1P22A

Structure of a beta-trcp1-skp1-beta-catenin complex: destruction motif binding and lysine specificity on the scfbeta-trcp1 ubiquitin ligase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
411
structure length
402
Chain Sequence
SPAIMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/WD-repeat protein 1A
publication title Structure of a beta-TrCP1-Skp1-beta-Catenin complex: destruction motif binding and lysine specificity of the SCFbeta-TrCP1 ubiquitin ligase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 107
structure length 402
sequence length 411
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1p22A01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1p22A02
4GQ1A 2P1PB 4A09A 1XKSA 3NVXA 5EMJB 5GSAA 3UKRC 5KDOB 4AOWA 3AL9A 1MG2A 3SHFA 3OW8A 4U7AA 5I5IA 3MZKA 2H14A 3SBQA 5TEEA 3IKOA 3A0FA 4J0XA 4YVDA 3C6PB 1ERJA 5TEFA 4ZOYA 2W18A 4A09B 3V9FA 3BG1A 5EMLB 4O9DA 2Z2NA 2P9LC 4XYHA 5EMKB 3E0CA 3EI3A 2B5MA 3SN6B 3ULEC 3OL2A 5HE1B 4XEIC 1VYHC 3MKQA 1TBGA 4IA9A 1SQJA 4PXWA 4L1QD 5CXCA 4QT8A 3ZWLB 3MMYA 3NVNA 2O9KA 3N0EA 3FGBA 1RI6A 4A08A 5EAMA 4FAVD 2CO0A 2CE8A 4CZYA 4I6JB 2XL2A 1YFQA 3PXWD 4J77A 4X61B 4PBZA 3OL2B 4A2MA 3FM0A 5IBKB 3SBPA 4GMBA 5TDHB 5C2WB 4XYIA 4N14A 3SVWD 3J80g 4QRJA 4J73A 3SCYA 5I5MA 5TF2A 4ZOXA 2H68A 5AMSA 4ERQA 4CI8A 3UVKA 3I7LA 3UR4A 2E31A 3DXMC 4HDJA 4ERZA 1B9YA 3SLED 2CN3A 3U4YA 4FWWA 4OZUA 2Q7QA 2P9PC 1MG3A 3K26A 4LGNA 3RN1D 3UVOA 2EBSA 5THAA 4JSXC 2YMUA 3CFVA 4L9OA 4J79A 4I79A 3C9CA 2AQ5A 2PM7B 3CFSB 1SQ9A 2YBAA 4A2LA 3RSEC 3JAMg 3EMHA 2H9MA 3AL8A 5FKTA 4A11A 2G99A 4H5JA 5H1MA 1A0RB 5EM2A 2J57G 1JMZB 5CXBA 3BWSA 5C2VB 1MDAH 2B4EA 5EAPA 2G9AA 4CY3A 2P1NB 3AH8B 4GZ8A 3C6NB 3UVMA 3I89A 2OVPB 2IUQA 2YB8B 4CI3A 1NR0A 3OGMB 4JXMA 3AL8B 5FA5B 4CY2A 2P1OB 3SMRA 2GC7A 5FKSA 4NSXA 3GFCA 4CZVA 5EM2B 2OIZA 2PM9A 2H47A 5FQDA 4E54A 5H14A 1FS1A 5FLXg 5HE3B 5CYKA 2H9PA 5CXBB 