1XVCE

Soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 59
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvcE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvcE02
1FZ7E 1FZ8E 1MMOG 1MTYG 1XVGE 1MHZG 1XVDE 1XMHE 1FZ2E 1XVCE 1FYZE 1FZ6E 1XMFE 1XU5E 1XVFE 1FZ9E 1XVEE 1FZ0E 1XU3E 4GAMC 1MHYG 1FZIE 1FZ3E 1FZ5E 1XMGE 1XVBE 1FZHE 1FZ1E 1FZ4E
chains in the Genus database with same CATH superfamily
3LZJA 3L2OB 4RG8A 3C95A 3KD1E 4KHNA 3N1EA 1MHZG 3NE6A 1N1CA 2VJ5A 3RWUA 4M3RA 1XVCE 1XMFE 3QERA 4X5MA 3SQ1A 3QEWA 4KI4A 3J2PA 3V7DB 1LDKE 1FZ9E 1XVEE 3C6NB 3QNNA 4JS4A 2P1MB 4J2EA 2VIXA 4ICGC 4EYWA 4JRQA 1Q9XA 4FJIA 2OZSA 1P22A 4M41A 4KI6A 4DU3A 1WAJA 1XU3E 4DTNA 3SQ2A 2PFTA 4GAMC 2YB5A 3LDSA 3NAEA 4DTUA 1FZ3E 3TAEA 3RMCA 4RL5A 3L8BA 4FK0A 4HCCA 2MZWB 4AKHA 3L1NA 3HGKE 1FZ4E 2OZMA 3TL8B 2JQTA 3LD8A 3TAGA 3OGMB 4J2BA 2MW2A 3SUNA 3MKSB 1MTYG 4J2AA 2RKHA 4DU1A 1FZ2E 4M3WA 2MMBA 3UIQA 4KHUA 3QEIA 2VJ4A 2H4TA 4FJ5A 4EP9A 4FJMA 4JRPA 4FK2A 3QESA 4DTPA 3CFPA 4FJ8A 3SUQA 2LF6A 3E4WA 2B7MA 4IT5A 3LZIA 2OVRB 4J2DA 2RCUA 2K5SA 2OVQB 4DTXA 3CQ8A 2P1PB 4FJ9A 2OVPB 3NCIA 3SQ4A 3RMBA 2JHAA 2FYOA 1FZ5E 1IH7A 3QETA 3HP9A 1FZHE 1FZ1E 4FJ7A 1XL3C 3J27A 4RNGA 3WSOA 3CFOA 4DTRA 3NHGA 3SUOA 3SNNA 3QEPA 4DU4A 2P5OA 3KD5E 4FJLA 1FS1A 4M3TA 4AI6A 4ADNA 3SI6A 1MMOG 1IG9A 2E31A 3SQ0A 2DTUA 3TABA 1XVDE 2B8IA 1XMHE 2JHCA 1FYZE 1FZ6E 3QNOA 5H37A 4E3SA 2JH9A 4B08A 2E32A 3TAFA 3QEVA 2B1EA 1XVFE 4KHSA 3CFRA 4FJJA 3NDKA 3NGIA 3S9HA 1Q9YA 4FVMA 3E4YA 4M3UA 1WAFA 2P1OB 4AKIA 1JW2A 2PFVA 3BVOA 4M42A 4I6JB 2HD0A 4E4BA 4DTOA 1FPOA 3SPYA 3LDBA 4FJXA 3QEXA 4DTSA 4I9LA 1XMGE 4M45A 4JS5A 4FJHA 3C6OB 2DY4A 4X5NA 4DTMA 3HGLA 3C94A 1FZ7E 3HL8A 1FZ8E 4FK4A 2QXFA 4M3ZA 1XVGE 5IBKB 3SVIA 2JH8A 4ADOA 2P1NB 2P5GA 4FJGA 2ATQA 4I9QA 4AKGA 3OGKB 3N1BA 3SUPA 3L0MA 1XU5E 2OYQA 4FJNA 3RMAA 4KHWA 4EPHA 3UO3A 4FJKA 4HCBA 4QNCA 3SCXA 2LF3A 1NEXB 3SJJA 1CLQA 1FZ0E 2DEBA 2JPNA 3UO2A 3OGLB 5IREA 1MHYG 1FZIE 4M3XA 1FXXA 4KHQA 4M3YA 1XVBE 3C6PB 2FW3A 2JHPA 4KHYA 3RMDA 2P1QB 3TJYA 5IZ7A 3K2OA 4DTJA 3SPZA 4QNDA
chains in the Genus database with same CATH topology
