4ADOA

Fusidic acid resistance protein fusb
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
209
Chain Sequence
MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic resistance
molecule keywords FAR1
publication title Structure and Function of Fusb: An Elongation Factor G-Binding Fusidic Acid Resistance Protein Active in Ribosomal Translocation and Recycling
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 71
structure length 209
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
A PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4adoA01
4ADOA 2YB5A 4ADNA 4E4BA 2MZWB
chains in the Genus database with same CATH superfamily
1FZ0E 4FJ7A 4M42A 1IH7A 3J2PA 4QNCA 3SQ2A 1FZ8E 3KD1E 2VIXA 4HCCA 3C6OB 3TL8B 1P22A 5IREA 3HGLA 1XVCE 4DTPA 1IG9A 3SVIA 4JRPA 3UO2A 3SUNA 1XVBE 2B1EA 3J27A 3LZJA 3WSOA 5IBKB 3HP9A 4DTMA 2P1PB 4EP9A 1XVEE 3L2OB 4KHNA 4M3WA 4E4BA 3OGLB 3SCXA 4JRQA 2P5OA 2DTUA 3QERA 3NGIA 2MW2A 4FVMA 1MHZG 1CLQA 3QESA 4FJGA 1MTYG 4GAMC 4IT5A 4M41A 3N1EA 1N1CA 2FYOA 2JHPA 3L1NA 2JQTA 3C6PB 2JHAA 1XL3C 4M45A 3NE6A 3QEWA 2VJ4A 3SQ4A 3RMCA 3SUOA 4M3XA 4M3ZA 1XMHE 2B7MA 3SNNA 4J2DA 2JH9A 4ADNA 3QNOA 2OVPB 2OZSA 4KHWA 4AKHA 3CQ8A 4I9LA 2LF6A 3RMBA 3NCIA 3RMAA 4KHYA 3UO3A 1WAJA 4DTSA 3SJJA 4FJHA 3HL8A 4JS5A 2DEBA 2FW3A 2OVQB 3TAGA 2RCUA 4J2EA 3LZIA 3NAEA 2OYQA 3V7DB 3NHGA 1FZ7E 3OGMB 4DU1A 1XU5E 3QNNA 1FZHE 4FJJA 2QXFA 4M3YA 4DTNA 3K2OA 4DTJA 2P5GA 3KD5E 3RWUA 3L8BA 3TAFA 2RKHA 2B8IA 2LF3A 3CFOA 1FXXA 4DTXA 4E3SA 3QEPA 4B08A 4RG8A 4I9QA 2HD0A 4ADOA 3TABA 4FK2A 4QNDA 4KI4A 3QEXA 3QEIA 4M3UA 4HCBA 3CFPA 4JS4A 3TJYA 3LDSA 4FJIA 3E4YA 2OVRB 1FYZE 1XVGE 4X5MA 4FJ8A 1FZ5E 1XMFE 3TAEA 1Q9XA 2JH8A 3HGKE 4FJ5A 4KHQA 4AI6A 1FS1A 1FZ3E 4I6JB 3C95A 4RL5A 3SUPA 3SPYA 2VJ5A 1JW2A 4FJNA 2E32A 2P1OB 4AKIA 4DTRA 3LD8A 4M3TA 1MMOG 3SUQA 3L0MA 2H4TA 4ICGC 1FPOA 3C94A 3QETA 2OZMA 4KHSA 2ATQA 1FZIE 1FZ4E 2P1MB 3SPZA 5IZ7A 2PFVA 3C6NB 4J2BA 3NDKA 1FZ6E 5H37A 1FZ1E 4EPHA 4KHUA 2MZWB 4FJ9A 3SQ1A 4FJLA 3E4WA 4M3RA 3CFRA 4EYWA 3OGKB 1Q9YA 4DTUA 4FJMA 4FJKA 1XVFE 4FJXA 2P1QB 4X5NA 2PFTA 3SQ0A 1FZ9E 2JPNA 2P1NB 3BVOA 3LDBA 4DTOA 4FK0A 4KI6A 4RNGA 2YB5A 2MMBA 2E31A 4DU3A 4AKGA 1MHYG 1NEXB 3RMDA 2JHCA 4J2AA 1XU3E 1WAFA 2K5SA 1FZ2E 1XMGE 3QEVA 3N1BA 3MKSB 2DY4A 3S9HA 1LDKE 3UIQA 4FK4A 1XVDE 4DU4A 3SI6A
