1XVCE

Soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
total genus 59
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvcE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvcE02
1FZ8E 1FZ3E 1FZ1E 1FZHE 1XVFE 1MHYG 1MHZG 1XMGE 1FZ6E 1XVCE 1MMOG 1MTYG 1FZ2E 1XMFE 1FZ9E 1FZ0E 1FZ5E 1XVBE 1XU5E 1FZ7E 1XVGE 1XU3E 1XVEE 1FYZE 1FZIE 1FZ4E 1XMHE 1XVDE 4GAMC
chains in the Genus database with same CATH superfamily
3K2OA 4M3RA 4EPHA 2P1QB 2JPNA 3UO2A 3J27A 3LD8A 3TAFA 3RMBA 3NCIA 3RMDA 1MHZG 4I9QA 4E3SA 3SUPA 4QNCA 1FZ6E 1XVCE 1MMOG 1MTYG 3TL8B 4M42A 3C94A 1FS1A 3L2OB 1XMFE 2VJ4A 1FZ0E 4RG8A 3OGKB 5IBKB 1WAFA 4QNDA 4JS5A 4FJHA 4M3UA 1XU5E 2P1NB 3TAGA 2OZSA 4FJMA 4X5MA 3SQ1A 4M3WA 3SQ4A 3J2PA 4GAMC 3QESA 1FYZE 4X5NA 3QEPA 4FK2A 4AI6A 1Q9XA 3HGKE 4FJLA 4EYWA 4DTOA 3QETA 1XMHE 2DY4A 2MZWB 4FJ9A 3SPYA 3L8BA 3QERA 3L0MA 3HL8A 3C6OB 3RMAA 2JH8A 3N1EA 3NAEA 4DU3A 3S9HA 3RMCA 1FZHE 4FJXA 1FPOA 4M3ZA 3C6NB 3CFPA 4KHYA 2RCUA 2PFTA 4FJIA 1Q9YA 1MHYG 2E32A 2HD0A 2JHCA 3SCXA 1XMGE 1IG9A 2OVQB 2P1PB 4DTPA 3CQ8A 3KD5E 3SNNA 4M45A 2OZMA 3TJYA 1FZ9E 3UO3A 3NDKA 3L1NA 5IZ7A 4DU4A 1XVBE 4B08A 2MW2A 3NE6A 4FJKA 3QNNA 1FXXA 4DU1A 4FJJA 4KHNA 3SPZA 4I9LA 4J2DA 2RKHA 3N1BA 4KI6A 4DTJA 3TAEA 4ADNA 4FK4A 4KHUA 1FZ8E 3E4WA 3TABA 1FZ1E 4M3YA 2K5SA 2OVPB 4M3XA 4IT5A 2JHPA 3LZJA 2P1MB 4DTNA 3LDBA 4FJ7A 2DTUA 3BVOA 2JHAA 4KHQA 3QNOA 2OYQA 2QXFA 4I6JB 3SQ2A 2JQTA 2VIXA 4DTSA 1FZ5E 4HCCA 4ICGC 1P22A 3KD1E 3NHGA 1FZ7E 4JS4A 4FVMA 5H37A 2H4TA 3HP9A 4DTXA 2P5GA 4KHWA 3QEVA 1XU3E 2FYOA 2MMBA 3E4YA 1XVEE 3SUNA 4J2BA 4FJ8A 4HCBA 4FK0A 2FW3A 4AKIA 2OVRB 4FJNA 4EP9A 1FZ4E 3HGLA 3LZIA 4JRQA 1LDKE 4KI4A 3WSOA 3C95A 4AKGA 2B1EA 4RL5A 3UIQA 1FZ3E 3LDSA 3QEXA 3MKSB 4ADOA 3OGMB 1N1CA 4JRPA 3SI6A 2P5OA 2DEBA 1XVFE 2LF3A 3CFOA 4FJGA 4FJ5A 3SVIA 1CLQA 2LF6A 2VJ5A 3NGIA 2B8IA 2B7MA 4DTUA 4DTRA 1XL3C 3SUQA 1FZ2E 2PFVA 4M41A 3C6PB 4E4BA 3QEIA 5IREA 1IH7A 4J2EA 2YB5A 1XVGE 3RWUA 4KHSA 2ATQA 4AKHA 4DTMA 4M3TA 3CFRA 1FZIE 1WAJA 3OGLB 3SJJA 3SUOA 3V7DB 2E31A 3QEWA 3SQ0A 4J2AA 1JW2A 1XVDE 2JH9A 2P1OB 4RNGA 1NEXB
chains in the Genus database with same CATH topology
