG A;  3M8E A;  1G3W A;  4L0Y B;  1FOK A;  1Y0U A;  3I5U A;  1MDM A;  3KP6 A;  4A0X A;  1SFX A;  3E6M A;  3LAP A;  2UZK A;  1YS7 A;  2BE5 F;  3JTH A;  3KP7 A;  4KYW A;  2B0L A;  2PBI A;  1L3L A;  1IN7 A;  1ZRE A;  1ZGJ A;  3KLO A;  1R23 A;  4R8H A;  2DPD A;  1FPO A;  3CJN A;  4XBF A;  2P4W A;  3KE2 A;  1SD6 A;  2QQB A;  1QNT A;  1GVJ A;  1XGN A;  2F5C A;  4AWX B;  1IRG A;  1TQM A;  2FRH A;  5EEH A;  2EFQ A;  4MTE A;  3JAM K;  3KEO A;  1LEA A;  4XSX F;  2L4M A;  4CZZ A;  3GWZ A;  1E2X A;  2M45 A;  5ERI A;  3K1P A;  5FO5 A;  3ZQ7 A;  5D4R A;  2RDP A;  3V7R A;  4G7Z F;  3SHF A;  1K6O A;  5LHI A;  5F6F A;  4CHU A;  1P92 A;  3K69 A;  2NS0 A;  3CLO A;  5HOO A;  5JI6 A;  1LB2 A;  3V8J A;  3R6S A;  3GLX A;  1FT9 A;  2XHK A;  1ZHF A;  3BPV A;  1Z91 A;  1U8R A;  1XSX A;  3N97 A;  4KUM A;  4UVB A;  4KN7 X;  1XMK A;  2QQA A;  2YX7 A;  3CUO A;  1KYZ A;  3F8B A;  2BBY A;  3LWF A;  3E5U A;  4I0A A;  3F23 A;  1ZLJ A;  1OYY A;  1DDN A;  4P96 A;  5E1W A;  2KIU A;  4OIR F;  4CO8 A;  1J2X A;  3U2R A;  5L3E A;  1YTY A;  2XVC A;  4PDK A;  2WC2 A;  3FXQ A;  3FWE A;  4I7H A;  5CJ9 A;  3RTR A;  2WWY A;  5CVU A;  3V8K A;  1G3T A;  3GX4 X;  4HLX A;  2RNJ A;  5K5Q A;  2ZNZ A;  1U2W A;  3Q5F A;  3V4G A;  1SD5 A;  5F1R A;  1HW5 A;  3MCZ A;  3ZMS A;  2ESH A;  1HXD A;  1EH7 A;  3ZMD A;  2L02 A;  5E18 F;  1BC8 C;  2CG4 A;  4KIF A;  5BMZ A;  1XSD A;  2V1U A;  2H6C A;  3U9G A;  3ERE D;  2P5V A;  1FX7 A;  1SMY F;  4N9H A;  5DD8 A;  3O3K A;  1J7K A;  2DK5 A;  1F5T A;  2O3F A;  3D0S A;  3L09 A;  1JHH A;  2A61 A;  4KMU X;  3SZT A;  2J5O A;  3COA C;  2D45 A;  4ESB A;  4HDV A;  1BM9 A;  2HGC A;  1WSU A;  1KU2 A;  4Q47 A;  4EM2 A;  4N9I A;  3DF8 A;  3WTU C;  4ENM A;  1K78 A;  3HSE A;  1IN5 A;  4ZH4 F;  3IRR A;  1YO5 C;  2STW A;  4GYI A;  3K9T A;  2PI0 A;  3CUQ C;  3K0L A;  2MC3 A;  2EFO A;  3JSP A;  5H20 A;  3JW4 A;  3HTS B;  3RDI A;  4ZYG A;  3LST A;  3F22 A;  1FPQ A;  3HRM A;  4P55 A;  2YX4 A;  2QBY B;  2M1B A;  1Z6T A;  2M87 A;  4BHC A;  3TDZ C;  3J7A O;  4HDU A;  4ON0 A;  3QPT A;  2FNA A;  3QPH A;  1G3S A;  4DQ2 A;  4GCV A;  3OOP A;  4PZJ A;  4IPA A;  4FT8 A;  4L9V A;  2WTE A;  1FP2 A;  2M5W A;  4WK8 F;  2MLG A;  1MJ9 A;  5ICC A;  2IT0 A;  3C7J A;  2GXG A;  1IAW A;  3SQN A;  3M1E A;  3IRQ A;  2DI3 A;  2ZFW A;  5AIP A;  1Z6R A;  4FHT A;  2VOP A;  3B02 A;  4U0W A;  2VBW A;  5FGM A;  4OU0 A;  5FFX A;  4ZYD A;  4HAM A;  5K1Y A;  1ONV A;  1XCV A;  4XLN F;  4FX0 A;  3F6V A;  3TOA A;  1RNL A;  2QEN A;  4L18 B;  5H6Q A;  4AIJ A;  2OQR A;  4IT5 A;  3N4M A;  3I71 A;  2UWM A;  3F8F A;  1TLH B;  1G6N A;  1R1T A;  2DQR A;  2K7L A;  5CVI A;  1BIB A;  4BHP A;  1CF7 A;  3TO9 A;  2FU4 A;  3GYH X;  1IZ1 A;  1S6L A;  5D5U B;  3DPL C;  2VBX A;  3F72 A;  1W5S A;  4A2U A;  4KNY A;  1WRJ A;  3LA3 A;  5DCM A;  4LLG F;  4KN4 X;  3QRF F;  3FXU A;  5FB2 A;  1STZ A;  2FNP A;  1SD7 A;  4BH9 A;  2H27 A;  2H94 A;  1YIO A;  4GGG A;  4B8X A;  3LFK A;  1FSH A;  1KQ9 A;  1YFH A;  1OMI A;  2HR3 A;  2FXA A;  3IWF A;  2ZME A;  3LA2 A;  2XUB A;  2XAF A;  3BJA A;  3HHH A;  4UNO A;  4EJU A;  4P5O A;  2QBY A;  3HUG A;  4Q48 A;  3BJ6 A;  4RAZ A;  1MJB A;  3RKY A;  3RIR A;  3F8M A;  4IXA A;  4HV5 A;  1K7A A;  1TBX A;  1UCR A;  4EJT A;  4YG2 F;  4GO1 A;  1E17 A;  1HBX G;  1RZ4 A;  2O6G E;  1SFE A;  1R5G A;  5L3D A;  2Z3Y A;  2Z9O A;  1QPM A;  3ROU A;  4BXU A;  2FF4 A;  2YU3 A;  3VFZ A;  5D8K B;  1KYW A;  4IHT A;  4HX8 A;  1BBY A;  2CSO A;  3F8C A;  5HS8 A;  1U78 A;  4YFX F;  4M6Y A;  4P9F A;  2V79 A;  4RGU A;  3I4P A;  4UUV A;  2FML A;  1U5T B;  2O61 A;  2DBB A;  3HOT A;  4WCG A;  1G4D A;  5LLQ A;  5LHH A;  3GFM A;  4ESF A;  2HTJ A;  1S8N A;  3WE3 A;  1RUO A;  1ZG1 A;  1ON2 A;  1O3Q A;  1K79 A;  2EV6 A;  1WWX A;  2EFP A;  3I58 A;  3TO7 A;  3F21 A;  5HVQ C;  2D1H A;  2D1V A;  1FLI A;  4A0Y A;  3R60 A;  3IKT A;  5ICG A;  2PLY A;  3WTY C;  2VT2 A;  1XN7 A;  2W57 A;  3EET A;  1U3E M;  2ZNY A;  2FQ3 A;  1Q1H A;  4BNC A;  1IXS B;  1T2K A;  2QM3 A;  5L3B A;  2A68 F;  5JFR A;  2DFI A;  4R1H A;  2V6C A;  5IT9 Z;  2JSC A;  3G73 A;  2HZT A;  2ZCW A;  1Z1D A;  2EWN A;  2HS5 A;  5JHU A;  4MTD A;  1FBQ A;  1VTN C;  1QQI A;  1KU3 A;  2GZW A;  1REP C;  2DPU A;  4IRI A;  1XGM A;  2ADU A;  2NNY A;  4R79 A;  2L01 A;  5D8L B;  1IXR C;  1WI9 A;  3LAJ A;  3TO6 A;  2RVC A;  2CW0 F;  1S3J A;  2FSW A;  2J5P A;  3GUD A;  2VXZ A;  5IT3 A;  3QU3 A;  4NB5 A;  2IP2 A;  1ZLK A;  2HYF A;  4QLC U;  2XAH A;  4EM1 A;  4JBA A;  3Q9S A;  1FWZ A;  4KMF A;  2W24 A;  3RKW A;  4ZZD A;  1EH8 A;  4Y13 A;  5DD4 A;  1HKT A;  3IL2 A;  3ECO A;  1J75 A;  2EB7 A;  2P8T A;  4OIO F;  2KIF A;  3P9K A;  4UV8 A;  2FOK A;  4XRF A;  5HS9 A;  2ISZ A;  3T5X A;  4ZZL A;  1KU9 A;  1KGS A;  3GW2 A;  3WGH A;  5HLI A;  3UO3 A;  3I64 A;  1MD0 A;  2VBZ A;  1FNN A;  1U5T A;  4U7D A;  4EQQ A;  3MAJ A;  3FXR A;  5AON A;  2YSR A;  1DP7 P;  4M74 A;  4PGH A;  2PQ8 A;  2Z33 A;  1ZG3 A;  4YIF A;  3D5L A;  1ZYR F;  3CDH A;  1TW2 A;  4F7Z A;  3HSR A;  3M8F A;  2ZO4 A;  3BWG A;  2DW4 A;  3P9I A;  5L3G A;  3KET A;  5ILS A;  2K4B A;  5FFZ A;  1IW7 F;  1ODD A;  2FE3 A;  2ZKZ A;  1C0W A;  2GA1 A;  4M71 A;  4UVA A;  5FLX