2RKHA

Crystal structure of a putative apha-like transcription factor (zp_00208345.1) from magnetospirillum magnetotacticum ms-1 at 2.00 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
164
Chain Sequence
TLTPKEAVRLCALGTIASQPMRYSELAGSVRHFTSRIMGPSLELMGISIELLRYEGLVEAVDAMLAISAAGRRELHSLLTARLRPGSDLSKLVVALKMRFLGLMEAEERAHQIDLLIEGVDSELARLADLRGGEGGSALAAWLDHDMALLESRLAWLEDFRARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative AphA-like transcription factor (ZP_00208345.1) from Magnetospirillum magnetotacticum MS-1 at 2.00 A resolution
rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Transcription
molecule keywords Putative AphA-like transcription factor
total genus 49
structure length 164
sequence length 174
ec nomenclature
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rkhA01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 2rkhA02
1HXDA 1HW5A 1ZN2A 3OOPA 4EJTA 1KYZA 4RGUA 4EGYA 1D8JA 2EV6A 3V8JA 4BH9A 5IT3A 1P2FA 1U5TB 3FF5A 5HVQC 1BI2A 5D8KB 5F1RA 3J80Z 1ODDA 5BOXA 5D4SA 2XIGA 5AIQA 4CZZA 2NNNA 3ZMVA 4ENKA 2QLZA 1QZYA 2VOPA 3ECOA 1BI0A 5HLHA 4I0BA 3J81Z 3FHZA 2IVMA 2VBWA 1ZHFA 4G7OF 1TW3A 3WTTC 1T0FA 1GHCA 2MH9A 3J80K 5LEJA 1V4RA 2E1CA 1ZRDA 4M74A 3H3ZA 1R00A 1XGSA 3CUQC 1OYYA 3ROUA 1LDDA 2HKOA 4KIFA 5AONA 5H6QA 2LF8A 2HFHA 4XBFA 2M87A 4KDPA 3RYRA 4L0ZB 3PFIA 4GXOA 3DKWA 1I1GA 1CF7A 2HTSA 1HKTA 1B6AA 2VN2A 3P7NA 1S7OA 5LBQA 2JSCA 4RS8A 4GYGA 3C7JA 2OBPA 1XDUA 4IPAA 5DUIA 3K69A 3S2WA 3L2CA 3HTSB 1ZRCA 5ED4A 3VFZA 3DPTA 4OINF 4OMYA 2YU3A 1BC7C 2V1UA 1SD4A 2UWMA 5E8IA 1OR7A 4Q4ZF 2C6YA 2ISZA 4ZZLA 2Z5UA 1K78A 1J7KA 3BJ6A 2VBXA 3N97A 2ZXJA 5JVTA 2RGVA 4ENJA 1YW8A 4IRHA 2A69F 4HQEA 4G6DA 4KN7X 2A07F 1STZA 1O57A 2HYGD 2DAOA 2A6EF 1QZZA 4EJWA 1BI1A 3CUQA 1IN7A 3L00A 4RGRA 2PMHA 4G6QA 1ZYRF 1TTYA 2Z33A 2ZO4A 1SMYF 3GF2A 4AWXB 1XGNA 3JW4A 1FX7A 1Z6RA 4O5VA 5L3BA 3JSOA 1Z05A 4L5IA 3WTUC 3MWMA 1XSVA 3QAHA 2FBKA 5D6EA 4ENMA 4WXDA 3ABTA 4AIJA 2H94A 2PI0A 1B9NA 2FBIA 2JZYA 3EYYA 3MFKA 4FT8A 1G3SA 2W84A 2H27A 4RB0A 4RAZA 1YLFA 1TNSA 1RNLA 2LKPA 5FO5A 3FWEA 5JI6A 4Q5SF 4ETSA 5FFZA 1ZG5A 3DP7A 4KFCA 1F5TA 1S29A 2D1HA 2FRHA 2E7XA 1IF1A 3COAC 4CYDA 2L54A 3HSFA 3P9KA 2COMA 3T5XA 2HDCA 2GIVA 3FMQA 1FBQA 2FU4A 4LK1F 3KCCA 2OD5A 2XAFA 2RDPA 4AIHA 1C0WA 2FF4A 1PDNC 1K78B 4LFUA 1T2KA 4OMZA 1R23A 4HQMA 1J5YA 3IC7A 3L9FA 5JHUA 2BE5F 3LSTA 4L9NA 2Y48A 2VT2A 3J7AO 3E3VA 4MNUA 1V3FA 4XSXF 2ADUA 4R8HA 2K4BA 3CUOA 2J5OA 1IXRC 1S7AA 3JTGA 3WTSC 2K7LA 2FSWA 4U0VA 3DQVC 5LGUA 4Y15A 1FOKA 4A0YA 1LNWA 2R7DA 2IW5A 4L9JA 4HX7A 1GVJA 4EM2A 4WCGA 4FX0A 1J2XA 3N4MA 2A68F 4LB5A 2ACJA 3GFLA 4RAYA 5E1ZB 1YG2A 3MQ0A 4EGZA 2EB7A 3ZN0A 5ICCA 3WGIA 2LDUA 1O7LA 1IN8A 3FXQA 2NS0A 3E6CC 3I0TA 3M1EA 1TNTA 5D5UB 5K5QA 2L4AA 4MHGA 1AOYA 1FSHA 3PQJA 4L5JA 2W25A 4M6XA 4U7BA 1EV7A 3CDHA 2DQRA 3KZZA 1AWCA 3WGHA 3F6VA 4WF2A 3BWGA 2X4HA 5LGNA 3IRQA 3DEUA 3C3WA 2MLGA 4FHTA 2Z9OA 4HLXA 3DF8A 4LGWA 2YX4A 2P4WA 3SXYA 5LEKA 2KIUA 5J6XA 2GXBA 4NQWA 1UHWA 1W5SA 1LEAA 1FZPB 1FYLA 1ZLJA 2QBYA 5FLXZ 1X3UA 4YFKF 3FMSA 3IWFA 1CF7B 2KRFA 4ESFA 5TJJA 4YIFA 3EQLF 4KNYA 4I7HA 5D8LB 3SFZA 5JR3A 5DD4A 1RZ4A 3F3XA 3WTWC 1P4WA 1R5HA 2D1VA 4I01A 2IA2A 3HYIA 3QRFF 2IP2A 5DDGA 2M1BA 4LJZF 3I71A 2HZTA 4XLNF 3QPTA 2OZ6A 2HOEA 1MZBA 2K27A 2NAZA 4YG2F 5A2QK 5K5RA 1XCVA 1XGOA 5F6FA 4D0PA 1WKMA 3F8CA 4ESBA 2DO7A 1MJ9A 3ECHA 1QPMA 1P4XA 4G94A 1CGPA 1ULYA 4KMFA 4E70A 4IRIA 3EYIA 1Q1HA 3QP6A 3BDDA 2D45A 3K1PA 2CGPA 1KU9A 4LK0F 1LB2A 5L3DA 1D8KA 1F9NA 3WGGA 3L09A 4UVCA 1IRFA 4P5OA 2HGCA 4L9VA 1FBUA 2M8EA 3H92A 1YTYA 2LF7A 3TO6A 1KU3A 3O3KA 1K6OA 3WE2A 2P6SA 3HSEA 5CLSA 5DYMA 4ZYDA 3LAPA 5L3GA 1BIAA 1SFEA 2YR2A 4UV9A 3BOQA 3KP5A 2DPUA 3FZVA 2QVOA 4KA4A 2RQPA 2W85A 3P9CA 1MDMB 1W4MA 2BV6A 2QQBA 3GEZA 4U7DA 2W24A 1FYMA 3BZ6A 2CSOA 2JRTA 3JSPA 1KQ9A 3DFGA 4PZJA 4KIBA 3TOAA 1GXQA 3HOSA 2FBHA 2X0LA 5ILVA 1FPOA 1FNNA 1KA8A 4Y17A 2DFIA 4HYEA 5L3CA 4HBLA 2EK5A 1D5VA 1BM9A 3KE2A 3HOTA 1W5TA 4KN4X 2BEOA 3RKWA 5CJ9A 1K79A 4MTEA 3MEXA 4B8XA 2L3DA 3T0YA 1EH7A 4M71A 1QO0D 1UCRA 1FC3A 4MEXF 1JGSA 1MJAA 2XKOA 3CUQB 4KUMA 5DEQA 2GA1A 4OIOF 1J9IA 4P9UA 4WX9A 1MGTA 1P92A 2CYYA 4HLYA 2F5EA 1SAXA 3GYHX 1QBJA 5HDGA 2ZFWA 2CWEA 2HYFA 5FFXA 4HDUA 5CVJA 4HOBA 3KP3A 2PLYA 2MH2A 2EFOA 3FXRA 1R5GA 1BI3A 3SZTA 1ZG1A 1T6SA 4U0WA 1QGPA 3R61A 2K86A 2RNJA 3ZN1A 2DT5A 3M8FA 4EQQA 1S3JA 2VE8A 4UHTA 2F2EA 3ELKA 4IHSA 5HDKA 3WTZA 3R4KA 1MDMA 4U88A 3EDPA 2MA3A 1P6RA 4RB2C 3KP6A 2IA0A 2L02A 3F6OA 1ZGJA 2D2WA 1R1UA 4MTDA 2Y75A 3CO7C 2PJPA 2VC0A 1O3SA 2OQGA 2HTJA 3U2RA 3VODA 2ZKZA 4I98B 4EJUA 1YW7A 5CVIA 5DCMB 4ASNA 3CTAA 5DV5A 2FXAA 4KIGA 1KU2A 5D5VB 1R58A 1NHAA 1SFUA 2BBYA 1ZARA 1BN5A 2VE9A 4JQFA 1IXSB 1Z1DA 2IJLA 1IW7F 4ON0A 4OOIA 2FNPA 3LQQA 3C1DA 5FD6A 2ELHA 3GZ6A 5LGTA 5HDNA 4XLPF 1ZLKA 3TKYA 1DDNA 5HS9A 1H0MA 2DLLA 4HF0A 3EETA 2RC4A 5BQTA 4L18B 1T98A 2YPRA 1WSUA 2GAUA 2TDXA 1USSA 4A5NA 3TGNA 1T39A 1B4AA 1OKRA 5CVUA 1H9GA 5ICFA 2JTVA 4A6EA 4NHJA 2EJRA 2HR3A 5HLGA 4N9IA 2HS5A 3E6BA 4HF1A 3LWFA 1IUYA 1FYKA 4O6JA 1S6LA 1L3LA 1TQIA 1S8NA 2EV5A 4IRGA 4XSZF 3ERED 4I2OA 2FOKA 5BPIA 1RI7A 3B73A 3KEOA 2ZMEA 4DQ2A 3RIRA 1DPUA 2PG4A 2EFPA 3KLNA 1D3YA 1FBSA 4BHCA 1A04A 1FP1D 4IVNA 4KICA 2G7HA 5D6FA 4YIIA 4QLCU 5AIPA 3ISPA 2GXGA 4RB3C 1PP8F 1O3TA 2CFXA 1YW9A 1TQMA 3V4GA 3R0AA 4O3MA 2G7UA 1Z9CA 2DK8A 2VC1A 1W7PA 3V7SA 4L0YB 2QWWA 3DV8A 1F1ZA 2RKHA 1QNTA 2H6BA 3TQNA 3BPVA 4PGHA 5L3EA 2W57A 5DCFA 2HEOA 1SFXA 2STTA 1DP7P 1IN5A 1WWXA 4N0BA 1H9TA 1TBXA 2ETHA 3HTUA 5D5XB 4CHUA 3T8RA 3MCZA 2RV8A 4IT5A 5ILUA 4AIKA 2STWA 1XD7A 3WU1B 2FMLA 2MD5A 5H6RA 5LRRA 1EH6A 3RJPA 2Q8KA 3I53A 2V6CA 2OU2A 2DW4A 2ZJ2A 2E7WA 4ZYEA 3KP2A 4EVIA 3HHHA 1Z7UA 4G7ZF 4HX4A 3MAJA 3SHFA 4S05A 5A2QZ 1QQIA 4F7ZA 2J5PA 2KIFA 2KKOA 2JT1A 4BYYA 3PQKA 1U3EM 2VBYA 1UHMA 3NRVA 2MLKA 3QP5A 4M73A 1ZH5A 2R3SA 2KJBA 4IJAA 2DTRA 1I6XA 4A12A 1TLHB 4WWCA 3V8LA 2M5WA 1GXPA 1B59A 3BPXA 4CDGA 3GX4X 2WC2A 1DPRA 1R36A 2XGXA 4FX4A 2UXNA 1XMKA 1R7JA 1R22A 2FA5A 4L9TA 2YX7A 3E5XA 3V7CA 2BGCA 4QWQA 2PN6A 1FT9A 5DD8A 1JE8A 3E97A 1B9MA 1REPC 1B1BA 2MBFA 2QENA 3F8FA 2PBIA 2XV4S 2OZUA 2Q2EA 4A6DA 3HRSA 2L01A 2K4JA 3SZPA 3AAFA 1MKMA 4G9YA 4Y13A 3F22A 3WU0A 2HQNA 3KEQA 3O6BB 2PEXA 4IF4A 4JBAA 3LAJA 4BHPA 4KYWA 3E6DA 3RKXA 1KYWA 3ULQB 4M6YA 2O8XA 3HSRA 1G6NA 1J59A 2ZNZA 1G3WA 1XDSA 2FQ3A 5E17F 3JAMK 2LSOA 3GWZA 5FGMA 3FMRA 5J8CA 3T8TA 2CO5A 3GZ5A 4S04A 3GFMA 1P4AA 3E6MA 3DPLC 3QPHA 5BS6A 3HHGA 4P9FA 4UVBA 1XB4A 3GO5A 3Q5FA 5L3FA 5DCMA 4JK1X 1HW1A 1FPQA 2P5VA 1FWZA 2P5KA 1ZG3A 2K02A 4EM0B 1HW2A 2DK5A 2QBYB 2QYOA 1BBYA 2OAZA 3R6SA 5LRSA 2A6HF 1E17A 3UO2A 2F5FA 3J81K 1G3YA 1UFMA 1L0OC 5BMZA 1TW2A 4MQVA 2V9VA 3I58A 1SD5A 3CO6C 2FEZA 3IHUA 2WTEA 1IRGA 5D4RA 5LHHA 3TDZC 2RN7A 4LG0A 5FB2A 3TOBA 3BVOA 2KIMA 3FM3A 3WTVC 3LQRA 5E18F 1BC8C 2PQ8A 4LLGF 2MC3A 3BJAA 3VOEA 1ZRFA 1HKQA 3BY6A 4Z2YA 2AXLA 3UO3A 3TO7A 2ZNYA 4Q48A 1G3TA 1U8RA 4XRFA 5K5OA 2G9WA 5EEHA 1HKSA 4IXAA 5HS7A 2GZWA 4OIQF 3R60A 1PP7U 3QU3A 4OIPF 3HUGA 3NQOA 3WTXC 2PMUA 1FP2A 1YYVA 2NNYA 2OA4A 1FLIA 3F8NA 4CGZA 2OQRA 2XUBA 4I0AA 1R1TA 1LQ1A 4NB5A 1O3QA 2EFWA 3HRUA 4U0YA 4BHBA 3E5QA 3FX3A 3GLXA 3IRRA 1U5TA 5E20A 1WQ2A 2EFQA 5IT9K 1JHFA 3ZMDA 4UV8A 4CO8A 4BNCA 4K2EA 1LDJA 2JPCA 1SD6A 2DBBA 4HF2A 3FM5A 5DUKA 4EMSA 5TRDA 4MGRA 4G7HF 5D5WB 5FLXK 1ON2A 4LMYA 1HSTA 4WXCA 3I64A 1XSDA 1R1VA 2P8TA 3ZMZA 3SQNA 2VODA 1RUOA 2XASA 3IL2A 3G3ZA 4ZH4F 1O3RA 1Z91A 3WE3A 3RI4A 1LVAA 5K1YA 2CQKA 2XVCA 3RTRA 1ONVA 3W6KB 3JAMZ 4I02A 3KETA 2EA2A 2VONA 2F5CA 5E1WA 1IN6A 1OPCA 1YQAA 2O03A 3BP8A 2V79A 1JHHA 2O61A 1USTA 3RDIA 2XAGA 5BPDA 1N1CA 3I54A 2QM3A 1ON1A 2P6TA 1BJAA 2GQQA 1KQ8A 4PGGA 4A2UA 5LHIA 1RIOH 4GYIA 4TV7A 2HWVA 4LG0B 2HQRA 2AS5F 4N9HA 5E8GA 4AD9A 3IWZA 4GO1A 2L4MA 1XGMA 5J8FA 2UZKA 2Q0OA 2DQLA 3I59B 1U78A 3I4PA 2XAHA 1IAWA 1O7FA 4HV6A 3OV8A 1YIOA 3K9TA 5E1XA 1I27A 5HLIA 1F4KA 3MZHA 3LA3A 4HA8A 3REOA 3LA7A 2M30A 2DPDA 2XRNA 3TDUC 1KQ0A 4BAYA 3LA2A 4KT5C 2UXXA 4ZZDA 1XSXA 3W6JB 3RYPA 3I59A 3U1DA 4B09A 1G4DA 3H3UA 2YSRA 4R79A 2VT3A 2QUFA 4EM1A 2XHKA 3NEUA 2CW0F 2B0LA 3WG9A 1ZREA 4HW0A 3G73A 1SMTA 3BROA 2A61A 1YS7A 4YFXF 4IHTA 3WODF 1IN4A 3L7WA 2O0YA 2IA1A 2PFBA 4KMUX 3FXUA 4LLLA 4CXFA 1XMAA 3ZMSA 2NRAC 3BJOA 4RGXA 5H20A 4OU0A 3EUHA 3ABUA 1LEBA 6PAXA 1LDKB 3F8BA 3KZYA 2IT0A 3DXJF 1HSJA 5CVVA 1YO5C 1IZ1A 1J0RA 2O3FA 4EJVA 4ENNA 4Q47A 2A3SA 2V1DA 4LB6B 1YS6A 4WK8F 3IKTA 2ISYA 3CJNA 4P55A 2HKXA 3U9GA 2FE3A 1U2WA 2ESHA 2XKPA 3RKYA 4A5MA 2DU9A 5ICGA 4P96A 4MQ9F 4M9ZA 2QZ8A 1W7PD 3K1NA 4PDKA 4LLNA 2RVCA 1RUNA 5HS8A 2Z3YA 1XCBA 1WRJA 2GA2A 4GCVA 2P5LC 3D5LA 4UVAA 3IKVA 1JXSA 3ZP5A 3HRTA 3Q9SA 2XAQA 3E5UA 3GVAA 4M9XA 1I1SA 3GW2A 1EH8A 5F64A 4HAMA 4EJOA 1BOAA 3ZPLA 2O6GE 1E2XA 1YFHA 2VXZA 1UB9A 1OYIA 3K2ZA 2DI3A 1OYWA 4BQAA 1HBXG 3K0LA 5ICEA 3KFWX 1LJ9A 2A5YB 3F23A 3KLOA 4EV0A 4HX8A 3ZQ7A 4UXNA 4BXUA 3I5UA 3WTYC 1MJBA 1U6GA 4MEYF 2V1XA 2EWNA 4R1HA 3V7RA 4HZFA 2H6CA 3P9IA 4UNOA 5FD5A 3ZMTA 1W7PB 1KGSA 5LHGA 4AVPA 1DUXC 1XN7A 3Q9VA 4CICA 1J75A 3HIFA 4RB1A 4ZYHA 4LD5A 4G8XA 5CYVA 1U5TC 3QOPA 2GWRA 2CG4A 2EA4A 4M72A 3CLOA 3ZMUA 4HV5A 1Z6TA 1ZAOA 4RGSA 2ZCWA 1Y0UA 4OIRF 1BIBA 4ZYGA 1TQPA 3GFIA 2IRFG 2Y0MA 3GFJA 3JTHA 3D0SA 4HDVA 1MD0A 2EFNA 2P7VB 3HRMA 3O2PE 2IPQX 1VTNC 2NYXA 1FY7A 1T38A 2ESNA 1K7AA 5KK1A 4A0ZA 3C18A 2F5DA 1FSEA 3F72A 1PUEE 2XROA 2KJCA 4I09A 2Z99A 4M9SA 2BYVE 1KU7A 3MZYA 4UUVA 2XAJA 3KP7A 2QQ9A 1HQCA 2VOOA 5JFRA 4WXHA 3V8KA 3F8MA 2QQAA 3M7GA 3LFKA 4YFNF 1I5ZA 5LLQA 3RPQA 2M45A 2H09A 3ML6A 3M8EA 5EEGA 1WI9A 2E1NA 4DNCA 4ESJA 1OMIA 2WWYA 3KP4A 3QU6A 1IXCA 3GUDA 1SD7A 4PCQA 3TO9A 2LNBA 2EV0A 2P7CB 5KVRA 2VBZA 2WV0A 4H0EA 3M9AA 3F21A 5CVRA 1ZGAA 2JPBA 5HOOA 2R7FA 3GXOA 5ILSA 4A0XA 3K1MA 2FMYA 5ERIA 3VB2A 2ZMEB 3R0JA 3VEPA 4GGGA 2ZBKA 3B02A 5IT9Z 3T1BA 3RPUA 2FNAA
chains in the Genus database with same CATH superfamily
