1FZ5E

Methane monooxygenase hydroxylase, form ii crystallized anaerobically from reduced enzyme
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 57
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz5E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz5E02
1FZ3E 1XVGE 1XVDE 1MMOG 1XU5E 1FZ0E 1FZ8E 1XMHE 1MHYG 1XVBE 1XMGE 1FZ5E 1XVFE 1XVCE 1XVEE 4GAMC 1FYZE 1MHZG 1FZ9E 1FZ6E 1FZ4E 1FZHE 1FZ2E 1XU3E 1MTYG 1XMFE 1FZ7E 1FZ1E 1FZIE
chains in the Genus database with same CATH superfamily
4M41A 1FZ3E 4FK2A 2JHAA 1MMOG 3K2OA 3QNOA 2JQTA 4DTNA 4M3RA 4HCCA 4M3UA 2LF6A 3TAEA 1MHYG 2DEBA 1XVBE 2JH9A 3LDBA 4EP9A 4KHUA 3E4WA 3QEVA 1XVFE 2VJ5A 3TL8B 3RMCA 4HCBA 2QXFA 4E4BA 3MKSB 4GAMC 4KI6A 4FK0A 1MHZG 1FS1A 4FJ5A 4M42A 4I6JB 1FZ9E 3NDKA 4DU3A 5IREA 4I9QA 4FJXA 2DTUA 4RNGA 3UO3A 3SUPA 4FJLA 3QNNA 3N1BA 1FZIE 4ADNA 3UO2A 1XL3C 4EPHA 4ICGC 5IBKB 3KD1E 3SQ4A 4J2AA 3SUNA 2VJ4A 3TAGA 3CFOA 3LZJA 3OGLB 1Q9YA 3SCXA 3OGKB 1LDKE 4RL5A 4DU4A 3SPYA 2P5OA 4FJJA 2P1PB 2B1EA 4E3SA 4FVMA 3TJYA 3BVOA 5IZ7A 2P1QB 4DTSA 4FJ8A 1WAJA 4FJ9A 1P22A 3CFPA 4KHNA 1FZ6E 2ATQA 3C94A 3SUOA 4FJGA 4ADOA 4I9LA 2E31A 4KI4A 4M3TA 4DTUA 2PFVA 3J27A 2OYQA 1FZ7E 3CFRA 3LZIA 2OVQB 1NEXB 2P1MB 4KHSA 4JRPA 3OGMB 1FXXA 1XVGE 4M45A 3SQ1A 1XVDE 3J2PA 5H37A 3NCIA 2OZSA 2H4TA 3KD5E 1FPOA 4DU1A 3SI6A 3SPZA 3E4YA 4DTRA 1FZ8E 3NGIA 1XMHE 2E32A 2B8IA 3L0MA 4AKHA 3NHGA 3QEWA 3HGLA 2FW3A 4KHWA 1XMGE 2JH8A 3QERA 3LDSA 1XVCE 2LF3A 2K5SA 1XVEE 4M3WA 3HP9A 3NE6A 3HL8A 4FJMA 3LD8A 4DTOA 3QESA 1N1CA 1FYZE 2OVPB 1WAFA 3V7DB 2JHCA 4AKIA 3UIQA 3NAEA 3S9HA 3QEXA 4FJNA 3SJJA 3L1NA 4IT5A 1XMFE 4J2BA 4B08A 4QNCA 4J2DA 4KHQA 2JPNA 2OVRB 3L8BA 1FZ1E 1IG9A 2DY4A 2RCUA 4AI6A 2OZMA 2P5GA 4KHYA 1XU5E 4QNDA 4X5NA 4JS5A 4M3XA 1FZ0E 2B7MA 2MW2A 3SUQA 1JW2A 3TABA 1IH7A 4M3YA 3SNNA 2VIXA 3C6NB 3L2OB 3QETA 4J2EA 4FJKA 4AKGA 1FZ5E 4FK4A 3N1EA 3C6PB 4EYWA 2RKHA 3C6OB 2PFTA 3SVIA 2FYOA 4FJHA 1CLQA 3RWUA 4DTPA 2JHPA 4X5MA 2P1NB 3SQ0A 2HD0A 2MMBA 4RG8A 3HGKE 1FZ4E 4DTMA 1FZHE 1FZ2E 3CQ8A 1XU3E 4DTJA 2P1OB 3QEIA 1MTYG 3QEPA 2YB5A 1Q9XA 4M3ZA 3RMBA 4JRQA 3SQ2A 3TAFA 2MZWB 3C95A 3WSOA 3RMAA 3RMDA 4DTXA 4FJ7A 4FJIA 4JS4A
chains in the Genus database with same CATH topology