Z;  2F5F A;  1EH6 A;  1K78 B;  3SZP A;  2MH2 A;  3EUH A;  4L9N A;  3J80 K;  2FBK A;  3QOP A;  3ISP A;  4AIK A;  2HYG D;  4O5V A;  5D5W B;  4S04 A;  3FMR A;  1D3Y A;  1WKM A;  3GZ5 A;  5DEQ A;  2L3D A;  3GXO A;  4L9J A;  2VON A;  1DUX C;  2ELH A;  5ILU A;  3O2P E;  2LDU A;  1R7J A;  4Q5S F;  4A5N A;  1XD7 A;  1QZZ A;  2JT1 A;  4MEY F;  2K27 A;  3L2C A;  2FA5 A;  5DYM A;  2Q8K A;  1H9T A;  4UXN A;  4AVP A;  2R7D A;  3LA7 A;  2AXL A;  5K5O A;  2VOO A;  3GEZ A;  3BVO A;  4S05 A;  3ML6 A;  2HQN A;  2E7W A;  1BI2 A;  2O0Y A;  2HWV A;  3MFK A;  4IVN A;  2MA3 A;  4NQW A;  2PG4 A;  5CLS A;  1FBU A;  5DUI A;  5E20 A;  1GHC A;  4KA4 A;  1XDU A;  1JE8 A;  2XV4 S;  1AOY A;  3WTZ A;  4Y17 A;  4YII A;  4DNC A;  4HW0 A;  2O8X A;  3F8N A;  2GXB A;  2OD5 A;  5J6X A;  1FC3 A;  1V3F A;  2A69 F;  3DFG A;  3LQQ A;  4HF1 A;  4EGY A;  4LLN A;  1TNT A;  4G7H F;  1FYL A;  4EMS A;  5DV5 A;  2R3S A;  1R00 A;  3WTX C;  1SD4 A;  3R0J A;  3V7C A;  1CF7 B;  4IRH A;  2VT3 A;  5DCM B;  2BYV E;  4LLL A;  1RI7 A;  2CQK A;  2Z99 A;  1X3U A;  4G7O F;  4LB5 A;  5J8F A;  4XLP F;  2XKP A;  5D6F A;  4B09 A;  3KP4 A;  3IHU A;  1ZH5 A;  5D6E A;  3PFI A;  4RB0 A;  3E5Q A;  5D4S A;  3DV8 A;  2P5L C;  2DO7 A;  2HQR A;  4I2O A;  1BI1 A;  1QZY A;  2ZME B;  3DPT A;  2XIG A;  4JK1 X;  1LDJ A;  1R5H A;  3I0T A;  1OPC A;  1XMA A;  2K4J A;  1GXP A;  5E17 F;  2P5K A;  4LB6 B;  4M6X A;  3T8T A;  3WOD F;  3ZMU A;  1I5Z A;  3HIF A;  3W6K B;  3FM5 A;  3WU1 B;  4UV9 A;  2X4H A;  2BGC A;  5LGN A;  4A6D A;  1UB9 A;  1YLF A;  2EV5 A;  1WQ2 A;  1B1B A;  3ELK A;  3R0A A;  2LSO A;  3WGI A;  1IUY A;  2HTS A;  3KP5 A;  5D5V B;  1LEB A;  4G8X A;  2BV6 A;  5BPD A;  2HFH A;  4MNU A;  3MZH A;  1KA8 A;  5FLX K;  3E5X A;  3C18 A;  2XAG A;  4OIN F;  5H6R A;  2PMU A;  3GO5 A;  4I01 A;  3MEX A;  4ENJ A;  3REO A;  1YW8 A;  2GA2 A;  3WU0 A;  2JTV A;  4RS8 A;  4JQF A;  3CUQ A;  3M9A A;  1BN5 A;  4K2E A;  2RN7 A;  4HF2 A;  4LK0 F;  3K2Z A;  5CVR A;  3IC7 A;  3RYR A;  4CDG A;  1USS A;  2KKO A;  3TKY A;  4A6E A;  4NHJ A;  4EGZ A;  3MQ0 A;  3KZY A;  3OV8 A;  3VOD A;  2H09 A;  2G7U A;  3QAH A;  3SXY A;  3RJP A;  1R1V A;  3DP7 A;  5HDK A;  2CFX A;  4YFN F;  4HQE A;  2L4A A;  5CYV A;  2STT A;  4ASN A;  2XRO A;  5F64 A;  4A0Z A;  4I02 A;  2NYX A;  1I6X A;  3BY6 A;  3WTV C;  1B9N A;  5TRD A;  2XGX A;  2PFB A;  2QZ8 A;  1V4R A;  3JTG A;  1R1U A;  1IN6 A;  3E6D A;  4LG0 A;  5D5X B;  4RGX A;  2OAZ A;  3FF5 A;  3ULQ B;  1MZB A;  2Z5U A;  4HA8 A;  3Q9V A;  4L5I A;  2ZJ2 A;  2ETH A;  3KEQ A;  1LDK B;  4RGS A;  4WWC A;  3H3Z A;  3S2W A;  1ZRC A;  4O6J A;  1QBJ A;  4G9Y A;  3ABU A;  2JRT A;  2HKO A;  2MBF A;  1MGT A;  1EV7 A;  3DKW A;  3I59 A;  3BDD A;  2QWW A;  4PCQ A;  5LHG A;  5HLH A;  1SAX A;  3MZY A;  2QLZ A;  3ECH A;  3H3U A;  3I54 A;  2A07 F;  5FD5 A;  1P6R A;  2IPQ X;  1J5Y A;  2X0L A;  1I1G A;  4LK1 F;  1T98 A;  3UO2 A;  3NEU A;  4HQM A;  5L3F A;  1O7L A;  2XAQ A;  4Y15 A;  1HQC A;  3ZMT A;  5LEJ A;  5E1Z B;  1B4A A;  2LF7 A;  1D5V A;  3F6O A;  5HDG A;  1T39 A;  1H0M A;  1KQ0 A;  4FX4 A;  1F4K A;  2QVO A;  1B9M A;  5E8G A;  3H92 A;  2UXX A;  5HS7 A;  1T38 A;  2COM A;  4KIG A;  1LDD A;  5JR3 A;  1OR7 A;  3J81 Z;  1HW1 A;  2P6T A;  2FBH A;  1DPR A;  3QU6 A;  5A2Q Z;  4H0E A;  4BYY A;  1P4W A;  4KFC A;  3FX3 A;  3EQL F;  2JPC A;  3FZV A;  2DT5 A;  1U6G A;  2XAJ A;  1R58 A;  1DPU A;  3V7S A;  3RPU A;  4Q4Z F;  1SFU A;  5FD6 A;  3VEP A;  5DCF A;  2K02 A;  1PP7 U;  3MWM A;  3K1N A;  1OYW A;  2E7X A;  5EEG A;  2OU2 A;  4RB2 C;  1ZRF A;  2G7H A;  3BOQ A;  4M9X A;  1PP8 F;  2YR2 A;  3EYI A;  3T8R A;  2IA0 A;  1TNS A;  4HV6 A;  4EVI A;  1R22 A;  4LFU A;  1XGO A;  2XRN A;  2EA4 A;  5AIQ A;  2RKH A;  5BQT A;  4MHG A;  3C3W A;  1W7P A;  4I09 A;  2OZ6 A;  1MKM A;  3BPX A;  4M73 A;  2GWR A;  1ZN2 A;  1BJA A;  2A6H F;  1JHF A;  2MH9 A;  4RAY A;  2NNN A;  5E8I A;  4LD5 A;  2M30 A;  1W7P D;  1JXS A;  4L5J A;  1OKR A;  2DLL A;  4XSZ F;  3IKV A;  3K1M A;  3R4K A;  4UVC A;  4TV7 A;  2ISY A;  2VC0 A;  2C6Y A;  3RKX A;  3ABT A;  4U0Y A;  1F9N A;  4IRG A;  3B73 A;  4G6Q A;  2LF8 A;  4QWQ A;  3KZZ A;  3W6J B;  1FYK A;  3G3Z A;  1D8K A;  2IJL A;  4EJV A;  5LRR A;  1QGP A;  5BS6 A;  2RV8 A;  2IVM A;  3WGG A;  3HTU A;  4IF4 A;  5L3C A;  5J8C A;  2DQL A;  3KFW X;  1OYI A;  2VN2 A;  4AIH A;  2FBI A;  1FP1 D;  1Z9C A;  1HW2 A;  2KRF A;  3WG9 A;  2PMH A;  3V8L A;  4BHB A;  1IXC A;  3GFI A;  1F1Z A;  3R61 A;  1PDN C;  2W85 A;  2UXN A;  2VC1 A;  2W25 A;  1IN8 A;  2JPB A;  2H6B A;  3GFJ A;  4LMY A;  1ZGA A;  4HLY A;  2A3S A;  3GF2 A;  1ON1 A;  1RUN A;  4M72 A;  1ZAR A;  1Z7U A;  3LQR A;  2PJP A;  4RGR A;  4HOB A;  5LRS A;  2F5D A;  2GIV A;  2IA1 A;  2DTR A;  2MD5 A;  2IRF G;  4MQ9 F;  1W5T A;  1CGP A;  4CGZ A;  2OA4 A;  2LNB A;  5LGU A;  3DQV C;  4WXC A;  4GYG A;  3RI4 A;  2NRA C;  2RGV A;  1UHW A;  2EFW A;  2EV0 A;  2QYO A;  1HKS A;  1T0F A;  2VBY A;  4EJO A;  4MEX F;  1YS6 A;  4P9U A;  3J81 K;  1LQ1 A;  3VB2 A;  3I53 A;  5A2Q K;  2DK8 A;  4HBL A;  1TQP A;  2Y75 A;  1T6S A;  1RIO H;  3DEU A;  4GXO A;  5IT9 K;  2GAU A;  3WTW C;  4O3M A;  3C1D A;  3CUQ B;  1XB4 A;  1HSJ A;  2PEX A;  