chains in the Genus database with same CATH topology
1FZ0E 4FJ7A 4M42A 1IH7A 3J2PA 4QNCA 3SQ2A 1FZ8E 3KD1E 2VIXA 4HCCA 3C6OB 3TL8B 1P22A 5IREA 3HGLA 1XVCE 4DTPA 1IG9A 3SVIA 4JRPA 3SUNA 1XVBE 2B1EA 3J27A 3LZJA 3WSOA 5IBKB 3HP9A 4DTMA 2P1PB 4EP9A 1XVEE 3L2OB 4KHNA 4M3WA 4E4BA 3OGLB 3SCXA 4JRQA 2P5OA 2DTUA 3QERA 3NGIA 4FVMA 1CLQA 1MHZG 3QESA 4FJGA 1MTYG 4GAMC 4M41A 3N1EA 2FYOA 2JHPA 3L1NA 3C6PB 3RMCA 2JHAA 1XL3C 4M45A 3NE6A 3QEWA 2VJ4A 3SQ4A 3SUOA 4M3ZA 4M3XA 1XMHE 2B7MA 3SNNA 4J2DA 2JH9A 4ADNA 3QNOA 2OVPB 2OZSA 4KHWA 4AKHA 3CQ8A 4I9LA 2LF6A 3RMBA 3NCIA 3RMAA 4KHYA 1WAJA 4DTSA 3SJJA 4FJHA 3HL8A 4JS5A 2DEBA 2FW3A 2OVQB 3TAGA 2RCUA 4J2EA 3LZIA 3NAEA 2OYQA 3V7DB 3NHGA 1FZ7E 3OGMB 4DU1A 1XU5E 3QNNA 1FZHE 4FJJA 2QXFA 4M3YA 4DTNA 3K2OA 4DTJA 2P5GA 3KD5E 3RWUA 3L8BA 3TAFA 2B8IA 2LF3A 3CFOA 1FXXA 4DTXA 4E3SA 3QEPA 4B08A 4RG8A 4I9QA 2HD0A 4ADOA 3TABA 4FK2A 4QNDA 4KI4A 3QEXA 3QEIA 4M3UA 4HCBA 3CFPA 4JS4A 3TJYA 3LDSA 4FJIA 3E4YA 2OVRB 1FYZE 1XVGE 4X5MA 4FJ8A 1FZ5E 1XMFE 3TAEA 1Q9XA 2JH8A 3HGKE 4FJ5A 4KHQA 4AI6A 1FS1A 1FZ3E 4I6JB 3C95A 4RL5A 3SUPA 3SPYA 2VJ5A 4FJNA 2E32A 2P1OB 4AKIA 4DTRA 3LD8A 4M3TA 1MMOG 3SUQA 3L0MA 2H4TA 3C94A 3QETA 2OZMA 4KHSA 2ATQA 1FZIE 1FZ4E 2P1MB 3SPZA 5IZ7A 2PFVA 3C6NB 4J2BA 3NDKA 1FZ6E 5H37A 1FZ1E 4EPHA 4KHUA 2MZWB 4FJ9A 3SQ1A 4FJLA 3E4WA 4M3RA 3CFRA 4EYWA 3OGKB 1Q9YA 4DTUA 4FJMA 4FJKA 1XVFE 4FJXA 2P1QB 4X5NA 2PFTA 3SQ0A 1FZ9E 2JPNA 2P1NB 3LDBA 4DTOA 4FK0A 4KI6A 4RNGA 2YB5A 2MMBA 2E31A 4DU3A 4AKGA 1MHYG 1NEXB 3RMDA 2JHCA 4J2AA 1XU3E 1WAFA 1FZ2E 1XMGE 3QEVA 3N1BA 3MKSB 2DY4A 3S9HA 1LDKE 3UIQA 4FK4A 1XVDE 4DU4A 3SI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ADO A;  2YB5 A;  4ADN A;  4E4B A;  2MZW B; 
#chains in the Genus database with same CATH topology
 1FZ0 E;  4FJ7 A;  4M42 A;  1IH7 A;  3J2P A;  4QNC A;  3SQ2 A;  1FZ8 E;  3KD1 E;  2VIX A;  4HCC A;  3C6O B;  3TL8 B;  1P22 A;  5IRE A;  3HGL A;  1XVC E;  4DTP A;  1IG9 A;  3SVI A;  4JRP A;  3UO2 A;  3SUN A;  1XVB E;  2B1E A;  3J27 A;  3LZJ A;  3WSO A;  5IBK B;  3HP9 A;  4DTM A;  2P1P B;  4EP9 A;  1XVE E;  3L2O B;  4KHN A;  4M3W A;  4E4B A;  3OGL B;  3SCX A;  4JRQ A;  2P5O A;  2DTU A;  3QER