1B9XA 1GXRA 3OKWA 2H9NA 3JZNA 4CY5A 2IWFA 2P9KC 3RFHA 2IWKA 4PBYA 1PBYB 3JB9L 2QC5A 3V7DB 3OKYB 3GREA 2TRCB 3JZHA 4J8BA 3EWEA 3RMZD 2HXCA 2QXVA 2J55H 3EI1A 2H3XA 3DWLC 3C5MA 3I7NA 2PM9B 2XYIA 3I7HA 4CI1A 4E54B 3JPXA 2H9LA 3ODTA 5CYKB 4A0AA 3C75H 3AFCA 3PVWB 3OKTA 4FAND 3DSMA 5GXHA 4J0WA 5HQGA 4GGCA 2H6KA 3L2OB 1U4CA 4A0BA 2IURA 3P4FA 5AFU3 4QL1A 3JZGA 4E5ZA 3EI1B 2MTAH 2BBKH 3I7OA 4H5IA 2I0TA 5HE2B 3C99A 1FWXA 2IUPA 4K3JB 2UZXB 4AEZA 3EI3B 4CI2A 4ZN4A 4A0AB 2B5LA 2I0SA 2CO0C 4J87A 4GGDA 4ESGA 2P9SC 2YNOA 5CXCB 2P9UC 3L4OD 5SXMA 2B5NA 4E5ZB 2AGXA 2BCJB 1JJUB 1XIPA 3I2NA 2H6NA 5K19A 1LDKE 3RRMC 5GXIA 4LG9A 4BL0A 4A08B 5IGOA 5FXYA 2YNNA 2P9IC 4PSXB 5HE0B 3B7FA 4FA5D 3I8CA 2IAAA 5C9ZB 5IT9g 3PSLA 4U1EI 5A2Qg 2Z2PA 5IGQA 3UKUC 1P22A 1Q47A 2GNQA 2AH0A 2CNXA 4JSNC 4IMMA 1JMXB 4GQ2P 4BH6A 3OGLB 4R7AB 3F3FA 4JSVC 3MKSB 4O45A 2Z2OA 3VGZA 3MZLA 3J81g 4ERYA 5I5JA 4G56B 3PXSD 2OVRB 4Z8LA 5K1CC 5IC7A 4A11B 2HYEA 3IIYA 1N6EA 3I7PA 4GGAA 4J84A 4J86A 2UZYB 2PBIB 5AJAA 3DM0A 1OMWB 3F3PA 1PI6A 2CE9A 3UVNA 2YNPA 3EI4A 4O3TB 4L3HD 4UI9R 4BUJC 3BG0A 3OTTA 5EMMB 3FRXA 5FKQA 3RFGA 4JD2C 2CN2A 4EWRA 4GM8A 4PC0A 3SJLD 2J56H 3RN0D 4OWRA 4X60B 2P1MB 1NEXB 2P1QB 3F3GA 4D0KA 2PM6B 3PVUB 4PNKB 2OJYA 3IIWA 3NVQA 1TYQC 4FHLA 4FA9D 3EI4B 3MXXA 2AGZA 3RLMD 5FKRA 5B4WA 4ES0A 4K3ID 4A7JA 2OVQB 3KRWB 2XL3A 3IJ1A 2I3SA 3V5WB 5JWZA 4PSWB 3L4MD 4O3UB 4FA4D 5IJ8E 4J78A 3SBRA 3EG6A 4TZ4A 3PSCB 4ZOZA 4CC9A 2OK4A 4Y5RD 3HFQA 4A0BB 5IJ7E 3EI2A 4GM3A 2GC4A 2H6QA 4JT5C 3C6OB 4J8GA 3OGKB 1K32A 2AH1A 3JRPA 4ZOVA 4QQEA 1PEVA 4J81A 1GOTB 3JROA 4CY1A 3PXTD 1N6FA 1N6DA 3UVLA 4CZXA 2HKMA 3SWSD 2HKRA 4JT6C 5EARA 2XU7A 3I7KA 4X63B 5H17A 3IJ0A 3EI2B 2H13A 3KRXB 4KFMB 3W15A 1L0QA 4L3GD 3N0DA 4GQBB 1S4UX 4D6VA 4X3EA 2HJBA 3SXTD 2OK6A 1SHYB 4MK0B 3DXKC 4FB1D 1U2VC 3K27A 3CIKB 1PGUA 3PE7A 1QNIA 4FA1D 2HESX 1GP2B 3ORVD 4O1QD 2AGWA 1OLZA 1XHMA 1JOFA 1K8KC 3EU7A 5EALA 5HYNB 5GMKn 3VH0A 4JSPC 1GG2B 4GM9A 2AGLA 2I0RA 3IJCA 2I3TA 3I8EA 4J82A 1R5MA 2P9NC 2HJ4A 3SFZA 3OKYA 3WSOA 4LG8A 3VA6A 2IUVA 2AGYA 2E32A 4Y7RA