4M41A 1FZ3E 4FK2A 2JHAA 1MMOG 3K2OA 3QNOA 4DTNA 4M3UA 4M3RA 4HCCA 2LF6A 3TAEA 1MHYG 2DEBA 1XVBE 2JH9A 3LDBA 4EP9A 4KHUA 3E4WA 3QEVA 1XVFE 2VJ5A 3TL8B 3RMCA 4HCBA 2QXFA 4E4BA 3MKSB 4GAMC 4KI6A 4FK0A 1MHZG 1FS1A 4FJ5A 4M42A 4I6JB 1FZ9E 3NDKA 4DU3A 5IREA 4I9QA 4FJXA 2DTUA 4RNGA 3SUPA 4FJLA 3QNNA 3N1BA 1FZIE 4ADNA 4EPHA 1XL3C 5IBKB 3KD1E 3SQ4A 4J2AA 3SUNA 2VJ4A 3TAGA 3CFOA 3LZJA 3OGLB 1Q9YA 3SCXA 3OGKB 1LDKE 4RL5A 4DU4A 3SPYA 2P5OA 4FJJA 2P1PB 2B1EA 4E3SA 4FVMA 3TJYA 5IZ7A 2P1QB 4DTSA 4FJ8A 1WAJA 4FJ9A 1P22A 3CFPA 4KHNA 1FZ6E 2ATQA 3C94A 3SUOA 4FJGA 4ADOA 4I9LA 2E31A 4KI4A 4M3TA 4DTUA 2PFVA 3J27A 2OYQA 1FZ7E 3CFRA 3LZIA 2OVQB 1NEXB 2P1MB 4KHSA 4JRPA 3OGMB 1FXXA 1XVGE 4M45A 3SQ1A 1XVDE 3J2PA 5H37A 3NCIA 2OZSA 2H4TA 3KD5E 4DU1A 3SI6A 3SPZA 3E4YA 4DTRA 1FZ8E 3NGIA 1XMHE 2E32A 2B8IA 3L0MA 4AKHA 3NHGA 3QEWA 3HGLA 2FW3A 4KHWA 1XMGE 2JH8A 3QERA 3LDSA 1XVCE 2LF3A 4M3WA 1XVEE 3HP9A 3NE6A 3HL8A 4FJMA 3LD8A 4DTOA 3QESA 1FYZE 2OVPB 1WAFA 3V7DB 2JHCA 4AKIA 3UIQA 3NAEA 3S9HA 3QEXA 4FJNA 3SJJA 3L1NA 1XMFE 4J2BA 4B08A 4QNCA 4J2DA 4KHQA 2JPNA 2OVRB 3L8BA 1FZ1E 1IG9A 2DY4A 2RCUA 4AI6A 2OZMA 2P5GA 4KHYA 1XU5E 4QNDA 4X5NA 4JS5A 4M3XA 1FZ0E 2B7MA 3SUQA 3TABA 1IH7A 4M3YA 3SNNA 2VIXA 3C6NB 3L2OB 3QETA 4J2EA 4FJKA 4AKGA 1FZ5E 4FK4A 3N1EA 3C6PB 4EYWA 3C6OB 2PFTA 3SVIA 2FYOA 4FJHA 1CLQA 3RWUA 4DTPA 2JHPA 4X5MA 2P1NB 3SQ0A 2HD0A 2MMBA 4RG8A 3HGKE 1FZ4E 4DTMA 1FZHE 1FZ2E 3CQ8A 1XU3E 4DTJA 2P1OB 3QEIA 1MTYG 3QEPA 2YB5A 1Q9XA 4M3ZA 3RMBA 4JRQA 3SQ2A 3TAFA 2MZWB 3C95A 3WSOA 3RMAA 3RMDA 4DTXA 4FJ7A 4FJIA 4JS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ3 E;  1XVG E;  1XVD E;  1MMO G;  1XU5 E;  1FZ0 E;  1FZ8 E;  1XMH E;  1MHY G;  1XVB E;  1XMG E;  1FZ5 E;  1XVF E;  1XVC E;  1XVE E;  4GAM C;  1FYZ E;  1MHZ G;  1FZ9 E;  1FZ6 E;  1FZ4 E;  1FZH E;  1FZ2 E;  1XU3 E;  1MTY G;  1XMF E;  1FZ7 E;  1FZ1 E;  1FZI E; 
#chains in the Genus database with same CATH topology
 4M41 A;  1FZ3 E;  4FK2 A;  2JHA A;  1MMO G;  3K2O A;  3QNO A;  2JQT A;  4DTN A;  4M3R A;  4HCC A;  4M3U A;  2LF6 A;  3TAE A;  1MHY G;  2DEB A;  1XVB E;  2JH9 A;  3LDB A;  4EP9 A;  4KHU A;  3E4W A;  3QEV A;  1XVF E;  2VJ5 A;  3TL8 B;  3RMC A;  4HCB A;  2QXF A;  4E4B A;  3MKS B;  4GAM C;  4KI6 A;  4FK0 A;  1MHZ G;  1FS1 A;  4FJ5 A;  4M42 A;  4I6J B;  1FZ9 E;  3NDK