1XVCE

Soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
166
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 59
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvcE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvcE02
1XVGE 1FZ4E 1XVDE 1XVBE 1MHZG 1FZHE 1FZ9E 1FZ3E 1MHYG 1FZIE 1MTYG 1XVEE 1XVFE 1FZ0E 1FZ6E 1XVCE 1XMGE 1FZ8E 1XU5E 1XMHE 1MMOG 1FZ2E 1FYZE 4GAMC 1FZ5E 1FZ1E 1FZ7E 1XMFE 1XU3E
chains in the Genus database with same CATH superfamily
2JHPA 5IBKB 1FZ4E 2VJ5A 4RL5A 3SNNA 4FJGA 2JHAA 4DTNA 3RMBA 4X5NA 4FK0A 2P5GA 1XVBE 4FK4A 3CFOA 2RKHA 3SQ4A 2P1MB 2DTUA 3SUPA 5IZ7A 2ATQA 1FZIE 1XVEE 3SPZA 3KD1E 1FS1A 3UO2A 4FJMA 4KHNA 4FJLA 4DTOA 3WSOA 3OGKB 3C94A 2JPNA 4ICGC 4EP9A 3SCXA 4FJ7A 1FZ8E 2VIXA 1XU5E 3E4YA 2FW3A 3TJYA 4KI6A 3OGLB 1FYZE 1WAJA 3TAGA 4M45A 1CLQA 4E3SA 2PFVA 3QEIA 5IREA 4KHUA 3SUQA 5H37A 4AKHA 4FJJA 3QNNA 4M42A 3C6PB 2MW2A 3SQ1A 4M3XA 1XMFE 1XVGE 1FXXA 3NE6A 3L1NA 3SQ2A 3J2PA 4M3WA 2K5SA 4DTJA 4AKIA 2RCUA 2LF6A 1FZHE 3HGLA 2OVQB 4B08A 4DTSA 3QERA 3CFPA 2OZSA 4FJ8A 1MHYG 1MTYG 2LF3A 3QETA 4JS4A 3RMCA 1XVFE 3TL8B 4RNGA 4EYWA 1FZ0E 1FZ6E 3C6OB 2OZMA 1P22A 2P1OB 4M3ZA 2FYOA 3K2OA 1Q9YA 4QNCA 3QEPA 1XMHE 3HL8A 3LZJA 4DTRA 3SJJA 3RWUA 3BVOA 3CQ8A 4J2DA 4QNDA 4HCBA 4DTUA 4JS5A 3J27A 4M3RA 4GAMC 3HGKE 4FJIA 4J2EA 4KHWA 2E31A 1IH7A 3C95A 2DY4A 2JHCA 4EPHA 4J2BA 3NGIA 4JRQA 3V7DB 3QNOA 3SQ0A 4IT5A 1MHZG 4I9LA 3OGMB 4DU3A 1FZ9E 2P1PB 3NHGA 1N1CA 3TAFA 4X5MA 3TAEA 3QEWA 2B1EA 4I6JB 4KHQA 2DEBA 1IG9A 1XVCE 1XMGE 4RG8A 2P1QB 3SI6A 2HD0A 2OYQA 1FZ2E 3QEXA 4ADNA 3MKSB 4FJHA 2OVRB 3LDBA 3C6NB 3LDSA 2PFTA 3S9HA 3UIQA 3NAEA 3KD5E 4FJXA 1NEXB 2B7MA 1XL3C 4ADOA 4FJ5A 1LDKE 1FZ7E 3TABA 3L8BA 3SUNA 4AKGA 1XU3E 2JH8A 4KI4A 4M3YA 1XVDE 3UO3A 3SVIA 2E32A 1WAFA 4DTXA 2H4TA 3NDKA 4J2AA 4FK2A 4KHSA 3L0MA 3L2OB 1JW2A 4FJNA 1FZ3E 3QESA 4AI6A 4HCCA 4FJ9A 2P5OA 2JH9A 3RMDA 4KHYA 4DTMA 4DU4A 4M41A 2MZWB 3LD8A 3NCIA 4DTPA 4M3UA 3LZIA 4I9QA 1FPOA 1MMOG 4FVMA 2MMBA 3CFRA 4FJKA 2YB5A 4JRPA 3SPYA 2B8IA 3E4WA 2QXFA 3RMAA 4M3TA 3N1EA 2VJ4A 1FZ5E 4E4BA 4DU1A 2P1NB 3N1BA 3HP9A 3SUOA 3QEVA 1FZ1E 2OVPB 2JQTA 1Q9XA
chains in the Genus database with same CATH topology