chains in the Genus database with same CATH superfamily
4FK0A 3T3PA 4GQ1A 2P1PB 1GOGA 3MUOA 1XKSA 4A09A 1IH7A 1GOHA 2MZWB 3NVXA 4WK0A 3NIFA 5EMJB 5GSAA 1XMFE 3NAEA 3C94A 4M3ZA 4AN0A 3UKRC 5KDOB 4AOWA 4UM8A 3AL9A 1MG2A 3SHFA 4DU1A 2VJ4A 4AKGA 1O6FA 1FZ2E 3OW8A 2VDNA 4U7AA 4FK2A 5I5IA 3MZKA 4B08A 2H14A 3SBQA 4FJJA 5TEEA 2JH9A 3A0FA 3IKOA 4FJ9A 4J0XA 4RE5A 3QEXA 4FJMA 3C6PB 3TJYA 1ERJA 4YVDA 3O4HA 1UTCA 5TEFA 4ZOYA 1FXXA 2W18A 3SCXA 3ZE2A 4G55A 1E5TA 4A09B 3SUQA 2QXFA 4BP8A 3V9FA 3BG1A 1Q9YA 5EMLB 3IVMA 4O9DA 2Z2NA 2P9LC 4XYHA 5EMKB 3LDBA 3E0CA 3EI3A 1FZ6E 2RKHA 2B5MA 3IULA 5FFOA 3SN6B 3ULEC 3VI4A 3VI3A 3QETA 3OL2A 4XEIC 5HE1B 1VYHC 2EIEA 1TBGA 3MKQA 4IA9A 1SQJA 4PXWA 2HU7A 3QEVA 4L1QD 3QI0A 3SPYA 4AKIA 5CXCA 4QT8A 3ZWLB 3MMYA 1C9IA 3NVNA 2O9KA 3N0EA 1Q9XA 2DY4A 1UOQA 1XL3C 3RWUA 2FW3A 3QHYB 3FGBA 3EQ8A 1RI6A 1O6GA 4A08A 5H37A 5EAMA 2HU8A 2EIBA 4FAVD 2CO0A 2CE8A 4CZYA 4I6JB 4J2DA 2VDLA 2XL2A 4ICGC 3LD8A 3UO2A 1YFQA 4Z7NA 4AMYA 3PXWD 4J77A 2P5OA 4KHQA 2VDQA 4X61B 1A12A 4PBZA 3OL2B 4A2MA 3FM0A 5IBKB 3SBPA 4DTXA 2VC2A 3SUNA 4GMBA 3GC3B 4NC4A 4XYIA 4KI4A 5TDHB 5C2WB 4N14A 3SVWD 3J80g 4QRJA 4DTMA 4J73A 3SCYA 5I5MA 3O4IA 2PFVA 5TF2A 4ZOXA 2H68A 5AMSA 4ERQA 4CI8A 3UVKA 3I7LA 2OZSA 2E31A 3UR4A 3DXMC 4HDJA 4ERZA 1B9YA 4M3XA 3SLED 2CN3A 3U4YA 4FWWA 4OZUA 4BCBA 2Q7QA 1GOFA 2P9PC 1MG3A 3K26A 4LGNA 3J2PA 3RN1D 3UVOA 2EBSA 5THAA 5M5SA 4JSXC 2YMUA 3CFVA 4L9OA 4I79A 3C9CA 4J79A 2AQ5A 2PM7B 3CFSB 1SQ9A 2YBAA 4A2LA 3RSEC 3JAMg 4QNDA 3EMHA 1H2ZA 3IUNA 2H9MA 4G1EA 3AL8A 2H4TA 3DDUA 2B7MA 3BVOA 4DNUA 4EPHA 2VZ3A 5FKTA 4A11A 2G99A 4H5JA 2JHAA 5H1MA 4DTJA 1A0RB 5EM2A 1K3IA 3SQ2A 4AN1A 3N1EA 2J57G 4RE6A 1JMZB 2VZ1A 4FJGA 5CXBA 3BWSA 5C2VB 2QZPA 1MDAH 1E8MA 3K2OA 2B4EA 5EAPA 2G9AA 4CY3A 