3KD1E 1HXDA 3DPUA 1YJNI 1YI2I 1HW5A 5LFAA 3OL4A 1ZN2A 5J4YA 5EYRA 3OOPA 4EJTA 3L1NA 1KYZA 4PJNA 4RGUA 4EGYA 3K70D 2EV6A 1D8JA 4MIMA 3V8JA 2JA2A 4BH9A 5HNHA 2DMNA 1WH7A 5IT3A 1P2FA 3SUOA 1PJRA 2V9PA 1U5TB 4IHYA 3FF5A 1FTZA 4FJ9A 5HVQC 1BI2A 5D8KB 5F1RA 1HDPA 1ODDA 4YEJA 3J80Z 3I4NJ 4UB6C 5D4SA 5BOXA 1FXXA 3QEPA 3CJQB 2V6EA 2XIGA 5AIQA 4CZZA 2NNNA 3ZMVA 4ENKA 2QLZA 1RKTA 2OZMA 1QZYA 2VOPA 3ECOA 1BI0A 5HLHA 1B72B 3OS0A 3S3MA 4I0BA 3EPZA 3J81Z 3FHZA 4ZDOA 2IVMA 1FS1A 2VBWA 2LYCA 1ZHFA 2CMPA 3G4SI 1WJBA 3H3VK 5C4JJ 4G7OF 1P22A 1TW3A 3WTTC 1T0FA 1VQ6I 2MW8A 1X1DA 2JMWA 2HXIA 3JRHA 3BT9A 1ZK8A 4M3DA 1GHCA 5EEAA 2MH9A 3RQIA 3J80K 5LEJA 1V4RA 2EIKH 1XMGE 3AG1H 1ZR4A 4ADOA 1GUUA 2E1CA 2B63J 2W7NA 3OSFA 3FK6A 1ZRDA 4A3BJ 3WHBA 4M74A 1TC3C 3H3ZA 1Q9XA 2LOOA 1R00A 3MD2A 1WVRA 5FRMA 5J4VA 2DDAA 1XGSA 3CUQC 1BA5A 1OYYA 3ROUA 1LDDA 3L2QA 2R0QC 2WY8Q 3E1SA 2WB1A 2HKOA 4NUBA 3SEZA 1S5LC 2VQCA 5IYBJ 5DTDA 2LK2A 2RNGA 2E5ZA 4E6KG 4KI4A 4KIFA 3A03A 5AONA 3ZQHA 5H6QA 2LF8A 2HFHA 3I9V2 4XBFA 3OIOA 3K4CA 1H8AC 4B08A 5FJ8J 3QNOA 2M87A 1XVGE 4NBQA 4KDPA 4B4CA 3RYRA 1WPKA 3PFIA 4GXOA 4L0ZB 2DMTA 1MNEA 3DKWA 1E3PA 1FZIE 1XPXA 3L2UA 1I1GA 4A3FJ 1Z7LA 3WSOA 3JR9A 1V54H 1CF7A 2HTSA 1W0UA 1GT0C 1B6AA 1HKTA 4LIVA 2VN2A 3P7NA 1S7OA 5LBQA 4DTUA 2JSCA 4RS8A 4GYGA 3C7JA 1Y1VJ 4CCNA 2OBPA 2Z2SB 1HOMA 3QYBA 1MMGA 1XDUA 3H5NA 4IPAA 5DUIA 2DCEA 5B1AH 3K69A 3E4YA 2TCTA 3S2WA 3L2CA 3HTSB 4RA2A 3JRIA 2XRLA 1ZRCA 1MTYG 2P1NB 3ZGKA 4GAMC 3H0GJ 5ED4A 3VFZA 2FOWA 3DPTA 1JKPC 4OINF 4OMYA 2YU3A 1MW7A 2DJNA 2MYSA 1BC7C 3CD6I 2V1UA 1SD4A 2UWMA 4CCKA 2QGUA 5E8IA 1OR7A 4Q4ZF 2C6YA 2ISZA 3TP0A 4ZZLA 2Z5UA 4AKHA 3CCLI 1K78A 3N05A 1J7KA 1ETXA 3GTLJ 3BJ6A 2Q2EB 2VBXA 3N97A 2ZXJA 5F0HA 1JTXA 5CQEA 5JVTA 4FTHA 4FK0A 3BTJA 1V55H 2RGVA 4ENJA 1YW8A 1N78A 4IRHA 1UG0A 3C6PB 3SPZA 2R7SA 2A69F 4HQEA 3RMDA 4G6DA 2O8KA 3H5AA 2PMZA 3W2AA 2M2EA 4XONA 3KYDB 4KN7X 1VQ9I 4XRMA 2A07F 1JJ6C 2E60A 1STZA 1O57A 2HYGD 4GRIA 3J7YJ 2DAOA 2A6EF 5M3MJ 4DTRA 3TAGA 1QZZA 4EJWA 1BI1A 3CUQA 2BW3A 1IN7A 3HPHA 1WGXA 2M0MA 3L00A 1BR2A 4RGRA 2IEKA 4JX4A 2PMHA 4BKXA 4G6QA 1ZYRF 1TTYA 3G1OA 2Z33A 3RMBA 2ZO4A 1HC8A 4E4HA 1SMYF 5M5XJ 1B8IA 3GF2A 4AWXB 3HOZJ 2R5ZB 3S8PA 1XGNA 3JW4A 1FX7A 2X1DA 3GTPJ 1Z6RA 1S72I 4O5VA 4FJHA 2N8GA 1TWHJ 3HB9A 2XF5A 5L3BA 3JSOA 5CPRB 2GOXB 1Z05A 2V1NA 4L5IA 3WTUC 4E7LA 4JYKA 2R7OA 2XF6A 2Y69H 3ESWB 2GBYA 3MWMA 4Y52J 5C4XJ 2CV2A 1XSVA 2OCCH 3QAHA 2FBKA 4IQ4A 5D6EA 4ENMA 4WXDA 3ABTA 4AIJA 2E1MC 2ID3A 2H94A 3BR3A 2PI0A 3MKSB 5EZGA 1B9NA 2FBIA 2JZYA 3EYYA 3MFKA 1TP4A 1OCPA 4FT8A 2DOEA 1X3ZB 1G3SA 2W84A 2H27A 1PUFA 3PUFA 4RB0A 1TT0A 4AKIA 1YITI 4CYCB 3PIOF 4RAZA 3NCIA 4W97A 1YLFA 1TNSA 3CMYA 1RNLA 2E71A 4E7HA 2LKPA 4BACA 5FLVA 3NWSA 3IP4B 4BE2A 5FO5A 1EKEA 3FWEA 2OCEA 2VKVA 3S32A 5JI6A 4Q5SF 4ETSA 2PX9A 1FYZE 5FFZA 1ZG5A 2E2HJ 3DP7A 2W4SA 3C6NB 4KFCA 1F5TA 1S29A 2D1HA 1WJFA 2FRHA 3OYHA 2CU7A 2E7XA 5K7HA 1IF1A 1FOXA 4DTMA 2DJIA 1BJZA 1NH3A 1WAJA 4M3WA 3COAC 4FJLA 3HGYA 4CYDA 1ETVA 1VQMI 2L54A 2LY1A 1ZKGA 3CCJI 3HSFA 3P9KA 4M3UA 3QYEA 2COMA 3T5XA 3LSHA 1RC9A 1Z77A 2HNHA 3D5SC 5IOYA 2HDCA 2GIVA 3K4NA 3MKZA 3FMQA 1FBQA 2R93J 2BXZA 2QQ8A 2FU4A 4LK1F 3ERMA 1H88C 3KCCA 1XVFE 2ZXHA 2OD5A 4A3DJ 2XAFA 2R7UA 3ZCOA 2RDPA 4AIHA 5GADJ 1C0WA 2FF4A 1DP3A 3K2OA 1T95A 2OV7A 3OYGA 4DU3A 3S3OA 1PDNC 1K78B 2P81A 4LFUA 1T2KA 4FJ8A 4OMZA 1R23A 4HQMA 4XN0A 3OSGA 1I39A 1J5YA 3TW7A 4D9JA 3IC7A 3L9FA 5JHUA 4JOMA 5HODA 3RMCA 4II3A 2BE5F 3LSTA 4L9NA 2Y48A 2VT2A 3J7AO 3N1EA 3E3VA 4MNUA 3QYFA 5FROA 1V3FA 2LR8A 4XSXF 2ADUA 4R8HA 4JS5A 4X5NA 1MSFC 2K4BA 2ZJPF 3CUOA 2J5OA 1IXRC 1S7AA 5J3LA 5J1UA 2JA8J 3JTGA 3E4WA 3WTSC 3U21A 2A05A 2K7LA 2FSWA 1D1AA 4U0VA 2R7TA 3DQVC 5LGUA 2CS3A 4Y15A 1VQNI 1FOKA 4NC7A 4A0YA 1LNWA 2BOLA 2R7DA 4AVZA 3ASOH 5FLMJ 2JQTA 1JT6A 2IW5A 1FOYA 3HZJA 3PNTA 5C44J 3OYEA 4D7MA 2W1OA 3OGMB 4L9JA 2E1OA 4HX7A 5GAHJ 1ETYA 3GBGA 3QEXA 2ME6A 3EUHC 1GVJA 3W2VA 2R7RA 4PFPA 3QEVA 2HI3A 2JA6J 4EM2A 4WCGA 3PFYA 4FX0A 1AHDP 1J2XA 3N4MA 3OS2A 2IXSA 2A68F 1LFPA 4LB5A 2ACJA 1JKRC 1UHSA 3GFLA 4W1UA 4RAYA 3S2DJ 5E1ZB 1WHUA 1YG2A 3MQ0A 4JS4A 4EGZA 2EB7A 3ZN0A 5ICCA 3WGIA 3BQYA 2DFHA 2LDUA 4Y3OA 1O7LA 1IN8A 3D5RC 4RLFA 1EJ9A 3FXQA 4A3JJ 5F0FA 4FISA 2JUCA 2NS0A 3BZKA 4A3IJ 3E6CC 4LG3A 3I0TA 2LREA 3M1EA 3CQZJ 2VQLA 1TNTA 4CYCA 5D5UB 3JRBA 5K5QA 2L4AA 4MHGA 1AOYA 1FSHA 3FXMA 1DU0A 3PQJA 4D7NA 4L5JA 2JA7J 1J09A 2W25A 4M6XA 1CLQA 4AKGA 4U7BA 1LPQA 1EV7A 2HZDA 3CDHA 4DIQA 2DXIA 2DQRA 3KZZA 1AWCA 1YX5A 2OYQA 3WGHA 3ZQLA 1YRNA 1XL3C 3F6VA 5DM7F 2CJJA 4WF2A 1MNMC 3CFPA 3VPRA 4FJIA 3W6VA 2K3FA 3BWGA 2X4HA 5LGNA 1W1WE 4D1QA 3IRQA 3DEUA 3C3WA 1Z21A 2HD0A 2E31A 5M3FJ 2MLGA 4FHTA 1KZHA 2Z9OA 4HLXA 3HDDA 4XKWA 3DF8A 4LGWA 2YX4A 1SVLA 2P4WA 3PUBA 3SXYA 5LEKA 4M3RA 2KIUA 5FKLA 5J6XA 3ZQIA 4XRSA 3LSGA 4FASD 2GXBA 3C2BA 4NQWA 1MMNA 1UHWA 1W5SA 1LEAA 2WA0A 1FZPB 2R7ZJ 9ANTA 1FOWA 2F4MB 1SVMA 4AYBA 2TRTA 1FEXA 4BU2A 5B1BH 1Y39A 2P0WA 1FYLA 1XMXA 1OCZH 1A35A 3QERA 1ZLJA 1TZLA 2QBYA 5FLXZ 1X3UA 4YFKF 3FMSA 3IWFA 1CF7B 2KRFA 4ESFA 4MFEA 3HGLA 5TJJA 4YIFA 3EQLF 4KNYA 3QQAA 4I7HA 3FIWA 2OUMA 3SFZA 5D8LB 5JR3A 4HEA2 5DD4A 3AG3H 1Y0NA 3VYUB 1RZ4A 2M0CA 3K4MA 5IYDJ 3F3XA 2NS7A 1VQ4I 4JRPA 2MG4A 5GAGJ 1XS9A 4XKBA 1JUPA 4Z6YA 3WTWC 3CZ6A 1UELB 2P1PB 1P4WA 1R5HA 2D1VA 4I01A 2IA2A 5H37A 1X1AA 3HYIA 4FETA 4FVMA 1QRYA 3DKYA 2YS9A 3QRFF 2IP2A 3VDXA 4DYQA 5DDGA 4A3CJ 2JWTA 2IS2A 3SI6A 2JRMA 2M1BA 4LJZF 3FISA 3HOYJ 3I71A 1IDZA 4CCLA 2HZTA 4XLNF 3QPTA 2OZ6A 3BG9A 2HOEA 2X6YA 2CUZA 1MZBA 3CLQA 2K27A 4QNDA 2NAZA 3E7LA 4YG2F 3PNVA 5A2QK 1MMSA 4M3YA 3FXJA 5K5RA 1XCVA 2LBFA 3OYJA 3GTMJ 1XGOA 5F6FA 1ZGWA 4D0PA 1MH4A 4IHWA 1WKMA 3F8CA 4ESBA 2DFEA 1MJ9A 2DO7A 3AL0B 3CESA 5EGOB 2E32A 3ECHA 1QPMA 3SJJA 1P4XA 4G94A 1CGPA 2WAFA 1ETKA 1NG7A 3P5JA 4KHWA 3K10A 1GLNA 1ULYA 1D0YA 2LG4A 4KMFA 1IO2A 4E70A 4IRIA 3EYIA 1SEUA 1Q1HA 2RCUA 3QP6A 3BDDA 2D45A 3DBLB 3JCUC 3K1PA 2CGPA 1KU9A 4MFDA 5EG0A 4LK0F 1LB2A 1NK2P 5L3DA 1D8KA 1F9NA 3WGGA 3DLAA 3L09A 4UVCA 1DQUA 1IRFA 1UJ8A 2VPLA 4X6AJ 3BCAA 2HGCA 1OFCX 4P5OA 4YRVA 3A01A 4L9VA 1WI3A 1I6HJ 1FBUA 2M8EA 4NC6A 3H92A 1YJWI 1IC8A 2DYRH 1YTYA 2LF7A 2WBMA 2VL8A 2JJ7A 1DGWY 1V5FA 4B1RA 1ZR2A 2HPMA 4IHVA 2LF3A 3TO6A 5JLXA 2VB6A 2W82A 3S1QJ 1KU3A 3MVPA 3IH3A 3O3KA 1FIPA 2FUG2 1K6OA 2KZVA 4M3BA 3WE2A 2P6SA 3HSEA 1XC5A 2DOAA 4LIUA 5CLSA 2L9SA 3UR3C 5DYMA 4QTRA 4XLCA 4ZYDA 3H0DA 3LAPA 5IP6A 4PJLA 2MMBA 1OCOH 1BIAA 5L3GA 1SFEA 2YR2A 1R71A 4UV9A 3BOQA 3KP5A 4HPQA 2DPUA 3FZVA 5F1JA 2QVOA 3CDIA 4KHQA 1YE9A 4XICA 4KA4A 2MGQA 1F36A 2RQPA 2W85A 1V5EA 2X6XA 3P9CA 1P9QC 1MDMB 1W4MA 2P1OB 2A6TA 2BV6A 3CP8A 4MO7A 1JGGA 1F43A 4AC0A 3SUNA 2WV1A 2PJRA 3I4MJ 2QQBA 3KEYA 3LSMA 3V42A 3F0CA 3CFRA 3GEZA 5EDNA 4U7DA 2ID6A 2W24A 1VQ8I 5LD2C 2KRCA 4FE7A 4MLOA 2Y9YA 4NC8A 1FYMA 3BZ6A 2F48A 1PUFB 1XMHE 3ASNH 3FXOA 2CSOA 2JRTA 5F04A 1KQ9A 3JSPA 3DFGA 4PZJA 3ZQCA 1Y8RB 4KIBA 2KQRA 3TOAA 1GXQA 3HOSA 1QZEA 2FBHA 2X0LA 5ILVA 2JVGA 1EF4A 3F9KA 1FPOA 3GLLA 1FNNA 3OYMA 4PFOA 1KA8A 4Y17A 3VYRB 4RAGA 1IGNA 2DFIA 2GOMA 3H35A 4HYEA 5BNGA 5L3CA 4HBLA 2EK5A 1D5VA 1BM9A 3KE2A 1RESA 3HOTA 4J2BA 3G71I 4V19K 1W5TA 4KN4X 2BEOA 3OYKA 3RKWA 5CJ9A 2X9DA 1K79A 3S9HA 4OWRB 2F4IA 4MTEA 3SUPA 3MEXA 4B8XA 2L3DA 1D5YA 3T0YA 5GTHC 1UG2A 3DEEA 4IX7A 1AA7A 4DGWB 1FZ8E 3S1NJ 1EH7A 3VYTB 4M71A 1T56A 1QO0D 2CUEA 1UCRA 1X1PA 1FC3A 4MEXF 1JGSA 1MBJA 1MJAA 1CQTA 4RMNA 5GPCA 1PYVA 2YUSA 2XKOA 5IP7J 3CUQB 3NDKA 1Z67A 4KUMA 5DEQA 2GA1A 3BR6A 4XKVA 4OIOF 4P9UA 1J9IA 2QA4I 3OYAA 3CJRB 4L5EA 2XPUA 4I9LA 1M1EB 2LD5A 4WX9A 3LDBA 3J7AY 1MGTA 3OGLB 1X1CA 1SFOJ 1P92A 1S7EA 2CYYA 4HLYA 4DW6A 2F5EA 1SAXA 5FKOA 3GYHX 3KYLA 2FD5A 1QBJA 5HDGA 2ZFWA 2CWEA 4IZZA 3SVIA 3GTGJ 2HYFA 5FFXA 4HDUA 5CVJA 4HOBA 1VQ5I 2HVRA 2OF7A 1MMOG 3B6CA 2R92J 3KP3A 2PLYA 4FJGA 2MH2A 2EFOA 3FXRA 1R5GA 2LVSA 3CDLA 3CC4I 4ZJZA 1BI3A 3ABKH 3SZTA 1ZG1A 1T6SA 1A6IA 4U0WA 5EJCA 4AU7A 1QGPA 3R61A 3MZ8A 3OYLA 3HKZN 4E7SA 3PJRA 2K86A 2JQ7A 2E34A 3GTKJ 2E2JJ 2RNJA 4EYWA 2DMQA 3ZN1A 2DT5A 3DU5A 3M8FA 3OYDA 4EQQA 2VKDA 1S3JA 3X2QH 2K85A 2VE8A 3GMEA 4UHTA 4BJ5C 2F2EA 3SCXA 4CCOA 3ELKA 4IHSA 1IV6A 3FHNA 3CCUI 5HDKA 2O5RA 4ICGC 3HUGB 1IV8A 3WTZA 4CH7A 3HGKE 3R4KA 3CQ8A 2RREA 1MDMA 3L8BA 4U88A 2JHPA 3EDPA 2MA3A 1P6RA 4CZCA 5B66C 4RB2C 3KP6A 2PFTA 3S15J 1B72A 2P1QB 2IA0A 1XVBE 2HVQA 2L02A 3F6OA 1BR1A 1ZGJA 4XORA 2D2WA 3RSNA 1N75A 1R1UA 4BY7J 4MTDA 2Y75A 4E7JA 3CO7C 1MNDA 2PJPA 2LMDA 2E2IJ 2M8GX 2R4GA 2VC0A 3A0BC 2OQGA 3AFHA 1O3SA 3KPHA 2HTJA 1D1BA 4LOCA 4ZYAA 2EH3A 3U2RA 3TEDA 3VODA 2ZKZA 4I98B 1TWFJ 4HSTA 4EJUA 1E3HA 1YW7A 4F3QA 4BE1A 1WJCA 5CVIA 3GTJJ 5DCMB 2VJIA 4ASNA 1TT5B 3CTAA 3JRFA 5DV5A 3L2OB 1JW2A 2BVMA 4HCBA 2XGDA 4IQJA 2XAUA 1BL0A 2FXAA 4KIGA 1KU2A 5K7FA 5D5VB 4GFBA 1LKXA 4A3GJ 3JRGA 1R58A 4DTOA 1NHAA 2KL4A 1WCMJ 2OC6A 1SFUA 4E7IA 1TWGJ 2BBYA 2ZSHB 1ZELA 1ZARA 1BN5A 3OYFA 4G6TB 2QKLB 3LSPA 2VE9A 1YOVB 4JQFA 3HOUJ 4FJ5A 1IXSB 5J47A 3QODA 1Z1DA 2IJLA 1MMDA 3A4CA 2P1MB 1IW7F 2Z16A 2ZB9A 1MMAA 4ON0A 4OOIA 1QHHD 2ICWG 3HXLA 2FNPA 1Z3XA 3LQQA 3C1DA 3KYCB 2ELHA 5FD6A 2HXOA 2XF7A 3L2RA 3GZ6A 5LGTA 5HDNA 2HOTA 5IBKB 2DY4A 4LITA 3RZOJ 3CF2A 4NNJA 4XLPF 2DOFA 1ZLKA 3TKYA 2M4KA 1DDNA 2AQEA 5HS9A 1H0MA 2DLLA 4HF0A 4BBSJ 2E19A 3EETA 2HOAA 2RC4A 3CC7I 5BQTA 3IAM2 4L18B 1T98A 4YELA 3A02A 4M3EA 2YPRA 4FJXA 1WSUA 1LE8A 2P5OA 2GAUA 1JI8A 2TDXA 1USSA 4A5NA 3NARA 3TGNA 1TL8A 1T39A 1D0ZA 1B4AA 1OKRA 4AM3A 5CVUA 2M9HA 2H8RA 1H9GA 5ICFA 2CFOA 2JTVA 4A6EA 5E3MA 2M7BA 3CMEI 1P7IA 5FKKA 4NHJA 1X3WB 2EJRA 2HR3A 3SZGA 2PFVA 4QNCA 3JRAA 3CFOA 5HLGA 4N9IA 1R4NB 2HS5A 3E6BA 3DCFA 4V2GA 3J7ZI 1OISA 4HF1A 3LWFA 4OAYA 1OLTA 4XLEA 1A6QA 2CV0A 2BY1A 1FYKA 1IUYA 3TAEA 4PUSA 4BDZA 2O9LA 4O6JA 2L0KA 1S6LA 3S17J 1L3LA 4KISA 1OCTC 1TQIA 3FK7A 3OS1A 1S8NA 1VF9A 3RKQA 2EV5A 4IRGA 3CF5F 1N77A 4QIWN 4XSZF 3RQ4A 4AYBN 3ERED 5FKMA 2FOKA 4I2OA 5BPIA 1RI7A 5EF6A 2H1KA 3B73A 3KEOA 2KDOA 3HG9A 1TWAJ 1N25A 1U0JA 2HDDA 3SFIA 3ZR8X 2JH8A 1MIJA 2ZMEA 4DQ2A 2NXNB 3RIRA 3K4LA 3VSKA 2H1LA 2QF7A 2DA5A 2PG4A 1DPUA 2EFPA 3KLNA 2DA4A 1D3YA 3SQ0A 3QWLA 1FBSA 2KDZA 4BHCA 5DS9A 2Z1DA 2R5ZA 1A04A 1FP1D 2QCOA 4IVNA 4KICA 3W2WA 3ZQGA 4B44A 2G7HA 1VZ0A 3TL8B 5D6FA 4YIIA 4QLCU 2B9SA 2ECBA 4QSHA 5JVGF 4BE0A 3IAS2 4DYCA 3NAUA 5AIPA 4DBRA 3GZNB 3ISPA 3LFUA 2GXGA 4RB3C 1SC7A 1PP8F 1XMFE 1O3TA 2CFXA 3LDSA 2M3AA 1YW9A 1TQMA 1G2HA 3V4GA 1IRZA 2KPMA 3FKIJ 2AQFA 3R0AA 1RRJA 4HRIA 3QPLA 4JX6A 4II2A 4O3MA 3NWTA 2IS6A 3QPSA 4BS9A 2G7UA 4C2UA 4EPHA 1D1CA 1U9NA 1FZ6E 4DTSA 4I9QA 1Z9CA 2DK8A 3HL8A 2VC1A 1W7PA 3V7SA 4L0YB 2L7KA 2QWWA 2V26A 3DV8A 1F1ZA 2RKHA 2ZXIA 1QNTA 1IRXA 3DU6A 1WFXA 3MMYB 1Y1WJ 2H6BA 3HOVJ 3TQNA 3BPVA 2X6WA 2H4TA 