2JHPA 5IBKB 1FZ4E 2VJ5A 4RL5A 3SNNA 4FJGA 2JHAA 4DTNA 3RMBA 4X5NA 4FK0A 2P5GA 1XVBE 4FK4A 3CFOA 3SQ4A 2P1MB 2DTUA 3SUPA 5IZ7A 2ATQA 1FZIE 1XVEE 3SPZA 3KD1E 1FS1A 4FJMA 4KHNA 4FJLA 4DTOA 3WSOA 3OGKB 3C94A 2JPNA 4FK2A 4EP9A 3SCXA 4FJ7A 1FZ8E 2VIXA 1XU5E 3E4YA 2FW3A 3TJYA 4KI6A 3OGLB 1FYZE 1WAJA 3TAGA 4M45A 1CLQA 4E3SA 2PFVA 3QEIA 5IREA 4KHUA 3SUQA 5H37A 4AKHA 4FJJA 3QNNA 4M42A 3C6PB 3SQ1A 4M3XA 1XMFE 1XVGE 1FXXA 3NE6A 3L1NA 3SQ2A 3J2PA 4M3WA 4DTJA 4AKIA 2RCUA 2LF6A 1FZHE 3HGLA 2OVQB 4B08A 4DTSA 3QERA 3CFPA 2OZSA 4FJ8A 1MHYG 1MTYG 2LF3A 3QETA 4JS4A 3RMCA 1XVFE 3TL8B 4RNGA 4EYWA 1FZ0E 1FZ6E 3C6OB 2OZMA 1P22A 2P1OB 4M3ZA 2FYOA 3K2OA 1Q9YA 4QNCA 3QEPA 1XMHE 3HL8A 3LZJA 4DTRA 3SJJA 3RWUA 3CQ8A 4J2DA 4QNDA 4HCBA 4DTUA 4JS5A 3J27A 4M3RA 4GAMC 3HGKE 4FJIA 4J2EA 4KHWA 2E31A 3C95A 1IH7A 2DY4A 2JHCA 4EPHA 4J2BA 3NGIA 4JRQA 3V7DB 3QNOA 3SQ0A 1MHZG 4I9LA 3OGMB 4DU3A 1FZ9E 2P1PB 3NHGA 3TAFA 4X5MA 3TAEA 3QEWA 2B1EA 4I6JB 4KHQA 2DEBA 1IG9A 1XVCE 1XMGE 4RG8A 2P1QB 3SI6A 2HD0A 2OYQA 1FZ2E 3QEXA 4ADNA 3MKSB 4FJHA 2OVRB 3LDBA 3C6NB 3LDSA 2PFTA 3S9HA 3UIQA 3NAEA 3KD5E 4FJXA 1NEXB 2B7MA 1XL3C 4ADOA 4FJ5A 1LDKE 1FZ7E 3TABA 3L8BA 3SUNA 4AKGA 1XU3E 2JH8A 4KI4A 4M3YA 1XVDE 3SVIA 2E32A 1WAFA 4DTXA 2H4TA 3NDKA 4J2AA 4KHSA 3L0MA 3L2OB 4FJNA 1FZ3E 3QESA 4AI6A 4HCCA 4FJ9A 2P5OA 2JH9A 3RMDA 4KHYA 4DTMA 4DU4A 4M41A 2MZWB 3LD8A 3NCIA 4DTPA 4M3UA 3LZIA 4I9QA 1MMOG 4FVMA 4FJKA 2MMBA 3CFRA 2YB5A 4JRPA 3SPYA 2B8IA 3E4WA 2QXFA 3RMAA 4M3TA 3N1EA 2VJ4A 1FZ5E 4E4BA 4DU1A 2P1NB 3N1BA 3HP9A 3SUOA 3QEVA 1FZ1E 2OVPB 1Q9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVG E;  1FZ4 E;  1XVD E;  1XVB E;  1MHZ G;  1FZH E;  1FZ9 E;  1FZ3 E;  1MHY G;  1FZI E;  1MTY G;  1XVE E;  1XVF E;  1FZ0 E;  1FZ6 E;  1XVC E;  1XMG E;  1FZ8 E;  1XU5 E;  1XMH E;  1MMO G;  1FZ2 E;  1FYZ E;  4GAM C;  1FZ5 E;  1FZ1 E;  1FZ7 E;  1XMF E;  1XU3 E; 
#chains in the Genus database with same CATH topology
 2JHP A;  5IBK B;  1FZ4 E;  2VJ5 A;  4RL5 A;  3SNN A;  4FJG A;  2JHA A;  4DTN A;  3RMB A;  4X5N A;  4FK0 A;  2P5G A;  1XVB E;  4FK4 A;  3CFO A;  2RKH A;  3SQ4 A;  2P1M B;  2DTU A;  3SUP A;  5IZ7 A;  2ATQ A;  1FZI E;  1XVE E;  3SPZ A;  3KD1 E;  1FS1 A;  3UO2 A;  4FJM A;  4KHN A;  4FJL A;  4DTO A;  3WSO A;  3OGK B;  3C94 A;  2JPN A;  4ICG C;  4EP9 A;  3SCX A;  4FJ7 A;  1FZ8 E;  