4M9S A;  1BC7 C;  4E70 A;  5TJJ A;  3T1B A;  1YYV A;  1BI0 A;  5KK1 A;  2RC4 A;  3WTT C;  3SFZ A;  4WF2 A;  3QP5 A;  2E1N A;  2CO5 A;  4MQV A;  4ENK A;  4L9T A;  5DUK A;  1Z05 A;  3L9F A;  5CVJ A;  4CXF A;  1XCB A;  5JVT A;  2D2W A;  4ENN A;  3E6C C;  4EM0 B;  4OOI A;  4LGW A;  2P7V B;  3IWZ A;  5LGT A;  3TGN A;  4LG0 B;  1UFM A;  3ZN1 A;  1IF1 A;  4BAY A;  3NRV A;  3HSF A;  2NAZ A;  4U7B A;  1KQ8 A;  3GZ6 A;  2HKX A;  2HEO A;  4ZYE A;  2K86 A;  2CGP A;  1B6A A;  1BOA A;  2A6E F;  2F2E A;  3WE2 A;  3AAF A;  3ZMV A;  1I27 A;  3CO7 C;  3E97 A;  3O6B B;  5ED4 A;  3I59 B;  4ZYH A;  2VE8 A;  3JSO A;  1XDS A;  4HYE A;  2HOE A;  2L54 A;  4AD9 A;  4L0Z B;  2OZU A;  2EFN A;  1ZRD A;  3BJO A;  2ACJ A;  1ZAO A;  3RPQ A;  2ESN A;  5E1X A;  4KIC A;  1XGS A;  2O03 A;  3FM3 A;  2P6S A;  1LVA A;  2RQP A;  1P2F A;  1GXQ A;  3NQO A;  4HX7 A;  2DAO A;  1S7A A;  2BEO A;  2P7C B;  2JZY A;  2DU9 A;  3BP8 A;  1O7F A;  2FEZ A;  3HRS A;  1FZP B;  3TQN A;  3CO6 C;  3HYI A;  1SMT A;  2WV0 A;  4WXD A;  2OBP A;  1J59 A;  2Q2E A;  4G94 A;  4U88 A;  4WX9 A;  3P9C A;  4UHT A;  4OIQ F;  1QO0 D;  3FHZ A;  1TTY A;  2V1D A;  2KJB A;  4A5M A;  1YW7 A;  4RB1 A;  3HHG A;  4D0P A;  1NHA A;  2W84 A;  1UHM A;  5ICF A;  1FBS A;  1AWC A;  1D8J A;  3HRT A;  2R7F A;  1UST A;  1HKQ A;  2V9V A;  3QP6 A;  1LNW A;  3JAM Z;  3F3X A;  6PAX A;  3PQK A;  1J9I A;  1YG2 A;  1O3R A;  4EV0 A;  2KIM A;  2KJC A;  4LJZ F;  4OIP F;  2Y0M A;  3U1D A;  1TQI A;  1BIA A;  3KP2 A;  1A04 A;  3HOS A;  4PGG A;  3P7N A;  4KDP A;  2CYY A;  3J80 Z;  2EA2 A;  3KLN A;  3ZMZ A;  1IN4 A;  1MJA A;  1P4X A;  1S7O A;  1W7P B;  2MLK A;  3M7G A;  3RYP A;  2CWE A;  2ZBK A;  2YPR A;  3L7W A;  2QQ9 A;  2AS5 F;  4M9Z A;  4KT5 C;  2HDC A;  4MGR A;  5LEK A;  2V1X A;  2GQQ A;  1HST A;  1J0R A;  1W4M A;  4BQA A;  1ULY A;  4IJA A;  5HDN A;  1MDM B;  4HF0 A;  4HX4 A;  5BOX A;  1L0O C;  4N0B A;  2A5Y B;  4U0V A;  1B59 A;  4RB3 C;  5HLG A;  4ETS A;  4WXH A;  3ZPL A;  4ESJ A;  3TDU C;  3L00 A;  1S29 A;  2VOD A;  1IRF A;  4CYD A;  5CVV A;  2XKO A;  2ZXJ A;  3KP3 A;  2E1C A;  1H9G A;  1XSV A;  2Y48 A;  2Q0O A; 
#chains in the Genus database with same CATH topology
 2VQH A;  1XPX A;  2H4T A;  4RNG A;  3CCY A;  3WTS C;  5ILV A;  5BPI A;  4UY8 I;  1YW9 A;  1P4A A;  4KIB A;  1NK2 P;  1T95 A;  4RA2 A;  3PO2 J;  2DT7 B;  3L2V A;  3BQZ A;  1JGS A;  4GRI A;  4IO9 F;  1ZR2 A;  1O3T A;  4JS4 A;  4CIC A;  3OYG A;  3DXJ F;  1BI3 A;  2DTZ A;  3FMS A;  1U5T C;  2QUF A;  2EJR A;  2G9W A;  4XID A;  3BR3 A;  4I0B A;  1ZG5 A;  2MG4 A;  3FMQ A;  2IEK A;  3GFL A;  3DBL B;  3JRF A;  3BZ6 A;  4CUG A;  3HPG A;  2W48 A;  4AI6 A;  4C2M J;  4OMY A;  3CCS I;  2VUM J;  2VE9 A;  4II2 A;  1WFX A;  3HRU A;  1FYM A;  1FSE A;  2RCU A;  4AYB N;  5LBQ A;  4DYQ A;  1QA6 A;  3UIQ A;  4DTO A;  4HZF A;  4B3X A;  3PQJ A;  3CTA A;  2LKP A;  5JHF A;  3ZN0 A;  1IRZ A;  4RG8 A;  4KI6 A;  1YHQ I;  1RES A;  3E3V A;  5GPC A;  2IW5 A;  3AG1 H;  3EDP A;  4M45 A;  3ERM A;  1QRY A;  3Q0W A;  3TOB A;  1PUE E;  3AL0 C;  1IDY A;  4Z2Y A;  1X2N A;  1FY7 A;  5ICE A;  3HGL A;  4BDY A;  5F08 A;  5KVR A;  3SJM A;  1IUF A;  1YQA A;  3EYY A;  1W0U A;  2F4I A;  1FIA A;  1WH5 A;  2VXD A;  3GVA A;  1VQ6 I;  3Q0U A;  1WJE A;  1I1S A;  3TP3 A;  3GME A;  1G3Y A;  2KIQ A;  1LJ9 A;  4IQ4 A;  1LVK A;  5GPA A;  1R36 A;  3CF2 A;  2XAS A;  3PNY A;  2OQG A;  3A2K A;  4OMZ A;  4XRM A;  2IA2 A;  1KU7 A;  1WVR A;  1OCZ H;  2F5E A;  4B47 A;  1U9O A;  4G6D A;  3EUH C;  3K7A J;  4FCY A;  1A6I A;  4B44 A;  3CQ8 A;  5K5R A;  4I98 B;  4EJW A;  3HXL A;  4HSR A;  2FMY A;  3W3C A;  3SDB A;  3DLL F;  2TDX A;  3KCC A;  2JVH A;  4J2B A;  2EK5 A;  2M8E A;  3CCU I;  4A12 A;  4E7I A;  3BR0 A;  2QGU A;  3K4M A;  2PN6 A;  1T33 A;  3ZP5 A;  3T0Y A;  3HOW J;  1O57 A;  3VOE A;  4IHS A;  2BY1 A;  2JUC A;  1N1C A;  1TW3 A;  2NXN B;  1ITY A;  4YFK F;  1PJR A;  3E6B A;  2DFF A;  1O3S A;  3BCB A;  4HRI A;  4LOC A;  3S32 A;  2O9L A;  3BRO A;  5DDG A;  5E79 C;  3M8E A;  1QHG A;  1G3W A;  4L0Y B;  5J1R A;  1JW2 A;  3ASN H;  5KHD A;  2R7Z J;  1EA3 A;  1FOK A;  1Y0U A;  4XRS A;  3FHN A;  1FZ9 E;  3I5U A;  1MDM A;  3KP6 A;  1IV8 A;  2IS2 A;  1X1B A;  4A0X A;  1SFX A;  4YEJ A;  4BBR J;  3E6M A;  5GTI C;  3LAP A;  2UZK A;  3K70 D;  1YS7 A;  2WAE A;  2WV1 A;  3NWS A;  2BE5 F;  3JTH A;  3K4B A;  3KP7 A;  4DYR A;  3C2B A;  4KYW A;  3OGL B;  2B0L A;  2PBI A;  2R93 J;  3LSG A;  1L3L A;  1IN7 A;  1ZRE A;  2ZJQ F;  1ZGJ A;  3KLO A;  1R23 A;  4R8H A;  2DPD A;  1RRJ A;  3SQ1 A;  1FPO A;  5DS9 A;  3D5R C;  1D1B A;  2IGO A;  3CJN A;  4XBF A;  2L7F P;  2P4W A;  4N4N B;  3KE2 A;  1V54 H;  1SD6 A;  2QQB A;  2CS3 A;  2N8G A;  1QNT A;  1R6R A;  3OYF A;  1GVJ A;  1XGN A;  2GIZ A;  1KZH A;  2F5C A;  4AWX B;  1IRG A;  1TQM A;  2FRH A;  5EEH A;  2EFQ A;  4MTE A;  3JAM K;  3KEO A;  2VKH A;  1LEA A;  4CCO A;  4UUS B;  1XVE E;  5FRM A;  4XSX F;  3TW6 A;  2L4M A;  4CZZ A;  5FKK A;  4PJN A;  4XLC A;  3GWZ A;  1A35 A;  1E2X A;  3VSK A;  4KJZ A;  2X6W A;  3H5A A;  2M45 A;  4W97 A;  2EIK H;  1RKW A;  3U1K A;  5ERI A;  4A3L J;  2B8I A;  3K1P A;  5FO5 A;  3ZQ7 A;  1X2M A;  5D4R A;  2RDP A;  