4PGHA 5L3EA 1BW6A 3CCRI 2VIXA 2W57A 5DCFA 2HEOA 4FJNA 1SFXA 4FE4A 2STTA 5GPAA 1DP7P 1IN5A 1WWXA 1R6RA 5E3OA 1VQLI 4N0BA 4I76A 1ORKA 2HOSA 4DZPA 3PO3J 1H9TA 1TBXA 2ETHA 3HTUA 5D5XB 5F08A 4CHUA 4Y33A 3T8RA 4BJ6C 2K40A 3MCZA 1SVOA 3I3LA 2RV8A 4IT5A 5ILUA 4AIKA 2STWA 1XD7A 3WU1B 2OVRB 2M4GA 4DTJA 2FMLA 2ZMEC 1X4PA 2MD5A 5H6RA 3HGGA 5TGTA 4J19A 2DFFA 2FW3A 4M3XA 5LRRA 4C9YA 1EH6A 2BY3A 2VQGA 3RJPA 1VQOI 2UUZA 4M3FA 1D0XA 1NG6A 3BR2A 3BG6A 3NGIA 2WAQA 2Q8KA 3I53A 2WADA 2V6CA 4XKCA 3QOEA 2OU2A 3BTLA 2BHZA 4J2EA 1AKHB 4X1EA 2DW4A 2ZJ2A 1FZ2E 3DWLE 2E7WA 4ZYEA 3KP2A 2XPWA 4EVIA 3FBIB 3HHHA 1Z7UA 4G7ZF 4RLQA 3BTCA 4XQFA 3SPYA 4EP9A 1OR7C 4HX4A 1HA8A 3MAJA 2EZHA 5IYCJ 3SHFA 4EEFG 4FJJA 5IOZA 4S05A 2IBDA 3MKWB 2E36A 5A2QZ 4AIDA 1QQIA 2OTLI 4F7ZA 2CQNA 2J5PA 2KIFA 2KKOA 2JT1A 4BYYA 3OYNA 3PQKA 1U3EM 2VBYA 5CKTA 1UHMA 3NRVA 1T8IA 3HL2A 2MLKA 3LSRA 4B47A 4N4OB 3QP5A 1YJ9I 4M73A 3IV5A 1ZH5A 2R3SA 2KJBA 4B3AA 4IJAA 2DTRA 1I6XA 1WJ5A 3DBRB 4A12A 1TLHB 2VUMJ 4WWCA 3V8LA 2M5WA 3LZIA 3BQZA 1U9OA 3CCEI 2OJED 3RZDJ 3VWBA 1GXPA 2X1EA 1B59A 2LKSA 3BPXA 4CDGA 4BEHB 3GX4X 2WC2A 2BW3B 1MHZG 1DPRA 2CQ7A 1R36A 3HOWJ 2BZTA 3AL0C 2XGXA 1Q9YA 4HG2A 2MD0A 3SJMA 2UXNA 1XMKA 4FX4A 1R7JA 1R22A 3M4OJ 2FA5A 1FMWA 4L9TA 5KNLA 2YX7A 3E5XA 3U1KA 2LKXA 3V7CA 4FJKA 2BGCA 3Q0WA 1IH7A 2YU9J 4QWQA 4HNUA 2PN6A 1FT9A 3NHGA 2DA1A 5DD8A 2NVYJ 1JE8A 4DBQA 3E97A 3BG7A 1B9MA 1REPC 1B1BA 2MBFA 2QENA 3B6AA 3F8FA 2PBIA 2XV4S 2OZUA 3HBLA 1JTYA 2Q2EA 4XRSG 4BJTA 2K5CA 4A6DA 4BEHA 3A0HC 4XN3A 2IS4A 1KONA 3HRSA 1U8BA 2NOGA 2L01A 4BQOA 2K4JA 3KIOA 3EUKL 4C2MJ 3SZPA 5EG0B 3AAFA 2LRDA 1VQPI 1MKMA 2ZSIB 3M3YJ 4DTPA 4G9YA 4Y13A 1GV5A 3F22A 3WU0A 2HQNA 4HCCA 3KEQA 3O6BB 2PEXA 4IF4A 4JBAA 1OCRH 3LAJA 4BHPA 4KYWA 3TAFA 3E6DA 3RKXA 1KYWA 3A1YA 4M6YA 1T0FC 2O8XA 3ULQB 1JKOC 2CW7A 5JLWA 3HSRA 2KP6A 1G6NA 1J59A 2GIZA 2XGCA 2QSFX 1POGA 2ZNZA 4BQNA 1G3WA 1XDSA 3LZJA 2FQ3A 2AXTC 5E17F 3JAMK 2LLKA 2LSOA 4S0HB 2CH0A 1R49A 4JX5A 3GWZA 3L2VA 2B1EA 3TMOA 5FGMA 1XG1A 3FMRA 1R5ID 5J8CA 1A5JA 3IH2A 3T8TA 2CO5A 1FTTA 4RM3A 1RPWA 4BBRJ 2HYJA 5GP9A 3GZ5A 1X2MA 1QPIA 1ETWA 4S04A 1WJAA 3GFMA 1MSEC 1P4AA 3E6MA 3DPLC 3QPHA 4A69C 5BS6A 3HHGA 4P9FA 1RR8C 4H4KC 4UVBA 1XB4A 3GO5A 4FJ7A 3Q5FA 5L3FA 5DCMA 4JK1X 1HW1A 2PMZN 1FPQA 2P5VA 3G1LA 2X48A 1FWZA 2P5KA 3L2WA 4J00A 1ZG3A 5F27A 1HLVA 2EBIA 1DU6A 4XOTA 2K02A 4EM0B 4RG8A 1HW2A 2DK5A 2QYOA 2DA7A 2QBYB 1BBYA 2OAZA 3R6SA 5LRSA 3K4KA 2A6HF 4E7KA 4DYRA 2QSHX 4F55A 4XR6A 3G1MA 1E17A 3UO2A 2F5FA 3J81K 5J1YA 1G3YA 1BR4A 1UFMA 2KLOA 1L0OC 3HKZA 5BMZA 3H9QA 3BG3A 1YRNB 1TW2A 4MQVA 3DTKA 2V9VA 4J01A 3I58A 1SD5A 3HEFA 1FZ7E 3CO6C 3AG4H 1W36C 3SDGA 3CCVI 2FEZA 5FKNA 1WAFA 3IHUA 2DDBA 2WTEA 1IRGA 3BC8A 2MSYA 5D4RA 3WU2C 2AO9A 1ERDA 3TJYA 4JRQA 1FMVA 2NVUB 1I3QJ 3RWUA 1DGRM 5LHHA 3OIQA 3TDZC 2RN7A 4BXFA 2QEXI 2K9LA 2QKMB 3QEWA 4LG0A 2KIQA 5FB2A 1XVEE 3TOBA 1ITYA 3BVOA 1IG9A 2KIMA 3CCQI 3FM3A 3SQ4A 2JPNA 3WTVC 2BHYA 3LQRA 5E18F 1BC8C 2KHMA 3HOXJ 2PQ8A 2Y9ZA 1XTAA 2EZIA 4LLGF 1Y56A 2X85A 1AKHA 1LUJB 4UUTA 2MC3A 3S1MJ 3BJAA 2COBA 3VOEA 2W48A 5IY5H 1I3AA 4KHNA 1T08B 1ZRFA 1HKQA 3S1RJ 2ZJQF 2E1MB 3JRCA 3BY6A 4Z2YA 3MKYB 2AXLA 3UO3A 1X58A 4KITB 3LMMA 2GM4A 3SDBA 3TO7A 2ZNYA 2JHCA 4Q48A 1X19A 4JP0A 2VLAA 2FQ4A 1MBEA 1G3TA 1U8RA 4M42A 2CQQA 4XRFA 1WZ2A 3UNGC 2G9WA 5EEHA 5K5OA 1HKSA 4M41A 1ZQ3P 2L9NA 4IXAA 4XLFA 3LSJA 5JHFA 2DTUA 3C6OB 4FK2A 1Y8QB 4CA0A 5HS7A 1RETA 2GZWA 3OOUA 3PSFA 3LNQA 4OIQF 3R60A 1B8IB 4FJMA 1LFBA 1PP7U 3QU3A 1R9TJ 4OIPF 1Z0XA 2KFDA 4ZC3A 2WAEA 4A3MJ 2ZFUA 5TISC 4E3SA 3HUGA 3NQOA 1RR7A 3WTXC 2E35A 3H1CA 2PMUA 2DMPA 1FP2A 1YYVA 2IAIA 1K83J 3M8JA 2NNYA 3V7DB 2NOJB 2JSPA 2OA4A 2Y0SN 1FLIA 2WB1N 3F8NA 4CGZA 2LH9A 2OQRA 2XUBA 4I0AA 1JUSA 1W5CC 1R1TA 1LQ1A 3HP9A 3O8HA 4NB5A 1O3QA 2EFWA 3HRUA 4HSRA 3G6EI 4I6JB 4BXXJ 4EATA 4RL5A 2R7XA 4U0YA 4BHBA 5E79C 2JN6A 3E0JB 3N1BA 5IZ7A 1I50J 1XX5A 2R7WA 3E5QA 3OYCA 3FX3A 3QEIA 2K9MA 3GLXA 3IRRA 3A2KA 1U5TA 5E20A 1WQ2A 2EFQA 1W36D 5IT9K 1JHFA 5B5EC 3L1PA 3ZMDA 2LFBA 4UV8A 2ELKA 1Q1VA 4CO8A 2L9VA 4BNCA 3CP2A 4K2EA 1A36A 2PJRB 1LDJA 3ZQFA 2JPCA 2KT0A 1SD6A 2DBBA 4HF2A 5F0CA 1HCRA 2R7VA 4J2AA 5KAFC 3FM5A 5DUKA 4EMSA 2YB5A 2DN0A 5TRDA 5DM6F 2VJ4A 1MBHA 2DYSH 4MGRA 3A01B 4G7HF 2JA5J 5D5WB 4CUGA 2VASA 1QHGA 4DOZA 3PNYA 2F5VA 3H9JA 5CQGA 4Y4RA 2DA6A 5FLXK 1ON2A 3C95A 4LMYA 1HSTA 4WXCA 4DZJA 3I64A 3S93A 1GVDA 1XSDA 1R1VA 4KT6A 5H2FC 4XLHA 2P8TA 3ZMZA 3SQNA 2NVXJ 3H36A 2VODA 2VJJA 1RUOA 2XPVA 2BY2A 5HNFA 4XMYA 1W0TA 2XASA 4XNFA 3ZOBA 3IL2A 3OR2C 2E5NA 3SEQA 2EIMH 3G3ZA 3BR1A 3OYBA 4DU4A 3OYIA 4ZH4F 1O3RA 1Z91A 3KX2A 3WE3A 3RI4A 4M3GA 2WY7Q 1LVAA 3NAEA 1NTCA 1OCCH 5K1YA 2CQKA 2XVCA 4IO9F 3BR5A 3RTRA 3NE6A 1QU3A 5FRNA 1ONVA 2F6CA 1ENHA 3W6KB 5IREA 3JAMZ 4I02A 3AKZA 3KETA 2EA2A 3W3CA 2VONA 2F5CA 5E1WA 1IN6A 1OPCA 5M5WJ 2B7MA 1YQAA 2O03A 1IDYA 3BP8A 2IGMA 2V79A 3HM5A 1GV2A 1JHHA 2O61A 2LY9A 1USTA 4RM2A 1H89C 4XM3A 2W00A 3RDIA 3GTQJ 2XAGA 1UMQA 2X6OA 2DA3A 3I54A 2R5YA 2QM3A 5BPDA 1UAAA 1N1CA 1RKWA 1MBKA 4ANJA 3CMAI 1ON1A 2LBFB 2B8IA 2P6TA 3UKGA 3UIQA 1JKQC 1BJAA 2GQQA 2KRHA 1G8XA 3BG5A 1KQ8A 4PGGA 1TWCJ 4A2UA 4I6ZA 5LHIA 1RIOH 4B3XA 4GYIA 3J2PA 4TV7A 2H8WA 5B3SH 4PJMA 1SAUA 2HWVA 4DTNA 1X2NA 2VKEA 4KI6A 4LG0B 1BW5A 2HQRA 1XVCE 1MBGA 4A3KJ 2AS5F 4UY8I 3K7AJ 4N9HA 5E8GA 4AD9A 3IWZA 2L7ZA 1LFUP 1HDDC 3OWTA 4GO1A 5J1RA 1VQKI 4C30A 4C3JJ 2MC4A 2L4MA 2XDVA 1XGMA 5J8FA 3BLYA 2UZKA 2EZKA 1K61A 1XVDE 3FKJA 4IKFA 2XB5A 2LF6A 2OTJI 2Q0OA 2HU9A 4A93J 2DQLA 2X1CA 3I59B 1U78A 2MZWB 3CJTB 3I4PA 2XAHA 1ZTRA 1IAWA 3J27A 1O7FA 3FDYA 4FQGA 4HV6A 4IOAF 3OV8A 1YIOA 2BY0A 3K9TA 4AI6A 5E1XA 4QPOA 1I27A 1FZ4E 1S9HA 2XB0X 5HLIA 4A3EJ 3QESA 1YX3A 1F4KA 3DKXA 3I56I 4KHSA 3MZHA 3LA3A 2DA2A 2FJ1A 3GCMA 1K6YA 4HA8A 2HPIA 1JJ8C 3K2AA 4DU1A 3REOA 3CC2I 4ZDPA 3LA7A 3OL3A 2M30A 2Q1ZB 1PVEA 2DPDA 2XRNA 3TDUC 1ACIA 1KQ0A 2L5QA 2L7MP 1ETQA 1P7JA 1VI0A 4BAYA 2JUGA 3LA2A 2UXXA 4KT5C 2M34A 4ZZDA 1XSXA 3W6JB 4RBOA 3PIPF 3RYPA 2CQXA 4U87A 3I59A 3U1DA 4B09A 5EGOA 1EA3A 1G4DA 2KZGA 3OMYA 2VJ5A 5IP9J 2RQQA 5KAIC 3H3UA 4IOCF 3O8GA 3RMAA 2YSRA 4R79A 2VT3A 2QUFA 4EM1A 3I55I 2XHKA 3NEUA 2CW0F 2JHAA 2B0LA 3Q0UA 1JUMA 2BVLA 2OVQB 1QVUA 1QVTA 2EPFA 3WG9A 1ZREA 4HW0A 3G73A 3SUQA 1SMTA 3ABLH 4CCMA 4BY1J 3BROA 2G0EA 2A61A 2R7QA 3S3NA 1XU3E 3S14J 1YS7A 4YFXF 3HC7A 4IHTA 5E3NA 2I8DA 3WODF 1IN4A 3L7WA 2O0YA 2IA1A 3ABMH 2IGOA 3DTIA 2MFZA 4E7ZA 3DEWA 4PSXA 2PFBA 2EIJH 4KMUX 4XK4A 4KHYA 1ETOA 2Y0SA 3FXUA 2I10A 2MABA 3VSLA 4BQQA 4LLLA 4CXFA 1YHQI 1XMAA 3ZMSA 3HJEA 2NRAC 3BJOA 4RGXA 5H20A 4YIRX 4M6VA 1UZCA 2ELJA 4OU0A 1SANA 3EUHA 2ME0A 2K5SA 3ABUA 3JRDA 1LEBA 6PAXA 3OY9A 1LDKB 2KISA 3MN2A 3F8BA 3KZYA 2F4OB 4HNTA 3LL7A 2IT0A 4J2DA 4M3TA 3RPUD 3DLLF 2FX0A 3BTIA 3DXJF 1HSJA 4PJJA 5CVVA 1YO5C 2BXYA 2A5WA 3BCBA 1IZ1A 3HPGA 1J0RA 1IJWC 2O3FA 3LOCA 4EJVA 4ENNA 3CCYA 4Q47A 1A31A 2A3SA 2IGKA 2I5UA 4IEJA 2DT7B 1T33A 3BR0A 2DMUA 2V1DA 3K6GA 4LB6B 1YS6A 2K9SA 2OPTA 2L2OA 1FZ0E 4WK8F 4XOPA 2CRGA 3TL4X 3IKTA 2P5GA 2ISYA 3CJNA 1YIJI 4P55A 2HKXA 3U9GA 3L0MA 4ZTFA 2FE3A 2Y30A 1U2WA 1VFCA 2GLOA 2ESHA 2K3PA 5KHDA 3IH4A 3TW6A 2XKPA 3RKYA 2CUFA 4A5MA 2DU9A 5ICGA 4P96A 4ITVA 5K7ZA 2V4JC 4DTXA 4MQ9F 4M9ZA 1O4XA 1E3OC 3PO2J 2QZ8A 1W7PD 4N4NB 3K1NA 4PDKA 5IPAA 4LLNA 2NVTJ 2RVCA 1RUNA 5HS8A 3S2HJ 2Z3YA 3FBNB 3ZQQA 1XCBA 1WRJA 4C3HJ 2GA2A 4GCVA 4XLAA 2P5LC 2CUJA 3D5LA 2LTPA 4UVAA 3IKVA 4I99C 4ZTJA 1JXSA 3LSKA 1JT0A 3QETA 4FK4A 3ZP5A 2DT6A 1VNDA 3D1NI 4F92B 3CMMA 4P1WA 1WJEA 3HRTA 3Q9SA 2XAQA 4QPQA 3E5UA 3CCMI 1IG7A 3PM1A 2LP0A 3GVAA 4M9XA 3ZRGA 1I1SA 3GW2A 3SYTA 1EH8A 1VQ7I 4UB8C 2VXDA 5F64A 4HAMA 2AHQA 4PSWA 2X51A 2ECCA 3TBIA 4EJOA 1BOAA 4CCJA 3MKLA 3ZPLA 2O6GE 2ZJRF 4X5MA 1E2XA 1YFHA 2VXZA 3QNNA 2EILH 4IHXA 1UB9A 1X1BA 3SNNA 1OYIA 4RDUA 3K2ZA 3K4BA 2ZXWH 2DI3A 3BZCA 1OYWA 1BOBA 2EQRA 4RAFA 4ADNA 4BQAA 1HBXG 3WG7H 2B7EA 3K0LA 2ZC2A 4BUPA 5ICEA 3C2GA 1K4TA 4RNGA 3KFWX 3GTOJ 1OQYA 2IGNA 5E3LA 3H5RA 1LJ9A 4ZDLA 3TABA 2A5YB 3F23A 3DBHB 3KLOA 1FZ9E 2IS1A 4EV0A 3VYSB 2DTZA 4AUXA 2CV1A 4C2TA 4HX8A 3ZQ7A 4UXNA 4BXUA 3C2HA 2MW2A 3I5UA 3OR1C 3RCOA 3EUAA 3OIPA 1NEXB 4E4BA 4G12A 3WTYC 1MJBA 1U6GA 2L9RA 3KZIC 4IL6C 3LSIA 4MEYF 2V1XA 2XC7A 2V7FA 2EWNA 3AG2H 2UV1A 4R1HA 3V7RA 4HZFA 2O7OA 4F52A 2H6CA 3P9IA 4UNOA 2JK3A 5EZHA 5FD5A 3ZMTA 1W7PB 1KGSA 5LHGA 4AVPA 3C94A 1DUXC 1Z3YA 4A3LJ 1QA6A 1MH3A 2LC2A 1XN7A 2EINH 3Q9VA 3SQ1A 4CICA 1J75A 2K9QA 2WAQN 4C3IJ 1FZ5E 3HIFA 4RB1A 1WH5A 1GDTA 2OVPB 4XL9A 4ZYHA 4LD5A 4DJAA 4G8XA 4M3ZA 1SFKA 4PK4A 4FCYA 4BL0B 1LVKA 3SQ2A 5CYVA 2R5YB 2DODA 1U5TC 4NDLA 3QOPA 4UUSB 2RAEA 2GWRA 1FJLA 2CG4A 2EA4A 2EZLA 3CLOA 4M72A 3ZMUA 5GTIC 4M45A 4HV5A 1R4MB 1Z6TA 4NQWB 1V5GA 1ZAOA 4RGSA 2V9KA 2ZCWA 1Y0UA 2GXAA 2QSGX 4OIRF 1BIBA 4ZYGA 4UUSA 1TQPA 3GFIA 2IRFG 3CCSI 1LDKE 3G2BA 2Y0MA 3DTEA 3GFJA 3JTHA 2HQ5A 3D0SA 4Y7NJ 3M07A 3LD8A 5C3EJ 4V2FA 1FZHE 4HDVA 2ATQA 3PL8A 1MD0A 2EFNA 2P7VB 3Q3SA 3JREA 1IUFA 3HRMA 3O2PE 2OZSA 2IPQX 2VKHA 2VQHA 1VTNC 2NYXA 1FY7A 1MBFA 2ESNA 2LY2A 3K70C 1T38A 1K7AA 3Q0VA 3TP3A 3FXLA 2XSDC 2XGEA 2KMUA 5KK1A 4A0ZA 2NS8A 3C18A 2F5DA 4X0GA 2DEBA 3K4JA 2Y31A 2VI6A 1FSEA 3F72A 2NVQJ 1PUEE 2XROA 4D5CA 2KJCA 4F93B 4BGDA 1XU5E 4I09A 2Z99A 3FXKA 1FZ1E 4M9SA 4KHUA 2CW8A 2BYVE 2M7AA 3WHCA 1X4OA 4KJZA 2D5VA 2JVHA 3MZYA 1KU7A 4UUVA 2XAJA 3KP7A 2QQ9A 2JH9A 4CSWA 1WJDA 1HQCA 2VOOA 5JFRA 4WXHA 2VPRA 3V8KA 1NK3P 3F8MA 2QQAA 3M7GA 5GAEJ 3LFKA 4YFNF 1I5ZA 2XSJC 4OAZA 3H9GA 5J40A 1LE8B 4D5FA 2HVSA 5LLQA 3RPQA 2M45A 5KCMA 2H09A 3ZXSA 3ML6A 2QXFA 1G59A 2HQAA 3M8EA 4F91B 3PSIA 1Y6IA 3M1CA 5M5YJ 5EEGA 1MHYG 1WI9A 2E1NA 4DNCA 4ESJA 1OMIA 4HNVA 2L7FP 2WWYA 1FIAA 3KP4A 3QU6A 5HLTA 1IXCA 3GUDA 4ABZA 3OGKB 1SD7A 4PCQA 3TO9A 2LNBA 2EV0A 2FYOA 2P7CB 5KVRA 2VBZA 2Y2ZA 1OJLA 2WV0A 3M9AA 2HDWA 4H0EA 3KD5E 5CVRA 3F21A 1ZGAA 1HF0A 1K4SA 2JPBA 5HOOA 4BDYA 1E0EA 2R7FA 4PJ0C 1FZ3E 3GXOA 2K9NA 5ILSA 4A0XA 3K1MA 2FMYA 5ERIA 3VB2A 4B43A 4XIDA 1AU7A 2ZMEB 3R0JA 3VEPA 1APLC 4GGGA 2ZBKA 3B02A 3S16J 5IT9Z 3ONQA 3RPUA 3T1BA 4B48A 4GDFA 3IUOA 2FNAA
chains in the Genus database with same CATH topology