2VIX A;  1XU5 E;  3E4Y A;  2FW3 A;  3TJY A;  4KI6 A;  3OGL B;  1FYZ E;  1WAJ A;  3TAG A;  4M45 A;  1CLQ A;  4E3S A;  2PFV A;  3QEI A;  5IRE A;  4KHU A;  3SUQ A;  5H37 A;  4AKH A;  4FJJ A;  3QNN A;  4M42 A;  3C6P B;  2MW2 A;  3SQ1 A;  4M3X A;  1XMF E;  1XVG E;  1FXX A;  3NE6 A;  3L1N A;  3SQ2 A;  3J2P A;  4M3W A;  2K5S A;  4DTJ A;  4AKI A;  2RCU A;  2LF6 A;  1FZH E;  3HGL A;  2OVQ B;  4B08 A;  4DTS A;  3QER A;  3CFP A;  2OZS A;  4FJ8 A;  1MHY G;  1MTY G;  2LF3 A;  3QET A;  4JS4 A;  3RMC A;  1XVF E;  3TL8 B;  4RNG A;  4EYW A;  1FZ0 E;  1FZ6 E;  3C6O B;  2OZM A;  1P22 A;  2P1O B;  4M3Z A;  2FYO A;  3K2O A;  1Q9Y A;  4QNC A;  3QEP A;  1XMH E;  3HL8 A;  3LZJ A;  4DTR A;  3SJJ A;  3RWU A;  3BVO A;  3CQ8 A;  4J2D A;  4QND A;  4HCB A;  4DTU A;  4JS5 A;  3J27 A;  4M3R A;  4GAM C;  3HGK E;  4FJI A;  4J2E A;  4KHW A;  2E31 A;  1IH7 A;  3C95 A;  2DY4 A;  2JHC A;  4EPH A;  4J2B A;  3NGI A;  4JRQ A;  3V7D B;  3QNO A;  3SQ0 A;  4IT5 A;  1MHZ G;  4I9L A;  3OGM B;  4DU3 A;  1FZ9 E;  2P1P B;  3NHG A;  1N1C A;  3TAF A;  4X5M A;  3TAE A;  3QEW A;  2B1E A;  4I6J B;  4KHQ A;  2DEB A;  1IG9 A;  1XVC E;  1XMG E;  4RG8 A;  2P1Q B;  3SI6 A;  2HD0 A;  2OYQ A;  1FZ2 E;  3QEX A;  4ADN A;  3MKS B;  4FJH A;  2OVR B;  3LDB A;  3C6N B;  3LDS A;  2PFT A;  3S9H A;  3UIQ A;  3NAE A;  3KD5 E;  4FJX A;  1NEX B;  2B7M A;  1XL3 C;  4ADO A;  4FJ5 A;  1LDK E;  1FZ7 E;  3TAB A;  3L8B A;  3SUN A;  4AKG A;  1XU3 E;  2JH8 A;  4KI4 A;  4M3Y A;  1XVD E;  3UO3 A;  3SVI A;  2E32 A;  1WAF A;  4DTX A;  2H4T A;  3NDK A;  4J2A A;  4FK2 A;  4KHS A;  3L0M A;  3L2O B;  1JW2 A;  4FJN A;  1FZ3 E;  3QES A;  4AI6 A;  4HCC A;  4FJ9 A;  2P5O A;  2JH9 A;  3RMD A;  4KHY A;  4DTM A;  4DU4 A;  4M41 A;  2MZW B;  3LD8 A;  3NCI A;  4DTP A;  4M3U A;  3LZI A;  4I9Q A;  1FPO A;  1MMO G;  4FVM A;  2MMB A;  3CFR A;  4FJK A;  2YB5 A;  4JRP A;  3SPY A;  2B8I A;  3E4W A;  2QXF A;  3RMA A;  4M3T A;  3N1E A;  2VJ4 A;  1FZ5 E;  4E4B A;  4DU1 A;  2P1N B;  3N1B A;  3HP9 A;  3SUO A;  3QEV A;  1FZ1 E;  2OVP B;  2JQT A;  1Q9X A; 
#chains in the Genus database with same CATH homology