5BNG A;  3V7R A;  4G7Z F;  3SHF A;  1K6O A;  2P1O B;  3OYJ A;  2QA4 I;  3Q3S A;  5LHI A;  3L0M A;  2HVQ A;  5F6F A;  3AKZ A;  4CHU A;  2RNG A;  1P92 A;  4EP9 A;  2DA2 A;  2BZT A;  3K69 A;  2NS0 A;  2E1M C;  2K85 A;  3V42 A;  3CLO A;  5HOO A;  5JI6 A;  1LB2 A;  3NGI A;  3V8J A;  2E2H J;  3R6S A;  3GLX A;  1FT9 A;  4XKB A;  2XHK A;  1ZHF A;  3K6G A;  3LFU A;  3OL3 A;  3BPV A;  3IAS 2;  1Z91 A;  2KT0 A;  4FJN A;  2Y2Z A;  3PIP F;  1U8R A;  3C2G A;  4M42 A;  1XG1 A;  2VJI A;  1XSX A;  3N97 A;  3IH2 A;  2X6O A;  1ETW A;  4KUM A;  4UVB A;  5FLV A;  1G59 A;  4KN7 X;  3A0H C;  3VYR B;  1XMK A;  2EIJ H;  1FZH E;  3IH3 A;  2JVG A;  1MBG A;  2QQA A;  2YX7 A;  3CUO A;  1FTZ A;  1KYZ A;  3F8B A;  2BBY A;  3LWF A;  5B66 C;  2DMT A;  3E5U A;  4I0A A;  3ABK H;  3F23 A;  1ZLJ A;  1OYY A;  4QPQ A;  2BXZ A;  5F04 A;  4FJ5 A;  4HNT A;  1GV2 A;  2E35 A;  1DDN A;  4P96 A;  2L9S A;  3VDX A;  5E1W A;  2KIU A;  1YJN I;  1A31 A;  4KHW A;  4OIR F;  4CO8 A;  1J2X A;  4IL6 C;  2QKM B;  1U0J A;  3U2R A;  5L3E A;  1YTY A;  1A36 A;  3SQ2 A;  2XPW A;  2XVC A;  5FJ8 J;  4J19 A;  4PDK A;  4D5C A;  2X6Y A;  2WC2 A;  1FOW A;  3A01 A;  4JRP A;  1T56 A;  3FXQ A;  3SUP A;  1FMW A;  4BDZ A;  3FWE A;  4I7H A;  5CJ9 A;  4YIR X;  3MKZ A;  2JHA A;  3RTR A;  4GAM C;  2WWY A;  5CVU A;  5B1B H;  3V8K A;  1Z3X A;  5EZG A;  1G3T A;  3GX4 X;  4HLX A;  4ZC3 A;  2RNJ A;  2VKE A;  3QOE A;  5K5Q A;  2M34 A;  2DA3 A;  1U2W A;  2NOG A;  2ZNZ A;  3Q5F A;  2HI3 A;  2M8G X;  1Y8Q B;  3V4G A;  1SD5 A;  2DFH A;  5F1R A;  1HW5 A;  1TWH J;  1SFK A;  3HOX J;  3MCZ A;  3ZMS A;  2ESH A;  1HXD A;  1EH7 A;  3ZMD A;  2W7N A;  2L02 A;  3CME I;  2KPM A;  2L0K A;  5J4Y A;  4AYB A;  3OYH A;  5E18 F;  2FW3 A;  1BC8 C;  1XTA A;  3BTJ A;  4M3G A;  2CG4 A;  4KIF A;  5BMZ A;  1XSD A;  2V1U A;  2H6C A;  3U9G A;  3HGK E;  3ERE D;  4J2E A;  2P5V A;  2PFT A;  2M0C A;  1TWG J;  4ZJZ A;  4CSW A;  1FX7 A;  4AKH A;  1SMY F;  3CDI A;  3BG7 A;  4N9H A;  1H88 C;  2VQL A;  4B48 A;  5DD8 A;  1LFP A;  3O3K A;  3D1N I;  3HM5 A;  2Q2E B;  1J7K A;  3BTL A;  1IGN A;  1WZ2 A;  3L2W A;  4FJJ A;  2DK5 A;  3RMA A;  1F5T A;  2O3F A;  3LMM A;  3D0S A;  3L09 A;  1JHH A;  2A61 A;  4KMU X;  3SZT A;  1MMG A;  2J5O A;  3COA C;  3S17 J;  3TBI A;  2D45 A;  1ETQ A;  4M6V A;  4ESB A;  4C2U A;  1U9N A;  2EIN H;  4HDV A;  1BM9 A;  2ZSH B;  2HGC A;  5FKN A;  2V9K A;  1KU2 A;  2M9H A;  3C2H A;  1WSU A;  3MKS B;  4XKW A;  1K4S A;  2DJN A;  4Q47 A;  4EM2 A;  4N9I A;  3DF8 A;  4BQN A;  3WTU C;  4XOT A;  4ENM A;  3HP9 A;  1K78 A;  1VQ7 I;  3HSE A;  2Z1D A;  1IN5 A;  4ZH4 F;  2H8R A;  1MBF A;  3IRR A;  2LOO A;  3HBL A;  1YO5 C;  3GLL A;  2STW A;  4GYI A;  3K9T A;  4QSH A;  2PI0 A;  2Y69 H;  2RAE A;  3CUQ C;  3K0L A;  2MC3 A;  3NAR A;  3CMA I;  2EFO A;  3JSP A;  3HJE A;  5H20 A;  3JW4 A;  3HTS B;  1WJF A;  3RDI A;  1T08 B;  1JT6 A;  4ZYG A;  3LST A;  3HZJ A;  2EZK A;  3OS0 A;  5M3F J;  3HOU J;  3UNG C;  4XLE A;  5J4V A;  3F22 A;  1FPQ A;  1M1E B;  3HRM A;  4P55 A;  2QEX I;  2YX4 A;  3PJR A;  2QBY B;  2ZC2 A;  2M1B A;  1Z6T A;  3HUG B;  2M87 A;  4RAG A;  4BHC A;  3NDK A;  3TDZ C;  2AHQ A;  3DEW A;  1YJW I;  3J7A O;  3TP0 A;  4HDU A;  3HGG A;  4ON0 A;  3I55 I;  3QPT A;  1XVC E;  3Q0V A;  1XU5 E;  2FNA A;  1MSE C;  1P7I A;  3BG6 A;  3QPH A;  1G3S A;  2OVQ B;  4DQ2 A;  2XGE A;  1QVT A;  3OOP A;  4GCV A;  4MIM A;  4IPA A;  4PZJ A;  4FT8 A;  4IOA F;  4L9V A;  3ONQ A;  2WTE A;  1FP2 A;  3FIW A;  4XOP A;  2M5W A;  3BR1 A;  4WK8 F;  1OQY A;  1N25 A;  1TWA J;  2KP6 A;  2MLG A;  1JKP C;  1MJ9 A;  5ICC A;  2IT0 A;  3DPU A;  2KZG A;  3C7J A;  2GXG A;  4V2G A;  4CA0 A;  1P7J A;  1LE8 A;  1IAW A;  3SQN A;  3M1E A;  3IRQ A;  1SVO A;  2DI3 A;  3G4S I;  1AHD P;  1GVD A;  2ZFW A;  2OCC H;  3W2V A;  1WAJ A;  5AIP A;  1Z6R A;  4FHT A;  4M3D A;  4CCJ A;  3A0B C;  2VOP A;  3B02 A;  4U0W A;  4A3I J;  2VBW A;  5FGM A;  2KDZ A;  1FZ6 E;  4BEH B;  2BY2 A;  2HNH A;  4OU0 A;  5FFX A;  4CCN A;  4ZYD A;  3C6O B;  4HAM A;  5K1Y A;  3HL8 A;  3F9K A;  3H36 A;  4XKC A;  1ONV A;  2B7M A;  1XCV A;  4BY1 J;  4BE0 A;  4II3 A;  1MMA A;  4XLN F;  4FX0 A;  3F6V A;  1EKE A;  1FIP A;  2YB5 A;  3TOA A;  5GAE J;  1B72 A;  2KDO A;  4X5M A;  3S8P A;  3RZO J;  3RWU A;  1RNL A;  2QEN A;  4L18 B;  5IZ7 A;  2LBF B;  5H6Q A;  2F48 A;  4AIJ A;  2OQR A;  4IT5 A;  1MW7 A;  3PUF A;  3N4M A;  3HOZ J;  3I71 A;  1N78 A;  4QNC A;  2UWM A;  3F8F A;  4A3K J;  1R4M B;  2HOT A;  5B5E C;  3HOV J;  1WJ5 A;  1TLH B;  1G6N A;  4BJ6 C;  1R1T A;  2DQR A;  2HYJ A;  2EQR A;  2K7L A;  3GTL J;  1JKO C;  5CVI A;  4DTR A;  1BIB A;  1Z0X A;  3WU2 C;  4BHP A;  1CF7 A;  2HQA A;  2K9S A;  2FU4 A;  3TO9 A;  3GYH X;  3TMO A;  1IZ1 A;  1S6L A;  5D5U B;  2ZJP F;  3DPL C;  3S1Q J;  2VBX A;  3F72 A;  1W5S A;  4A2U A;  4XOR A;  1OFC X;  2MFZ A;  2E2J J;  4KNY A;  1WRJ A;  3LA3 A;  5DCM A;  4LLG F;  4KN4 X;  3QYB A;  3QRF F;  3FXU A;  1SFO J;  2R7V A;  4D7N A;  3FBN B;  2R7O A;  5FB2 A;  1STZ A;  2FNP A;  2FX0 A;  1UG2 A;  4DU4 A;  1SD7 A;  5HLT A;  1IH7 A;  1XMH E;  4X1E A;  1QHH D;  2JUG A;  3O8G A;  3I56 I;  4BH9 A;  2XSJ C;  2H94 A;  2H27 A;  1YIO A;  2M2E A;  