1FZ5E

Methane monooxygenase hydroxylase, form ii crystallized anaerobically from reduced enzyme
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
total genus 57
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz5E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz5E02
1XVFE 1FZ1E 1MMOG 1XVGE 1XU5E 1XVEE 1XVDE 4GAMC 1XMFE 1XVBE 1FZ3E 1MHZG 1FZ6E 1FZ4E 1FZHE 1FZIE 1XMHE 1FYZE 1XVCE 1FZ0E 1XMGE 1FZ2E 1FZ9E 1MTYG 1XU3E 1MHYG 1FZ5E 1FZ8E 1FZ7E
chains in the Genus database with same CATH superfamily
3NAEA 3SUPA 4ICGC 4FVMA 3HGKE 3QEPA 2VJ4A 3LDBA 4ADOA 2P1NB 2VJ5A 3C6NB 4JS4A 4EP9A 3OGLB 3QERA 3QETA 1P22A 3L1NA 3SVIA 4X5MA 2JH9A 3NDKA 3SQ4A 3KD1E 4J2DA 2DY4A 4I9LA 3J2PA 3L8BA 4FJKA 1FZ0E 1LDKE 2PFVA 3RMAA 3L0MA 3QESA 3SPYA 3OGMB 3C94A 1FZ2E 4FJGA 1FZ9E 3E4YA 3QEIA 3SPZA 4M3WA 3CFPA 2OVPB 3NE6A 3SUQA 1MTYG 2OYQA 4FJ9A 4M3ZA 4I6JB 3UO3A 3S9HA 3QEWA 1IH7A 2HD0A 2JPNA 1N1CA 4IT5A 4EYWA 3SJJA 2DTUA 2B7MA 3C6PB 1XVFE 3RMCA 1MMOG 4DTJA 5IBKB 1XVEE 4DU1A 3BVOA 2JH8A 4M41A 3QEXA 3N1EA 3SUNA 2P5OA 2OZMA 4FJ7A 3V7DB 3HP9A 4GAMC 1XVBE 3SCXA 1FZ3E 3J27A 3CQ8A 4AKHA 4M3TA 3RMDA 4FJ8A 1FZ4E 1NEXB 2FW3A 1XL3C 4B08A 3TAGA 4X5NA 2OZSA 4HCBA 4FK0A 1XVCE 3C6OB 4ADNA 4KHQA 3MKSB 2E31A 2H4TA 3N1BA 3HGLA 2LF6A 3E4WA 4E3SA 4DTNA 4M42A 2FYOA 1WAFA 4AKGA 2OVQB 3CFOA 4FJNA 1FXXA 3TAEA 1IG9A 2JHAA 4QNDA 1FZ7E 1Q9YA 2P5GA 2P1PB 4FJIA 4J2BA 2B8IA 5H37A 4M45A 3LZIA 1Q9XA 4RL5A 3NHGA 2P1QB 3NCIA 4RNGA 4FJJA 4JRPA 4KI6A 4KHUA 2RKHA 1XMFE 1CLQA 4FK2A 1FZ6E 3KD5E 3RMBA 1FS1A 3SUOA 3WSOA 1FZIE 4DTOA 1XMHE 2PFTA 2JQTA 4AI6A 4FJLA 4RG8A 1XMGE 3OGKB 4M3XA 4EPHA 5IZ7A 4FJMA 3QNNA 4E4BA 3C95A 4FJXA 2MW2A 3LZJA 1XU3E 3K2OA 4DTPA 1MHYG 1JW2A 1FZ5E 3UIQA 4JRQA 3NGIA 4AKIA 3QEVA 4DTUA 4KHNA 4KI4A 4M3UA 1FZ1E 1XVGE 1XU5E 1XVDE 1FPOA 3LD8A 2ATQA 3SQ0A 4FJHA 2MZWB 3TL8B 2B1EA 4KHWA 3TABA 1MHZG 2JHCA 4JS5A 3L2OB 1WAJA 4DU3A 2P1MB 4DTSA 3LDSA 3SQ1A 1FZHE 3RWUA 2DEBA 1FYZE 4QNCA 5IREA 3CFRA 3UO2A 3TAFA 2MMBA 4J2AA 2K5SA 2OVRB 4FJ5A 3SQ2A 4KHYA 4DU4A 2VIXA 2RCUA 4DTXA 3SI6A 4KHSA 4J2EA 2LF3A 4M3YA 3SNNA 4HCCA 2QXFA 2YB5A 4DTMA 2E32A 3QNOA 4DTRA 4I9QA 2JHPA 3TJYA 1FZ8E 4M3RA 2P1OB 4FK4A 3HL8A
chains in the Genus database with same CATH topology