A;  3NGI A;  2MW2 A;  4FVM A;  1MHZ G;  1CLQ A;  3QES A;  4FJG A;  1MTY G;  4GAM C;  4IT5 A;  4M41 A;  3N1E A;  1N1C A;  2FYO A;  2JHP A;  3L1N A;  2JQT A;  3C6P B;  2JHA A;  1XL3 C;  4M45 A;  3NE6 A;  3QEW A;  2VJ4 A;  3SQ4 A;  3RMC A;  3SUO A;  4M3X A;  4M3Z A;  1XMH E;  2B7M A;  3SNN A;  4J2D A;  2JH9 A;  4ADN A;  3QNO A;  2OVP B;  2OZS A;  4KHW A;  4AKH A;  3CQ8 A;  4I9L A;  2LF6 A;  3RMB A;  3NCI A;  3RMA A;  4KHY A;  3UO3 A;  1WAJ A;  4DTS A;  3SJJ A;  4FJH A;  3HL8 A;  4JS5 A;  2DEB A;  2FW3 A;  2OVQ B;  3TAG A;  2RCU A;  4J2E A;  3LZI A;  3NAE A;  2OYQ A;  3V7D B;  3NHG A;  1FZ7 E;  3OGM B;  4DU1 A;  1XU5 E;  3QNN A;  1FZH E;  4FJJ A;  2QXF A;  4M3Y A;  4DTN A;  3K2O A;  4DTJ A;  2P5G A;  3KD5 E;  3RWU A;  3L8B A;  3TAF A;  2RKH A;  2B8I A;  2LF3 A;  3CFO A;  1FXX A;  4DTX A;  4E3S A;  3QEP A;  4B08 A;  4RG8 A;  4I9Q A;  2HD0 A;  4ADO A;  3TAB A;  4FK2 A;  4QND A;  4KI4 A;  3QEX A;  3QEI A;  4M3U A;  4HCB A;  3CFP A;  4JS4 A;  3TJY A;  3LDS A;  4FJI A;  3E4Y A;  2OVR B;  1FYZ E;  1XVG E;  4X5M A;  4FJ8 A;  1FZ5 E;  1XMF E;  3TAE A;  1Q9X A;  2JH8 A;  3HGK E;  4FJ5 A;  4KHQ A;  4AI6 A;  1FS1 A;  1FZ3 E;  4I6J B;  3C95 A;  4RL5 A;  3SUP A;  3SPY A;  2VJ5 A;  1JW2 A;  4FJN A;  2E32 A;  2P1O B;  4AKI A;  4DTR A;  3LD8 A;  4M3T A;  1MMO G;  3SUQ A;  3L0M A;  2H4T A;  4ICG C;  1FPO A;  3C94 A;  3QET A;  2OZM A;  4KHS A;  2ATQ A;  1FZI E;  1FZ4 E;  2P1M B;  3SPZ A;  5IZ7 A;  2PFV A;  3C6N B;  4J2B A;  3NDK A;  1FZ6 E;  5H37 A;  1FZ1 E;  4EPH A;  4KHU A;  2MZW B;  4FJ9 A;  3SQ1 A;  4FJL A;  3E4W A;  4M3R A;  3CFR A;  4EYW A;  3OGK B;  1Q9Y A;  4DTU A;  4FJM A;  4FJK A;  1XVF E;  4FJX A;  2P1Q B;  4X5N A;  2PFT A;  3SQ0 A;  1FZ9 E;  2JPN A;  2P1N B;  3BVO A;  3LDB A;  4DTO A;  4FK0 A;  4KI6 A;  4RNG A;  2YB5 A;  2MMB A;  2E31 A;  4DU3 A;  4AKG A;  1MHY G;  1NEX B;  3RMD A;  2JHC A;  4J2A A;  1XU3 E;  1WAF A;  2K5S A;  1FZ2 E;  1XMG E;  3QEV A;  3N1B A;  3MKS B;  2DY4 A;  3S9H A;  1LDK E;  3UIQ A;  4FK4 A;  1XVD E;  4DU4 A;  3SI6 A; 
#chains in the Genus database with same CATH homology