4GGG A;  4M3F A;  3KZI C;  4HG2 A;  4C30 A;  4B8X A;  1RPW A;  2X51 A;  5E3N A;  3LFK A;  4X0G A;  3MZ8 A;  1FSH A;  1KQ9 A;  1VQM I;  3BC8 A;  1YFH A;  3E1S A;  2ZB9 A;  1OMI A;  2CUZ A;  1HOM A;  2HR3 A;  2V7F A;  2WA0 A;  2FXA A;  4I9L A;  1MBE A;  3OL4 A;  1VND A;  3IWF A;  2ZME A;  3LA2 A;  4MO7 A;  2XUB A;  2QSF X;  2NS7 A;  2XAF A;  2XB0 X;  1X4P A;  3BJA A;  3L2R A;  3HHH A;  3BZK A;  4UNO A;  3G2B A;  4EJU A;  3PNV A;  4M3U A;  4P5O A;  3JR9 A;  2QBY A;  3HUG A;  4Q48 A;  3S93 A;  3BJ6 A;  4RAZ A;  4ZDL A;  1MJB A;  3RKY A;  4GDF A;  3RIR A;  4X5N A;  1U8B A;  1WPK A;  2P5G A;  5M5W J;  3F8M A;  4HCB A;  4IXA A;  2KIS A;  4HV5 A;  4I76 A;  1K7A A;  1TBX A;  1UCR A;  2PX9 A;  3CP2 A;  1ERD A;  1D0Z A;  3B6C A;  1RC9 A;  4EJT A;  3WHB A;  4YG2 F;  4GO1 A;  1E17 A;  1MH4 A;  1V5F A;  1HBX G;  1RZ4 A;  2O6G E;  3AFH A;  3PSF A;  1OCT C;  1SFE A;  3SCX A;  1R5G A;  5L3D A;  2Z3Y A;  2Z9O A;  1QPM A;  3ROU A;  4XN0 A;  4BXU A;  2YU9 J;  2FF4 A;  1LDK E;  2YU3 A;  3VFZ A;  5D8K B;  4XRS G;  1KYW A;  5TGT A;  3SFI A;  4XL9 A;  4IHT A;  4HX8 A;  4E7S A;  4HPQ A;  3B6A A;  2MW2 A;  3QES A;  4RLQ A;  1BBY A;  5IYD J;  3LNQ A;  2CSO A;  3F8C A;  5HS8 A;  1U78 A;  1W1W E;  1Y1W J;  3KYL A;  2L9R A;  4YFX F;  4M6Y A;  1SAU A;  4PK4 A;  4BEH A;  4P9F A;  2V79 A;  4RGU A;  3CP8 A;  4F3Q A;  5E3O A;  3I4P A;  4QPO A;  4UUV A;  3ZCO A;  2FML A;  1U5T B;  2O61 A;  2HOS A;  1YRN B;  4Y7N J;  4DTN A;  2DBB A;  1MMN A;  1ZKG A;  2NVY J;  3HOT A;  4WCG A;  1G4D A;  2TCT A;  5LLQ A;  5LHH A;  1IDZ A;  2O7O A;  3GFM A;  4ESF A;  2HTJ A;  1S8N A;  4ZTJ A;  3WE3 A;  3OSF A;  1RUO A;  3H3V K;  4CYC B;  4NDL A;  4HNU A;  3VYU B;  1ZG1 A;  3CFO A;  1ON2 A;  2LBF A;  3HL2 A;  2A6T A;  1O3Q A;  1K79 A;  2EV6 A;  4BQO A;  5FKM A;  1WWX A;  1KON A;  2EFP A;  1YIJ I;  3I58 A;  1JTY A;  2CUJ A;  3TO7 A;  3F21 A;  5HVQ C;  3NE6 A;  4A3B J;  2D1H A;  2D1V A;  3VYS B;  2H8W A;  3E0J B;  4A69 C;  3GTO J;  3JRA A;  2CV1 A;  1FLI A;  3SPZ A;  4A0Y A;  1MSF C;  3HC7 A;  3R60 A;  2R7Q A;  4BL0 B;  1CLQ A;  3IKT A;  5ICG A;  1RKT A;  2PLY A;  3F0C A;  3WTY C;  1OIS A;  4B43 A;  2VT2 A;  1XN7 A;  2OC6 A;  2W57 A;  2L7K A;  3EET A;  1U3E M;  3ZOB A;  5IP9 J;  4G12 A;  1MHZ G;  2ZNY A;  2FQ3 A;  2VIX A;  3C6N B;  1G8X A;  3ESW B;  1Q1H A;  4BNC A;  1IXS B;  2CRG A;  1T2K A;  3CFP A;  4B4C A;  1W36 D;  3CMM A;  2MMB A;  2QM3 A;  3ZQG A;  2A68 F;  5L3B A;  5J1Y A;  2R4G A;  5JFR A;  1ZGW A;  2DFI A;  4R1H A;  4B08 A;  2V6C A;  1BW5 A;  1JGG A;  5IT9 Z;  1JI8 A;  2JSC A;  3G73 A;  2HZT A;  2ZCW A;  3LSM A;  1Z1D A;  1FOX A;  2EWN A;  2HS5 A;  2HD0 A;  5JHU A;  3CCL I;  4FJM A;  4DTM A;  3GTJ J;  3VSL A;  5FRN A;  4MTD A;  1FBQ A;  1VTN C;  1QQI A;  3OOU A;  1KU3 A;  2GZW A;  1REP C;  1MBJ A;  1X1P A;  3ZQF A;  2DPU A;  1WHU A;  4KHN A;  5FKO A;  4IRI A;  1XGM A;  2ADU A;  3OS2 A;  4R79 A;  2NNY A;  1Y0N A;  4DBQ A;  2DEB A;  2L01 A;  2K5S A;  2P5O A;  1K61 A;  1FZ2 E;  4EPH A;  4RAF A;  5D8L B;  1IXR C;  2CW7 A;  1OCO H;  3CCQ I;  1WI9 A;  1WJC A;  2XF7 A;  3EUA A;  4F52 A;  2Y31 A;  3TO6 A;  3LAJ A;  2RVC A;  1B8I B;  1S3J A;  2CW0 F;  3SZG A;  2FSW A;  3CFR A;  2J5P A;  3GUD A;  2FUG 2;  2F5V A;  1EF4 A;  2VXZ A;  2KHM A;  5IT3 A;  3OGM B;  3QU3 A;  3OYN A;  2HXI A;  3FKJ A;  1GLN A;  2EZI A;  4NB5 A;  2IP2 A;  4Y3O A;  1HA8 A;  5FKL A;  1ZLK A;  2HYF A;  4QIW N;  4QLC U;  2XAH A;  4EM1 A;  2DT6 A;  4BKX A;  4JBA A;  4NC8 A;  3Q9S A;  5B3S H;  1FWZ A;  4DGW B;  4KMF A;  2W24 A;  4DTS A;  3RKW A;  4ZZD A;  1EH8 A;  2M7B A;  1LFB A;  2LRD A;  4C3H J;  4E7J A;  1E3O C;  3OYL A;  4Y13 A;  4ADO A;  5DD4 A;  3DCF A;  5EJC A;  4B1R A;  2HDD A;  1HKT A;  3IL2 A;  3A01 B;  2R5Y B;  3ECO A;  1J75 A;  1I6H J;  2EB7 A;  1QU3 A;  1MNE A;  2P8T A;  4EAT A;  4OIO F;  2P1N B;  2OVR B;  2P1P B;  1NG6 A;  2L7M P;  5M3M J;  2X1D A;  4DIQ A;  2KIF A;  3OYB A;  2WY8 Q;  2XGD A;  3P9K A;  4UV8 A;  2FOK A;  4A3J J;  4XRF A;  5E3L A;  2Q1Z B;  5HS9 A;  2ISZ A;  3SUQ A;  2HZD A;  3T5X A;  4ZZL A;  1KU9 A;  1X19 A;  3MVP A;  3CCV I;  3A03 A;  1KGS A;  3GW2 A;  4A3E J;  3IAM 2;  3WGH A;  1AU7 A;  3S1R J;  5HLI A;  5H2F C;  1IV6 A;  3H0D A;  3K2A A;  1MIJ A;  2K9M A;  1FTT A;  3UO3 A;  2XPV A;  3I64 A;  1MD0 A;  2HPI A;  4Y33 A;  2VBZ A;  1FNN A;  4FJX A;  1U5T A;  1ZTR A;  4U7D A;  1YRN A;  4XM3 A;  4EQQ A;  3QYE A;  4M3R A;  1SVM A;  4C2T A;  3MAJ A;  3FXR A;  3PM1 A;  5AON A;  5J40 A;  4M41 A;  2X1C A;  3BR6 A;  2YSR A;  2CMP A;  1MND A;  1DP7 P;  5KAF C;  1TC3 C;  2HVR A;  4M74 A;  4CYC A;  2DMU A;  4PGH A;  3QET A;  2PQ8 A;  2DA4 A;  4XR6 A;  2Z33 A;  3S1N J;  1ZG3 A;  4YIF A;  2DYR H;  4XLF A;  3I9V 2;  3D5L A;  1TWF J;  3CCE I;  3DTE A;  1ZYR F;  2XDV A;  3CDH A;  1TW2 A;  3GBG A;  4F7Z A;  2CW8 A;  3LSR A;  4J01 A;  3HSR A;  3K10 A;  3M8F A;  3BLY A;  2ZO4 A;  2E1M B;  4EEF G;  2IS4 A;  1IO2 A;  3BWG A;  1T0F C;  2DW4 A;  3J27 A;  4BJ5 C;  2Y9Z A;  3P9I A;  2H1K A;  5L3G A;  3S15 J;  2KQR A;  1ZR4 A;  1AA7 A;  5DM7 F;  2EIL H;  4LIV A;  2OJE D;  3KET A;  2LKS A;  5ILS A;  2K4B A;  5FFZ A;  1IW7 F;  1ODD A;  2FE3 A;  2F4O