3NAEA 3SUPA 4FVMA 3HGKE 3QEPA 2VJ4A 3LDBA 4ADOA 2P1NB 2VJ5A 3C6NB 4JS4A 4EP9A 3OGLB 3QERA 3QETA 1P22A 3L1NA 3SVIA 4X5MA 2JH9A 3NDKA 3SQ4A 3KD1E 4J2DA 2DY4A 4I9LA 3J2PA 3L8BA 4FJKA 1FZ0E 1LDKE 2PFVA 3RMAA 3L0MA 3QESA 3SPYA 3OGMB 3C94A 1FZ2E 4FJGA 1FZ9E 3E4YA 3QEIA 3SPZA 4M3WA 3CFPA 2OVPB 3NE6A 3SUQA 1MTYG 2OYQA 4FJ9A 4M3ZA 4I6JB 3S9HA 3QEWA 1IH7A 2HD0A 2JPNA 4EYWA 2DTUA 3SJJA 2B7MA 3C6PB 1XVFE 3RMCA 1MMOG 4DTJA 5IBKB 1XVEE 4DU1A 4M41A 2JH8A 3QEXA 3SUNA 3N1EA 2OZMA 2P5OA 4FJ7A 3V7DB 3HP9A 4GAMC 1XVBE 3SCXA 1FZ3E 3J27A 3CQ8A 4AKHA 4M3TA 3RMDA 4FJ8A 1FZ4E 1NEXB 2FW3A 1XL3C 4B08A 3TAGA 4X5NA 2OZSA 4HCBA 4FK0A 1XVCE 3C6OB 4ADNA 4KHQA 3MKSB 2E31A 2H4TA 3N1BA 3HGLA 2LF6A 3E4WA 4E3SA 4DTNA 4M42A 2FYOA 1WAFA 4AKGA 2OVQB 3CFOA 4FJNA 1FXXA 3TAEA 1IG9A 2JHAA 4QNDA 1FZ7E 1Q9YA 2P5GA 2P1PB 4FJIA 4J2BA 2B8IA 5H37A 4M45A 3LZIA 1Q9XA 4RL5A 3NHGA 2P1QB 3NCIA 4RNGA 4FJJA 4JRPA 4KI6A 4KHUA 1CLQA 1XMFE 4FK2A 1FZ6E 3KD5E 3RMBA 1FS1A 3SUOA 3WSOA 1FZIE 4DTOA 1XMHE 2PFTA 4AI6A 4FJLA 4RG8A 1XMGE 3OGKB 4M3XA 4EPHA 5IZ7A 4FJMA 3QNNA 4E4BA 3C95A 4FJXA 3LZJA 1XU3E 3K2OA 4DTPA 1MHYG 1FZ5E 3UIQA 4JRQA 3NGIA 4AKIA 3QEVA 4DTUA 4KHNA 4KI4A 4M3UA 1FZ1E 1XVGE 1XU5E 1XVDE 3LD8A 4FJHA 2ATQA 3SQ0A 2MZWB 3TL8B 2B1EA 4KHWA 3TABA 1MHZG 2JHCA 4JS5A 3L2OB 1WAJA 4DU3A 2P1MB 4DTSA 3LDSA 3SQ1A 1FZHE 3RWUA 2DEBA 1FYZE 4QNCA 5IREA 3CFRA 4J2AA 3TAFA 2MMBA 2OVRB 4FJ5A 3SQ2A 4KHYA 4DU4A 2VIXA 2RCUA 4DTXA 3SI6A 4KHSA 4J2EA 2LF3A 4M3YA 3SNNA 4HCCA 2QXFA 2YB5A 4DTMA 2E32A 3QNOA 4DTRA 4I9QA 2JHPA 3TJYA 1FZ8E 4M3RA 2P1OB 4FK4A 3HL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVF E;  1FZ1 E;  1MMO G;  1XVG E;  1XU5 E;  1XVE E;  1XVD E;  4GAM C;  1XMF E;  1XVB E;  1FZ3 E;  1MHZ G;  1FZ6 E;  1FZ4 E;  1FZH E;  1FZI E;  1XMH E;  1FYZ E;  1XVC E;  1FZ0 E;  1XMG E;  1FZ2 E;  1FZ9 E;  1MTY G;  1XU3 E;  1MHY G;  1FZ5 E;  1FZ8 E;  1FZ7 E; 
#chains in the Genus database with same CATH topology
 3NAE A;  3SUP A;  4ICG C;  4FVM A;  3HGK E;  3QEP A;  2VJ4 A;  3LDB A;  4ADO A;  2P1N B;  2VJ5 A;  3C6N B;  4JS4 A;  4EP9 A;  3OGL B;  3QER A;  3QET A;  1P22 A;  3L1N A;  3SVI A;  4X5M A;  2JH9 A;  3NDK A;  3SQ4 A;  3KD1 E;  4J2D A;  2DY4 A;  4I9L A;  3J2P A;  3L8B A;  4FJK A;  1FZ0 E;  1LDK E;  2PFV A;  3RMA A;  3L0M A;  3QES A;  3SPY A;  3OGM B;  3C94 