1HXDA 1HW5A 1ZN2A 3OOPA 4EJTA 1KYZA 4RGUA 4EGYA 1D8JA 2EV6A 3V8JA 4BH9A 5IT3A 1P2FA 1U5TB 3FF5A 5HVQC 1BI2A 5D8KB 5F1RA 3J80Z 1ODDA 5BOXA 5D4SA 2XIGA 5AIQA 4CZZA 2NNNA 3ZMVA 4ENKA 2QLZA 1QZYA 2VOPA 3ECOA 1BI0A 5HLHA 4I0BA 3J81Z 3FHZA 2IVMA 2VBWA 1ZHFA 4G7OF 1TW3A 3WTTC 1T0FA 1GHCA 2MH9A 3J80K 5LEJA 1V4RA 2E1CA 1ZRDA 4M74A 3H3ZA 1R00A 1XGSA 3CUQC 1OYYA 3ROUA 1LDDA 2HKOA 4KIFA 5AONA 5H6QA 2LF8A 2HFHA 4XBFA 2M87A 4KDPA 3RYRA 4L0ZB 3PFIA 4GXOA 3DKWA 1I1GA 1CF7A 2HTSA 1HKTA 1B6AA 2VN2A 3P7NA 1S7OA 5LBQA 2JSCA 4RS8A 4GYGA 3C7JA 2OBPA 1XDUA 4IPAA 5DUIA 3K69A 3S2WA 3L2CA 3HTSB 1ZRCA 5ED4A 3VFZA 3DPTA 4OINF 4OMYA 2YU3A 1BC7C 2V1UA 1SD4A 2UWMA 5E8IA 1OR7A 4Q4ZF 2C6YA 2ISZA 4ZZLA 2Z5UA 1K78A 1J7KA 3BJ6A 2VBXA 3N97A 2ZXJA 5JVTA 2RGVA 4ENJA 1YW8A 4IRHA 2A69F 4HQEA 4G6DA 4KN7X 2A07F 1STZA 1O57A 2HYGD 2DAOA 2A6EF 1QZZA 4EJWA 1BI1A 3CUQA 1IN7A 3L00A 4RGRA 2PMHA 4G6QA 1ZYRF 1TTYA 2Z33A 2ZO4A 1SMYF 3GF2A 4AWXB 1XGNA 3JW4A 1FX7A 1Z6RA 4O5VA 5L3BA 3JSOA 1Z05A 4L5IA 3WTUC 3MWMA 1XSVA 3QAHA 2FBKA 5D6EA 4ENMA 4WXDA 3ABTA 4AIJA 2H94A 2PI0A 1B9NA 2FBIA 2JZYA 3EYYA 3MFKA 4FT8A 1G3SA 2W84A 2H27A 4RB0A 4RAZA 1YLFA 1TNSA 1RNLA 2LKPA 5FO5A 3FWEA 5JI6A 4Q5SF 4ETSA 5FFZA 1ZG5A 3DP7A 4KFCA 1F5TA 1S29A 2D1HA 2FRHA 2E7XA 1IF1A 3COAC 4CYDA 2L54A 3HSFA 3P9KA 2COMA 3T5XA 2HDCA 2GIVA 3FMQA 1FBQA 2FU4A 4LK1F 3KCCA 2OD5A 2XAFA 2RDPA 4AIHA 1C0WA 2FF4A 1PDNC 1K78B 4LFUA 1T2KA 4OMZA 1R23A 4HQMA 1J5YA 3IC7A 3L9FA 5JHUA 2BE5F 3LSTA 4L9NA 2Y48A 2VT2A 3J7AO 3E3VA 4MNUA 1V3FA 4XSXF 2ADUA 4R8HA 2K4BA 3CUOA 2J5OA 1IXRC 1S7AA 3JTGA 3WTSC 2K7LA 2FSWA 4U0VA 3DQVC 5LGUA 4Y15A 1FOKA 4A0YA 1LNWA 2R7DA 2IW5A 4L9JA 4HX7A 1GVJA 4EM2A 4WCGA 4FX0A 1J2XA 3N4MA 2A68F 4LB5A 2ACJA 3GFLA 4RAYA 5E1ZB 1YG2A 3MQ0A 4EGZA 2EB7A 3ZN0A 5ICCA 3WGIA 2LDUA 1O7LA 1IN8A 3FXQA 2NS0A 3E6CC 3I0TA 3M1EA 1TNTA 5D5UB 5K5QA 2L4AA 4MHGA 1AOYA 1FSHA 3PQJA 4L5JA 2W25A 4M6XA 4U7BA 1EV7A 3CDHA 2DQRA 3KZZA 1AWCA 3WGHA 3F6VA 4WF2A 3BWGA 2X4HA 5LGNA 3IRQA 3DEUA 3C3WA 2MLGA 4FHTA 2Z9OA 4HLXA 3DF8A 4LGWA 2YX4A 2P4WA 3SXYA 5LEKA 2KIUA 5J6XA 2GXBA 4NQWA 1UHWA 1W5SA 1LEAA 1FZPB 1FYLA 1ZLJA 2QBYA 5FLXZ 1X3UA 4YFKF 3FMSA 3IWFA 1CF7B 2KRFA 4ESFA 5TJJA 4YIFA 3EQLF 4KNYA 4I7HA 5D8LB 3SFZA 5JR3A 5DD4A 1RZ4A 3F3XA 3WTWC 1P4WA 1R5HA 2D1VA 4I01A 2IA2A 3HYIA 3QRFF 2IP2A 5DDGA 2M1BA 4LJZF 3I71A 2HZTA 4XLNF 3QPTA 2OZ6A 2HOEA 1MZBA 2K27A 2NAZA 4YG2F 5A2QK 5K5RA 1XCVA 1XGOA 5F6FA 4D0PA 1WKMA 3F8CA 4ESBA 2DO7A 1MJ9A 3ECHA 1QPMA 1P4XA 4G94A 1CGPA 1ULYA 4KMFA 4E70A 4IRIA 3EYIA 1Q1HA 3QP6A 3BDDA 2D45A 3K1PA 2CGPA 1KU9A 4LK0F 1LB2A 5L3DA 1D8KA 1F9NA 3WGGA 3L09A 4UVCA 1IRFA 4P5OA 2HGCA 4L9VA 1FBUA 2M8EA 3H92A 1YTYA 2LF7A 3TO6A 1KU3A 3O3KA 1K6OA 3WE2A 2P6SA 3HSEA 5CLSA 5DYMA 4ZYDA 3LAPA 5L3GA 1BIAA 1SFEA 2YR2A 4UV9A 3BOQA 3KP5A 2DPUA 3FZVA 2QVOA 4KA4A 2RQPA 2W85A 3P9CA 1MDMB 1W4MA 2BV6A 2QQBA 3GEZA 4U7DA 2W24A 1FYMA 3BZ6A 2CSOA 2JRTA 3JSPA 1KQ9A 3DFGA 4PZJA 4KIBA 3TOAA 1GXQA 3HOSA 2FBHA 2X0LA 5ILVA 1FPOA 1FNNA 1KA8A 4Y17A 2DFIA 4HYEA 5L3CA 4HBLA 2EK5A 1D5VA 1BM9A 3KE2A 3HOTA 1W5TA 4KN4X 2BEOA 3RKWA 5CJ9A 1K79A 4MTEA 3MEXA 4B8XA 2L3DA 3T0YA 1EH7A 4M71A 1QO0D 1UCRA 1FC3A 4MEXF 1JGSA 1MJAA 2XKOA 3CUQB 4KUMA 5DEQA 2GA1A 4OIOF 1J9IA 4P9UA 4WX9A 1MGTA 1P92A 2CYYA 4HLYA 2F5EA 1SAXA 3GYHX 1QBJA 5HDGA 2ZFWA 2CWEA 2HYFA 5FFXA 4HDUA 5CVJA 4HOBA 3KP3A 2PLYA 2MH2A 2EFOA 3FXRA 1R5GA 1BI3A 3SZTA 1ZG1A 1T6SA 4U0WA 1QGPA 3R61A 2K86A 2RNJA 3ZN1A 2DT5A 3M8FA 4EQQA 1S3JA 2VE8A 4UHTA 2F2EA 3ELKA 4IHSA 5HDKA 3WTZA 3R4KA 1MDMA 4U88A 3EDPA 2MA3A 1P6RA 4RB2C 3KP6A 2IA0A 2L02A 3F6OA 1ZGJA 2D2WA 1R1UA 4MTDA 2Y75A 3CO7C 2PJPA 2VC0A 1O3SA 2OQGA 2HTJA 3U2RA 3VODA 2ZKZA 4I98B 4EJUA 1YW7A 5CVIA 5DCMB 4ASNA 3CTAA 5DV5A 2FXAA 4KIGA 1KU2A 5D5VB 1R58A 1NHAA 1SFUA 2BBYA 1ZARA 1BN5A 2VE9A 4JQFA 1IXSB 1Z1DA 2IJLA 1IW7F 4ON0A 4OOIA 2FNPA 3LQQA 3C1DA 5FD6A 2ELHA 3GZ6A 5LGTA 5HDNA 4XLPF 1ZLKA 3TKYA 1DDNA 5HS9A 1H0MA 2DLLA 4HF0A 3EETA 2RC4A 5BQTA 4L18B 1T98A 2YPRA 1WSUA 2GAUA 2TDXA 1USSA 4A5NA 3TGNA 1T39A 1B4AA 1OKRA 5CVUA 1H9GA 5ICFA 2JTVA 4A6EA 4NHJA 2EJRA 2HR3A 5HLGA 4N9IA 2HS5A 3E6BA 4HF1A 3LWFA 1IUYA 1FYKA 4O6JA 1S6LA 1L3LA 1TQIA 1S8NA 2EV5A 4IRGA 4XSZF 3ERED 4I2OA 2FOKA 5BPIA 1RI7A 3B73A 3KEOA 2ZMEA 4DQ2A 3RIRA 1DPUA 2PG4A 2EFPA 3KLNA 1D3YA 1FBSA 4BHCA 1A04A 1FP1D 4IVNA 4KICA 2G7HA 5D6FA 4YIIA 4QLCU 5AIPA 3ISPA 2GXGA 4RB3C 1PP8F 1O3TA 2CFXA 1YW9A 1TQMA 3V4GA 3R0AA 4O3MA 2G7UA 1Z9CA 2DK8A 2VC1A 1W7PA 3V7SA 4L0YB 2QWWA 3DV8A 1F1ZA 2RKHA 1QNTA 2H6BA 3TQNA 3BPVA 4PGHA 5L3EA 2W57A 5DCFA 2HEOA 1SFXA 2STTA 1DP7P 1IN5A 1WWXA 4N0BA 1H9TA 1TBXA 2ETHA 3HTUA 5D5XB 4CHUA 3T8RA 3MCZA 2RV8A 4IT5A 5ILUA 4AIKA 2STWA 1XD7A 3WU1B 2FMLA 2MD5A 5H6RA 5LRRA 1EH6A 3RJPA 2Q8KA 3I53A 2V6CA 2OU2A 2DW4A 2ZJ2A 2E7WA 4ZYEA 3KP2A 4EVIA 3HHHA 1Z7UA 4G7ZF 4HX4A 3MAJA 3SHFA 4S05A 5A2QZ 1QQIA 4F7ZA 2J5PA 2KIFA 2KKOA 2JT1A 4BYYA 3PQKA 1U3EM 2VBYA 1UHMA 3NRVA 2MLKA 3QP5A 4M73A 1ZH5A 2R3SA 2KJBA 4IJAA 2DTRA 1I6XA 4A12A 1TLHB 4WWCA 3V8LA 2M5WA 1GXPA 1B59A 3BPXA 4CDGA 3GX4X 2WC2A 1DPRA 1R36A 2XGXA 4FX4A 2UXNA 1XMKA 1R7JA 1R22A 2FA5A 4L9TA 2YX7A 3E5XA 3V7CA 2BGCA 4QWQA 2PN6A 1FT9A 5DD8A 1JE8A 3E97A 1B9MA 1REPC 1B1BA 2MBFA 2QENA 3F8FA 2PBIA 2XV4S 2OZUA 2Q2EA 4A6DA 3HRSA 2L01A 2K4JA 3SZPA 3AAFA 1MKMA 4G9YA 4Y13A 3F22A 3WU0A 2HQNA 3KEQA 3O6BB 2PEXA 4IF4A 4JBAA 3LAJA 4BHPA 4KYWA 3E6DA 3RKXA 1KYWA 3ULQB 4M6YA 2O8XA 3HSRA 1G6NA 1J59A 2ZNZA 1G3WA 1XDSA 2FQ3A 5E17F 3JAMK 2LSOA 3GWZA 5FGMA 3FMRA 5J8CA 3T8TA 2CO5A 3GZ5A 4S04A 3GFMA 1P4AA 3E6MA 3DPLC 3QPHA 5BS6A 3HHGA 4P9FA 4UVBA 1XB4A 3GO5A 3Q5FA 5L3FA 5DCMA 4JK1X 1HW1A 1FPQA 2P5VA 1FWZA 2P5KA 1ZG3A 2K02A 4EM0B 1HW2A 2DK5A 2QBYB 2QYOA 1BBYA 2OAZA 3R6SA 5LRSA 2A6HF 1E17A 3UO2A 2F5FA 3J81K 1G3YA 1UFMA 1L0OC 5BMZA 1TW2A 4MQVA 2V9VA 3I58A 1SD5A 3CO6C 2FEZA 3IHUA 2WTEA 1IRGA 5D4RA 5LHHA 3TDZC 2RN7A 4LG0A 5FB2A 3TOBA 3BVOA 2KIMA 3FM3A 3WTVC 3LQRA 5E18F 1BC8C 2PQ8A 4LLGF 2MC3A 3BJAA 3VOEA 1ZRFA 1HKQA 3BY6A 4Z2YA 2AXLA 3UO3A 3TO7A 2ZNYA 4Q48A 1G3TA 1U8RA 4XRFA 5K5OA 2G9WA 5EEHA 1HKSA 4IXAA 5HS7A 2GZWA 4OIQF 3R60A 1PP7U 3QU3A 4OIPF 3HUGA 3NQOA 3WTXC 2PMUA 1FP2A 1YYVA 2NNYA 2OA4A 1FLIA 3F8NA 4CGZA 2OQRA 2XUBA 4I0AA 1R1TA 1LQ1A 4NB5A 1O3QA 2EFWA 3HRUA 4U0YA 4BHBA 3E5QA 3FX3A 3GLXA 3IRRA 1U5TA 5E20A 1WQ2A 2EFQA 5IT9K 1JHFA 3ZMDA 4UV8A 4CO8A 4BNCA 4K2EA 1LDJA 2JPCA 1SD6A 2DBBA 4HF2A 3FM5A 5DUKA 4EMSA 5TRDA 4MGRA 4G7HF 5D5WB 5FLXK 1ON2A 4LMYA 1HSTA 4WXCA 3I64A 1XSDA 1R1VA 2P8TA 3ZMZA 3SQNA 2VODA 1RUOA 2XASA 3IL2A 3G3ZA 4ZH4F 1O3RA 1Z91A 3WE3A 3RI4A 1LVAA 5K1YA 2CQKA 2XVCA 3RTRA 1ONVA 3W6KB 3JAMZ 4I02A 3KETA 2EA2A 2VONA 2F5CA 5E1WA 1IN6A 1OPCA 1YQAA 2O03A 3BP8A 2V79A 1JHHA 2O61A 1USTA 3RDIA 2XAGA 5BPDA 1N1CA 3I54A 2QM3A 1ON1A 2P6TA 1BJAA 2GQQA 1KQ8A 4PGGA 4A2UA 5LHIA 1RIOH 4GYIA 4TV7A 2HWVA 4LG0B 2HQRA 2AS5F 4N9HA 5E8GA 4AD9A 3IWZA 4GO1A 2L4MA 1XGMA 5J8FA 2UZKA 2Q0OA 2DQLA 3I59B 1U78A 3I4PA 2XAHA 1IAWA 1O7FA 4HV6A 3OV8A 1YIOA 3K9TA 5E1XA 1I27A 5HLIA 1F4KA 3MZHA 3LA3A 4HA8A 3REOA 3LA7A 2M30A 2DPDA 2XRNA 3TDUC 1KQ0A 4BAYA 3LA2A 4KT5C 2UXXA 4ZZDA 1XSXA 3W6JB 3RYPA 3I59A 3U1DA 4B09A 1G4DA 3H3UA 2YSRA 4R79A 2VT3A 2QUFA 4EM1A 2XHKA 3NEUA 2CW0F 2B0LA 3WG9A 1ZREA 4HW0A 3G73A 1SMTA 3BROA 2A61A 1YS7A 4YFXF 4IHTA 3WODF 1IN4A 3L7WA 2O0YA 2IA1A 2PFBA 4KMUX 3FXUA 4LLLA 4CXFA 1XMAA 3ZMSA 2NRAC 3BJOA 4RGXA 5H20A 4OU0A 3EUHA 3ABUA 1LEBA 6PAXA 1LDKB 3F8BA 3KZYA 2IT0A 3DXJF 1HSJA 5CVVA 1YO5C 1IZ1A 1J0RA 2O3FA 4EJVA 4ENNA 4Q47A 2A3SA 2V1DA 4LB6B 1YS6A 4WK8F 3IKTA 2ISYA 3CJNA 4P55A 2HKXA 3U9GA 2FE3A 1U2WA 2ESHA 2XKPA 3RKYA 4A5MA 2DU9A 5ICGA 4P96A 4MQ9F 4M9ZA 2QZ8A 1W7PD 3K1NA 4PDKA 4LLNA 2RVCA 1RUNA 5HS8A 2Z3YA 1XCBA 1WRJA 2GA2A 4GCVA 2P5LC 3D5LA 4UVAA 3IKVA 1JXSA 3ZP5A 3HRTA 3Q9SA 2XAQA 3E5UA 3GVAA 4M9XA 1I1SA 3GW2A 1EH8A 5F64A 4HAMA 4EJOA 1BOAA 3ZPLA 2O6GE 1E2XA 1YFHA 2VXZA 1UB9A 1OYIA 3K2ZA 2DI3A 1OYWA 4BQAA 1HBXG 3K0LA 5ICEA 3KFWX 1LJ9A 2A5YB 3F23A 3KLOA 4EV0A 4HX8A 3ZQ7A 4UXNA 4BXUA 3I5UA 3WTYC 1MJBA 1U6GA 4MEYF 2V1XA 2EWNA 4R1HA 3V7RA 4HZFA 2H6CA 3P9IA 4UNOA 5FD5A 3ZMTA 1W7PB 1KGSA 5LHGA 4AVPA 1DUXC 1XN7A 3Q9VA 4CICA 1J75A 3HIFA 4RB1A 4ZYHA 4LD5A 4G8XA 5CYVA 1U5TC 3QOPA 2GWRA 2CG4A 2EA4A 4M72A 3CLOA 3ZMUA 4HV5A 1Z6TA 1ZAOA 4RGSA 2ZCWA 1Y0UA 4OIRF 1BIBA 4ZYGA 1TQPA 3GFIA 2IRFG 2Y0MA 3GFJA 3JTHA 3D0SA 4HDVA 1MD0A 2EFNA 2P7VB 3HRMA 3O2PE 2IPQX 1VTNC 2NYXA 1FY7A 1T38A 2ESNA 1K7AA 5KK1A 4A0ZA 3C18A 2F5DA 1FSEA 3F72A 1PUEE 2XROA 2KJCA 4I09A 2Z99A 4M9SA 2BYVE 1KU7A 3MZYA 4UUVA 2XAJA 3KP7A 2QQ9A 1HQCA 2VOOA 5JFRA 4WXHA 3V8KA 3F8MA 2QQAA 3M7GA 3LFKA 4YFNF 1I5ZA 5LLQA 3RPQA 2M45A 2H09A 3ML6A 3M8EA 5EEGA 1WI9A 2E1NA 4DNCA 4ESJA 1OMIA 2WWYA 3KP4A 3QU6A 1IXCA 3GUDA 1SD7A 4PCQA 3TO9A 2LNBA 2EV0A 2P7CB 5KVRA 2VBZA 2WV0A 4H0EA 3M9AA 3F21A 5CVRA 1ZGAA 2JPBA 5HOOA 2R7FA 3GXOA 5ILSA 4A0XA 3K1MA 2FMYA 5ERIA 3VB2A 2ZMEB 3R0JA 3VEPA 4GGGA 2ZBKA 3B02A 5IT9Z 3T1BA 3RPUA 2FNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXD A;  1HW5 A;  1ZN2 A;  3OOP A;  4EJT A;  1KYZ A;  4RGU A;  4EGY A;  1D8J A;  2EV6 A;  3V8J A;  4BH9 A;  5IT3 A;  1P2F A;  1U5T B;  3FF5 A;  5HVQ C;  1BI2 A;  5D8K B;  5F1R A;  3J80 Z;  1ODD A;  5BOX A;  5D4S A;  2XIG A;  5AIQ A;  4CZZ A;  2NNN A;  3ZMV A;  4ENK A;  2QLZ A;  1QZY A;  2VOP A;  3ECO A;  1BI0 A;  5HLH A;  4I0B A;  3J81 Z;  3FHZ A;  2IVM A;  2VBW A;  1ZHF A;  4G7O F;  1TW3 A;  3WTT C;  1T0F A;  1GHC A;  2MH9 A;  3J80 K;  5LEJ A;  1V4R A;  2E1C A;  1ZRD A;  4M74 A;  3H3Z A;  1R00 A;  1XGS A;  3CUQ C;  1OYY A;  3ROU A;  1LDD A;  2HKO A;  4KIF A;  5AON A;  5H6Q A;  2LF8 A;  2HFH A;  4XBF A;  2M87 A;  4KDP A;  3RYR A;  4L0Z B;  3PFI A;  4GXO A;  3DKW A;  1I1G A;  1CF7 A;  2HTS A;  1HKT A;  1B6A A;  2VN2 A;  3P7N A;  1S7O A;  5LBQ A;  2JSC A;  4RS8 A;  4GYG A;  3C7J A;  2OBP A;  1XDU A;  4IPA A;  5DUI A;  3K69 A;  3S2W A;  3L2C A;  3HTS B;  1ZRC A;  5ED4 A;  3VFZ A;  3DPT A;  4OIN F;  4OMY A;  2YU3 A;  1BC7 C;  2V1U A;  1SD4 A;  2UWM A;  5E8I A;  1OR7 A;  4Q4Z F;  2C6Y A;  2ISZ A;  4ZZL A;  2Z5U A;  1K78 A;  1J7K A;  3BJ6 A;  2VBX A;  3N97 A;  2ZXJ A;  5JVT A;  2RGV A;  4ENJ A;  1YW8 A;  4IRH A;  2A69 F;  4HQE A;  4G6D A;  4KN7 X;  2A07 F;  1STZ A;  1O57 A;  2HYG D;  2DAO A;  2A6E F;  1QZZ A;  4EJW A;  1BI1 A;  3CUQ A;  1IN7 A;  3L00 A;  4RGR A;  2PMH A;  4G6Q A;  1ZYR F;  1TTY A;  2Z33 A;  2ZO4 A;  1SMY F;  3GF2 A;  4AWX B;  1XGN A;  3JW4 A;  1FX7 A;  1Z6R A;  4O5V A;  5L3B A;  3JSO A;  1Z05 A;  4L5I