B;  2ZKZ A;  3BTI A;  2JQT A;  4UB8 C;  1C0W A;  2GA1 A;  4DTU A;  1LPQ A;  3W6V A;  1TT5 B;  4M71 A;  3C94 A;  4UVA A;  1JUM A;  5FLX Z;  2XF5 A;  2F5F A;  1EH6 A;  3E4Y A;  3TED A;  1K78 B;  3SZP A;  3SYT A;  1YIT I;  2MH2 A;  3EUH A;  2X48 A;  4L9N A;  3J80 K;  4JX5 A;  3OYM A;  5GP9 A;  2BW3 B;  4YEL A;  2BHZ A;  1SC7 A;  2LY2 A;  3GTM J;  4NNJ A;  3MD2 A;  2MAB A;  2FBK A;  3QOP A;  3ISP A;  4DU3 A;  4AIK A;  2HYG D;  5HOD A;  1VQ4 I;  2YS9 A;  4O5V A;  5D5W B;  2ELJ A;  5F0C A;  2V6E A;  3FK7 A;  4KIS A;  4RMN A;  3QEV A;  4S04 A;  4J2D A;  3GTK J;  3FMR A;  3IV5 A;  1D3Y A;  1JUP A;  3UKG A;  1HCR A;  1WKM A;  3GZ5 A;  4BJT A;  5DEQ A;  4XKV A;  2L3D A;  2JPN A;  3GXO A;  4L9J A;  4A3G J;  2QXF A;  2VON A;  4ZTF A;  1DUX C;  2KRC A;  3A4C A;  2LG4 A;  3BT9 A;  2DXI A;  1B8I A;  2ELH A;  2JA2 A;  5ILU A;  3O2P E;  2Y9Y A;  4I9Q A;  3CJT B;  1S72 I;  4QND A;  2LDU A;  1R7J A;  4Q5S F;  2O8K A;  3SUN A;  4A5N A;  1XD7 A;  1QZZ A;  1TWC J;  2CUE A;  2JT1 A;  4MEY F;  4DZJ A;  2K27 A;  4AVZ A;  5C44 J;  4W1U A;  4FJH A;  3L2C A;  2FA5 A;  4IZZ A;  1JKR C;  3GCM A;  3W2W A;  5GTH C;  4U87 A;  5DYM A;  2Q8K A;  2VJJ A;  4JOM A;  2XF6 A;  4UXN A;  1PUF A;  4AVP A;  2R7D A;  4MLO A;  1H9T A;  2A05 A;  3PNT A;  3LA7 A;  2AXL A;  5K5O A;  2VOO A;  3GEZ A;  2R5Y A;  1LE8 B;  4CCM A;  2CUF A;  4PUS A;  3BVO A;  5DTD A;  1ACI A;  4S05 A;  1S5L C;  3ML6 A;  1E3H A;  1R71 A;  4RM2 A;  2HQN A;  1R9T J;  2PMZ N;  3OIO A;  2E7W A;  1BI2 A;  4UB6 C;  2O0Y A;  2HWV A;  3MFK A;  4IVN A;  1N77 A;  2MA3 A;  1VQN I;  3OS1 A;  4NQW A;  5M5Y J;  2ZFU A;  1YI2 I;  1VQO I;  2PG4 A;  5CLS A;  1FBU A;  3BCA A;  4BGD A;  3V7D B;  4JP0 A;  2MW8 A;  5DUI A;  1R49 A;  5E20 A;  1GHC A;  3OWT A;  4DW6 A;  4XN3 A;  3J7Y J;  1SAN A;  1XDU A;  4KA4 A;  3CZ6 A;  1JE8 A;  5GAG J;  2DA5 A;  2XV4 S;  1AOY A;  1FZ7 E;  3WTZ A;  5IP7 J;  4Y17 A;  2GLO A;  2LFB A;  1SVL A;  1B72 B;  4YII A;  1MBK A;  4JX4 A;  4DNC A;  4HW0 A;  2DDB A;  2O8X A;  3F8N A;  2GXB A;  5EDN A;  3JRE A;  2OD5 A;  5J6X A;  4E7K A;  1FC3 A;  1V3F A;  2A69 F;  3DFG A;  3LQQ A;  4HF1 A;  3U21 A;  2EBI A;  4EGY A;  2CQ7 A;  4LLN A;  3OYD A;  1TNT A;  4ANJ A;  4G7H F;  1FYL A;  4EMS A;  3LD8 A;  5DV5 A;  2COB A;  3TL8 B;  4V19 K;  2R3S A;  3SJJ A;  2IGK A;  3EUK L;  3GTG J;  1R00 A;  3WTX C;  1R5I D;  1SD4 A;  3BG9 A;  2IBD A;  3R0J A;  1HLV A;  2R7U A;  3V7C A;  1CF7 B;  4IRH A;  4F91 B;  2JA6 J;  2JWT A;  3AG3 H;  2XC7 A;  2VT3 A;  3CCJ I;  2LTP A;  3K2O A;  3QEW A;  2L9V A;  3S3O A;  2NVT J;  2BY3 A;  3L1N A;  3OYE A;  3M8J A;  3TW7 A;  5DCM B;  2BYV E;  4LLL A;  1RI7 A;  2CQK A;  4IHX A;  3ZGK A;  5TIS C;  1UHS A;  2Z99 A;  2P1M B;  1X3U A;  4G7O F;  4LB5 A;  3OR2 C;  4HNV A;  5J8F A;  4XLP F;  3LDS A;  2XKP A;  2MGQ A;  5D6F A;  4B09 A;  3KP4 A;  3IHU A;  1ZH5 A;  5D6E A;  4YRV A;  4A93 J;  3PFI A;  2BW3 A;  1XL3 C;  4RB0 A;  1BR2 A;  3E5Q A;  4L5E A;  5D4S A;  3DV8 A;  3QNN A;  2JH8 A;  2P5L C;  2DO7 A;  1JTX A;  2ICW G;  2XSD C;  2R92 J;  2HQR A;  4I2O A;  1BI1 A;  1WI3 A;  1VQ9 I;  1QZY A;  4V2F A;  2ZME B;  3DPT A;  2LK2 A;  1XMG E;  2XIG A;  4C9Y A;  3ABM H;  4ICG C;  4JK1 X;  5FRO A;  2CH0 A;  2OTL I;  1LDJ A;  1R5H A;  3I0T A;  3RQI A;  1SEU A;  2OTJ I;  4CCL A;  2WY7 Q;  2VPL A;  1OPC A;  1D1C A;  1XMA A;  2K4J A;  4Z6Y A;  1GXP A;  4BXX J;  1DU6 A;  4DBR A;  5E17 F;  2P5K A;  1PVE A;  3TAG A;  2XAU A;  4LB6 B;  3RZD J;  4M6X A;  2VLA A;  2LVS A;  4FK0 A;  1JJ8 C;  2HU9 A;  2E34 A;  3T8T A;  3WOD F;  1FZ1 E;  3ZMU A;  5IRE A;  1OJL A;  1I5Z A;  3HIF A;  3DBR B;  3D5S C;  4AID A;  3W6K B;  2AQF A;  2CQN A;  3FM5 A;  2DFE A;  1RET A;  2GOM A;  3WU1 B;  4FJ7 A;  1ETO A;  3DU5 A;  3OIP A;  2ZXI A;  1UG0 A;  5K7Z A;  3FKI J;  4UV9 A;  2W00 A;  1V5E A;  1POG A;  2X4H A;  2BGC A;  1AKH A;  5LGN A;  2DA6 A;  4A6D A;  3G6E I;  1VQ8 I;  5C4X J;  1A5J A;  1MTY G;  2K9N A;  1APL C;  5LD2 C;  1UB9 A;  1ETY A;  1YLF A;  4M3W A;  2EV5 A;  2E5N A;  1H8A C;  1T8I A;  1WQ2 A;  1B1B A;  2B1E A;  3ELK A;  3R0A A;  5EEA A;  2LSO A;  3QYF A;  3BR2 A;  3WGI A;  1EJ9 A;  1IUY A;  2HTS A;  2IS6 A;  3KP5 A;  4DTJ A;  1S7E A;  1FZ8 E;  1Z21 A;  5D5V B;  1TL8 A;  3GTP J;  1LEB A;  4MFD A;  4G8X A;  2BV6 A;  5BPD A;  3I4M J;  1E3P A;  2HFH A;  3M1C A;  4MNU A;  2FD5 A;  4LG3 A;  1Y56 A;  1KA8 A;  3MZH A;  5FLX K;  2WAD A;  1VF9 A;  3CCR I;  4E3S A;  3E5X A;  3C18 A;  5IY5 H;  3DU6 A;  2XAG A;  4OIN F;  4BBS J;  4IEJ A;  5H6R A;  1ETV A;  2MZW B;  3ZXS A;  4F93 B;  2NVX J;  2PMU A;  3GO5 A;  4I01 A;  3MEX A;  4ENJ A;  3REO A;  1YW8 A;  2JJ7 A;  2GA2 A;  3WU0 A;  5J47 A;  2ZJR F;  3KD5 E;  1FZI E;  2KLO A;  3L8B A;  2JTV A;  2X6X A;  2E36 A;  4RS8 A;  3HG9 A;  1D0Y A;  4JQF A;  3CUQ A;  2JHP A;  3M9A A;  3JRD A;  1DP3 A;  3QEP A;  4ADN A;  1BN5 A;  1NG7 A;  4K2E A;  2RN7 A;  2WAF A;  3JRB A;  4HF2 A;  1WJB A;  4LK0 F;  3K2Z A;  1D0X A;  2K3P A;  5CVR A;  1JKQ C;  3IC7 A;  4XLA A;  3RYR A;  1IRX A;  4CDG A;  3LSH A;  1USS A;  2KKO A;  3TKY A;  4A6E A;  3MMY B;  2BVM A;  1DU0 A;  4NHJ A;  4EGZ A;  2FOW A;  1MMD A;  3MQ0 A;  3KZY A;  3OV8 A;  2IXS