2P1NB 2VDMA 3AH8B 4JHPC 4WJKA 1MHZG 2B1EA 3IUJA 4GZ8A 3RMCA 3C6NB 3UVMA 3I89A 2OVPB 2IUQA 2YB8B 4CI3A 4EYWA 1FZ9E 1NR0A 3OGMB 4JXMA 4RG8A 4X5MA 3AL8B 5FA5B 4CY2A 2P1OB 3SMRA 2GC7A 5FKSA 4NSXA 3GFCA 4HCBA 4CZVA 2EICA 3E4YA 2YB5A 5EM2B 4DTNA 4M3YA 2OIZA 2PM9A 2H47A 5FQDA 2MMBA 4E54A 5H14A 1MTYG 1FS1A 1FZIE 3NGIA 5HDBA 3V4VA 5FLXg 3S9HA 5HE3B 5CYKA 2H9PA 5CXBB 1B9XA 3CFRA 1GXRA 3OKWA 2H9NA 2XE4A 4RL5A 3JZNA 3ZE0A 4CY5A 2HU5A 2IWFA 1FZ5E 4AX4A 1FZHE 4G1MA 2P9KC 3RFHA 3TL8B 2IWKA 4KHSA 4FJ7A 4PBYA 2VIXA 3HGKE 1PBYB 2VDRA 2LF6A 3JB9L 2BKLA 2QC5A 3V7DB 3OKYB 3GREA 2TRCB 3JZHA 4J8BA 3EWEA 3RMZD 2HXCA 2QXVA 2J55H 3EI1A 2H3XA 2LF3A 4Z7OA 3QEIA 3DWLC 3NHGA 3C5MA 3I7NA 4DTRA 2PM9B 2XYIA 3I7HA 4CI1A 4E54B 3JPXA 2H9LA 3ODTA 5CYKB 4A0AA 3C75H 3AFCA 3PVWB 3OKTA 3EQ7A 3ZE1A 4FAND 3DSMA 2VDOA 5GXHA 3GD1I 4J0WA 5HQGA 1FZ0E 3TAFA 4KHNA 2H6KA 4JRQA 3J27A 4GGCA 3L2OB 2PFTA 1U4CA 4A0BA 2IURA 3P4FA 3K72A 5AFU3 4QL1A 3JZGA 4E5ZA 3EI1B 2MTAH 3KD5E 2BBKH 3I7OA 3MUNA 4H5IA 2I0TA 4J2BA 5HE2B 3C99A 4KHWA 1FWXA 3N1BA 4AMZA 2IUPA 1C9LA 1L5GA 4K3JB 1VE7A 2UZXB 4AEZA 2K5SA 3EQ9A 3EI3B 4CI2A 4ZN4A 4A0AB 2B5LA 2I0SA 3UO3A 2CO0C 3QNOA 5M61A 4J87A 4GGDA 4FK4A 4ESGA 2P9SC 2YNOA 4KHYA 5CXCB 2P9UC 4L1MA 1VZ3A 1XU3E 3L4OD 5SXMA 2B5NA 4E5ZB 2AGXA 4O02A 3E4WA 4M3RA 3SQ1A 3OF7A 2BCJB 1JJUB 1XIPA 3I2NA 2H6NA 5K19A 1LDKE 3RRMC 5GXIA 4LG9A 4BL0A 4A08B 4J2AA 3LZJA 5IGOA 4GAMC 5FXYA 2EIDA 2DEBA 2YNNA 2P9IC 4ADNA 4PSXB 5HE0B 4BCDA 4NENA 3B7FA 4FA5D 3I8CA 1XMGE 1VE6A 2IAAA 5C9ZB 5IT9g 3RMDA 3PSLA 5C86A 4U1EI 1FPOA 5A2Qg 2XZGA 2Z2PA 5IGQA 3UKUC 3NE6A 1E8NA 1P22A 3QERA 1Q47A 2GNQA 2MW2A 2AH0A 5E6SA 2CNXA 4JSNC 2VDPA 1JTDB 4J2EA 1IG9A 4IMMA 1XVEE 1JMXB 5IREA 5IZ7A 4GQ2P 4KHUA 2JQTA 4BH6A 5M5RA 3OGLB 4M3WA 4R7AB 1MMOG 3F3FA 4HCCA 4JSVC 1FYZE 4DU3A 3MKSB 4O45A 2Z2OA 3ZDZA 3RMAA 3NCIA 4EP9A 3VGZA 1QFMA 2JH8A 3MZLA 3L8BA 3J81g 4ERYA 4M3UA 4DNVA 5I5JA 3SPZA 