A;  3WTU C;  3MWM A;  1XSV A;  3QAH A;  2FBK A;  5D6E A;  4ENM A;  4WXD A;  3ABT A;  4AIJ A;  2H94 A;  2PI0 A;  1B9N A;  2FBI A;  2JZY A;  3EYY A;  3MFK A;  4FT8 A;  1G3S A;  2W84 A;  2H27 A;  4RB0 A;  4RAZ A;  1YLF A;  1TNS A;  1RNL A;  2LKP A;  5FO5 A;  3FWE A;  5JI6 A;  4Q5S F;  4ETS A;  5FFZ A;  1ZG5 A;  3DP7 A;  4KFC A;  1F5T A;  1S29 A;  2D1H A;  2FRH A;  2E7X A;  1IF1 A;  3COA C;  4CYD A;  2L54 A;  3HSF A;  3P9K A;  2COM A;  3T5X A;  2HDC A;  2GIV A;  3FMQ A;  1FBQ A;  2FU4 A;  4LK1 F;  3KCC A;  2OD5 A;  2XAF A;  2RDP A;  4AIH A;  1C0W A;  2FF4 A;  1PDN C;  1K78 B;  4LFU A;  1T2K A;  4OMZ A;  1R23 A;  4HQM A;  1J5Y A;  3IC7 A;  3L9F A;  5JHU A;  2BE5 F;  3LST A;  4L9N A;  2Y48 A;  2VT2 A;  3J7A O;  3E3V A;  4MNU A;  1V3F A;  4XSX F;  2ADU A;  4R8H A;  2K4B A;  3CUO A;  2J5O A;  1IXR C;  1S7A A;  3JTG A;  3WTS C;  2K7L A;  2FSW A;  4U0V A;  3DQV C;  5LGU A;  4Y15 A;  1FOK A;  4A0Y A;  1LNW A;  2R7D A;  2IW5 A;  4L9J A;  4HX7 A;  1GVJ A;  4EM2 A;  4WCG A;  4FX0 A;  1J2X A;  3N4M A;  2A68 F;  4LB5 A;  2ACJ A;  3GFL A;  4RAY A;  5E1Z B;  1YG2 A;  3MQ0 A;  4EGZ A;  2EB7 A;  3ZN0 A;  5ICC A;  3WGI A;  2LDU A;  1O7L A;  1IN8 A;  3FXQ A;  2NS0 A;  3E6C C;  3I0T A;  3M1E A;  1TNT A;  5D5U B;  5K5Q A;  2L4A A;  4MHG A;  1AOY A;  1FSH A;  3PQJ A;  4L5J A;  2W25 A;  4M6X A;  4U7B A;  1EV7 A;  3CDH A;  2DQR A;  3KZZ A;  1AWC A;  3WGH A;  3F6V A;  4WF2 A;  3BWG A;  2X4H A;  5LGN A;  3IRQ A;  3DEU A;  3C3W A;  2MLG A;  4FHT A;  2Z9O A;  4HLX A;  3DF8 A;  4LGW A;  2YX4 A;  2P4W A;  3SXY A;  5LEK A;  2KIU A;  5J6X A;  2GXB A;  4NQW A;  1UHW A;  1W5S A;  1LEA A;  1FZP B;  1FYL A;  1ZLJ A;  2QBY A;  5FLX Z;  1X3U A;  4YFK F;  3FMS A;  3IWF A;  1CF7 B;  2KRF A;  4ESF A;  5TJJ A;  4YIF A;  3EQL F;  4KNY A;  4I7H A;  5D8L B;  3SFZ A;  5JR3 A;  5DD4 A;  1RZ4 A;  3F3X A;  3WTW C;  1P4W A;  1R5H A;  2D1V A;  4I01 A;  2IA2 A;  3HYI A;  3QRF F;  2IP2 A;  5DDG A;  2M1B A;  4LJZ F;  3I71 A;  2HZT A;  4XLN F;  3QPT A;  2OZ6 A;  2HOE A;  1MZB A;  2K27 A;  2NAZ A;  4YG2 F;  5A2Q K;  5K5R A;  1XCV A;  1XGO A;  5F6F A;  4D0P A;  1WKM A;  3F8C A;  4ESB A;  2DO7 A;  1MJ9 A;  3ECH A;  1QPM A;  1P4X A;  4G94 A;  1CGP A;  1ULY A;  4KMF A;  4E70 A;  4IRI A;  3EYI A;  1Q1H A;  3QP6 A;  3BDD A;  2D45 A;  3K1P A;  2CGP A;  1KU9 A;  4LK0 F;  1LB2 A;  5L3D A;  1D8K A;  1F9N A;  3WGG A;  3L09 A;  4UVC A;  1IRF A;  4P5O A;  2HGC A;  4L9V A;  1FBU A;  2M8E A;  3H92 A;  1YTY A;  2LF7 A;  3TO6 A;  1KU3 A;  3O3K A;  1K6O A;  3WE2 A;  2P6S A;  3HSE A;  5CLS A;  5DYM A;  4ZYD A;  3LAP A;  5L3G A;  1BIA A;  1SFE A;  2YR2 A;  4UV9 A;  3BOQ A;  3KP5 A;  2DPU A;  3FZV A;  2QVO A;  4KA4 A;  2RQP A;  2W85 A;  3P9C A;  1MDM B;  1W4M A;  2BV6 A;  2QQB A;  3GEZ A;  4U7D A;  2W24 A;  1FYM A;  3BZ6 A;  2CSO A;  2JRT A;  3JSP A;  1KQ9 A;  3DFG A;  4PZJ A;  4KIB A;  3TOA A;  1GXQ A;  3HOS A;  2FBH A;  2X0L A;  5ILV A;  1FPO A;  1FNN A;  1KA8 A;  4Y17 A;  2DFI A;  4HYE A;  5L3C A;  4HBL A;  2EK5 A;  1D5V A;  1BM9 A;  3KE2 A;  3HOT A;  1W5T A;  4KN4 X;  2BEO A;  3RKW A;  5CJ9 A;  1K79 A;  4MTE A;  3MEX A;  4B8X A;  2L3D A;  3T0Y A;  1EH7 A;  4M71 A;  1QO0 D;  1UCR A;  1FC3 A;  4MEX F;  1JGS A;  1MJA A;  2XKO A;  3CUQ B;  4KUM A;  5DEQ A;  2GA1 A;  4OIO F;  1J9I A;  4P9U A;  4WX9 A;  1MGT A;  1P92 A;  2CYY A;  4HLY A;  2F5E A;  1SAX A;  3GYH X;  1QBJ A;  5HDG A;  2ZFW A;  2CWE A;  2HYF A;  5FFX A;  4HDU A;  5CVJ A;  4HOB A;  3KP3 A;  2PLY A;  2MH2 A;  2EFO A;  3FXR A;  1R5G A;  1BI3 A;  3SZT A;  1ZG1 A;  1T6S A;  4U0W A;  1QGP A;  3R61 A;  2K86 A;  2RNJ A;  3ZN1 A;  2DT5 A;  3M8F A;  4EQQ A;  1S3J A;  2VE8 A;  4UHT A;  2F2E A;  3ELK A;  4IHS A;  5HDK A;  3WTZ A;  3R4K A;  1MDM A;  4U88 A;  3EDP A;  2MA3 A;  1P6R A;  4RB2 C;  3KP6 A;  2IA0 A;  2L02 A;  3F6O A;  1ZGJ A;  2D2W A;  1R1U A;  4MTD A;  2Y75 A;  3CO7 C;  2PJP A;  2VC0 A;  1O3S A;  2OQG A;  2HTJ A;  3U2R A;  3VOD A;  2ZKZ A;  4I98 B;  4EJU A;  1YW7 A;  5CVI A;  5DCM B;  4ASN A;  3CTA A;  5DV5 A;  2FXA A;  4KIG A;  1KU2 A;  5D5V B;  1R58 A;  1NHA A;  1SFU A;  2BBY A;  1ZAR A;  1BN5 A;  2VE9 A;  4JQF A;  1IXS B;  1Z1D A;  2IJL A;  1IW7 F;  4ON0 A;  4OOI A;  2FNP A;  3LQQ A;  3C1D A;  5FD6 A;  2ELH A;  3GZ6 A;  5LGT A;  5HDN A;  4XLP F;  1ZLK A;  3TKY A;  1DDN A;  5HS9 A;  1H0M A;  2DLL A;  4HF0 A;  3EET A;  2RC4 A;  5BQT A;  4L18 B;  1T98 A;  2YPR A;  1WSU A;  2GAU A;  2TDX A;  1USS A;  4A5N A;  3TGN A;  1T39 A;  1B4A A;  1OKR A;  5CVU A;  1H9G A;  5ICF A;  2JTV A;  4A6E A;  4NHJ A;  2EJR A;  2HR3 A;  5HLG A;  4N9I A;  2HS5 A;  3E6B A;  4HF1 A;  3LWF A;  1IUY A;  1FYK A;  4O6J A;  1S6L A;  1L3L A;  1TQI A;  1S8N A;  2EV5 A;  4IRG A;  4XSZ F;  3ERE D;  4I2O A;  2FOK A;  5BPI A;  1RI7 A;  3B73 A;  3KEO A;  2ZME A;  4DQ2 A;  3RIR A;  1DPU A;  2PG4 A;  2EFP A;  3KLN A;  1D3Y A;  1FBS A;  4BHC A;  1A04 A;  1FP1 D;  4IVN A;  4KIC A;  2G7H A;  5D6F A;  4YII A;  4QLC U;  5AIP A;  3ISP A;  2GXG A;  4RB3 C;  1PP8 F;  1O3T A;  2CFX A;  1YW9 A;  1TQM A;  3V4G A;  3R0A A;  4O3M A;  2G7U A;  1Z9C A;  2DK8 A;  2VC1 A;  1W7P A;  3V7S A;  4L0Y B;  2QWW A;  3DV8 A;  1F1Z A;  2RKH A;  1QNT A;  2H6B A;  3TQN A;  3BPV A;  4PGH A;  5L3E A;  2W57 A;  5DCF A;  2HEO A;  1SFX A;  2STT A;  1DP7 P;  1IN5 A;  1WWX A;  4N0B A;  1H9T A;  1TBX A;  2ETH A;  3HTU A;  5D5X B;  4CHU A;  3T8R A;  3MCZ A;  2RV8 A;  4IT5 A;  5ILU A;  4AIK A;  2STW A;  1XD7 A;  3WU1 B;  2FML A;  2MD5 A;  5H6R A;  5LRR A;  1EH6 A;  3RJP A;  2Q8K A;  3I53 A;  2V6C A;  2OU2 A;  2DW4 A;  2ZJ2 A;  2E7W A;  4ZYE A;  3KP2 A;  4EVI A;  3HHH A;  1Z7U A;  4G7Z F;  4HX4 A;  3MAJ A;  3SHF A;  4S05 A;  5A2Q Z;  1QQI A;  4F7Z A;  2J5P A;  2KIF A;  2KKO A;  2JT1 A;  4BYY A;  3PQK A;  1U3E M;  2VBY A;  1UHM A;  3NRV A;  2MLK A;  3QP5 A;  4M73 A;  1ZH5 A;  2R3S A;  2KJB A;  4IJA A;  2DTR A;  1I6X A;  4A12 A;  1TLH B;  4WWC A;  3V8L A;  2M5W A;  1GXP A;  1B59 A;  3BPX A;  4CDG A;  3GX4 X;  2WC2 A;  1DPR A;  1R36 A;  2XGX A;  4FX4 A;  2UXN A;  1XMK A;  1R7J A;  1R22 A;  2FA5 A;  4L9T A;  2YX7 A;  3E5X A;  3V7C A;  2BGC A;  4QWQ A;  2PN6 A;  1FT9 A;  5DD8 A;  1JE8 A;  3E97 A;  1B9M A;  1REP C;  1B1B A;  2MBF A;  2QEN A;  3F8F A;  2PBI A;  2XV4 S;  2OZU A;  2Q2E A;  4A6D A;  3HRS A;  2L01 A;  2K4J A;  3SZP A;  3AAF A;  1MKM A;  4G9Y A;  4Y13 A;  3F22 A;  3WU0 A;  2HQN A;  3KEQ A;  3O6B B;  2PEX A;  4IF4 A;  4JBA A;  3LAJ A;  4BHP A;  4KYW A;  3E6D A;  3RKX A;  1KYW A;  3ULQ B;  4M6Y A;  2O8X A;  3HSR A;  1G6N A;  1J59 A;  2ZNZ A;  1G3W A;  1XDS A;  2FQ3 A;  5E17 F;  3JAM K;  2LSO A;  3GWZ A;  5FGM A;  3FMR A;  5J8C A;  3T8T A;  2CO5 A;  3GZ5 A;  4S04 A;  3GFM A;  1P4A A;  3E6M A;  3DPL C;  3QPH A;  5BS6 A;  3HHG A;  4P9F A;  4UVB A;  1XB4 A;  3GO5 A;  3Q5F A;  5L3F A;  5DCM A;  4JK1 X;  1HW1 A;  1FPQ A;  2P5V A;  1FWZ A;  2P5K A;  1ZG3 A;  2K02 A;  4EM0 B;  1HW2 A;  2DK5 A;  2QBY B;  2QYO A;  1BBY A;  2OAZ A;  3R6S A;  5LRS A;  2A6H F;  1E17 A;  3UO2 A;  2F5F A;  3J81 K;  1G3Y A;  1UFM A;  1L0O C;  5BMZ A;  1TW2 A;  4MQV A;  2V9V A;  3I58 A;  1SD5 A;  3CO6 C;  2FEZ A;  3IHU A;  2WTE A;  1IRG A;  5D4R A;  5LHH A;  3TDZ C;  2RN7 A;  4LG0 A;  5FB2 A;  3TOB A;  3BVO A;  2KIM A;  3FM3 A;  3WTV C;  3LQR A;  5E18 F;  1BC8 C;  2PQ8 A;  4LLG F;  2MC3 A;  3BJA A;  3VOE A;  1ZRF A;  1HKQ A;  3BY6 A;  4Z2Y A;  2AXL A;  3UO3 A;  3TO7 A;  2ZNY A;  4Q48 A;  1G3T A;  1U8R A;  4XRF A;  5K5O A;  2G9W A;  5EEH A;  1HKS A;  4IXA A;  5HS7 A;  2GZW A;  4OIQ F;  3R60 A;  1PP7 U;  3QU3 A;  4OIP F;  3HUG A;  3NQO A;  3WTX C;  2PMU A;  1FP2 A;  1YYV A;  2NNY A;  2OA4 A;  1FLI A;  3F8N A;  4CGZ A;  2OQR A;  2XUB A;  4I0A A;  1R1T A;  1LQ1 A;  4NB5 A;  1O3Q A;  2EFW A;  3HRU A;  4U0Y A;  4BHB A;  3E5Q A;  3FX3 A;  3GLX A;  3IRR A;  1U5T A;  5E20 A;  1WQ2 A;  2EFQ A;  5IT9 K;  1JHF A;  3ZMD A;  4UV8 A;  4CO8 A;  4BNC A;  4K2E A;  1LDJ A;  2JPC A;  1SD6 A;  2DBB A;  4HF2 A;  3FM5 A;  5DUK A;  4EMS A;  5TRD A;  4MGR A;  4G7H F;  5D5W B;  5FLX K;  1ON2 A;  4LMY A;  1HST A;  4WXC A;  3I64 A;  1XSD A;  1R1V A;  2P8T A;  3ZMZ A;  3SQN A;  2VOD A;  1RUO A;  2XAS A;  3IL2 A;  3G3Z A;  4ZH4 F;  1O3R A;  1Z91 A;  3WE3 A;  3RI4 A;  1LVA A;  5K1Y A;  2CQK A;  2XVC A;  3RTR A;  1ONV A;  3W6K B;  3JAM Z;  4I02 A;  3KET A;  2EA2 A;  2VON A;  2F5C A;  5E1W A;  1IN6 A;  1OPC A;  1YQA A;  2O03 A;  3BP8 A;  2V79 A;  1JHH A;  2O61 A;  1UST A;  3RDI A;  2XAG A;  5BPD A;  1N1C A;  3I54 A;  2QM3 A;  1ON1 A;  2P6T A;  1BJA A;  2GQQ A;  1KQ8 A;  4PGG A;  4A2U A;  5LHI A;  1RIO H;  4GYI A;  4TV7 A;  2HWV A;  4LG0 B;  2HQR A;  2AS5 F;  4N9H A;  5E8G A;  4AD9 A;  3IWZ A;  4GO1 A;  2L4M A;  1XGM A;  5J8F A;  2UZK A;  2Q0O A;  2DQL A;  3I59 B;  1U78 A;  3I4P A;  2XAH A;  1IAW A;  1O7F A;  4HV6 A;  3OV8 A;  1YIO A;  3K9T A;  5E1X A;  1I27 A;  5HLI A;  1F4K A;  3MZH A;  3LA3 A;  4HA8 A;  3REO A;  3LA7 A;  2M30 A;  2DPD A;  2XRN A;  3TDU C;  1KQ0 A;  4BAY A;  3LA2 A;  4KT5 C;  2UXX A;  4ZZD A;  1XSX A;  3W6J B;  3RYP A;  3I59 A;  3U1D A;  4B09 A;  1G4D A;  3H3U A;  2YSR A;  4R79 A;  2VT3 A;  2QUF A;  4EM1 A;  2XHK A;  3NEU A;  2CW0 F;  2B0L A;  3WG9 A;  1ZRE A;  4HW0 A;  3G73 A;  1SMT A;  3BRO A;  2A61 A;  1YS7 A;  4YFX F;  4IHT A;  3WOD F;  1IN4 A;  3L7W A;  2O0Y A;  2IA1 A;  2PFB A;  4KMU X;  3FXU A;  4LLL A;  4CXF A;  1XMA A;  3ZMS A;  2NRA C;  3BJO A;  4RGX A;  5H20 A;  4OU0 A;  3EUH A;  3ABU A;  1LEB A;  6PAX A;  1LDK B;  3F8B A;  3KZY A;  2IT0 A;  3DXJ F;  1HSJ A;  5CVV A;  1YO5 C;  1IZ1 A;  1J0R A;  2O3F A;  4EJV A;  4ENN A;  4Q47 A;  2A3S A;  2V1D A;  4LB6 B;  1YS6 A;  4WK8 F;  3IKT A;  2ISY A;  3CJN A;  4P55 A;  2HKX A;  3U9G A;  2FE3 A;  1U2W A;  2ESH A;  2XKP A;  3RKY A;  4A5M A;  2DU9 A;  5ICG A;  4P96 A;  4MQ9 F;  4M9Z A;  2QZ8 A;  1W7P D;  3K1N A;  4PDK A;  4LLN A;  2RVC A;  1RUN A;  5HS8 A;  2Z3Y A;  1XCB A;  1WRJ A;  2GA2 A;  4GCV A;  2P5L C;  3D5L A;  4UVA A;  3IKV A;  1JXS A;  3ZP5 A;  3HRT A;  3Q9S A;  2XAQ A;  3E5U A;  3GVA A;  4M9X A;  1I1S A;  3GW2 A;  1EH8 A;  5F64 A;  4HAM A;  4EJO A;  1BOA A;  3ZPL A;  2O6G E;  1E2X A;  1YFH A;  2VXZ A;  1UB9 A;  1OYI A;  3K2Z