A;  2X85 A;  2IGM A;  3VOD A;  2H09 A;  4IKF A;  1FZ0 E;  1VQ5 I;  2G7U A;  5IP6 A;  3QAH A;  3SXY A;  2V9P A;  2JHC A;  2ME0 A;  2LR8 A;  5J1U A;  5F27 A;  3RJP A;  5FLM J;  2LKX A;  4X6A J;  3FXK A;  3PFY A;  4KIT B;  2IAI A;  3OY9 A;  1R1V A;  3DP7 A;  4FE4 A;  2OZM A;  3ZQQ A;  2YUS A;  5HDK A;  2CFX A;  4YFN F;  4HQE A;  2L4A A;  4IHY A;  5CYV A;  2DJI A;  2STT A;  2QF7 A;  1IC8 A;  4ASN A;  1MMS A;  2EZL A;  1W36 C;  2XRO A;  2ECB A;  1YE9 A;  2LF3 A;  5F64 A;  4A0Z A;  4I02 A;  2NYX A;  1I6X A;  3BY6 A;  3WTV C;  5JLW A;  1Y39 A;  3C6P B;  2Z2S B;  1B9N A;  2PMZ A;  4DZP A;  5TRD A;  3KYD B;  2XGX A;  2LMD A;  2PFB A;  1V4R A;  2QZ8 A;  3JRH A;  2CV0 A;  3JTG A;  1R1U A;  3H0G J;  4KT6 A;  1IN6 A;  2E2I J;  2ATQ A;  2RQQ A;  3E6D A;  2DOF A;  4JX6 A;  4LG0 A;  5D5X B;  2ZSI B;  1FEX A;  4RGX A;  2OAZ A;  3FF5 A;  3KIO A;  1Q1V A;  4E4H A;  1ZQ3 P;  3H9J A;  3UR3 C;  2OZS A;  3RKQ A;  3H9Q A;  3E4W A;  3ULQ B;  1MZB A;  2VL8 A;  2ID3 A;  2Z5U A;  3CJQ B;  4HA8 A;  3Q9V A;  4L5I A;  1W5C C;  2ZJ2 A;  1FZ5 E;  2ETH A;  3CJR B;  3KEQ A;  3OYA A;  1LDK B;  3KPH A;  2MSY A;  2ZXW H;  4RGS A;  1VI0 A;  4WWC A;  3H3Z A;  4G6T B;  3S2W A;  1ZRC A;  4O6J A;  1QBJ A;  4G9Y A;  2JQ7 A;  3ABU A;  2JRT A;  2HKO A;  3BZC A;  2MBF A;  2LY1 A;  3JRG A;  4JS5 A;  1MGT A;  4PSW A;  5EF6 A;  1EV7 A;  3DKW A;  3RMB A;  3I59 A;  3VPR A;  3ZQL A;  3BDD A;  1K83 J;  2QWW A;  4PCQ A;  4PJ0 C;  3OYC A;  3ABL H;  3ZQH A;  5LHG A;  2HXO A;  1RR8 C;  5HLH A;  1SAX A;  1MMO G;  3RMD A;  3MZY A;  1NK3 P;  2QQ8 A;  2QLZ A;  3KEY A;  3ECH A;  3H3U A;  3I54 A;  3MN2 A;  2CV2 A;  4HEA 2;  2A07 F;  5FD5 A;  4M3Z A;  4AKI A;  1P6R A;  2IPQ X;  1J5Y A;  1WCM J;  3OGK B;  2X0L A;  1FOY A;  1Z77 A;  1I1G A;  4LK1 F;  5IBK B;  1X58 A;  1XVD E;  3DTI A;  1T98 A;  3UO2 A;  3NEU A;  3G71 I;  2QCO A;  4HQM A;  5L3F A;  4D7M A;  1O7L A;  2XAQ A;  3WSO A;  2I8D A;  3K70 C;  5K7H A;  1G2H A;  4Y15 A;  1HQC A;  3ZMT A;  5EGO B;  2W4S A;  5LEJ A;  3LSK A;  5E1Z B;  3LSP A;  1B4A A;  2LF7 A;  1D5V A;  2W1O A;  3F6O A;  5HDG A;  2EIM H;  3AL0 B;  2BHY A;  4ZDO A;  1T39 A;  1H0M A;  1KQ0 A;  4XIC A;  4FX4 A;  4A3F J;  1ZEL A;  1F4K A;  2QVO A;  2XGC A;  2MC4 A;  1B9M A;  5E8G A;  1E0E A;  3H92 A;  1XMF E;  2UXX A;  3SEQ A;  5HS7 A;  1T38 A;  2COM A;  4KIG A;  1GT0 C;  1LDD A;  4A3C J;  1S9H A;  3AG4 H;  3G1L A;  5HNF A;  5JR3 A;  4KI4 A;  1OR7 A;  3J81 Z;  5EYR A;  1F43 A;  4RDU A;  1HW1 A;  4E6K G;  1Z3Y A;  2P6T A;  1JT0 A;  2FBH A;  1DPR A;  3QU6 A;  5A2Q Z;  4H0E A;  5DM6 F;  4BE1 A;  4AM3 A;  1YX3 A;  3S1M J;  2K9L A;  2NVU B;  4BYY A;  1P4W A;  4IOC F;  3HEF A;  4KFC A;  2BY0 A;  4E4B A;  4DYC A;  1BW6 A;  3FX3 A;  3EQL F;  2LC2 A;  3CCM I;  2AQE A;  2JPC A;  3FZV A;  2DT5 A;  1U6G A;  2XAJ A;  4FJ8 A;  5CPR B;  1R58 A;  5IOY A;  5IPA A;  2R7R A;  1DPU A;  4ITV A;  3V7S A;  1JUS A;  2Y0S N;  3WHC A;  3RPU A;  4Q4Z F;  1SFU A;  5FD6 A;  2VQG A;  3SQ4 A;  3GZN B;  3CC2 I;  4IHW A;  1N75 A;  3VEP A;  4FVM A;  5DCF A;  2K02 A;  2R7T A;  3N1B A;  3NAU A;  1PP7 U;  2DMP A;  3MWM A;  3K1N A;  2OCE A;  1OYW A;  2E7X A;  5GAD J;  5EEG A;  2E31 A;  4FJL A;  2LLK A;  2OU2 A;  1FJL A;  4RB2 C;  3QER A;  4FAS D;  1ZRF A;  2PJR B;  4FJG A;  2G7H A;  2L2O A;  1VQP I;  3BOQ A;  2JRM A;  3LL7 A;  4XNF A;  1BL0 A;  4M9X A;  3RPU D;  1PP8 F;  2YR2 A;  3BR5 A;  3SPY A;  2OV7 A;  2ID6 A;  2KRH A;  3X2Q H;  4PFO A;  3TAB A;  2DY4 A;  1PUF B;  1OCP A;  2LY9 A;  3T8R A;  2IA0 A;  3EYI A;  2K5C A;  1XS9 A;  3VYT B;  1TNS A;  4HV6 A;  4KHS A;  4EVI A;  4AC0 A;  1XVG E;  1YOV B;  3DKY A;  1R22 A;  4LFU A;  1YX5 A;  4A3D J;  3J2P A;  1RR7 A;  2P0W A;  1XGO A;  5M5X J;  1WGX A;  2XRN A;  3L2Q A;  3HPH A;  2EA4 A;  1IG9 A;  5AIQ A;  2V26 A;  2RKH A;  2VKD A;  3QWL A;  4NQW B;  4KHY A;  5EG0 A;  3PO3 J;  5BQT A;  3S3N A;  3MKY B;  4MHG A;  1X4O A;  2EH3 A;  2L5Q A;  2R7X A;  2DMN A;  3C3W A;  1W7P A;  3CLQ A;  3LSJ A;  4PJJ A;  4I09 A;  3EPZ A;  2OZ6 A;  1MKM A;  3FBI B;  3H9G A;  1O4X A;  3BPX A;  4M73 A;  4UUT A;  2GWR A;  1ZN2 A;  3SDG A;  1ETX A;  4M3Y A;  2EZH A;  2JK3 A;  1A6Q A;  4PFP A;  1BJA A;  1V55 H;  2NS8 A;  2A6H F;  2H1L A;  2R5Z B;  2BXY A;  1JHF A;  1TZL A;  2MH9 A;  4DTP A;  4AU7 A;  3TJY A;  4RAY A;  2NNN A;  5KAI C;  2F4M B;  3J7A Y;  5E8I A;  4LD5 A;  4QTR A;  3K4J A;  1MNM C;  1XU3 E;  1DGW Y;  2M30 A;  3HGY A;  2WAQ N;  1W7P D;  2GBY A;  1HDD C;  3VWB A;  1JXS A;  4L5J A;  3QPS A;  1OKR A;  4Y52 J;  3NAE A;  2DCE A;  2DLL A;  2OYQ A;  4XSZ F;  3IKV A;  4KHQ A;  2ELK A;  3K1M A;  3R4K A;  4UVC A;  5EGO A;  4TV7 A;  2ISY A;  2VC0 A;  2C6Y A;  3HKZ N;  3RKX A;  3HOY J;  1Q9Y A;  3ABT A;  3M3Y J;  1Y6I A;  4U0Y A;  1F9N A;  4D1Q A;  4IRG A;  3B73 A;  4FJI A;  4G6Q A;  3DBH B;  2L7Z A;  2LF8 A;  4BQQ A;  3DTK A;  3G1M A;  4QWQ A;  3KZZ A;  3W6J B;  3QEX A;  1FYK A;  3G3Z A;  3HDD A;  1D8K A;  2IJL A;  2P1Q B;  3FDY A;  5LRR A;  4EJV A;  2IGN A;  1QGP A;  4FE7 A;  1ETK A;  3FK6 A;  4FK4 A;  5BS6 A;  2RV8 A;  1MH3 A;  3A02 A;  3K4N A;  2W82 A;  2IVM A;  4FET A;  4OAZ A;  3IH4 A;  2UUZ A;  3WGG A;  3HTU A;  1FMV A;  