 1FZ0 E;  4FJ7 A;  4M42 A;  1IH7 A;  3J2P A;  4QNC A;  3SQ2 A;  1FZ8 E;  3KD1 E;  2VIX A;  4HCC A;  3C6O B;  3TL8 B;  1P22 A;  5IRE A;  3HGL A;  1XVC E;  4DTP A;  1IG9 A;  3SVI A;  4JRP A;  3SUN A;  1XVB E;  2B1E A;  3J27 A;  3LZJ A;  3WSO A;  5IBK B;  3HP9 A;  4DTM A;  2P1P B;  4EP9 A;  1XVE E;  3L2O B;  4KHN A;  4M3W A;  4E4B A;  3OGL B;  3SCX A;  4JRQ A;  2P5O A;  2DTU A;  3QER A;  3NGI A;  4FVM A;  1CLQ A;  1MHZ G;  3QES A;  4FJG A;  1MTY G;  4GAM C;  4M41 A;  3N1E A;  2FYO A;  2JHP A;  3L1N A;  3C6P B;  3RMC A;  2JHA A;  1XL3 C;  4M45 A;  3NE6 A;  3QEW A;  2VJ4 A;  3SQ4 A;  3SUO A;  4M3Z A;  4M3X A;  1XMH E;  2B7M A;  3SNN A;  4J2D A;  2JH9 A;  4ADN A;  3QNO A;  2OVP B;  2OZS A;  4KHW A;  4AKH A;  3CQ8 A;  4I9L A;  2LF6 A;  3RMB A;  3NCI A;  3RMA A;  4KHY A;  1WAJ A;  4DTS A;  3SJJ A;  4FJH A;  3HL8 A;  4JS5 A;  2DEB A;  2FW3 A;  2OVQ B;  3TAG A;  2RCU A;  4J2E A;  3LZI A;  3NAE A;  2OYQ A;  3V7D B;  3NHG A;  1FZ7 E;  3OGM B;  4DU1 A;  1XU5 E;  3QNN A;  1FZH E;  4FJJ A;  2QXF A;  4M3Y A;  4DTN A;  3K2O A;  4DTJ A;  2P5G A;  3KD5 E;  3RWU A;  3L8B A;  3TAF A;  2B8I A;  2LF3 A;  3CFO A;  1FXX A;  4DTX A;  4E3S A;  3QEP A;  4B08 A;  4RG8 A;  4I9Q A;  2HD0 A;  4ADO A;  3TAB A;  4FK2 A;  4QND A;  4KI4 A;  3QEX A;  3QEI A;  4M3U A;  4HCB A;  3CFP A;  4JS4 A;  3TJY A;  3LDS A;  4FJI A;  3E4Y A;  2OVR B;  1FYZ E;  1XVG E;  4X5M A;  4FJ8 A;  1FZ5 E;  1XMF E;  3TAE A;  1Q9X A;  2JH8 A;  3HGK E;  4FJ5 A;  4KHQ A;  4AI6 A;  1FS1 A;  1FZ3 E;  4I6J B;  3C95 A;  4RL5 A;  3SUP A;  3SPY A;  2VJ5 A;  4FJN A;  2E32 A;  2P1O B;  4AKI A;  4DTR A;  3LD8 A;  4M3T A;  1MMO G;  3SUQ A;  3L0M A;  2H4T A;  3C94 A;  3QET A;  2OZM A;  4KHS A;  2ATQ A;  1FZI E;  1FZ4 E;  2P1M B;  3SPZ A;  5IZ7 A;  2PFV A;  3C6N B;  4J2B A;  3NDK A;  1FZ6 E;  5H37 A;  1FZ1 E;  4EPH A;  4KHU A;  2MZW B;  4FJ9 A;  3SQ1 A;  4FJL A;  3E4W A;  4M3R A;  3CFR A;  4EYW A;  3OGK B;  1Q9Y A;  4DTU A;  4FJM A;  4FJK A;  1XVF E;  4FJX A;  2P1Q B;  4X5N A;  2PFT A;  3SQ0 A;  1FZ9 E;  2JPN A;  2P1N B;  3LDB A;  4DTO A;  4FK0 A;  4KI6 A;  4RNG A;  2YB5 A;  2MMB A;  2E31 A;  4DU3 A;  4AKG A;  1MHY G;  1NEX B;  3RMD A;  2JHC A;  4J2A A;  1XU3 E;  1WAF A;  1FZ2 E;  1XMG E;  3QEV A;  3N1B A;  3MKS B;  2DY4 A;  3S9H A;  1LDK E;  3UIQ A;  4FK4 A;  1XVD E;  4DU4 A;  3SI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...