1FZ8E 4G56B 3L0MA 1H2XA 3PXSD 2OVRB 4Z8LA 5K1CC 5IC7A 4A11B 2HYEA 3IIYA 1M1XA 1N6EA 3I7PA 4GGAA 4J84A 4J86A 3HL8A 1YR2A 1H2YA 4JRPA 3TABA 4KI6A 2PBIB 2UZYB 5AJAA 5E6UA 3DM0A 1OMWB 1FZ1E 1H2WA 3F3PA 1XVDE 1PI6A 2CE9A 3UVNA 2YNPA 3EI4A 2P5GA 4L3HD 4O3TB 4DTUA 4UI9R 3LZIA 4BUJC 3BG0A 4I9LA 3OTTA 5EMMB 3FRXA 5FKQA 3RFGA 3K71A 4JD2C 2CN2A 1UOOA 4EWRA 4NBMA 4E3SA 4GM8A 1XVFE 3IUQA 4PC0A 3SJLD 2J56H 3RN0D 4OWRA 4BCCA 4X60B 2P1MB 1XVCE 5E6RA 4BP9A 2HD0A 1NEXB 2DTUA 2P1QB 3F3GA 4D0KA 2PM6B 3ZDYA 3PVUB 1XVGE 4Z7QA 3C95A 4PNKB 2OJYA 2VJ5A 1MHYG 3IIWA 1WAFA 1I2MB 5M5VA 3NVQA 3UIQA 3KCIA 3QNNA 1TYQC 3NDKA 3CQ8A 4FHLA 4UM9A 4FA9D 3EI4B 3SUPA 3MXXA 2AGZA 3IJEA 3RLMD 5FKRA 3RMBA 5C92A 3HGLA 1XMHE 4FJNA 5B4WA 2OZMA 4ES0A 4K3ID 4FJKA 2FYOA 4A7JA 3QEWA 2OVQB 3KRWB 2XDWA 3CFOA 2JHPA 2XL3A 3IJ1A 2RCUA 2I3SA 3V5WB 5JWZA 4PSWB 3L1NA 3ZDXA 3L4MD 4O3UB 4FJHA 4M3TA 4FA4D 5IJ8E 4J78A 4X5NA 4D9SA 3SBRA 3EG6A 4TZ4A 3SI6A 1FZ4E 3PSCB 3O4JA 4ZOZA 4O2WA 4WK4A 3QESA 4NAAA 4CC9A 2OK4A 4E4BA 1XVBE 3HFQA 4Y5RD 4A0BB 5IJ7E 3SQ0A 3SJJA 3EI2A 1JV2A 2OYQA 4GM3A 4IRZA 2GC4A 2H6QA 1VZ2A 4JT5C 4MMYA 5M5TA 3C6OB 4RNGA 4MMZA 4J8GA 1T2XA 3MVDK 3V4PA 4AKHA 4DTSA 3IURA 3OGKB 1N1CA 2ATQA 1K32A 4FJ8A 3T3MA 1XU5E 3HP9A 2AH1A 3JRPA 2B8IA 4ZOVA 4QQEA 1PEVA 4J81A 4DTPA 1GOTB 3JROA 4CY1A 3PXTD 2JHCA 1N6FA 1N6DA 2QR5A 3UVLA 2HKMA 4CZXA 1QFSA 3SWSD 2WQ8A 4FJIA 2HKRA 4M45A 4AI6A 1UOPA 3FCSA 4JT6C 4FVMA 5EARA 2XU7A 4WK2A 4FJLA 3I7KA 1CLQA 4X63B 3QEPA 5H17A 4FJXA 3IJ0A 3EI2B 3TAEA 2H13A 3KRXB 4KFMB 5FFGA 5M5UA 4M42A 3IUMA 3W15A 1L0QA 4L3GD 4IT5A 3N0DA 4GQBB 1S4UX 3K6SA 4D6VA 4X3EA 2HJBA 3SXTD 2OK6A 4DTOA 1SHYB 4MK0B 3DXKC 2VDKA 4DNWA 4FB1D 3SQ4A 4I9QA 1U2VC 3K27A 3LDSA 3SNNA 3CIKB 3O4GA 1PGUA 4JHNA 1WAJA 3PE7A 4QNCA 4QAMA 3FCUA 4FJ5A 4DU4A 1QNIA 2HESX 4FA1D 1GP2B 3KD1E 3ORVD 3NIGA 4O1QD 3TAGA 2AGWA 1OLZA 1XHMA 1FZ7E 1JOFA 1K8KC 3SUOA 1JW2A 1BPOA 3EU7A 5EALA 5HYNB 5GMKn 3SVIA 1FZ3E 3NIDA 2JPNA 3VH0A 1GG2B 4JSPC 3CFPA 4M41A 4JS4A 2AGLA 2I0RA 3IJCA 4GM9A 2I3TA 3I8EA 1R5MA 2P9NC 4J82A 2HJ4A 3SFZA 3OKYA 3WSOA 4LG8A 3VA6A 4MMXA 2IUVA 1TYEA 4JS5A 1U8CA 2AGYA 2JKXA 4ADOA 2E32A 4Y7RA