4IF4 A;  5L3C A;  4D5F A;  5J8C A;  2DTU A;  1UEL B;  1PYV A;  2DQL A;  3KFW X;  1OYI A;  2VN2 A;  3OR1 C;  4AIH A;  1UAA A;  2FBI A;  1ZK8 A;  4MFE A;  1FP1 D;  5KNL A;  1Z9C A;  2B9S A;  4EYW A;  2DDA A;  3DWL E;  4B3A A;  2KRF A;  3WG9 A;  1HW2 A;  4I99 C;  2DYS H;  2PMH A;  3V8L A;  4BHB A;  1IXC A;  3GFI A;  1F1Z A;  2BVL A;  3R61 A;  4A3M J;  1GUU A;  1IG7 A;  2G0E A;  1PDN C;  1DQU A;  2CU7 A;  4HCC A;  2W85 A;  3G1O A;  5IYB J;  4FJ9 A;  3MKL A;  1UMQ A;  2HDW A;  2UXN A;  2VC1 A;  2DMQ A;  1W0T A;  2D5V A;  5CKT A;  1K6Y A;  2DOD A;  2A5W A;  2W25 A;  1IN8 A;  2JPB A;  2H6B A;  3GFJ A;  4C3I J;  2PJR A;  2R7S A;  1J09 A;  4LMY A;  1ZGA A;  2VB6 A;  4HLY A;  2A3S A;  3GF2 A;  4IQJ A;  1ON1 A;  1RUN A;  1D5Y A;  3H35 A;  1WJD A;  2DN0 A;  4OWR B;  3CC7 I;  1X1A A;  1R4N B;  4M72 A;  1ZAR A;  1Z7U A;  2XB5 A;  2I10 A;  4XLH A;  1QVU A;  4NC6 A;  3LQR A;  2GM4 A;  1OCR H;  3JRI A;  4KHU A;  2M7A A;  1XVB E;  2PJP A;  1VQL I;  4RGR A;  4HOB A;  5LRS A;  2Y30 A;  2F5D A;  3DEE A;  1AKH B;  1JJ6 C;  2GIV A;  3J7Z I;  3CD6 I;  5B1A H;  2IA1 A;  2VQC A;  2KZV A;  1HF0 A;  2DTR A;  2MD5 A;  2IRF G;  4MQ9 F;  4NC7 A;  1W5T A;  1CGP A;  4CGZ A;  2OA4 A;  4M3B A;  5J3L A;  3CC4 I;  4HST A;  2LNB A;  3BG5 A;  3TL4 X;  5LGU A;  4M3T A;  2LF6 A;  3LDB A;  3DQV C;  2GOX B;  1BR1 A;  4GYG A;  4WXC A;  3RI4 A;  2NRA C;  1MBH A;  3JRC A;  3H1C A;  4ABZ A;  2RGV A;  1UHW A;  2M3A A;  5KCM A;  2EV0 A;  5JLX A;  1Y8R B;  4ZDP A;  4BXF A;  2QYO A;  4NUB A;  2EFW A;  1HKS A;  2LD5 A;  1FXX A;  3S2H J;  1T0F A;  2VBY A;  4EJO A;  4IX7 A;  4PJL A;  4MEX F;  1YS6 A;  3K4K A;  2R5Z A;  4P9U A;  4M3X A;  3J81 K;  3SEZ A;  1LQ1 A;  1F36 A;  3VB2 A;  2JSP A;  3CES A;  3I53 A;  2UV1 A;  2K40 A;  5A2Q K;  2GXA A;  2DK8 A;  2O5R A;  2K9Q A;  1I3Q J;  5E3M A;  3K4L A;  4HBL A;  1TQP A;  1X3W B;  2KFD A;  2Y75 A;  3ZQI A;  1T6S A;  1RIO H;  2JA7 J;  4NBQ A;  3DEU A;  4GXO A;  5IT9 K;  3BTC A;  4BAC A;  3W2A A;  4XQF A;  1V5G A;  2OPT A;  2GAU A;  3E7L A;  5K7F A;  3OIQ A;  1X1D A;  4IHV A;  2Y0S A;  4C3J J;  3WTW C;  4O3M A;  3C1D A;  1X3Z B;  3CUQ B;  1GV5 A;  4DOZ A;  1Z67 A;  1XB4 A;  3K4C A;  3QQA A;  1HSJ A;  4FQG A;  3OSG A;  2VKV A;  3BG3 A;  2PEX A;  2WB1 N;  3QOD A;  2OF7 A;  3NHG A;  2V4J C;  3N05 A;  4M9S A;  4I6Z A;  1BC7 C;  2CQQ A;  4E70 A;  5TJJ A;  1XX5 A;  4UUS A;  2M0M A;  3T1B A;  2XRL A;  2BOL A;  1UJ8 A;  4CCK A;  2JH9 A;  1YYV A;  1BI0 A;  2VJ5 A;  3FXO A;  4JYK A;  5KK1 A;  9ANT A;  1FYZ E;  2RC4 A;  1LFU P;  5LFA A;  3P5J A;  2ECC A;  2VI6 A;  1IJW C;  4PJM A;  2VJ4 A;  3WTT C;  5JVG F;  5C3E J;  3SFZ A;  4WF2 A;  4I6J B;  3QP5 A;  2E1N A;  2CO5 A;  2DOA A;  4MQV A;  4ENK A;  1NH3 A;  3SUO A;  4L9T A;  4P1W A;  1QZE A;  3TAF A;  1OCC H;  5DUK A;  1Z05 A;  3L9F A;  5CVJ A;  2R0Q C;  4CXF A;  3S9H A;  1I39 A;  1XCB A;  2P81 A;  2D2W A;  5JVT A;  4ENN A;  1GDT A;  2QSG X;  3E6C C;  4EM0 B;  4OOI A;  4LGW A;  2P7V B;  3IWZ A;  4BUP A;  2NVQ J;  5LGT A;  1BA5 A;  4CH7 A;  3TGN A;  3DKX A;  2IS1 A;  4AKG A;  2E60 A;  4LG0 B;  1UFM A;  3RMC A;  1OLT A;  1BJZ A;  4FJK A;  2B7E A;  3ZN1 A;  1IF1 A;  4BAY A;  3NRV A;  3ZRG A;  3NCI A;  3PSI A;  3HSF A;  2NAZ A;  4U7B A;  2DA7 A;  2AO9 A;  1UZC A;  1KQ8 A;  2OUM A;  3GZ6 A;  2HKX A;  2HEO A;  4E7Z A;  3RCO A;  4ZYE A;  3CF5 F;  2K86 A;  4RL5 A;  2CGP A;  1B6A A;  3CDL A;  1H89 C;  2B63 J;  1BOA A;  4PSX A;  4D9J A;  3GTQ J;  3FXL A;  1FZ4 E;  2A6E F;  2WAQ A;  2F2E A;  2RRE A;  2FQ4 A;  3WE2 A;  4BE2 A;  3AAF A;  3ZMV A;  2QSH X;  1I27 A;  3CO7 C;  5IOZ A;  1XC5 A;  3E97 A;  3PIO F;  3O6B B;  3S16 J;  2HOA A;  2KL4 A;  3HKZ A;  5ED4 A;  2ZME C;  3I59 B;  4ZYH A;  2VE8 A;  1QPI A;  3JCU C;  3JSO A;  3BQY A;  2EPF A;  1K4T A;  1XDS A;  4HYE A;  2I5U A;  2VPR A;  1WJA A;  2HOE A;  4BY7 J;  3L2O B;  2Z16 A;  4F92 B;  1TT0 A;  4DTX A;  4S0H B;  2L54 A;  3PL8 A;  4AD9 A;  4L0Z B;  2OZU A;  3H5R A;  1D1A A;  4DU1 A;  2EFN A;  4RLF A;  3S3M A;  1ZRD A;  3N1E A;  2JMW A;  3BJO A;  2ACJ A;  1ZAO A;  2VAS A;  4XK4 A;  3M07 A;  2M4K A;  2ESN A;  4ZYA A;  3RPQ A;  5E1X A;  3TAE A;  4KIC A;  1XGS A;  1XMX A;  5F0F A;  5C4J J;  2O03 A;  1VQK I;  3ZQC A;  3S14 J;  3FM3 A;  2P6S A;  1YJ9 I;  2WBM A;  2JN6 A;  1TP4 A;  4GFB A;  1LVA A;  2RQP A;  1P2F A;  3FIS A;  1GXQ A;  2ME6 A;  3WG7 H;  4FTH A;  2HPM A;  3NQO A;  4JRQ A;  3LZI A;  2X9D A;  4HX7 A;  5GAH J;  1Z7L A;  2DAO A;  1S7A A;  2MD0 A;  1P22 A;  2BEO A;  3AG2 H;  2P7C B;  2JZY A;  2DU9 A;  3BP8 A;  1O7F A;  2FEZ A;  3HRS A;  1FZP B;  3TQN A;  3KX2 A;  3OYI A;  2HQ5 A;  2CJJ A;  3NWT A;  3CO6 C;  3HYI A;  1SMT A;  1LUJ B;  2DA1 A;  4BU2 A;  2WV0 A;  2K3F A;  2V1N A;  5H37 A;  1LKX A;  2E1O A;  3ASO H;  1ORK A;  4H4K C;  2KMU A;  2MYS A;  4WXD A;  4FK2 A;  2OBP A;  3SQ0 A;  3L1P A;  1J59 A;  2Q2E A;  4G94 A;  4XON A;  5F0H A;  1FS1 A;  4CZC A;  3RQ4 A;  5EZH A;  2XPU A;  3PUB A;  1WH7 A;  2NOJ B;  4U88 A;  1BR4 A;  4WX9 A;  4J00 A;  1I50 J;  3P9C A;  3S2D J;  1P9Q C;  5F1J A;  2CQX A;  4UHT A;  4OIQ F;  1QO0 D;  3FHZ A;  1TTY A;  1Y1V J;  2V1D A;  2KJB A;  3LSI A;  4RBO A;  4A5M A;  4E