A;  1FZ2 E;  4FJG A;  1FZ9 E;  3E4Y A;  3QEI A;  3SPZ A;  4M3W A;  3CFP A;  2OVP B;  3NE6 A;  3SUQ A;  1MTY G;  2OYQ A;  4FJ9 A;  4M3Z A;  4I6J B;  3UO3 A;  3S9H A;  3QEW A;  1IH7 A;  2HD0 A;  2JPN A;  1N1C A;  4IT5 A;  4EYW A;  3SJJ A;  2DTU A;  2B7M A;  3C6P B;  1XVF E;  3RMC A;  1MMO G;  4DTJ A;  5IBK B;  1XVE E;  4DU1 A;  3BVO A;  2JH8 A;  4M41 A;  3QEX A;  3N1E A;  3SUN A;  2P5O A;  2OZM A;  4FJ7 A;  3V7D B;  3HP9 A;  4GAM C;  1XVB E;  3SCX A;  1FZ3 E;  3J27 A;  3CQ8 A;  4AKH A;  4M3T A;  3RMD A;  4FJ8 A;  1FZ4 E;  1NEX B;  2FW3 A;  1XL3 C;  4B08 A;  3TAG A;  4X5N A;  2OZS A;  4HCB A;  4FK0 A;  1XVC E;  3C6O B;  4ADN A;  4KHQ A;  3MKS B;  2E31 A;  2H4T A;  3N1B A;  3HGL A;  2LF6 A;  3E4W A;  4E3S A;  4DTN A;  4M42 A;  2FYO A;  1WAF A;  4AKG A;  2OVQ B;  3CFO A;  4FJN A;  1FXX A;  3TAE A;  1IG9 A;  2JHA A;  4QND A;  1FZ7 E;  1Q9Y A;  2P5G A;  2P1P B;  4FJI A;  4J2B A;  2B8I A;  5H37 A;  4M45 A;  3LZI A;  1Q9X A;  4RL5 A;  3NHG A;  2P1Q B;  3NCI A;  4RNG A;  4FJJ A;  4JRP A;  4KI6 A;  4KHU A;  2RKH A;  1XMF E;  1CLQ A;  4FK2 A;  1FZ6 E;  3KD5 E;  3RMB A;  1FS1 A;  3SUO A;  3WSO A;  1FZI E;  4DTO A;  1XMH E;  2PFT A;  2JQT A;  4AI6 A;  4FJL A;  4RG8 A;  1XMG E;  3OGK B;  4M3X A;  4EPH A;  5IZ7 A;  4FJM A;  3QNN A;  4E4B A;  3C95 A;  4FJX A;  2MW2 A;  3LZJ A;  1XU3 E;  3K2O A;  4DTP A;  1MHY G;  1JW2 A;  1FZ5 E;  3UIQ A;  4JRQ A;  3NGI A;  4AKI A;  3QEV A;  4DTU A;  4KHN A;  4KI4 A;  4M3U A;  1FZ1 E;  1XVG E;  1XU5 E;  1XVD E;  1FPO A;  3LD8 A;  2ATQ A;  3SQ0 A;  4FJH A;  2MZW B;  3TL8 B;  2B1E A;  4KHW A;  3TAB A;  1MHZ G;  2JHC A;  4JS5 A;  3L2O B;  1WAJ A;  4DU3 A;  2P1M B;  4DTS A;  3LDS A;  3SQ1 A;  1FZH E;  3RWU A;  2DEB A;  1FYZ E;  4QNC A;  5IRE A;  3CFR A;  3UO2 A;  3TAF A;  2MMB A;  4J2A A;  2K5S A;  2OVR B;  4FJ5 A;  3SQ2 A;  4KHY A;  4DU4 A;  2VIX A;  2RCU A;  4DTX A;  3SI6 A;  4KHS A;  4J2E A;  2LF3 A;  4M3Y A;  3SNN A;  4HCC A;  2QXF A;  2YB5 A;  4DTM A;  2E32 A;  3QNO A;  4DTR A;  4I9Q A;  2JHP A;  3TJY A;  1FZ8 E;  4M3R A;  2P1O B;  4FK4 A;  3HL8 A; 
#chains in the Genus database with same CATH homology