3K2OA 4M3RA 4EPHA 2P1QB 2JPNA 3J27A 3LD8A 3TAFA 3RMBA 3NCIA 3RMDA 1MHZG 4I9QA 4E3SA 3SUPA 4QNCA 1FZ6E 1XVCE 1MMOG 1MTYG 3TL8B 4M42A 3C94A 1FS1A 3L2OB 1XMFE 2VJ4A 1FZ0E 4RG8A 3OGKB 5IBKB 1WAFA 4QNDA 4JS5A 4FJHA 4M3UA 1XU5E 2P1NB 3TAGA 2OZSA 4FJMA 4X5MA 3SQ1A 4M3WA 3SQ4A 3J2PA 4GAMC 3QESA 1FYZE 4X5NA 3QEPA 4FK2A 4AI6A 1Q9XA 3HGKE 4FJLA 4EYWA 4DTOA 3QETA 1XMHE 2DY4A 2MZWB 4FJ9A 3SPYA 3L8BA 3QERA 3L0MA 3HL8A 3C6OB 3RMAA 2JH8A 3N1EA 3NAEA 4DU3A 3S9HA 3RMCA 1FZHE 4FJXA 4M3ZA 3C6NB 3CFPA 4KHYA 2RCUA 2PFTA 4FJIA 1Q9YA 1MHYG 2E32A 2HD0A 2JHCA 3SCXA 1XMGE 1IG9A 2OVQB 2P1PB 4DTPA 3CQ8A 3KD5E 3SNNA 4M45A 2OZMA 3TJYA 1FZ9E 3NDKA 3L1NA 5IZ7A 4DU4A 1XVBE 4B08A 3NE6A 4FJKA 3QNNA 1FXXA 4DU1A 4FJJA 4KHNA 3SPZA 4I9LA 4J2DA 3N1BA 4KI6A 4DTJA 3TAEA 4ADNA 4FK4A 4KHUA 1FZ8E 3E4WA 3TABA 1FZ1E 4M3YA 2OVPB 4M3XA 2JHPA 3LZJA 2P1MB 4DTNA 3LDBA 4FJ7A 2DTUA 2JHAA 4KHQA 3QNOA 2OYQA 2QXFA 4I6JB 3SQ2A 2VIXA 4DTSA 1FZ5E 4HCCA 1P22A 3KD1E 3NHGA 1FZ7E 4JS4A 4FVMA 5H37A 2H4TA 3HP9A 4DTXA 2P5GA 4KHWA 3QEVA 1XU3E 2FYOA 2MMBA 3E4YA 1XVEE 3SUNA 4J2BA 4FJ8A 4HCBA 4FK0A 2FW3A 4AKIA 2OVRB 4FJNA 4EP9A 1FZ4E 3HGLA 3LZIA 4JRQA 1LDKE 4KI4A 3WSOA 3C95A 4AKGA 2B1EA 4RL5A 3UIQA 1FZ3E 3LDSA 3QEXA 3MKSB 4ADOA 3OGMB 4JRPA 3SI6A 2P5OA 2DEBA 1XVFE 2LF3A 3CFOA 4FJGA 4FJ5A 3SVIA 1CLQA 2LF6A 2VJ5A 3NGIA 2B8IA 2B7MA 4DTUA 4DTRA 1XL3C 3SUQA 1FZ2E 2PFVA 4M41A 3C6PB 4E4BA 3QEIA 5IREA 1IH7A 4J2EA 1XVGE 3RWUA 4KHSA 2ATQA 4AKHA 1NEXB 4DTMA 4M3TA 3CFRA 1FZIE 1WAJA 3OGLB 3SJJA 3SUOA 3V7DB 2E31A 3QEWA 3SQ0A 4J2AA 1XVDE 2JH9A 2P1OB 4RNGA 2YB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ8 E;  1FZ3 E;  1FZ1 E;  1FZH E;  1XVF E;  1MHY G;  1MHZ G;  1XMG E;  1FZ6 E;  1XVC E;  1MMO G;  1MTY G;  1FZ2 E;  1XMF E;  1FZ9 E;  1FZ0 E;  1FZ5 E;  1XVB E;  1XU5 E;  1FZ7 E;  1XVG E;  1XU3 E;  1XVE E;  1FYZ E;  1FZI E;  1FZ4 E;  1XMH E;  1XVD E;  4GAM C; 
#chains in the Genus database with same CATH topology
 3K2O A;  4M3R A;  4EPH A;  2P1Q B;  2JPN A;  3UO2 A;  3J27 A;  3LD8 A;  3TAF A;  3RMB A;  3NCI A;  3RMD A;  1MHZ G;  4I9Q A;  4E3S A;  3SUP A;  4QNC A;  1FZ6 E;  1XVC E;  1MMO G;  1MTY G;  3TL8 B;  4M42 A;  3C94 A;  1FS1 A;  3L2O B;  1XMF E;  2VJ4 A;  1FZ0 E;  4RG8 A;  3OGK B;  5IBK B;  1WAF A;  4QND A;  4JS5 A;  4FJH A;  4M3U A;  1XU5 E;  2P1N B;  3TAG A;  2OZS A;  4FJM A;  4X5M A;  3SQ1 A;  4M3W