A;  2DI3 A;  1OYW A;  4BQA A;  1HBX G;  3K0L A;  5ICE A;  3KFW X;  1LJ9 A;  2A5Y B;  3F23 A;  3KLO A;  4EV0 A;  4HX8 A;  3ZQ7 A;  4UXN A;  4BXU A;  3I5U A;  3WTY C;  1MJB A;  1U6G A;  4MEY F;  2V1X A;  2EWN A;  4R1H A;  3V7R A;  4HZF A;  2H6C A;  3P9I A;  4UNO A;  5FD5 A;  3ZMT A;  1W7P B;  1KGS A;  5LHG A;  4AVP A;  1DUX C;  1XN7 A;  3Q9V A;  4CIC A;  1J75 A;  3HIF A;  4RB1 A;  4ZYH A;  4LD5 A;  4G8X A;  5CYV A;  1U5T C;  3QOP A;  2GWR A;  2CG4 A;  2EA4 A;  4M72 A;  3CLO A;  3ZMU A;  4HV5 A;  1Z6T A;  1ZAO A;  4RGS A;  2ZCW A;  1Y0U A;  4OIR F;  1BIB A;  4ZYG A;  1TQP A;  3GFI A;  2IRF G;  2Y0M A;  3GFJ A;  3JTH A;  3D0S A;  4HDV A;  1MD0 A;  2EFN A;  2P7V B;  3HRM A;  3O2P E;  2IPQ X;  1VTN C;  2NYX A;  1FY7 A;  1T38 A;  2ESN A;  1K7A A;  5KK1 A;  4A0Z A;  3C18 A;  2F5D A;  1FSE A;  3F72 A;  1PUE E;  2XRO A;  2KJC A;  4I09 A;  2Z99 A;  4M9S A;  2BYV E;  1KU7 A;  3MZY A;  4UUV A;  2XAJ A;  3KP7 A;  2QQ9 A;  1HQC A;  2VOO A;  5JFR A;  4WXH A;  3V8K A;  3F8M A;  2QQA A;  3M7G A;  3LFK A;  4YFN F;  1I5Z A;  5LLQ A;  3RPQ A;  2M45 A;  2H09 A;  3ML6 A;  3M8E A;  5EEG A;  1WI9 A;  2E1N A;  4DNC A;  4ESJ A;  1OMI A;  2WWY A;  3KP4 A;  3QU6 A;  1IXC A;  3GUD A;  1SD7 A;  4PCQ A;  3TO9 A;  2LNB A;  2EV0 A;  2P7C B;  5KVR A;  2VBZ A;  2WV0 A;  4H0E A;  3M9A A;  3F21 A;  5CVR A;  1ZGA A;  2JPB A;  5HOO A;  2R7F A;  3GXO A;  5ILS A;  4A0X A;  3K1M A;  2FMY A;  5ERI A;  3VB2 A;  2ZME B;  3R0J A;  3VEP A;  4GGG A;  2ZBK A;  3B02 A;  5IT9 Z;  3T1B A;  3RPU A;  2FNA A; 
#chains in the Genus database with same CATH topology
 3KD1 E;  1HXD A;  3DPU A;  1YJN I;  1YI2 I;  1HW5 A;  5LFA A;  3OL4 A;  1ZN2 A;  5J4Y A;  5EYR A;  3OOP A;  4EJT A;  3L1N A;  1KYZ A;  4PJN A;  4RGU A;  4EGY A;  3K70 D;  2EV6 A;  1D8J A;  4MIM A;  3V8J A;  2JA2 A;  4BH9 A;  5HNH A;  2DMN A;  1WH7 A;  5IT3 A;  1P2F A;  3SUO A;  1PJR A;  2V9P A;  1U5T B;  4IHY A;  3FF5 A;  1FTZ A;  4FJ9 A;  5HVQ C;  1BI2 A;  5D8K B;  5F1R A;  1HDP A;  1ODD A;  4YEJ A;  3J80 Z;  3I4N J;  4UB6 C;  5D4S A;  5BOX A;  1FXX A;  3QEP A;  3CJQ B;  2V6E A;  2XIG A;  5AIQ A;  4CZZ A;  2NNN A;  3ZMV A;  4ENK A;  2QLZ A;  1RKT A;  2OZM A;  1QZY A;  2VOP A;  3ECO A;  1BI0 A;  5HLH A;  1B72 B;  3OS0 A;  3S3M A;  4I0B A;  3EPZ A;  3J81 Z;  3FHZ A;  4ZDO A;  2IVM A;  1FS1 A;  2VBW A;  2LYC A;  1ZHF A;  2CMP A;  3G4S I;  1WJB A;  3H3V K;  5C4J J;  4G7O F;  1P22 A;  1TW3 A;  3WTT C;  1T0F A;  1VQ6 I;  2MW8 A;  1X1D A;  2JMW A;  2HXI A;  3JRH A;  3BT9 A;  1ZK8 A;  4M3D A;  1GHC A;  5EEA A;  2MH9 A;  3RQI A;  3J80 K;  5LEJ A;  1V4R A;  2EIK H;  1XMG E;  3AG1 H;  1ZR4 A;  4ADO A;  1GUU A;  2E1C A;  2B63 J;  2W7N A;  3OSF A;  3FK6 A;  1ZRD A;  4A3B J;  3WHB A;  4M74 A;  1TC3 C;  3H3Z A;  1Q9X A;  2LOO A;  1R00 A;  3MD2 A;  1WVR A;  5FRM A;  5J4V A;  2DDA A;  1XGS A;  3CUQ C;  1BA5 A;  1OYY A;  3ROU A;  1LDD A;  3L2Q A;  2R0Q C;  2WY8 Q;  3E1S A;  2WB1 A;  2HKO A;  4NUB A;  3SEZ A;  1S5L C;  2VQC A;  5IYB J;  5DTD A;  2LK2 A;  2RNG A;  2E5Z A;  4E6K G;  4KI4 A;  4KIF A;  3A03 A;  5AON A;  3ZQH A;  5H6Q A;  2LF8 A;  2HFH A;  3I9V 2;  4XBF A;  3OIO A;  3K4C A;  1H8A C;  4B08 A;  5FJ8 J;  3QNO A;  2M87 A;  1XVG E;  4NBQ A;  4KDP A;  4B4C A;  3RYR A;  1WPK A;  3PFI A;  4GXO A;  4L0Z B;  2DMT A;  1MNE A;  3DKW A;  1E3P A;  1FZI E;  1XPX A;  3L2U A;  1I1G A;  4A3F J;  1Z7L A;  3WSO A;  3JR9 A;  1V54 H;  1CF7 A;  2HTS A;  1W0U A;  1GT0 C;  1B6A A;  1HKT A;  4LIV A;  2VN2 A;  3P7N A;  1S7O A;  5LBQ A;  4DTU A;  2JSC A;  4RS8 A;  4GYG A;  3C7J A;  1Y1V J;  4CCN A;  2OBP A;  2Z2S B;  1HOM A;  3QYB A;  1MMG A;  1XDU A;  3H5N A;  4IPA A;  5DUI A;  2DCE A;  5B1A H;  3K69 A;  3E4Y A;  2TCT A;  3S2W A;  3L2C A;  3HTS B;  4RA2 A;  3JRI A;  2XRL A;  1ZRC A;  1MTY G;  2P1N B;  3ZGK A;  4GAM C;  3H0G J;  5ED4 A;  3VFZ A;  2FOW A;  3DPT A;  1JKP C;  4OIN F;  4OMY A;  2YU3 A;  1MW7 A;  2DJN A;  2MYS A;  1BC7 C;  3CD6 I;  2V1U A;  1SD4 A;  2UWM A;  4CCK A;  2QGU A;  5E8I A;  1OR7 A;  4Q4Z F;  2C6Y A;  2ISZ A;  3TP0 A;  4ZZL A;  2Z5U A;  4AKH A;  3CCL I;  1K78 A;  3N05 A;  1J7K A;  1ETX A;  3GTL J;  3BJ6 A;  2Q2E B;  2VBX A;  3N97 A;  2ZXJ A;  5F0H A;  1JTX A;  5CQE A;  5JVT A;  4FTH A;  4FK0 A;  3BTJ A;  1V55 H;  2RGV A;  4ENJ A;  1YW8 A;  1N78 A;  4IRH A;  1UG0 A;  3C6P B;  3SPZ A;  2R7S A;  2A69 F;  4HQE A;  3RMD A;  4G6D A;  2O8K A;  3H5A A;  2PMZ A;  3W2A A;  2M2E A;  4XON A;  3KYD B;  4KN7 X;  1VQ9 I;  4XRM A;  2A07 F;  1JJ6 C;  2E60 A;  1STZ A;  1O57 A;  2HYG D;  4GRI A;  3J7Y J;  2DAO A;  2A6E F;  5M3M J;  4DTR A;  3TAG A;  1QZZ A;  4EJW A;  1BI1 A;  3CUQ A;  2BW3 A;  1IN7 A;  3HPH A;  1WGX A;  2M0M A;  3L00 A;  1BR2 A;  4RGR A;  2IEK A;  4JX4 A;  2PMH A;  4BKX A;  4G6Q A;  1ZYR F;  1TTY A;  3G1O A;  2Z33 A;  3RMB A;  2ZO4 A;  1HC8 A;  4E4H A;  1SMY F;  5M5X J;  1B8I A;  3GF2 A;  4AWX B;  3HOZ J;  2R5Z B;  3S8P A;  1XGN A;  3JW4 A;  1FX7 A;  2X1D A;  3GTP J;  1Z6R A;  1S72 I;  4O5V A;  4FJH A;  2N8G A;  1TWH J;  3HB9 A;  2XF5 A;  5L3B A;  3JSO A;  5CPR B;  2GOX B;  1Z05 A;  2V1N A;  4L5I A;  3WTU C;  4E7L A;  4JYK A;  2R7O A;  2XF6 A;  2Y69 H;  3ESW B;  2GBY A;  3MWM A;  4Y52 J;  5C4X J;  2CV2 A;  1XSV A;  2OCC H;  3QAH A;  2FBK A;  4IQ4 A;  5D6E A;  4ENM A;  4WXD A;  3ABT A;  4AIJ A;  2E1M C;  2ID3 A;  2H94 A;  3BR3 A;  2PI0 A;  3MKS B;  5EZG A;  1B9N A;  2FBI A;  2JZY A;  3EYY A;  3MFK A;  1TP4 A;  1OCP A;  4FT8 A;  2DOE A;  1X3Z B;  1G3S A;  2W84 A;  2H27 A;  1PUF A;  3PUF A;  4RB0 A;  1TT0 A;  4AKI A;  1YIT I;  4CYC B;  3PIO F;  4RAZ A;  3NCI A;  4W97 A;  1YLF A;  1TNS A;  3CMY A;  1RNL A;  2E71 A;  4E7H A;  2LKP A;  4BAC A;  5FLV A;  3NWS A;  3IP4 B;  4BE2 A;  5FO5 A;  1EKE A;  3FWE A;  2OCE A;  2VKV A;  3S32 A;  5JI6 A;  4Q5S F;  4ETS A;  2PX9 A;  1FYZ E;  5FFZ A;  1ZG5 A;  2E2H J;  3DP7 A;  2W4S A;  3C6N B;  4KFC A;  1F5T A;  1S29 A;  2D1H A;  1WJF A;  2FRH A;  3OYH A;  2CU7 A;  2E7X A;  5K7H A;  1IF1 A;  1FOX A;  4DTM A;  2DJI A;  1BJZ A;  1NH3 A;  1WAJ A;  4M3W A;  3COA C;  4FJL A;  3HGY A;  4CYD A;  1ETV A;  1VQM I;  2L54 A;  2LY1 A;  1ZKG A;  3CCJ I;  3HSF A;  3P9K A;  4M3U A;  3QYE A;  2COM A;  3T5X A;  3LSH A;  1RC9 A;  1Z77 A;  2HNH A;  3D5S C;  5IOY A;  2HDC A;  2GIV A;  3K4N A;  3MKZ A;  3FMQ A;  1FBQ A;  2R93 J;  2BXZ A;  2QQ8 A;  2FU4 A;  4LK1 F;  3ERM A;  1H88 C;  3KCC A;  1XVF E;  2ZXH A;  2OD5 A;  4A3D J;  2XAF A;  2R7U A;  3ZCO A;  2RDP A;  4AIH A;  5GAD J;  1C0W A;  2FF4 A;  1DP3 A;  3K2O A;  1T95 A;  2OV7 A;  3OYG A;  4DU3 A;  3S3O A;  1PDN C;  1K78 B;  2P81 A;  4LFU A;  1T2K A;  4FJ8 A;  4OMZ A;  1R23 A;  4HQM A;  4XN0 A;  3OSG A;  1I39 A;  1J5Y A;  3TW7 A;  4D9J A;  3IC7 A;  3L9F A;  5JHU A;  4JOM A;  5HOD A;  3RMC A;  4II3 A;  2BE5 F;  3LST A;  4L9N A;  2Y48 A;  2VT2 A;  3J7A O;  3N1E A;  3E3V A;  4MNU A;  3QYF A;  5FRO A;  1V3F A;  2LR8 A;  4XSX F;  2ADU A;  4R8H A;  4JS5 A;  4X5N A;  1MSF C;  2K4B A;  2ZJP F;  3CUO A;  2J5O A;  1IXR C;  1S7A A;  5J3L A;  5J1U A;  2JA8 J;  3JTG A;  3E4W A;  3WTS C;  3U21 A;  2A05 A;  2K7L A;  2FSW A;  1D1A A;  4U0V A;  2R7T A;  3DQV C;  5LGU A;  2CS3 A;  4Y15 A;  1VQN I;  1FOK A;  4NC7 A;  4A0Y A;  1LNW A;  2BOL A;  2R7D A;  4AVZ A;  3ASO H;  5FLM J;  2JQT A;  1JT6 A;  2IW5 A;  1FOY A;  3HZJ A;  3PNT A;  5C44 J;  3OYE A;  4D7M A;  2W1O A;  3OGM B;  4L9J A;  2E1O A;  4HX7 A;  5GAH J;  1ETY A;  3GBG A;  3QEX A;  2ME6 A;  3EUH C;  1GVJ A;  3W2V A;  2R7R A;  4PFP A;  3QEV A;  2HI3 A;  2JA6 J;  4EM2 A;  4WCG A;  3PFY A;  4FX0 A;  1AHD P;  1J2X A;  3N4M A;  3OS2 A;  2IXS A;  2A68 F;  1LFP A;  4LB5 A;  2ACJ A;  1JKR C;  1UHS A;  3GFL A;  4W1U A;  4RAY A;  3S2D J;  5E1Z B;  1WHU A;  1YG2 A;  3MQ0 A;  4JS4 A;  4EGZ A;  2EB7 A;  3ZN0 A;  5ICC A;  3WGI A;  3BQY A;  2DFH A;  2LDU A;  4Y3O A;  1O7L A;  1IN8 A;  3D5R C;  4RLF A;  1EJ9 A;  3FXQ A;  4A3J J;  5F0F A;  4FIS A;  2JUC A;  2NS0 A;  3BZK A;  4A3I J;  3E6C C;  4LG3 A;  3I0T A;  2LRE A;  3M1E A;  3CQZ J;  2VQL A;  1TNT A;  4CYC A;  5D5U B;  3JRB A;  5K5Q A;  2L4A A;  4MHG A;  1AOY A;  1FSH A;  3FXM A;  1DU0 A;  3PQJ A;  4D7N A;  4L5J A;  2JA7 J;  1J09 A;  2W25 A;  4M6X A;  1CLQ A;  4AKG A;  4U7B A;  1LPQ A;  1EV7 A;  2HZD A;  3CDH A;  4DIQ A;  2DXI A;  2DQR A;  3KZZ A;  1AWC A;  1YX5 A;  2OYQ A;  3WGH A;  3ZQL A;  1YRN A;  1XL3 C;  3F6V A;  5DM7 F;  2CJJ A;  4WF2 A;  1MNM C;  3CFP A;  3VPR A;  4FJI A;  3W6V A;  2K3F A;  3BWG A;  2X4H A;  5LGN A;  1W1W E;  4D1Q A;  3IRQ A;  3DEU A;  3C3W A;  1Z21 A;  2HD0 A;  2E31 A;  5M3F J;  2MLG A;  4FHT A;  1KZH A;  2Z9O A;  4HLX A;  3HDD A;  4XKW A;  3DF8 A;  4LGW A;  2YX4 A;  1SVL A;  2P4W A;  3PUB A;  3SXY A;  5LEK A;  4M3R A;  2KIU A;  5FKL A;  5J6X A;  3ZQI A;  4XRS A;  3LSG A;  4FAS D;  2GXB A;  3C2B A;  4NQW A;  1MMN A;  1UHW A;  1W5S A;  1LEA A;  2WA0 A;  1FZP B;  2R7Z J;  9ANT A;  1FOW A;  2F4M B;  1SVM A;  4AYB A;  2TRT A;  1FEX A;  4BU2 A;  5B1B H;  1Y39 A;  2P0W A;  1FYL A;  1XMX A;  1OCZ H;  1A35 A;  3QER A;  1ZLJ A;  1TZL A;  2QBY A;  5FLX Z;  1X3U A;  4YFK F;  3FMS A;  3IWF A;  1CF7 B;  2KRF A;  4ESF A;  4MFE A;  3HGL A;  5TJJ A;  4YIF A;  3EQL F;  4KNY A;  3QQA A;  4I7H A;  3FIW A;  2OUM A;  3SFZ A;  5D8L B;  5JR3 A;  4HEA 2;  5DD4 A;  3AG3 H;  1Y0N A;  3VYU B;  1RZ4 A;  2M0C A;  3K4M A;  5IYD J;  3F3X A;  2NS7 A;  1VQ4 I;  4JRP A;  2MG4 A;  5GAG J;  1XS9 A;  4XKB A;  1JUP A;  4Z6Y A;  3WTW C;  3CZ6 A;  1UEL B;  2P1P B;  1P4W A;  1R5H A;  2D1V A;  4I01 A;  2IA2 A;  5H37 A;  1X1A A;  3HYI A;  4FET A;  4FVM A;  1QRY A;  3DKY A;  2YS9 A;  3QRF F;  2IP2 A;  3VDX A;  4DYQ A;  5DDG A;  4A3C J;  2JWT A;  2IS2 A;  3SI6 A;  2JRM A;  2M1B A;  4LJZ F;  3FIS A;  3HOY J;  3I71 A;  1IDZ A;  4CCL A;  2HZT A;  4XLN F;  3QPT A;  2OZ6 A;  3BG9 A;  2HOE A;  2X6Y A;  2CUZ A;  1MZB A;  3CLQ A;  2K27 A;  4QND A;  2NAZ A;  3E7L A;  4YG2 F;  3PNV A;  5A2Q K;  1MMS A;  4M3Y A;  3FXJ A;  5K5R A;  1XCV A;  2LBF A;  3OYJ A;  3GTM J;  1XGO A;  5F6F A;  1ZGW A;  4D0P A;  1MH4 A;  4IHW A;  1WKM A;  3F8C A;  4ESB A;  2DFE A;  1MJ9 A;  2DO7 A;  3AL0 B;  3CES A;  5EGO B;  2E32 A;  3ECH A;  1QPM A;  3SJJ A;  1P4X A;  4G94 