3LZJA 3L2OB 4RG8A 3C95A 3KD1E 4KHNA 3N1EA 1MHZG 3NE6A 2VJ5A 3RWUA 4M3RA 1XVCE 1XMFE 3QERA 4X5MA 3SQ1A 3QEWA 4KI4A 3J2PA 3V7DB 1LDKE 1FZ9E 1XVEE 3C6NB 3QNNA 4JS4A 2P1MB 4J2EA 2VIXA 4EYWA 4JRQA 1Q9XA 4FJIA 2OZSA 1P22A 4M41A 4KI6A 4DU3A 1WAJA 1XU3E 4DTNA 3SQ2A 2PFTA 4GAMC 2YB5A 3LDSA 3NAEA 4DTUA 1FZ3E 3TAEA 3RMCA 4RL5A 3L8BA 4FK0A 4HCCA 2MZWB 4AKHA 3L1NA 3HGKE 1FZ4E 2OZMA 3TL8B 3LD8A 3TAGA 3OGMB 4J2BA 3SUNA 4J2AA 3MKSB 1MTYG 4DU1A 1FZ2E 4M3WA 2MMBA 3UIQA 4KHUA 3QEIA 2VJ4A 2H4TA 4FJ5A 4EP9A 4FJMA 4JRPA 4FK2A 3QESA 4DTPA 3CFPA 4FJ8A 3SUQA 2LF6A 3E4WA 2B7MA 3LZIA 2OVRB 4J2DA 2RCUA 2OVQB 4DTXA 3CQ8A 2P1PB 4FJ9A 2OVPB 3NCIA 3SQ4A 3RMBA 2JHAA 2FYOA 1FZ5E 1IH7A 3QETA 3HP9A 1FZHE 1FZ1E 4FJ7A 1XL3C 3J27A 4RNGA 3WSOA 3CFOA 4DTRA 3NHGA 3SUOA 3SNNA 3QEPA 4DU4A 2P5OA 3KD5E 4FJLA 1FS1A 4M3TA 4AI6A 4ADNA 3SI6A 1MMOG 1IG9A 2E31A 3SQ0A 2DTUA 3TABA 1XVDE 2B8IA 1XMHE 2JHCA 1FYZE 1FZ6E 3QNOA 5H37A 4E3SA 2JH9A 4B08A 2E32A 3TAFA 3QEVA 2B1EA 1XVFE 4KHSA 3CFRA 4FJJA 3NDKA 3NGIA 3S9HA 1Q9YA 4FVMA 3E4YA 4M3UA 1WAFA 2P1OB 4AKIA 2PFVA 4M42A 4I6JB 2HD0A 4E4BA 4DTOA 3SPYA 4FJXA 3LDBA 3QEXA 4DTSA 4I9LA 1XMGE 4M45A 4JS5A 4FJHA 3C6OB 2DY4A 4X5NA 4DTMA 3HGLA 3C94A 1FZ7E 3HL8A 1FZ8E 4FK4A 2QXFA 4M3ZA 1XVGE 5IBKB 3SVIA 2JH8A 4ADOA 2P1NB 2P5GA 4FJGA 2ATQA 4I9QA 4AKGA 3OGKB 3N1BA 3SUPA 3L0MA 1XU5E 2OYQA 4FJNA 3RMAA 4KHWA 4EPHA 4FJKA 4HCBA 4QNCA 3SCXA 2LF3A 1NEXB 3SJJA 1CLQA 1FZ0E 2DEBA 2JPNA 3OGLB 5IREA 1MHYG 1FZIE 4M3XA 1FXXA 4KHQA 4M3YA 1XVBE 3C6PB 2FW3A 2JHPA 4KHYA 3RMDA 2P1QB 3TJYA 5IZ7A 3K2OA 4DTJA 3SPZA 4QNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ7 E;  1FZ8 E;  1MMO G;  1MTY G;  1XVG E;  1MHZ G;  1XVD E;  1XMH E;  1FZ2 E;  1XVC E;  1FYZ E;  1FZ6 E;  1XMF E;  1XU5 E;  1XVF E;  1FZ9 E;  1XVE E;  1FZ0 E;  1XU3 E;  4GAM C;  1MHY G;  1FZI E;  1FZ3 E;  1FZ5 E;  1XMG E;  1XVB E;  1FZH E;  1FZ1 E;  1FZ4 E; 
#chains in the Genus database with same CATH topology
 3LZJ A;  3L2O B;  4RG8 A;  3C95 A;  3KD1 E;  4KHN A;  3N1E A;  1MHZ G;  3NE6 A;  1N1C A;  2VJ5 A;  3RWU A;  4M3R A;  1XVC E;  1XMF E;  3QER A;  4X5M A;  3SQ1 A;  3QEW A;  4KI4 A;  3J2P A;  3V7D B;  1LDK E;  1FZ9 E;  1XVE E;  3C6N B;  3QNN A;  4JS4 A;  2P1M B;  4J2E A;  2VIX A;  4ICG C;  4EYW A;  4JRQ A;  1Q9X A;  4FJI A;  2OZS A;  1P22 A;  4M41 A;  4KI6 A;  4DU3 A;  1WAJ A;  1XU3 E;  4DTN A;  3SQ2 A;  