A;  3SQ4 A;  3J2P A;  4GAM C;  3QES A;  1FYZ E;  4X5N A;  3QEP A;  4FK2 A;  4AI6 A;  1Q9X A;  3HGK E;  4FJL A;  4EYW A;  4DTO A;  3QET A;  1XMH E;  2DY4 A;  2MZW B;  4FJ9 A;  3SPY A;  3L8B A;  3QER A;  3L0M A;  3HL8 A;  3C6O B;  3RMA A;  2JH8 A;  3N1E A;  3NAE A;  4DU3 A;  3S9H A;  3RMC A;  1FZH E;  4FJX A;  1FPO A;  4M3Z A;  3C6N B;  3CFP A;  4KHY A;  2RCU A;  2PFT A;  4FJI A;  1Q9Y A;  1MHY G;  2E32 A;  2HD0 A;  2JHC A;  3SCX A;  1XMG E;  1IG9 A;  2OVQ B;  2P1P B;  4DTP A;  3CQ8 A;  3KD5 E;  3SNN A;  4M45 A;  2OZM A;  3TJY A;  1FZ9 E;  3UO3 A;  3NDK A;  3L1N A;  5IZ7 A;  4DU4 A;  1XVB E;  4B08 A;  2MW2 A;  3NE6 A;  4FJK A;  3QNN A;  1FXX A;  4DU1 A;  4FJJ A;  4KHN A;  3SPZ A;  4I9L A;  4J2D A;  2RKH A;  3N1B A;  4KI6 A;  4DTJ A;  3TAE A;  4ADN A;  4FK4 A;  4KHU A;  1FZ8 E;  3E4W A;  3TAB A;  1FZ1 E;  4M3Y A;  2K5S A;  2OVP B;  4M3X A;  4IT5 A;  2JHP A;  3LZJ A;  2P1M B;  4DTN A;  3LDB A;  4FJ7 A;  2DTU A;  3BVO A;  2JHA A;  4KHQ A;  3QNO A;  2OYQ A;  2QXF A;  4I6J B;  3SQ2 A;  2JQT A;  2VIX A;  4DTS A;  1FZ5 E;  4HCC A;  4ICG C;  1P22 A;  3KD1 E;  3NHG A;  1FZ7 E;  4JS4 A;  4FVM A;  5H37 A;  2H4T A;  3HP9 A;  4DTX A;  2P5G A;  4KHW A;  3QEV A;  1XU3 E;  2FYO A;  2MMB A;  3E4Y A;  1XVE E;  3SUN A;  4J2B A;  4FJ8 A;  4HCB A;  4FK0 A;  2FW3 A;  4AKI A;  2OVR B;  4FJN A;  4EP9 A;  1FZ4 E;  3HGL A;  3LZI A;  4JRQ A;  1LDK E;  4KI4 A;  3WSO A;  3C95 A;  4AKG A;  2B1E A;  4RL5 A;  3UIQ A;  1FZ3 E;  3LDS A;  3QEX A;  3MKS B;  4ADO A;  3OGM B;  1N1C A;  4JRP A;  3SI6 A;  2P5O A;  2DEB A;  1XVF E;  2LF3 A;  3CFO A;  4FJG A;  4FJ5 A;  3SVI A;  1CLQ A;  2LF6 A;  2VJ5 A;  3NGI A;  2B8I A;  2B7M A;  4DTU A;  4DTR A;  1XL3 C;  3SUQ A;  1FZ2 E;  2PFV A;  4M41 A;  3C6P B;  4E4B A;  3QEI A;  5IRE A;  1IH7 A;  4J2E A;  2YB5 A;  1XVG E;  3RWU A;  4KHS A;  2ATQ A;  4AKH A;  4DTM A;  4M3T A;  3CFR A;  1FZI E;  1WAJ A;  3OGL B;  3SJJ A;  3SUO A;  3V7D B;  2E31 A;  3QEW A;  3SQ0 A;  4J2A A;  1JW2 A;  1XVD E;  2JH9 A;  2P1O B;  4RNG A;  1NEX B; 
#chains in the Genus database with same CATH homology