A;  1CGP A;  2WAF A;  1ETK A;  1NG7 A;  3P5J A;  4KHW A;  3K10 A;  1GLN A;  1ULY A;  1D0Y A;  2LG4 A;  4KMF A;  1IO2 A;  4E70 A;  4IRI A;  3EYI A;  1SEU A;  1Q1H A;  2RCU A;  3QP6 A;  3BDD A;  2D45 A;  3DBL B;  3JCU C;  3K1P A;  2CGP A;  1KU9 A;  4MFD A;  5EG0 A;  4LK0 F;  1LB2 A;  1NK2 P;  5L3D A;  1D8K A;  1F9N A;  3WGG A;  3DLA A;  3L09 A;  4UVC A;  1DQU A;  1IRF A;  1UJ8 A;  2VPL A;  4X6A J;  3BCA A;  2HGC A;  1OFC X;  4P5O A;  4YRV A;  3A01 A;  4L9V A;  1WI3 A;  1I6H J;  1FBU A;  2M8E A;  4NC6 A;  3H92 A;  1YJW I;  1IC8 A;  2DYR H;  1YTY A;  2LF7 A;  2WBM A;  2VL8 A;  2JJ7 A;  1DGW Y;  1V5F A;  4B1R A;  1ZR2 A;  2HPM A;  4IHV A;  2LF3 A;  3TO6 A;  5JLX A;  2VB6 A;  2W82 A;  3S1Q J;  1KU3 A;  3MVP A;  3IH3 A;  3O3K A;  1FIP A;  2FUG 2;  1K6O A;  2KZV A;  4M3B A;  3WE2 A;  2P6S A;  3HSE A;  1XC5 A;  2DOA A;  4LIU A;  5CLS A;  2L9S A;  3UR3 C;  5DYM A;  4QTR A;  4XLC A;  4ZYD A;  3H0D A;  3LAP A;  5IP6 A;  4PJL A;  2MMB A;  1OCO H;  1BIA A;  5L3G A;  1SFE A;  2YR2 A;  1R71 A;  4UV9 A;  3BOQ A;  3KP5 A;  4HPQ A;  2DPU A;  3FZV A;  5F1J A;  2QVO A;  3CDI A;  4KHQ A;  1YE9 A;  4XIC A;  4KA4 A;  2MGQ A;  1F36 A;  2RQP A;  2W85 A;  1V5E A;  2X6X A;  3P9C A;  1P9Q C;  1MDM B;  1W4M A;  2P1O B;  2A6T A;  2BV6 A;  3CP8 A;  4MO7 A;  1JGG A;  1F43 A;  4AC0 A;  3SUN A;  2WV1 A;  2PJR A;  3I4M J;  2QQB A;  3KEY A;  3LSM A;  3V42 A;  3F0C A;  3CFR A;  3GEZ A;  5EDN A;  4U7D A;  2ID6 A;  2W24 A;  1VQ8 I;  5LD2 C;  2KRC A;  4FE7 A;  4MLO A;  2Y9Y A;  4NC8 A;  1FYM A;  3BZ6 A;  2F48 A;  1PUF B;  1XMH E;  3ASN H;  3FXO A;  2CSO A;  2JRT A;  5F04 A;  1KQ9 A;  3JSP A;  3DFG A;  4PZJ A;  3ZQC A;  1Y8R B;  4KIB A;  2KQR A;  3TOA A;  1GXQ A;  3HOS A;  1QZE A;  2FBH A;  2X0L A;  5ILV A;  2JVG A;  1EF4 A;  3F9K A;  1FPO A;  3GLL A;  1FNN A;  3OYM A;  4PFO A;  1KA8 A;  4Y17 A;  3VYR B;  4RAG A;  1IGN A;  2DFI A;  2GOM A;  3H35 A;  4HYE A;  5BNG A;  5L3C A;  4HBL A;  2EK5 A;  1D5V A;  1BM9 A;  3KE2 A;  1RES A;  3HOT A;  4J2B A;  3G71 I;  4V19 K;  1W5T A;  4KN4 X;  2BEO A;  3OYK A;  3RKW A;  5CJ9 A;  2X9D A;  1K79 A;  3S9H A;  4OWR B;  2F4I A;  4MTE A;  3SUP A;  3MEX A;  4B8X A;  2L3D A;  1D5Y A;  3T0Y A;  5GTH C;  1UG2 A;  3DEE A;  4IX7 A;  1AA7 A;  4DGW B;  1FZ8 E;  3S1N J;  1EH7 A;  3VYT B;  4M71 A;  1T56 A;  1QO0 D;  2CUE A;  1UCR A;  1X1P A;  1FC3 A;  4MEX F;  1JGS A;  1MBJ A;  1MJA A;  1CQT A;  4RMN A;  5GPC A;  1PYV A;  2YUS A;  2XKO A;  5IP7 J;  3CUQ B;  3NDK A;  1Z67 A;  4KUM A;  5DEQ A;  2GA1 A;  3BR6 A;  4XKV A;  4OIO F;  4P9U A;  1J9I A;  2QA4 I;  3OYA A;  3CJR B;  4L5E A;  2XPU A;  4I9L A;  1M1E B;  2LD5 A;  4WX9 A;  3LDB A;  3J7A Y;  1MGT A;  3OGL B;  1X1C A;  1SFO J;  1P92 A;  1S7E A;  2CYY A;  4HLY A;  4DW6 A;  2F5E A;  1SAX A;  5FKO A;  3GYH X;  3KYL A;  2FD5 A;  1QBJ A;  5HDG A;  2ZFW A;  2CWE A;  4IZZ A;  3SVI A;  3GTG J;  2HYF A;  5FFX A;  4HDU A;  5CVJ A;  4HOB A;  1VQ5 I;  2HVR A;  2OF7 A;  1MMO G;  3B6C A;  2R92 J;  3KP3 A;  2PLY A;  4FJG A;  2MH2 A;  2EFO A;  3FXR A;  1R5G A;  2LVS A;  3CDL A;  3CC4 I;  4ZJZ A;  1BI3 A;  3ABK H;  3SZT A;  1ZG1 A;  1T6S A;  1A6I A;  4U0W A;  5EJC A;  4AU7 A;  1QGP A;  3R61 A;  3MZ8 A;  3OYL A;  3HKZ N;  4E7S A;  3PJR A;  2K86 A;  2JQ7 A;  2E34 A;  3GTK J;  2E2J J;  2RNJ A;  4EYW A;  2DMQ A;  3ZN1 A;  2DT5 A;  3DU5 A;  3M8F A;  3OYD A;  4EQQ A;  2VKD A;  1S3J A;  3X2Q H;  2K85 A;  2VE8 A;  3GME A;  4UHT A;  4BJ5 C;  2F2E A;  3SCX A;  4CCO A;  3ELK A;  4IHS A;  1IV6 A;  3FHN A;  3CCU I;  5HDK A;  2O5R A;  4ICG C;  3HUG B;  1IV8 A;  3WTZ A;  4CH7 A;  3HGK E;  3R4K A;  3CQ8 A;  2RRE A;  1MDM A;  3L8B A;  4U88 A;  2JHP A;  3EDP A;  2MA3 A;  1P6R A;  4CZC A;  5B66 C;  4RB2 C;  3KP6 A;  2PFT A;  3S15 J;  1B72 A;  2P1Q B;  2IA0 A;  1XVB E;  2HVQ A;  2L02 A;  3F6O A;  1BR1 A;  1ZGJ A;  4XOR A;  2D2W A;  3RSN A;  1N75 A;  1R1U A;  4BY7 J;  4MTD A;  2Y75 A;  4E7J A;  3CO7 C;  1MND A;  2PJP A;  2LMD A;  2E2I J;  2M8G X;  2R4G A;  2VC0 A;  3A0B C;  2OQG A;  3AFH A;  1O3S A;  3KPH A;  2HTJ A;  1D1B A;  4LOC A;  4ZYA A;  2EH3 A;  3U2R A;  3TED A;  3VOD A;  2ZKZ A;  4I98 B;  1TWF J;  4HST A;  4EJU A;  1E3H A;  1YW7 A;  4F3Q A;  4BE1 A;  1WJC A;  5CVI A;  3GTJ J;  5DCM B;  2VJI A;  4ASN A;  1TT5 B;  3CTA A;  3JRF A;  5DV5 A;  3L2O B;  1JW2 A;  2BVM A;  4HCB A;  2XGD A;  4IQJ A;  2XAU A;  1BL0 A;  2FXA A;  4KIG A;  1KU2 A;  5K7F A;  5D5V B;  4GFB A;  1LKX A;  4A3G J;  3JRG A;  1R58 A;  4DTO A;  1NHA A;  2KL4 A;  1WCM J;  2OC6 A;  1SFU A;  4E7I A;  1TWG J;  2BBY A;  2ZSH B;  1ZEL A;  1ZAR A;  1BN5 A;  3OYF A;  4G6T B;  2QKL B;  3LSP A;  2VE9 A;  1YOV B;  4JQF A;  3HOU J;  4FJ5 A;  1IXS B;  5J47 A;  3QOD A;  1Z1D A;  2IJL A;  1MMD A;  3A4C A;  2P1M B;  1IW7 F;  2Z16 A;  2ZB9 A;  1MMA A;  4ON0 A;  4OOI A;  1QHH D;  2ICW G;  3HXL A;  2FNP A;  1Z3X A;  3LQQ A;  3C1D A;  3KYC B;  2ELH A;  5FD6 A;  2HXO A;  2XF7 A;  3L2R A;  3GZ6 A;  5LGT A;  5HDN A;  2HOT A;  5IBK B;  2DY4 A;  4LIT A;  3RZO J;  3CF2 A;  4NNJ A;  4XLP F;  2DOF A;  1ZLK A;  3TKY A;  2M4K A;  1DDN A;  2AQE A;  5HS9 A;  1H0M A;  2DLL A;  4HF0 A;  4BBS J;  2E19 A;  3EET A;  2HOA A;  2RC4 A;  3CC7 I;  5BQT A;  3IAM 2;  4L18 B;  1T98 A;  4YEL A;  3A02 A;  4M3E A;  2YPR A;  4FJX A;  1WSU A;  1LE8 A;  2P5O A;  2GAU A;  1JI8 A;  2TDX A;  1USS A;  4A5N A;  3NAR A;  3TGN A;  1TL8 A;  1T39 A;  1D0Z A;  1B4A A;  1OKR A;  4AM3 A;  5CVU A;  2M9H A;  2H8R A;  1H9G A;  5ICF A;  2CFO A;  2JTV A;  4A6E A;  5E3M A;  2M7B A;  3CME I;  1P7I A;  5FKK A;  4NHJ A;  1X3W B;  2EJR A;  2HR3 A;  3SZG A;  2PFV A;  4QNC A;  3JRA A;  3CFO A;  5HLG A;  4N9I A;  1R4N B;  2HS5 A;  3E6B A;  3DCF A;  4V2G A;  3J7Z I;  1OIS A;  4HF1 A;  3LWF A;  4OAY A;  1OLT A;  4XLE A;  1A6Q A;  2CV0 A;  2BY1 A;  1FYK A;  1IUY A;  3TAE A;  4PUS A;  4BDZ A;  2O9L A;  4O6J A;  2L0K A;  1S6L A;  3S17 J;  1L3L A;  4KIS A;  1OCT C;  1TQI A;  3FK7 A;  3OS1 A;  1S8N A;  1VF9 A;  3RKQ A;  2EV5 A;  4IRG A;  3CF5 F;  1N77 A;  4QIW N;  4XSZ F;  3RQ4 A;  4AYB N;  3ERE D;  5FKM A;  2FOK A;  4I2O A;  5BPI A;  1RI7 A;  5EF6 A;  2H1K A;  3B73 A;  3KEO A;  2KDO A;  3HG9 A;  1TWA J;  1N25 A;  1U0J A;  2HDD A;  3SFI A;  3ZR8 X;  2JH8 A;  1MIJ A;  2ZME A;  4DQ2 A;  2NXN B;  3RIR A;  3K4L A;  3VSK A;  2H1L A;  2QF7 A;  2DA5 A;  2PG4 A;  1DPU A;  2EFP A;  3KLN A;  2DA4 A;  1D3Y A;  3SQ0 A;  3QWL A;  1FBS A;  2KDZ A;  4BHC A;  5DS9 A;  2Z1D A;  2R5Z A;  1A04 A;  1FP1 D;  2QCO A;  4IVN A;  4KIC A;  3W2W A;  3ZQG A;  4B44 A;  2G7H A;  1VZ0 A;  3TL8 B;  5D6F A;  4YII A;  4QLC U;  2B9S A;  2ECB A;  4QSH A;  5JVG F;  4BE0 A;  3IAS 2;  4DYC A;  3NAU A;  5AIP A;  4DBR A;  3GZN B;  3ISP A;  3LFU A;  2GXG A;  4RB3 C;  1SC7 A;  1PP8 F;  1XMF E;  1O3T A;  2CFX A;  3LDS A;  2M3A A;  1YW9 A;  1TQM A;  1G2H A;  3V4G A;  1IRZ A;  2KPM A;  3FKI J;  2AQF A;  3R0A A;  1RRJ A;  4HRI A;  3QPL A;  4JX6 A;  4II2 A;  4O3M A;  3NWT A;  2IS6 A;  3QPS A;  4BS9 A;  2G7U A;  4C2U A;  4EPH A;  1D1C A;  1U9N A;  1FZ6 E;  4DTS A;  4I9Q A;  1Z9C A;  2DK8 A;  3HL8 A;  2VC1 A;  1W7P A;  3V7S A;  4L0Y B;  2L7K A;  2QWW A;  2V26 A;  3DV8 A;  1F1Z A;  2RKH A;  2ZXI A;  1QNT A;  1IRX A;  3DU6 A;  1WFX A;  3MMY B;  1Y1W J;  2H6B A;  3HOV J;  3TQN A;  3BPV A;  2X6W A;  2H4T A;  4PGH A;  5L3E A;  1BW6 A;  3CCR I;  2VIX A;  2W57 A;  5DCF A;  2HEO A;  4FJN A;  1SFX A;  4FE4 A;  2STT A;  5GPA A;  1DP7 P;  1IN5 A;  1WWX A;  1R6R A;  5E3O A;  1VQL I;  4N0B A;  4I76 A;  1ORK A;  2HOS A;  4DZP A;  3PO3 J;  1H9T A;  1TBX A;  2ETH A;  3HTU A;  5D5X B;  5F08 A;  4CHU A;  4Y33 A;  3T8R A;  4BJ6 C;  2K40 A;  3MCZ A;  1SVO A;  3I3L A;  2RV8 A;  4IT5 A;  5ILU A;  4AIK A;  2STW A;  1XD7 A;  3WU1 B;  2OVR B;  2M4G A;  4DTJ A;  2FML A;  2ZME C;  1X4P A;  2MD5 A;  5H6R A;  3HGG A;  5TGT A;  4J19 A;  2DFF A;  2FW3 A;  4M3X A;  5LRR A;  4C9Y A;  1EH6 A;  2BY3 A;  2VQG A;  3RJP A;  1VQO I;  2UUZ A;  4M3F A;  1D0X A;  1NG6 A;  3BR2 A;  3BG6 A;  3NGI A;  2WAQ A;  2Q8K A;  3I53 A;  2WAD A;  2V6C A;  4XKC A;  3QOE A;  2OU2 A;  3BTL A;  2BHZ A;  4J2E A;  1AKH B;  4X1E A;  2DW4 A;  2ZJ2 A;  1FZ2 E;  3DWL E;  2E7W A;  4ZYE A;  3KP2 A;  2XPW A;  4EVI A;  3FBI B;  3HHH A;  1Z7U A;  4G7Z F;  4RLQ A;  3BTC A;  4XQF A;  3SPY A;  4EP9 A;  1OR7 C;  4HX4 A;  1HA8 A;  3MAJ A;  2EZH A;  5IYC J;  3SHF A;  4EEF G;  4FJJ A;  5IOZ A;  4S05 A;  2IBD A;  3MKW B;  2E36 A;  5A2Q Z;  4AID A;  1QQI A;  2OTL I;  4F7Z A;  2CQN A;  2J5P A;  2KIF A;  2KKO A;  2JT1 A;  4BYY A;  3OYN A;  3PQK A;  1U3E M;  2VBY A;  5CKT A;  1UHM A;  3NRV A;  1T8I A;  3HL2 A;  2MLK A;  3LSR A;  4B47 A;  4N4O B;  3QP5 A;  1YJ9 I;  4M73 A;  3IV5 A;  1ZH5 A;  2R3S A;  2KJB A;  4B3A A;  4IJA A;  2DTR A;  1I6X A;  1WJ5 A;  3DBR B;  4A12 A;  1TLH B;  2VUM J;  4WWC A;  3V8L A;  2M5W A;  3LZI A;  3BQZ A;  1U9O A;  3CCE I;  2OJE D;  3RZD J;  3VWB A;  1GXP A;  2X1E A;  1B59 A;  2LKS A;  3BPX A;  4CDG A;  4BEH B;  3GX4 X;  2WC2 A;  2BW3 B;  1MHZ G;  1DPR A;  2CQ7 A;  1R36 A;  3HOW J;  2BZT A;  3AL0 C;  2XGX A;  1Q9Y A;  4HG2 A;  2MD0 A;  3SJM A;  2UXN A;  1XMK A;  4FX4 A;  1R7J A;  1R22 A;  3M4O J;  2FA5 A;  1FMW A;  4L9T A;  5KNL A;  2YX7 A;  3E5X A;  3U1K A;  2LKX A;  3V7C A;  4FJK A;  2BGC A;  3Q0W A;  1IH7 A;  2YU9 J;  4QWQ A;  4HNU A;  2PN6 A;  1FT9 A;  3NHG A;  2DA1 A;  5DD8 A;  2NVY J;  1JE8 A;  4DBQ A;  3E97 A;  3BG7 A;  1B9M A;  1REP C;  1B1B A;  2MBF A;  2QEN A;  3B6A A;  3F8F A;  2PBI A;  2XV4 S;  2OZU A;  3HBL A;  1JTY A;  2Q2E A;  4XRS G;  4BJT A;  2K5C A;  4A6D A;  4BEH A;  3A0H C;  4XN3 A;  2IS4 A;  1KON A;  3HRS A;  1U8B A;  2NOG A;  2L01 A;  4BQO A;  2K4J A;  3KIO A;  3EUK L;  4C2M J;  3SZP A;  5EG0 B;  3AAF A;  2LRD A;  1VQP I;  1MKM A;  2ZSI B;  3M3Y J;  4DTP A;  4G9Y A;  4Y13 A;  1GV5 A;  3F22 A;  3WU0 A;  2HQN A;  4HCC A;  3KEQ A;  3O6B B;  2PEX A;  4IF4 A;  4JBA A;  1OCR H;  3LAJ A;  4BHP A;  4KYW A;  3TAF A;  3E6D A;  3RKX A;  1KYW A;  3A1Y A;  4M6Y A;  1T0F C;  2O8X A;  3ULQ B;  1JKO C;  2CW7 A;  5JLW A;  3HSR A;  2KP6 A;  1G6N A;  1J59 A;  2GIZ A;  2XGC A;  2QSF X;  1POG A;  2ZNZ A;  4BQN A;  1G3W A;  1XDS A;  3LZJ A;  2FQ3 A;  2AXT C;  5E17 