 3NAE A;  3SUP A;  4FVM A;  3HGK E;  3QEP A;  2VJ4 A;  3LDB A;  4ADO A;  2P1N B;  2VJ5 A;  3C6N B;  4JS4 A;  4EP9 A;  3OGL B;  3QER A;  3QET A;  1P22 A;  3L1N A;  3SVI A;  4X5M A;  2JH9 A;  3NDK A;  3SQ4 A;  3KD1 E;  4J2D A;  2DY4 A;  4I9L A;  3J2P A;  3L8B A;  4FJK A;  1FZ0 E;  1LDK E;  2PFV A;  3RMA A;  3L0M A;  3QES A;  3SPY A;  3OGM B;  3C94 A;  1FZ2 E;  4FJG A;  1FZ9 E;  3E4Y A;  3QEI A;  3SPZ A;  4M3W A;  3CFP A;  2OVP B;  3NE6 A;  3SUQ A;  1MTY G;  2OYQ A;  4FJ9 A;  4M3Z A;  4I6J B;  3S9H A;  3QEW A;  1IH7 A;  2HD0 A;  2JPN A;  4EYW A;  2DTU A;  3SJJ A;  2B7M A;  3C6P B;  1XVF E;  3RMC A;  1MMO G;  4DTJ A;  5IBK B;  1XVE E;  4DU1 A;  4M41 A;  2JH8 A;  3QEX A;  3SUN A;  3N1E A;  2OZM A;  2P5O A;  4FJ7 A;  3V7D B;  3HP9 A;  4GAM C;  1XVB E;  3SCX A;  1FZ3 E;  3J27 A;  3CQ8 A;  4AKH A;  4M3T A;  3RMD A;  4FJ8 A;  1FZ4 E;  1NEX B;  2FW3 A;  1XL3 C;  4B08 A;  3TAG A;  4X5N A;  2OZS A;  4HCB A;  4FK0 A;  1XVC E;  3C6O B;  4ADN A;  4KHQ A;  3MKS B;  2E31 A;  2H4T A;  3N1B A;  3HGL A;  2LF6 A;  3E4W A;  4E3S A;  4DTN A;  4M42 A;  2FYO A;  1WAF A;  4AKG A;  2OVQ B;  3CFO A;  4FJN A;  1FXX A;  3TAE A;  1IG9 A;  2JHA A;  4QND A;  1FZ7 E;  1Q9Y A;  2P5G A;  2P1P B;  4FJI A;  4J2B A;  2B8I A;  5H37 A;  4M45 A;  3LZI A;  1Q9X A;  4RL5 A;  3NHG A;  2P1Q B;  3NCI A;  4RNG A;  4FJJ A;  4JRP A;  4KI6 A;  4KHU A;  1CLQ A;  1XMF E;  4FK2 A;  1FZ6 E;  3KD5 E;  3RMB A;  1FS1 A;  3SUO A;  3WSO A;  1FZI E;  4DTO A;  1XMH E;  2PFT A;  4AI6 A;  4FJL A;  4RG8 A;  1XMG E;  3OGK B;  4M3X A;  4EPH A;  5IZ7 A;  4FJM A;  3QNN A;  4E4B A;  3C95 A;  4FJX A;  3LZJ A;  1XU3 E;  3K2O A;  4DTP A;  1MHY G;  1FZ5 E;  3UIQ A;  4JRQ A;  3NGI A;  4AKI A;  3QEV A;  4DTU A;  4KHN A;  4KI4 A;  4M3U A;  1FZ1 E;  1XVG E;  1XU5 E;  1XVD E;  3LD8 A;  4FJH A;  2ATQ A;  3SQ0 A;  2MZW B;  3TL8 B;  2B1E A;  4KHW A;  3TAB A;  1MHZ G;  2JHC A;  4JS5 A;  3L2O B;  1WAJ A;  4DU3 A;  2P1M B;  4DTS A;  3LDS A;  3SQ1 A;  1FZH E;  3RWU A;  2DEB A;  1FYZ E;  4QNC A;  5IRE A;  3CFR A;  4J2A A;  3TAF A;  2MMB A;  2OVR B;  4FJ5 A;  3SQ2 A;  4KHY A;  4DU4 A;  2VIX A;  2RCU A;  4DTX A;  3SI6 A;  4KHS A;  4J2E A;  2LF3 A;  4M3Y A;  3SNN A;  4HCC A;  2QXF A;  2YB5 A;  4DTM A;  2E32 A;  3QNO A;  4DTR A;  4I9Q A;  2JHP A;  3TJY A;  1FZ8 E;  4M3R A;  2P1O B;  4FK4 A;  3HL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...