2PFT A;  4GAM C;  2YB5 A;  3LDS A;  3NAE A;  4DTU A;  1FZ3 E;  3TAE A;  3RMC A;  4RL5 A;  3L8B A;  4FK0 A;  4HCC A;  2MZW B;  4AKH A;  3L1N A;  3HGK E;  1FZ4 E;  2OZM A;  3TL8 B;  2JQT A;  3LD8 A;  3TAG A;  3OGM B;  4J2B A;  2MW2 A;  3SUN A;  3MKS B;  1MTY G;  4J2A A;  2RKH A;  4DU1 A;  1FZ2 E;  4M3W A;  2MMB A;  3UIQ A;  4KHU A;  3QEI A;  2VJ4 A;  2H4T A;  4FJ5 A;  4EP9 A;  4FJM A;  4JRP A;  4FK2 A;  3QES A;  4DTP A;  3CFP A;  4FJ8 A;  3SUQ A;  2LF6 A;  3E4W A;  2B7M A;  4IT5 A;  3LZI A;  2OVR B;  4J2D A;  2RCU A;  2K5S A;  2OVQ B;  4DTX A;  3CQ8 A;  2P1P B;  4FJ9 A;  2OVP B;  3NCI A;  3SQ4 A;  3RMB A;  2JHA A;  2FYO A;  1FZ5 E;  1IH7 A;  3QET A;  3HP9 A;  1FZH E;  1FZ1 E;  4FJ7 A;  1XL3 C;  3J27 A;  4RNG A;  3WSO A;  3CFO A;  4DTR A;  3NHG A;  3SUO A;  3SNN A;  3QEP A;  4DU4 A;  2P5O A;  3KD5 E;  4FJL A;  1FS1 A;  4M3T A;  4AI6 A;  4ADN A;  3SI6 A;  1MMO G;  1IG9 A;  2E31 A;  3SQ0 A;  2DTU A;  3TAB A;  1XVD E;  2B8I A;  1XMH E;  2JHC A;  1FYZ E;  1FZ6 E;  3QNO A;  5H37 A;  4E3S A;  2JH9 A;  4B08 A;  2E32 A;  3TAF A;  3QEV A;  2B1E A;  1XVF E;  4KHS A;  3CFR A;  4FJJ A;  3NDK A;  3NGI A;  3S9H A;  1Q9Y A;  4FVM A;  3E4Y A;  4M3U A;  1WAF A;  2P1O B;  4AKI A;  1JW2 A;  2PFV A;  3BVO A;  4M42 A;  4I6J B;  2HD0 A;  4E4B A;  4DTO A;  1FPO A;  3SPY A;  3LDB A;  4FJX A;  3QEX A;  4DTS A;  4I9L A;  1XMG E;  4M45 A;  4JS5 A;  4FJH A;  3C6O B;  2DY4 A;  4X5N A;  4DTM A;  3HGL A;  3C94 A;  1FZ7 E;  3HL8 A;  1FZ8 E;  4FK4 A;  2QXF A;  4M3Z A;  1XVG E;  5IBK B;  3SVI A;  2JH8 A;  4ADO A;  2P1N B;  2P5G A;  4FJG A;  2ATQ A;  4I9Q A;  4AKG A;  3OGK B;  3N1B A;  3SUP A;  3L0M A;  1XU5 E;  2OYQ A;  4FJN A;  3RMA A;  4KHW A;  4EPH A;  3UO3 A;  4FJK A;  4HCB A;  4QNC A;  3SCX A;  2LF3 A;  1NEX B;  3SJJ A;  1CLQ A;  1FZ0 E;  2DEB A;  2JPN A;  3UO2 A;  3OGL B;  5IRE A;  1MHY G;  1FZI E;  4M3X A;  1FXX A;  4KHQ A;  4M3Y A;  1XVB E;  3C6P B;  2FW3 A;  2JHP A;  4KHY A;  3RMD A;  2P1Q B;  3TJY A;  5IZ7 A;  3K2O A;  4DTJ A;  3SPZ A;  4QND A; 
#chains in the Genus database with same CATH homology
