1FZ5E

Methane monooxygenase hydroxylase, form ii crystallized anaerobically from reduced enzyme
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 57
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz5E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz5E02
1FZ3E 1FZ2E 1FZ7E 1XMHE 1FZ5E 1XU3E 1XVDE 1FZ6E 1XVBE 1MMOG 1FYZE 1XVGE 1FZ8E 1FZIE 1FZ1E 1XVCE 1MHYG 1FZ9E 1MHZG 1FZHE 4GAMC 1FZ0E 1FZ4E 1MTYG 1XMGE 1XVFE 1XVEE 1XMFE 1XU5E
chains in the Genus database with same CATH superfamily
3C94A 2MW2A 1N1CA 3J2PA 3L2OB 4FK0A 1P22A 1FZ7E 1FZ5E 4M45A 2OVRB 4FJLA 4I9LA 4M3RA 4DTRA 2E31A 2FYOA 4AI6A 3V7DB 2LF3A 4FJMA 3OGKB 3HP9A 4RG8A 1FYZE 1XVGE 4B08A 3SQ0A 4FJKA 2B7MA 3OGLB 4FJGA 3SNNA 1JW2A 2OVQB 1FPOA 3UO2A 3QEXA 4FJ5A 4DTXA 3OGMB 5IREA 3QNNA 1WAJA 3WSOA 2QXFA 3QETA 3LZIA 1IG9A 1MHZG 2B8IA 4EPHA 4X5NA 4RNGA 1Q9XA 3TAGA 1FZ4E 1CLQA 4KHWA 1XMGE 1XVFE 1NEXB 3TL8B 1IH7A 4KHSA 3BVOA 1FZ3E 2OYQA 4ICGC 1XU3E 4E3SA 4FK4A 2JQTA 2VJ4A 4DTPA 1FZ6E 3LZJA 4DTMA 4M3XA 4DU1A 4EYWA 3L8BA 3SPYA 4FJHA 4QNDA 3UO3A 1LDKE 3NCIA 3MKSB 4KHQA 5IBKB 1FZ8E 2ATQA 3N1BA 4M3WA 4DTSA 2OZSA 3SQ4A 2MMBA 1XVCE 1FXXA 4JS4A 3QESA 3SI6A 2P1OB 3HGLA 4M3YA 4I9QA 3C95A 3K2OA 3KD5E 2LF6A 3NHGA 2JH8A 3SQ1A 4AKHA 5H37A 1MTYG 3SUOA 3NGIA 3CQ8A 3SUQA 4FK2A 4M3UA 2H4TA 2YB5A 5IZ7A 1FZ2E 3QEPA 1XMHE 4I6JB 3CFPA 4HCBA 2OVPB 2FW3A 3NE6A 1Q9YA 4KI6A 2JHCA 3L1NA 4KHYA 4IT5A 2K5SA 3TAEA 2PFVA 4DTNA 4FJJA 2JPNA 1WAFA 3TAFA 1FZIE 2JHAA 2OZMA 3RWUA 4J2EA 3C6PB 4M42A 4AKGA 4J2AA 4FJIA 1MHYG 4X5MA 4EP9A 1FZ9E 3SCXA 2B1EA 4HCCA 4GAMC 4M41A 1FZ0E 2PFTA 4DTJA 3LDSA 4M3ZA 4QNCA 2RKHA 3N1EA 1XMFE 4DTOA 2JHPA 3SJJA 3LDBA 3NDKA 1FS1A 1XU5E 2JH9A 4JRQA 4ADNA 3S9HA 2P1NB 2P1PB 3CFRA 3QNOA 4KI4A 4KHUA 3NAEA 1XVDE 2P1MB 3SPZA 1XVBE 2DTUA 3TJYA 4E4BA 3C6NB 3RMAA 3QEVA 4FJXA 4FJNA 2VJ5A 3SQ2A 3RMDA 1MMOG 3RMBA 2RCUA 2P5OA 4J2BA 2P1QB 3QERA 3J27A 4AKIA 3RMCA 4KHNA 2P5GA 4M3TA 3CFOA 4FVMA 3SVIA 4DTUA 1FZ1E 4FJ8A 2VIXA 4RL5A 3SUNA 3KD1E 3E4WA 3HGKE 2DEBA 4JRPA 1FZHE 4ADOA 3SUPA 3E4YA 3QEIA 3QEWA 2MZWB 4DU4A 3TABA 3UIQA 4FJ9A 4JS5A 3L0MA 3LD8A 4FJ7A 1XL3C 1XVEE 3C6OB 4DU3A 4J2DA 3HL8A 2E32A 2DY4A 2HD0A
chains in the Genus database with same CATH topology