A;  4DU3 A;  5IRE A;  4I9Q A;  4FJX A;  2DTU A;  4RNG A;  3UO3 A;  3SUP A;  4FJL A;  3QNN A;  3N1B A;  1FZI E;  4ADN A;  3UO2 A;  1XL3 C;  4EPH A;  4ICG C;  5IBK B;  3KD1 E;  3SQ4 A;  4J2A A;  3SUN A;  2VJ4 A;  3TAG A;  3CFO A;  3LZJ A;  3OGL B;  1Q9Y A;  3SCX A;  3OGK B;  1LDK E;  4RL5 A;  4DU4 A;  3SPY A;  2P5O A;  4FJJ A;  2P1P B;  2B1E A;  4E3S A;  4FVM A;  3TJY A;  3BVO A;  5IZ7 A;  2P1Q B;  4DTS A;  4FJ8 A;  1WAJ A;  4FJ9 A;  1P22 A;  3CFP A;  4KHN A;  1FZ6 E;  2ATQ A;  3C94 A;  3SUO A;  4FJG A;  4ADO A;  4I9L A;  2E31 A;  4KI4 A;  4M3T A;  4DTU A;  2PFV A;  3J27 A;  2OYQ A;  1FZ7 E;  3CFR A;  3LZI A;  2OVQ B;  1NEX B;  2P1M B;  4KHS A;  4JRP A;  3OGM B;  1FXX A;  1XVG E;  4M45 A;  3SQ1 A;  1XVD E;  3J2P A;  5H37 A;  3NCI A;  2OZS A;  2H4T A;  3KD5 E;  1FPO A;  4DU1 A;  3SI6 A;  3SPZ A;  3E4Y A;  4DTR A;  1FZ8 E;  3NGI A;  1XMH E;  2E32 A;  2B8I A;  3L0M A;  4AKH A;  3NHG A;  3QEW A;  3HGL A;  2FW3 A;  4KHW A;  1XMG E;  2JH8 A;  3QER A;  3LDS A;  1XVC E;  2LF3 A;  2K5S A;  1XVE E;  4M3W A;  3HP9 A;  3NE6 A;  3HL8 A;  4FJM A;  3LD8 A;  4DTO A;  3QES A;  1N1C A;  1FYZ E;  2OVP B;  1WAF A;  3V7D B;  2JHC A;  4AKI A;  3UIQ A;  3NAE A;  3S9H A;  3QEX A;  4FJN A;  3SJJ A;  3L1N A;  4IT5 A;  1XMF E;  4J2B A;  4B08 A;  4QNC A;  4J2D A;  4KHQ A;  2JPN A;  2OVR B;  3L8B A;  1FZ1 E;  1IG9 A;  2DY4 A;  2RCU A;  4AI6 A;  2OZM A;  2P5G A;  4KHY A;  1XU5 E;  4QND A;  4X5N A;  4JS5 A;  4M3X A;  1FZ0 E;  2B7M A;  2MW2 A;  3SUQ A;  1JW2 A;  3TAB A;  1IH7 A;  4M3Y A;  3SNN A;  2VIX A;  3C6N B;  3L2O B;  3QET A;  4J2E A;  4FJK A;  4AKG A;  1FZ5 E;  4FK4 A;  3N1E A;  3C6P B;  4EYW A;  2RKH A;  3C6O B;  2PFT A;  3SVI A;  2FYO A;  4FJH A;  1CLQ A;  3RWU A;  4DTP A;  2JHP A;  4X5M A;  2P1N B;  3SQ0 A;  2HD0 A;  2MMB A;  4RG8 A;  3HGK E;  1FZ4 E;  4DTM A;  1FZH E;  1FZ2 E;  3CQ8 A;  1XU3 E;  4DTJ A;  2P1O B;  3QEI A;  1MTY G;  3QEP A;  2YB5 A;  1Q9X A;  4M3Z A;  3RMB A;  4JRQ A;  3SQ2 A;  3TAF A;  2MZW B;  3C95 A;  3WSO A;  3RMA A;  3RMD A;  4DTX A;  4FJ7 A;  4FJI A;  4JS4 A; 
#chains in the Genus database with same CATH homology