 3LZJ A;  3L2O B;  4RG8 A;  3C95 A;  3KD1 E;  4KHN A;  3N1E A;  1MHZ G;  3NE6 A;  2VJ5 A;  3RWU A;  4M3R A;  1XVC E;  1XMF E;  3QER A;  4X5M A;  3SQ1 A;  3QEW A;  4KI4 A;  3J2P A;  3V7D B;  1LDK E;  1FZ9 E;  1XVE E;  3C6N B;  3QNN A;  4JS4 A;  2P1M B;  4J2E A;  2VIX A;  4EYW A;  4JRQ A;  1Q9X A;  4FJI A;  2OZS A;  1P22 A;  4M41 A;  4KI6 A;  4DU3 A;  1WAJ A;  1XU3 E;  4DTN A;  3SQ2 A;  2PFT A;  4GAM C;  2YB5 A;  3LDS A;  3NAE A;  4DTU A;  1FZ3 E;  3TAE A;  3RMC A;  4RL5 A;  3L8B A;  4FK0 A;  4HCC A;  2MZW B;  4AKH A;  3L1N A;  3HGK E;  1FZ4 E;  2OZM A;  3TL8 B;  3LD8 A;  3TAG A;  3OGM B;  4J2B A;  3SUN A;  4J2A A;  3MKS B;  1MTY G;  4DU1 A;  1FZ2 E;  4M3W A;  2MMB A;  3UIQ A;  4KHU A;  3QEI A;  2VJ4 A;  2H4T A;  4FJ5 A;  4EP9 A;  4FJM A;  4JRP A;  4FK2 A;  3QES A;  4DTP A;  3CFP A;  4FJ8 A;  3SUQ A;  2LF6 A;  3E4W A;  2B7M A;  3LZI A;  2OVR B;  4J2D A;  2RCU A;  2OVQ B;  4DTX A;  3CQ8 A;  2P1P B;  4FJ9 A;  2OVP B;  3NCI A;  3SQ4 A;  3RMB A;  2JHA A;  2FYO A;  1FZ5 E;  1IH7 A;  3QET A;  3HP9 A;  1FZH E;  1FZ1 E;  4FJ7 A;  1XL3 C;  3J27 A;  4RNG A;  3WSO A;  3CFO A;  4DTR A;  3NHG A;  3SUO A;  3SNN A;  3QEP A;  4DU4 A;  2P5O A;  3KD5 E;  4FJL A;  1FS1 A;  4M3T A;  4AI6 A;  4ADN A;  3SI6 A;  1MMO G;  1IG9 A;  2E31 A;  3SQ0 A;  2DTU A;  3TAB A;  1XVD E;  2B8I A;  1XMH E;  2JHC A;  1FYZ E;  1FZ6 E;  3QNO A;  5H37 A;  4E3S A;  2JH9 A;  4B08 A;  2E32 A;  3TAF A;  3QEV A;  2B1E A;  1XVF E;  4KHS A;  3CFR A;  4FJJ A;  3NDK A;  3NGI A;  3S9H A;  1Q9Y A;  4FVM A;  3E4Y A;  4M3U A;  1WAF A;  2P1O B;  4AKI A;  2PFV A;  4M42 A;  4I6J B;  2HD0 A;  4E4B A;  4DTO A;  3SPY A;  4FJX A;  3LDB A;  3QEX A;  4DTS A;  4I9L A;  1XMG E;  4M45 A;  4JS5 A;  4FJH A;  3C6O B;  2DY4 A;  4X5N A;  4DTM A;  3HGL A;  3C94 A;  1FZ7 E;  3HL8 A;  1FZ8 E;  4FK4 A;  2QXF A;  4M3Z A;  1XVG E;  5IBK B;  3SVI A;  2JH8 A;  4ADO A;  2P1N B;  2P5G A;  4FJG A;  2ATQ A;  4I9Q A;  4AKG A;  3OGK B;  3N1B A;  3SUP A;  3L0M A;  1XU5 E;  2OYQ A;  4FJN A;  3RMA A;  4KHW A;  4EPH A;  4FJK A;  4HCB A;  4QNC A;  3SCX A;  2LF3 A;  1NEX B;  3SJJ A;  1CLQ A;  1FZ0 E;  2DEB A;  2JPN A;  3OGL B;  5IRE A;  1MHY G;  1FZI E;  4M3X A;  1FXX A;  4KHQ A;  4M3Y A;  1XVB E;  3C6P B;  2FW3 A;  2JHP A;  4KHY A;  3RMD A;  2P1Q B;  3TJY A;  5IZ7 A;  3K2O A;  4DTJ A;  3SPZ A;  4QND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...