3C94A 3J2PA 3L2OB 4FK0A 1P22A 1FZ7E 1FZ5E 4M45A 2OVRB 4FJLA 4I9LA 4M3RA 4DTRA 2E31A 2FYOA 4AI6A 3V7DB 2LF3A 4FJMA 3OGKB 3HP9A 4RG8A 1FYZE 1XVGE 4B08A 3SQ0A 4FJKA 2B7MA 3OGLB 4FJGA 3SNNA 2OVQB 4FJ5A 3QEXA 4DTXA 3OGMB 5IREA 3QNNA 1WAJA 3WSOA 2QXFA 3QETA 3LZIA 1IG9A 1MHZG 2B8IA 4EPHA 4X5NA 4RNGA 1Q9XA 3TAGA 1FZ4E 1CLQA 4KHWA 1XMGE 1XVFE 1NEXB 3TL8B 1IH7A 4KHSA 1FZ3E 2OYQA 1XU3E 4E3SA 4FK4A 2VJ4A 4DTPA 1FZ6E 3LZJA 4DTMA 4M3XA 4DU1A 4EYWA 3L8BA 3SPYA 4FJHA 4QNDA 3NCIA 1LDKE 3MKSB 4KHQA 5IBKB 1FZ8E 2ATQA 3N1BA 4M3WA 4DTSA 2OZSA 3SQ4A 2MMBA 1XVCE 1FXXA 4JS4A 3QESA 3SI6A 2P1OB 3HGLA 4M3YA 4I9QA 3C95A 3K2OA 3KD5E 2LF6A 3NHGA 2JH8A 3SQ1A 4AKHA 5H37A 1MTYG 3SUOA 3NGIA 3CQ8A 3SUQA 4FK2A 4M3UA 2H4TA 2YB5A 5IZ7A 1FZ2E 3QEPA 1XMHE 4I6JB 3CFPA 4HCBA 2OVPB 2FW3A 3NE6A 1Q9YA 4KI6A 2JHCA 3L1NA 4KHYA 3TAEA 2PFVA 4DTNA 4FJJA 2JPNA 1WAFA 3TAFA 1FZIE 2JHAA 2OZMA 3RWUA 4J2EA 3C6PB 4M42A 4AKGA 4J2AA 4FJIA 1MHYG 4X5MA 4EP9A 1FZ9E 3SCXA 2B1EA 4HCCA 4GAMC 4M41A 1FZ0E 2PFTA 4DTJA 3LDSA 4M3ZA 4QNCA 3N1EA 1XMFE 4DTOA 2JHPA 3SJJA 3LDBA 3NDKA 1FS1A 1XU5E 2JH9A 4JRQA 4ADNA 3S9HA 2P1NB 2P1PB 3CFRA 3QNOA 4KI4A 4KHUA 3NAEA 1XVDE 2P1MB 3SPZA 1XVBE 2DTUA 3TJYA 4E4BA 3C6NB 3RMAA 3QEVA 4FJXA 4FJNA 2VJ5A 3SQ2A 3RMDA 1MMOG 3RMBA 2RCUA 2P5OA 4J2BA 2P1QB 3QERA 3J27A 4AKIA 3RMCA 4KHNA 2P5GA 4M3TA 3CFOA 4FVMA 3SVIA 4DTUA 1FZ1E 4FJ8A 2VIXA 4RL5A 3SUNA 3KD1E 3E4WA 3HGKE 2DEBA 4JRPA 1FZHE 4ADOA 3SUPA 3E4YA 3QEIA 3QEWA 2MZWB 4DU4A 3TABA 3UIQA 4FJ9A 4JS5A 3L0MA 3LD8A 4FJ7A 1XL3C 1XVEE 3C6OB 4DU3A 4J2DA 3HL8A 2E32A 2DY4A 2HD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ3 E;  1FZ2 E;  1FZ7 E;  1XMH E;  1FZ5 E;  1XU3 E;  1XVD E;  1FZ6 E;  1XVB E;  1MMO G;  1FYZ E;  1XVG E;  1FZ8 E;  1FZI E;  1FZ1 E;  1XVC E;  1MHY G;  1FZ9 E;  1MHZ G;  1FZH E;  4GAM C;  1FZ0 E;  1FZ4 E;  1MTY G;  1XMG E;  1XVF E;  1XVE E;  1XMF E;  1XU5 E; 
#chains in the Genus database with same CATH topology
 3C94 A;  2MW2 A;  1N1C A;  3J2P A;  3L2O B;  4FK0 A;  1P22 A;  1FZ7 E;  1FZ5 E;  4M45 A;  2OVR B;  4FJL A;  4I9L A;  4M3R A;  4DTR A;  2E31 A;  2FYO A;  4AI6 A;  3V7D B;  2LF3 A;  4FJM A;  3OGK B;  3HP9 A;  4RG8 A;  1FYZ E;  1XVG E;  4B08 A;  3SQ0 A;  4FJK A;  2B7M A;  3OGL B;  4FJG A;  3SNN A;  1JW2 A;  2OVQ B;  1FPO A;  3UO2 A;  3QEX A;  4FJ5 A;  4DTX A;  3OGM