F;  3JAM K;  2LLK A;  2LSO A;  4S0H B;  2CH0 A;  1R49 A;  4JX5 A;  3GWZ A;  3L2V A;  2B1E A;  3TMO A;  5FGM A;  1XG1 A;  3FMR A;  1R5I D;  5J8C A;  1A5J A;  3IH2 A;  3T8T A;  2CO5 A;  1FTT A;  4RM3 A;  1RPW A;  4BBR J;  2HYJ A;  5GP9 A;  3GZ5 A;  1X2M A;  1QPI A;  1ETW A;  4S04 A;  1WJA A;  3GFM A;  1MSE C;  1P4A A;  3E6M A;  3DPL C;  3QPH A;  4A69 C;  5BS6 A;  3HHG A;  4P9F A;  1RR8 C;  4H4K C;  4UVB A;  1XB4 A;  3GO5 A;  4FJ7 A;  3Q5F A;  5L3F A;  5DCM A;  4JK1 X;  1HW1 A;  2PMZ N;  1FPQ A;  2P5V A;  3G1L A;  2X48 A;  1FWZ A;  2P5K A;  3L2W A;  4J00 A;  1ZG3 A;  5F27 A;  1HLV A;  2EBI A;  1DU6 A;  4XOT A;  2K02 A;  4EM0 B;  4RG8 A;  1HW2 A;  2DK5 A;  2QYO A;  2DA7 A;  2QBY B;  1BBY A;  2OAZ A;  3R6S A;  5LRS A;  3K4K A;  2A6H F;  4E7K A;  4DYR A;  2QSH X;  4F55 A;  4XR6 A;  3G1M A;  1E17 A;  3UO2 A;  2F5F A;  3J81 K;  5J1Y A;  1G3Y A;  1BR4 A;  1UFM A;  2KLO A;  1L0O C;  3HKZ A;  5BMZ A;  3H9Q A;  3BG3 A;  1YRN B;  1TW2 A;  4MQV A;  3DTK A;  2V9V A;  4J01 A;  3I58 A;  1SD5 A;  3HEF A;  1FZ7 E;  3CO6 C;  3AG4 H;  1W36 C;  3SDG A;  3CCV I;  2FEZ A;  5FKN A;  1WAF A;  3IHU A;  2DDB A;  2WTE A;  1IRG A;  3BC8 A;  2MSY A;  5D4R A;  3WU2 C;  2AO9 A;  1ERD A;  3TJY A;  4JRQ A;  1FMV A;  2NVU B;  1I3Q J;  3RWU A;  1DGR M;  5LHH A;  3OIQ A;  3TDZ C;  2RN7 A;  4BXF A;  2QEX I;  2K9L A;  2QKM B;  3QEW A;  4LG0 A;  2KIQ A;  5FB2 A;  1XVE E;  3TOB A;  1ITY A;  3BVO A;  1IG9 A;  2KIM A;  3CCQ I;  3FM3 A;  3SQ4 A;  2JPN A;  3WTV C;  2BHY A;  3LQR A;  5E18 F;  1BC8 C;  2KHM A;  3HOX J;  2PQ8 A;  2Y9Z A;  1XTA A;  2EZI A;  4LLG F;  1Y56 A;  2X85 A;  1AKH A;  1LUJ B;  4UUT A;  2MC3 A;  3S1M J;  3BJA A;  2COB A;  3VOE A;  2W48 A;  5IY5 H;  1I3A A;  4KHN A;  1T08 B;  1ZRF A;  1HKQ A;  3S1R J;  2ZJQ F;  2E1M B;  3JRC A;  3BY6 A;  4Z2Y A;  3MKY B;  2AXL A;  3UO3 A;  1X58 A;  4KIT B;  3LMM A;  2GM4 A;  3SDB A;  3TO7 A;  2ZNY A;  2JHC A;  4Q48 A;  1X19 A;  4JP0 A;  2VLA A;  2FQ4 A;  1MBE A;  1G3T A;  1U8R A;  4M42 A;  2CQQ A;  4XRF A;  1WZ2 A;  3UNG C;  2G9W A;  5EEH A;  5K5O A;  1HKS A;  4M41 A;  1ZQ3 P;  2L9N A;  4IXA A;  4XLF A;  3LSJ A;  5JHF A;  2DTU A;  3C6O B;  4FK2 A;  1Y8Q B;  4CA0 A;  5HS7 A;  1RET A;  2GZW A;  3OOU A;  3PSF A;  3LNQ A;  4OIQ F;  3R60 A;  1B8I B;  4FJM A;  1LFB A;  1PP7 U;  3QU3 A;  1R9T J;  4OIP F;  1Z0X A;  2KFD A;  4ZC3 A;  2WAE A;  4A3M J;  2ZFU A;  5TIS C;  4E3S A;  3HUG A;  3NQO A;  1RR7 A;  3WTX C;  2E35 A;  3H1C A;  2PMU A;  2DMP A;  1FP2 A;  1YYV A;  2IAI A;  1K83 J;  3M8J A;  2NNY A;  3V7D B;  2NOJ B;  2JSP A;  2OA4 A;  2Y0S N;  1FLI A;  2WB1 N;  3F8N A;  4CGZ A;  2LH9 A;  2OQR A;  2XUB A;  4I0A A;  1JUS A;  1W5C C;  1R1T A;  1LQ1 A;  3HP9 A;  3O8H A;  4NB5 A;  1O3Q A;  2EFW A;  3HRU A;  4HSR A;  3G6E I;  4I6J B;  4BXX J;  4EAT A;  4RL5 A;  2R7X A;  4U0Y A;  4BHB A;  5E79 C;  2JN6 A;  3E0J B;  3N1B A;  5IZ7 A;  1I50 J;  1XX5 A;  2R7W A;  3E5Q A;  3OYC A;  3FX3 A;  3QEI A;  2K9M A;  3GLX A;  3IRR A;  3A2K A;  1U5T A;  5E20 A;  1WQ2 A;  2EFQ A;  1W36 D;  5IT9 K;  1JHF A;  5B5E C;  3L1P A;  3ZMD A;  2LFB A;  4UV8 A;  2ELK A;  1Q1V A;  4CO8 A;  2L9V A;  4BNC A;  3CP2 A;  4K2E A;  1A36 A;  2PJR B;  1LDJ A;  3ZQF A;  2JPC A;  2KT0 A;  1SD6 A;  2DBB A;  4HF2 A;  5F0C A;  1HCR A;  2R7V A;  4J2A A;  5KAF C;  3FM5 A;  5DUK A;  4EMS A;  2YB5 A;  2DN0 A;  5TRD A;  5DM6 F;  2VJ4 A;  1MBH A;  2DYS H;  4MGR A;  3A01 B;  4G7H F;  2JA5 J;  5D5W B;  4CUG A;  2VAS A;  1QHG A;  4DOZ A;  3PNY A;  2F5V A;  3H9J A;  5CQG A;  4Y4R A;  2DA6 A;  5FLX K;  1ON2 A;  3C95 A;  4LMY A;  1HST A;  4WXC A;  4DZJ A;  3I64 A;  3S93 A;  1GVD A;  1XSD A;  1R1V A;  4KT6 A;  5H2F C;  4XLH A;  2P8T A;  3ZMZ A;  3SQN A;  2NVX J;  3H36 A;  2VOD A;  2VJJ A;  1RUO A;  2XPV A;  2BY2 A;  5HNF A;  4XMY A;  1W0T A;  2XAS A;  4XNF A;  3ZOB A;  3IL2 A;  3OR2 C;  2E5N A;  3SEQ A;  2EIM H;  3G3Z A;  3BR1 A;  3OYB A;  4DU4 A;  3OYI A;  4ZH4 F;  1O3R A;  1Z91 A;  3KX2 A;  3WE3 A;  3RI4 A;  4M3G A;  2WY7 Q;  1LVA A;  3NAE A;  1NTC A;  1OCC H;  5K1Y A;  2CQK A;  2XVC A;  4IO9 F;  3BR5 A;  3RTR A;  3NE6 A;  1QU3 A;  5FRN A;  1ONV A;  2F6C A;  1ENH A;  3W6K B;  5IRE A;  3JAM Z;  4I02 A;  3AKZ A;  3KET A;  2EA2 A;  3W3C A;  2VON A;  2F5C A;  5E1W A;  1IN6 A;  1OPC A;  5M5W J;  2B7M A;  1YQA A;  2O03 A;  1IDY A;  3BP8 A;  2IGM A;  2V79 A;  3HM5 A;  1GV2 A;  1JHH A;  2O61 A;  2LY9 A;  1UST A;  4RM2 A;  1H89 C;  4XM3 A;  2W00 A;  3RDI A;  3GTQ J;  2XAG A;  1UMQ A;  2X6O A;  2DA3 A;  3I54 A;  2R5Y A;  2QM3 A;  5BPD A;  1UAA A;  1N1C A;  1RKW A;  1MBK A;  4ANJ A;  3CMA I;  1ON1 A;  2LBF B;  2B8I A;  2P6T A;  3UKG A;  3UIQ A;  1JKQ C;  1BJA A;  2GQQ A;  2KRH A;  1G8X A;  3BG5 A;  1KQ8 A;  4PGG A;  1TWC J;  4A2U A;  4I6Z A;  5LHI A;  1RIO H;  4B3X A;  4GYI A;  3J2P A;  4TV7 A;  2H8W A;  5B3S H;  4PJM A;  1SAU A;  2HWV A;  4DTN A;  1X2N A;  2VKE A;  4KI6 A;  4LG0 B;  1BW5 A;  2HQR A;  1XVC E;  1MBG A;  4A3K J;  2AS5 F;  4UY8 I;  3K7A J;  4N9H A;  5E8G A;  4AD9 A;  3IWZ A;  2L7Z A;  1LFU P;  1HDD C;  3OWT A;  4GO1 A;  5J1R A;  1VQK I;  4C30 A;  4C3J J;  2MC4 A;  2L4M A;  2XDV A;  1XGM A;  5J8F A;  3BLY A;  2UZK A;  2EZK A;  1K61 A;  1XVD E;  3FKJ A;  4IKF A;  2XB5 A;  2LF6 A;  2OTJ I;  2Q0O A;  2HU9 A;  4A93 J;  2DQL A;  2X1C A;  3I59 B;  1U78 A;  2MZW B;  3CJT B;  3I4P A;  2XAH A;  1ZTR A;  1IAW A;  3J27 A;  1O7F A;  3FDY A;  4FQG A;  4HV6 A;  4IOA F;  3OV8 A;  1YIO A;  2BY0 A;  3K9T A;  4AI6 A;  5E1X A;  4QPO A;  1I27 A;  1FZ4 E;  1S9H A;  2XB0 X;  5HLI A;  4A3E J;  3QES A;  1YX3 A;  1F4K A;  3DKX A;  3I56 I;  4KHS A;  3MZH A;  3LA3 A;  2DA2 A;  2FJ1 A;  3GCM A;  1K6Y A;  4HA8 A;  2HPI A;  1JJ8 C;  3K2A A;  4DU1 A;  3REO A;  3CC2 I;  4ZDP A;  3LA7 A;  3OL3 A;  2M30 A;  2Q1Z B;  1PVE A;  2DPD A;  2XRN A;  3TDU C;  1ACI A;  1KQ0 A;  2L5Q A;  2L7M P;  1ETQ A;  1P7J A;  1VI0 A;  4BAY A;  2JUG A;  3LA2 A;  2UXX A;  4KT5 C;  2M34 A;  4ZZD A;  1XSX A;  3W6J B;  4RBO A;  3PIP F;  3RYP A;  2CQX A;  4U87 A;  3I59 A;  3U1D A;  4B09 A;  5EGO A;  1EA3 A;  1G4D A;  2KZG A;  3OMY A;  2VJ5 A;  5IP9 J;  2RQQ A;  5KAI C;  3H3U A;  4IOC F;  3O8G A;  3RMA A;  2YSR A;  4R79 A;  2VT3 A;  2QUF A;  4EM1 A;  3I55 I;  2XHK A;  3NEU A;  2CW0 F;  2JHA A;  2B0L A;  3Q0U A;  1JUM A;  2BVL A;  2OVQ B;  1QVU A;  1QVT A;  2EPF A;  3WG9 A;  1ZRE A;  4HW0 A;  3G73 A;  3SUQ A;  1SMT A;  3ABL H;  4CCM A;  4BY1 J;  3BRO A;  2G0E A;  2A61 A;  2R7Q A;  3S3N A;  1XU3 E;  3S14 J;  1YS7 A;  4YFX F;  3HC7 A;  4IHT A;  5E3N A;  2I8D A;  3WOD F;  1IN4 A;  3L7W A;  2O0Y A;  2IA1 A;  3ABM H;  2IGO A;  3DTI A;  2MFZ A;  4E7Z A;  3DEW A;  4PSX A;  2PFB A;  2EIJ H;  4KMU X;  4XK4 A;  4KHY A;  1ETO A;  2Y0S A;  3FXU A;  2I10 A;  2MAB A;  3VSL A;  4BQQ A;  4LLL A;  4CXF A;  1YHQ I;  1XMA A;  3ZMS A;  3HJE A;  2NRA C;  3BJO A;  4RGX A;  5H20 A;  4YIR X;  4M6V A;  1UZC A;  2ELJ A;  4OU0 A;  1SAN A;  3EUH A;  2ME0 A;  2K5S A;  3ABU A;  3JRD A;  1LEB A;  6PAX A;  3OY9 A;  1LDK B;  2KIS A;  3MN2 A;  3F8B A;  3KZY A;  2F4O B;  4HNT A;  3LL7 A;  2IT0 A;  4J2D A;  4M3T A;  3RPU D;  3DLL F;  2FX0 A;  3BTI A;  3DXJ F;  1HSJ A;  4PJJ A;  5CVV A;  1YO5 C;  2BXY A;  2A5W A;  3BCB A;  1IZ1 A;  3HPG A;  1J0R A;  1IJW C;  2O3F A;  3LOC A;  4EJV A;  4ENN A;  3CCY A;  4Q47 A;  1A31 A;  2A3S A;  2IGK A;  2I5U A;  4IEJ A;  2DT7 B;  1T33 A;  3BR0 A;  2DMU A;  2V1D A;  3K6G A;  4LB6 B;  1YS6 A;  2K9S A;  2OPT A;  2L2O A;  1FZ0 E;  4WK8 F;  4XOP A;  2CRG A;  3TL4 X;  3IKT A;  2P5G A;  2ISY A;  3CJN A;  1YIJ I;  4P55 A;  2HKX A;  3U9G A;  3L0M A;  4ZTF A;  2FE3 A;  2Y30 A;  1U2W A;  1VFC A;  2GLO A;  2ESH A;  2K3P A;  5KHD A;  3IH4 A;  3TW6 A;  2XKP A;  3RKY A;  2CUF A;  4A5M A;  2DU9 A;  5ICG A;  4P96 A;  4ITV A;  5K7Z A;  2V4J C;  4DTX A;  4MQ9 F;  4M9Z A;  1O4X A;  1E3O C;  3PO2 J;  2QZ8 A;  1W7P D;  4N4N B;  3K1N A;  4PDK A;  5IPA A;  4LLN A;  2NVT J;  2RVC A;  1RUN A;  5HS8 A;  3S2H J;  2Z3Y A;  3FBN B;  3ZQQ A;  1XCB A;  1WRJ A;  4C3H J;  2GA2 A;  4GCV A;  4XLA A;  2P5L C;  2CUJ A;  3D5L A;  2LTP A;  4UVA A;  3IKV A;  4I99 C;  4ZTJ A;  1JXS A;  3LSK A;  1JT0 A;  3QET A;  4FK4 A;  3ZP5 A;  2DT6 A;  1VND A;  3D1N I;  4F92 B;  3CMM A;  4P1W A;  1WJE A;  3HRT A;  3Q9S A;  2XAQ A;  4QPQ A;  3E5U A;  3CCM I;  1IG7 A;  3PM1 A;  2LP0 A;  3GVA A;  4M9X A;  3ZRG A;  1I1S A;  3GW2 A;  3SYT A;  1EH8 A;  1VQ7 I;  4UB8 C;  2VXD A;  5F64 A;  4HAM A;  2AHQ A;  4PSW A;  2X51 A;  2ECC A;  3TBI A;  4EJO A;  1BOA A;  4CCJ A;  3MKL A;  3ZPL A;  2O6G E;  2ZJR F;  4X5M A;  1E2X A;  1YFH A;  2VXZ A;  3QNN A;  2EIL H;  4IHX A;  1UB9 A;  1X1B A;  3SNN A;  1OYI A;  4RDU A;  3K2Z A;  3K4B A;  2ZXW H;  2DI3 A;  3BZC A;  1OYW A;  1BOB A;  2EQR A;  4RAF A;  4ADN A;  4BQA A;  1HBX G;  3WG7 H;  2B7E A;  3K0L A;  2ZC2 A;  4BUP A;  5ICE A;  3C2G A;  1K4T A;  4RNG A;  3KFW X;  3GTO J;  1OQY A;  2IGN A;  5E3L A;  3H5R A;  1LJ9 A;  4ZDL A;  3TAB A;  2A5Y B;  3F23 A;  3DBH B;  3KLO A;  1FZ9 E;  2IS1 A;  4EV0 A;  3VYS B;  2DTZ A;  4AUX A;  2CV1 A;  4C2T A;  4HX8 A;  3ZQ7 A;  4UXN A;  4BXU A;  3C2H A;  2MW2 A;  3I5U A;  3OR1 C;  3RCO A;  3EUA A;  3OIP A;  1NEX B;  4E4B A;  4G12 A;  3WTY C;  1MJB A;  1U6G A;  2L9R A;  3KZI C;  4IL6 C;  3LSI A;  4MEY F;  2V1X A;  2XC7 A;  2V7F A;  2EWN A;  3AG2 H;  2UV1 A;  4R1H A;  3V7R A;  4HZF A;  2O7O A;  4F52 A;  2H6C A;  3P9I A;  4UNO A;  2JK3 A;  5EZH A;  5FD5 A;  3ZMT A;  1W7P B;  1KGS A;  5LHG A;  4AVP A;  3C94 A;  1DUX C;  1Z3Y A;  4A3L J;  1QA6 A;  1MH3 A;  2LC2 A;  1XN7 A;  2EIN H;  3Q9V A;  3SQ1 A;  4CIC A;  1J75 A;  2K9Q A;  2WAQ N;  4C3I J;  1FZ5 E;  3HIF A;  4RB1 A;  1WH5 A;  1GDT A;  2OVP B;  4XL9 A;  4ZYH A;  4LD5 A;  4DJA A;  4G8X A;  4M3Z A;  1SFK A;  4PK4 A;  4FCY A;  4BL0 B;  1LVK A;  3SQ2 A;  5CYV A;  2R5Y B;  2DOD A;  1U5T C;  4NDL A;  3QOP A;  4UUS B;  2RAE A;  2GWR A;  1FJL A;  2CG4 A;  2EA4 A;  2EZL A;  3CLO A;  4M72 A;  3ZMU A;  5GTI C;  4M45 A;  4HV5 A;  1R4M B;  1Z6T A;  4NQW B;  1V5G A;  1ZAO A;  4RGS A;  2V9K A;  2ZCW A;  1Y0U A;  2GXA A;  2QSG X;  4OIR F;  1BIB A;  4ZYG A;  4UUS A;  1TQP A;  3GFI A;  2IRF G;  3CCS I;  1LDK E;  3G2B A;  2Y0M