 2JHP A;  5IBK B;  1FZ4 E;  2VJ5 A;  4RL5 A;  3SNN A;  4FJG A;  2JHA A;  4DTN A;  3RMB A;  4X5N A;  4FK0 A;  2P5G A;  1XVB E;  4FK4 A;  3CFO A;  3SQ4 A;  2P1M B;  2DTU A;  3SUP A;  5IZ7 A;  2ATQ A;  1FZI E;  1XVE E;  3SPZ A;  3KD1 E;  1FS1 A;  4FJM A;  4KHN A;  4FJL A;  4DTO A;  3WSO A;  3OGK B;  3C94 A;  2JPN A;  4FK2 A;  4EP9 A;  3SCX A;  4FJ7 A;  1FZ8 E;  2VIX A;  1XU5 E;  3E4Y A;  2FW3 A;  3TJY A;  4KI6 A;  3OGL B;  1FYZ E;  1WAJ A;  3TAG A;  4M45 A;  1CLQ A;  4E3S A;  2PFV A;  3QEI A;  5IRE A;  4KHU A;  3SUQ A;  5H37 A;  4AKH A;  4FJJ A;  3QNN A;  4M42 A;  3C6P B;  3SQ1 A;  4M3X A;  1XMF E;  1XVG E;  1FXX A;  3NE6 A;  3L1N A;  3SQ2 A;  3J2P A;  4M3W A;  4DTJ A;  4AKI A;  2RCU A;  2LF6 A;  1FZH E;  3HGL A;  2OVQ B;  4B08 A;  4DTS A;  3QER A;  3CFP A;  2OZS A;  4FJ8 A;  1MHY G;  1MTY G;  2LF3 A;  3QET A;  4JS4 A;  3RMC A;  1XVF E;  3TL8 B;  4RNG A;  4EYW A;  1FZ0 E;  1FZ6 E;  3C6O B;  2OZM A;  1P22 A;  2P1O B;  4M3Z A;  2FYO A;  3K2O A;  1Q9Y A;  4QNC A;  3QEP A;  1XMH E;  3HL8 A;  3LZJ A;  4DTR A;  3SJJ A;  3RWU A;  3CQ8 A;  4J2D A;  4QND A;  4HCB A;  4DTU A;  4JS5 A;  3J27 A;  4M3R A;  4GAM C;  3HGK E;  4FJI A;  4J2E A;  4KHW A;  2E31 A;  3C95 A;  1IH7 A;  2DY4 A;  2JHC A;  4EPH A;  4J2B A;  3NGI A;  4JRQ A;  3V7D B;  3QNO A;  3SQ0 A;  1MHZ G;  4I9L A;  3OGM B;  4DU3 A;  1FZ9 E;  2P1P B;  3NHG A;  3TAF A;  4X5M A;  3TAE A;  3QEW A;  2B1E A;  4I6J B;  4KHQ A;  2DEB A;  1IG9 A;  1XVC E;  1XMG E;  4RG8 A;  2P1Q B;  3SI6 A;  2HD0 A;  2OYQ A;  1FZ2 E;  3QEX A;  4ADN A;  3MKS B;  4FJH A;  2OVR B;  3LDB A;  3C6N B;  3LDS A;  2PFT A;  3S9H A;  3UIQ A;  3NAE A;  3KD5 E;  4FJX A;  1NEX B;  2B7M A;  1XL3 C;  4ADO A;  4FJ5 A;  1LDK E;  1FZ7 E;  3TAB A;  3L8B A;  3SUN A;  4AKG A;  1XU3 E;  2JH8 A;  4KI4 A;  4M3Y A;  1XVD E;  3SVI A;  2E32 A;  1WAF A;  4DTX A;  2H4T A;  3NDK A;  4J2A A;  4KHS A;  3L0M A;  3L2O B;  4FJN A;  1FZ3 E;  3QES A;  4AI6 A;  4HCC A;  4FJ9 A;  2P5O A;  2JH9 A;  3RMD A;  4KHY A;  4DTM A;  4DU4 A;  4M41 A;  2MZW B;  3LD8 A;  3NCI A;  4DTP A;  4M3U A;  3LZI A;  4I9Q A;  1MMO G;  4FVM A;  4FJK A;  2MMB A;  3CFR A;  2YB5 A;  4JRP A;  3SPY A;  2B8I A;  3E4W A;  2QXF A;  3RMA A;  4M3T A;  3N1E A;  2VJ4 A;  1FZ5 E;  4E4B A;  4DU1 A;  2P1N B;  3N1B A;  3HP9 A;  3SUO A;  3QEV A;  1FZ1 E;  2OVP B;  1Q9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...