B;  5IRE A;  3QNN A;  1WAJ A;  3WSO A;  2QXF A;  3QET A;  3LZI A;  1IG9 A;  1MHZ G;  2B8I A;  4EPH A;  4X5N A;  4RNG A;  1Q9X A;  3TAG A;  1FZ4 E;  1CLQ A;  4KHW A;  1XMG E;  1XVF E;  1NEX B;  3TL8 B;  1IH7 A;  4KHS A;  3BVO A;  1FZ3 E;  2OYQ A;  4ICG C;  1XU3 E;  4E3S A;  4FK4 A;  2JQT A;  2VJ4 A;  4DTP A;  1FZ6 E;  3LZJ A;  4DTM A;  4M3X A;  4DU1 A;  4EYW A;  3L8B A;  3SPY A;  4FJH A;  4QND A;  3UO3 A;  1LDK E;  3NCI A;  3MKS B;  4KHQ A;  5IBK B;  1FZ8 E;  2ATQ A;  3N1B A;  4M3W A;  4DTS A;  2OZS A;  3SQ4 A;  2MMB A;  1XVC E;  1FXX A;  4JS4 A;  3QES A;  3SI6 A;  2P1O B;  3HGL A;  4M3Y A;  4I9Q A;  3C95 A;  3K2O A;  3KD5 E;  2LF6 A;  3NHG A;  2JH8 A;  3SQ1 A;  4AKH A;  5H37 A;  1MTY G;  3SUO A;  3NGI A;  3CQ8 A;  3SUQ A;  4FK2 A;  4M3U A;  2H4T A;  2YB5 A;  5IZ7 A;  1FZ2 E;  3QEP A;  1XMH E;  4I6J B;  3CFP A;  4HCB A;  2OVP B;  2FW3 A;  3NE6 A;  1Q9Y A;  4KI6 A;  2JHC A;  3L1N A;  4KHY A;  4IT5 A;  2K5S A;  3TAE A;  2PFV A;  4DTN A;  4FJJ A;  2JPN A;  1WAF A;  3TAF A;  1FZI E;  2JHA A;  2OZM A;  3RWU A;  4J2E A;  3C6P B;  4M42 A;  4AKG A;  4J2A A;  4FJI A;  1MHY G;  4X5M A;  4EP9 A;  1FZ9 E;  3SCX A;  2B1E A;  4HCC A;  4GAM C;  4M41 A;  1FZ0 E;  2PFT A;  4DTJ A;  3LDS A;  4M3Z A;  4QNC A;  2RKH A;  3N1E A;  1XMF E;  4DTO A;  2JHP A;  3SJJ A;  3LDB A;  3NDK A;  1FS1 A;  1XU5 E;  2JH9 A;  4JRQ A;  4ADN A;  3S9H A;  2P1N B;  2P1P B;  3CFR A;  3QNO A;  4KI4 A;  4KHU A;  3NAE A;  1XVD E;  2P1M B;  3SPZ A;  1XVB E;  2DTU A;  3TJY A;  4E4B A;  3C6N B;  3RMA A;  3QEV A;  4FJX A;  4FJN A;  2VJ5 A;  3SQ2 A;  3RMD A;  1MMO G;  3RMB A;  2RCU A;  2P5O A;  4J2B A;  2P1Q B;  3QER A;  3J27 A;  4AKI A;  3RMC A;  4KHN A;  2P5G A;  4M3T A;  3CFO A;  4FVM A;  3SVI A;  4DTU A;  1FZ1 E;  4FJ8 A;  2VIX A;  4RL5 A;  3SUN A;  3KD1 E;  3E4W A;  3HGK E;  2DEB A;  4JRP A;  1FZH E;  4ADO A;  3SUP A;  3E4Y A;  3QEI A;  3QEW A;  2MZW B;  4DU4 A;  3TAB A;  3UIQ A;  4FJ9 A;  4JS5 A;  3L0M A;  3LD8 A;  4FJ7 A;  1XL3 C;  1XVE E;  3C6O B;  4DU3 A;  4J2D A;  3HL8 A;  2E32 A;  2DY4 A;  2HD0 A; 
#chains in the Genus database with same CATH homology