 4M41 A;  1FZ3 E;  4FK2 A;  2JHA A;  1MMO G;  3K2O A;  3QNO A;  4DTN A;  4M3U A;  4M3R A;  4HCC A;  2LF6 A;  3TAE A;  1MHY G;  2DEB A;  1XVB E;  2JH9 A;  3LDB A;  4EP9 A;  4KHU A;  3E4W A;  3QEV A;  1XVF E;  2VJ5 A;  3TL8 B;  3RMC A;  4HCB A;  2QXF A;  4E4B A;  3MKS B;  4GAM C;  4KI6 A;  4FK0 A;  1MHZ G;  1FS1 A;  4FJ5 A;  4M42 A;  4I6J B;  1FZ9 E;  3NDK A;  4DU3 A;  5IRE A;  4I9Q A;  4FJX A;  2DTU A;  4RNG A;  3SUP A;  4FJL A;  3QNN A;  3N1B A;  1FZI E;  4ADN A;  4EPH A;  1XL3 C;  5IBK B;  3KD1 E;  3SQ4 A;  4J2A A;  3SUN A;  2VJ4 A;  3TAG A;  3CFO A;  3LZJ A;  3OGL B;  1Q9Y A;  3SCX A;  3OGK B;  1LDK E;  4RL5 A;  4DU4 A;  3SPY A;  2P5O A;  4FJJ A;  2P1P B;  2B1E A;  4E3S A;  4FVM A;  3TJY A;  5IZ7 A;  2P1Q B;  4DTS A;  4FJ8 A;  1WAJ A;  4FJ9 A;  1P22 A;  3CFP A;  4KHN A;  1FZ6 E;  2ATQ A;  3C94 A;  3SUO A;  4FJG A;  4ADO A;  4I9L A;  2E31 A;  4KI4 A;  4M3T A;  4DTU A;  2PFV A;  3J27 A;  2OYQ A;  1FZ7 E;  3CFR A;  3LZI A;  2OVQ B;  1NEX B;  2P1M B;  4KHS A;  4JRP A;  3OGM B;  1FXX A;  1XVG E;  4M45 A;  3SQ1 A;  1XVD E;  3J2P A;  5H37 A;  3NCI A;  2OZS A;  2H4T A;  3KD5 E;  4DU1 A;  3SI6 A;  3SPZ A;  3E4Y A;  4DTR A;  1FZ8 E;  3NGI A;  1XMH E;  2E32 A;  2B8I A;  3L0M A;  4AKH A;  3NHG A;  3QEW A;  3HGL A;  2FW3 A;  4KHW A;  1XMG E;  2JH8 A;  3QER A;  3LDS A;  1XVC E;  2LF3 A;  4M3W A;  1XVE E;  3HP9 A;  3NE6 A;  3HL8 A;  4FJM A;  3LD8 A;  4DTO A;  3QES A;  1FYZ E;  2OVP B;  1WAF A;  3V7D B;  2JHC A;  4AKI A;  3UIQ A;  3NAE A;  3S9H A;  3QEX A;  4FJN A;  3SJJ A;  3L1N A;  1XMF E;  4J2B A;  4B08 A;  4QNC A;  4J2D A;  4KHQ A;  2JPN A;  2OVR B;  3L8B A;  1FZ1 E;  1IG9 A;  2DY4 A;  2RCU A;  4AI6 A;  2OZM A;  2P5G A;  4KHY A;  1XU5 E;  4QND A;  4X5N A;  4JS5 A;  4M3X A;  1FZ0 E;  2B7M A;  3SUQ A;  3TAB A;  1IH7 A;  4M3Y A;  3SNN A;  2VIX A;  3C6N B;  3L2O B;  3QET A;  4J2E A;  4FJK A;  4AKG A;  1FZ5 E;  4FK4 A;  3N1E A;  3C6P B;  4EYW A;  3C6O B;  2PFT A;  3SVI A;  2FYO A;  4FJH A;  1CLQ A;  3RWU A;  4DTP A;  2JHP A;  4X5M A;  2P1N B;  3SQ0 A;  2HD0 A;  2MMB A;  4RG8 A;  3HGK E;  1FZ4 E;  4DTM A;  1FZH E;  1FZ2 E;  3CQ8 A;  1XU3 E;  4DTJ A;  2P1O B;  3QEI A;  1MTY G;  3QEP A;  2YB5 A;  1Q9X A;  4M3Z A;  3RMB A;  4JRQ A;  3SQ2 A;  3TAF A;  2MZW B;  3C95 A;  3WSO A;  3RMA A;  3RMD A;  4DTX A;  4FJ7 A;  4FJI A;  4JS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...