 3K2O A;  4M3R A;  4EPH A;  2P1Q B;  2JPN A;  3J27 A;  3LD8 A;  3TAF A;  3RMB A;  3NCI A;  3RMD A;  1MHZ G;  4I9Q A;  4E3S A;  3SUP A;  4QNC A;  1FZ6 E;  1XVC E;  1MMO G;  1MTY G;  3TL8 B;  4M42 A;  3C94 A;  1FS1 A;  3L2O B;  1XMF E;  2VJ4 A;  1FZ0 E;  4RG8 A;  3OGK B;  5IBK B;  1WAF A;  4QND A;  4JS5 A;  4FJH A;  4M3U A;  1XU5 E;  2P1N B;  3TAG A;  2OZS A;  4FJM A;  4X5M A;  3SQ1 A;  4M3W A;  3SQ4 A;  3J2P A;  4GAM C;  3QES A;  1FYZ E;  4X5N A;  3QEP A;  4FK2 A;  4AI6 A;  1Q9X A;  3HGK E;  4FJL A;  4EYW A;  4DTO A;  3QET A;  1XMH E;  2DY4 A;  2MZW B;  4FJ9 A;  3SPY A;  3L8B A;  3QER A;  3L0M A;  3HL8 A;  3C6O B;  3RMA A;  2JH8 A;  3N1E A;  3NAE A;  4DU3 A;  3S9H A;  3RMC A;  1FZH E;  4FJX A;  4M3Z A;  3C6N B;  3CFP A;  4KHY A;  2RCU A;  2PFT A;  4FJI A;  1Q9Y A;  1MHY G;  2E32 A;  2HD0 A;  2JHC A;  3SCX A;  1XMG E;  1IG9 A;  2OVQ B;  2P1P B;  4DTP A;  3CQ8 A;  3KD5 E;  3SNN A;  4M45 A;  2OZM A;  3TJY A;  1FZ9 E;  3NDK A;  3L1N A;  5IZ7 A;  4DU4 A;  1XVB E;  4B08 A;  3NE6 A;  4FJK A;  3QNN A;  1FXX A;  4DU1 A;  4FJJ A;  4KHN A;  3SPZ A;  4I9L A;  4J2D A;  3N1B A;  4KI6 A;  4DTJ A;  3TAE A;  4ADN A;  4FK4 A;  4KHU A;  1FZ8 E;  3E4W A;  3TAB A;  1FZ1 E;  4M3Y A;  2OVP B;  4M3X A;  2JHP A;  3LZJ A;  2P1M B;  4DTN A;  3LDB A;  4FJ7 A;  2DTU A;  2JHA A;  4KHQ A;  3QNO A;  2OYQ A;  2QXF A;  4I6J B;  3SQ2 A;  2VIX A;  4DTS A;  1FZ5 E;  4HCC A;  1P22 A;  3KD1 E;  3NHG A;  1FZ7 E;  4JS4 A;  4FVM A;  5H37 A;  2H4T A;  3HP9 A;  4DTX A;  2P5G A;  4KHW A;  3QEV A;  1XU3 E;  2FYO A;  2MMB A;  3E4Y A;  1XVE E;  3SUN A;  4J2B A;  4FJ8 A;  4HCB A;  4FK0 A;  2FW3 A;  4AKI A;  2OVR B;  4FJN A;  4EP9 A;  1FZ4 E;  3HGL A;  3LZI A;  4JRQ A;  1LDK E;  4KI4 A;  3WSO A;  3C95 A;  4AKG A;  2B1E A;  4RL5 A;  3UIQ A;  1FZ3 E;  3LDS A;  3QEX A;  3MKS B;  4ADO A;  3OGM B;  4JRP A;  3SI6 A;  2P5O A;  2DEB A;  1XVF E;  2LF3 A;  3CFO A;  4FJG A;  4FJ5 A;  3SVI A;  1CLQ A;  2LF6 A;  2VJ5 A;  3NGI A;  2B8I A;  2B7M A;  4DTU A;  4DTR A;  1XL3 C;  3SUQ A;  1FZ2 E;  2PFV A;  4M41 A;  3C6P B;  4E4B A;  3QEI A;  5IRE A;  1IH7 A;  4J2E A;  1XVG E;  3RWU A;  4KHS A;  2ATQ A;  4AKH A;  1NEX B;  4DTM A;  4M3T A;  3CFR A;  1FZI E;  1WAJ A;  3OGL B;  3SJJ A;  3SUO A;  3V7D B;  2E31 A;  3QEW A;  3SQ0 A;  4J2A A;  1XVD E;  2JH9 A;  2P1O B;  4RNG A;  2YB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...