 3C94 A;  3J2P A;  3L2O B;  4FK0 A;  1P22 A;  1FZ7 E;  1FZ5 E;  4M45 A;  2OVR B;  4FJL A;  4I9L A;  4M3R A;  4DTR A;  2E31 A;  2FYO A;  4AI6 A;  3V7D B;  2LF3 A;  4FJM A;  3OGK B;  3HP9 A;  4RG8 A;  1FYZ E;  1XVG E;  4B08 A;  3SQ0 A;  4FJK A;  2B7M A;  3OGL B;  4FJG A;  3SNN A;  2OVQ B;  4FJ5 A;  3QEX A;  4DTX A;  3OGM B;  5IRE A;  3QNN A;  1WAJ A;  3WSO A;  2QXF A;  3QET A;  3LZI A;  1IG9 A;  1MHZ G;  2B8I A;  4EPH A;  4X5N A;  4RNG A;  1Q9X A;  3TAG A;  1FZ4 E;  1CLQ A;  4KHW A;  1XMG E;  1XVF E;  1NEX B;  3TL8 B;  1IH7 A;  4KHS A;  1FZ3 E;  2OYQ A;  1XU3 E;  4E3S A;  4FK4 A;  2VJ4 A;  4DTP A;  1FZ6 E;  3LZJ A;  4DTM A;  4M3X A;  4DU1 A;  4EYW A;  3L8B A;  3SPY A;  4FJH A;  4QND A;  3NCI A;  1LDK E;  3MKS B;  4KHQ A;  5IBK B;  1FZ8 E;  2ATQ A;  3N1B A;  4M3W A;  4DTS A;  2OZS A;  3SQ4 A;  2MMB A;  1XVC E;  1FXX A;  4JS4 A;  3QES A;  3SI6 A;  2P1O B;  3HGL A;  4M3Y A;  4I9Q A;  3C95 A;  3K2O A;  3KD5 E;  2LF6 A;  3NHG A;  2JH8 A;  3SQ1 A;  4AKH A;  5H37 A;  1MTY G;  3SUO A;  3NGI A;  3CQ8 A;  3SUQ A;  4FK2 A;  4M3U A;  2H4T A;  2YB5 A;  5IZ7 A;  1FZ2 E;  3QEP A;  1XMH E;  4I6J B;  3CFP A;  4HCB A;  2OVP B;  2FW3 A;  3NE6 A;  1Q9Y A;  4KI6 A;  2JHC A;  3L1N A;  4KHY A;  3TAE A;  2PFV A;  4DTN A;  4FJJ A;  2JPN A;  1WAF A;  3TAF A;  1FZI E;  2JHA A;  2OZM A;  3RWU A;  4J2E A;  3C6P B;  4M42 A;  4AKG A;  4J2A A;  4FJI A;  1MHY G;  4X5M A;  4EP9 A;  1FZ9 E;  3SCX A;  2B1E A;  4HCC A;  4GAM C;  4M41 A;  1FZ0 E;  2PFT A;  4DTJ A;  3LDS A;  4M3Z A;  4QNC A;  3N1E A;  1XMF E;  4DTO A;  2JHP A;  3SJJ A;  3LDB A;  3NDK A;  1FS1 A;  1XU5 E;  2JH9 A;  4JRQ A;  4ADN A;  3S9H A;  2P1N B;  2P1P B;  3CFR A;  3QNO A;  4KI4 A;  4KHU A;  3NAE A;  1XVD E;  2P1M B;  3SPZ A;  1XVB E;  2DTU A;  3TJY A;  4E4B A;  3C6N B;  3RMA A;  3QEV A;  4FJX A;  4FJN A;  2VJ5 A;  3SQ2 A;  3RMD A;  1MMO G;  3RMB A;  2RCU A;  2P5O A;  4J2B A;  2P1Q B;  3QER A;  3J27 A;  4AKI A;  3RMC A;  4KHN A;  2P5G A;  4M3T A;  3CFO A;  4FVM A;  3SVI A;  4DTU A;  1FZ1 E;  4FJ8 A;  2VIX A;  4RL5 A;  3SUN A;  3KD1 E;  3E4W A;  3HGK E;  2DEB A;  4JRP A;  1FZH E;  4ADO A;  3SUP A;  3E4Y A;  3QEI A;  3QEW A;  2MZW B;  4DU4 A;  3TAB A;  3UIQ A;  4FJ9 A;  4JS5 A;  3L0M A;  3LD8 A;  4FJ7 A;  1XL3 C;  1XVE E;  3C6O B;  4DU3 A;  4J2D A;  3HL8 A;  2E32 A;  2DY4 A;  2HD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...