chains in the Genus database with same CATH topology
4FK0A 4GQ1A 2P1PB 4A09A 1XKSA 1IH7A 2MZWB 3NVXA 5EMJB 5GSAA 1XMFE 3NAEA 3C94A 4M3ZA 3UKRC 5KDOB 4AOWA 3AL9A 1MG2A 3SHFA 4DU1A 2VJ4A 4AKGA 1FZ2E 3OW8A 4U7AA 4FK2A 5I5IA 3MZKA 4B08A 2H14A 3SBQA 4FJJA 5TEEA 2JH9A 3A0FA 3IKOA 4FJ9A 4J0XA 3QEXA 4FJMA 3C6PB 3TJYA 1ERJA 4YVDA 5TEFA 4ZOYA 1FXXA 2W18A 3SCXA 4A09B 3SUQA 2QXFA 3V9FA 3BG1A 1Q9YA 5EMLB 4O9DA 2Z2NA 2P9LC 4XYHA 5EMKB 3LDBA 3E0CA 3EI3A 1FZ6E 2B5MA 3SN6B 3ULEC 3QETA 3OL2A 4XEIC 5HE1B 1VYHC 3MKQA 1TBGA 4IA9A 1SQJA 4PXWA 3QEVA 4L1QD 3SPYA 4AKIA 5CXCA 4QT8A 3ZWLB 3MMYA 3NVNA 2O9KA 3N0EA 1Q9XA 2DY4A 1XL3C 3RWUA 2FW3A 3FGBA 1RI6A 4A08A 5H37A 5EAMA 4FAVD 2CO0A 2CE8A 4CZYA 4I6JB 4J2DA 2XL2A 3LD8A 1YFQA 3PXWD 4J77A 2P5OA 4KHQA 4X61B 4PBZA 3OL2B 4A2MA 3FM0A 5IBKB 3SBPA 4DTXA 3SUNA 4GMBA 5TDHB 5C2WB 4XYIA 4KI4A 4N14A 3SVWD 3J80g 4QRJA 4DTMA 4J73A 3SCYA 5I5MA 5TF2A 2PFVA 4ZOXA 2H68A 5AMSA 4ERQA 4CI8A 3UVKA 3I7LA 2OZSA 2E31A 3UR4A 3DXMC 4HDJA 4ERZA 1B9YA 4M3XA 3SLED 2CN3A 3U4YA 4FWWA 4OZUA 2Q7QA 2P9PC 1MG3A 3K26A 4LGNA 3J2PA 3RN1D 3UVOA 2EBSA 5THAA 4JSXC 2YMUA 3CFVA 4L9OA 4I79A 3C9CA 4J79A 2AQ5A 2PM7B 3CFSB 1SQ9A 2YBAA 4A2LA 3RSEC 3JAMg 4QNDA 3EMHA 2H9MA 3AL8A 2H4TA 2B7MA 4EPHA 5FKTA 4A11A 2G99A 4H5JA 2JHAA 5H1MA 4DTJA 1A0RB 5EM2A 3SQ2A 3N1EA 2J57G 1JMZB 4FJGA 5CXBA 3BWSA 5C2VB 1MDAH 3K2OA 2B4EA 5EAPA 2G9AA 4CY3A 2P1NB 3AH8B 1MHZG 2B1EA 4GZ8A 3RMCA 3C6NB 3UVMA 3I89A 2OVPB 2IUQA 2YB8B 4CI3A 4EYWA 1FZ9E 1NR0A 3OGMB 4JXMA 4RG8A 4X5MA 3AL8B 5FA5B 4CY2A 2P1OB 3SMRA 2GC7A 5FKSA 4NSXA 3GFCA 4HCBA 4CZVA 3E4YA 2YB5A 5EM2B 4DTNA 4M3YA 2OIZA 2PM9A 2H47A 5FQDA 2MMBA 4E54A 5H14A 1MTYG 1FS1A 1FZIE 3NGIA 5FLXg 3S9HA 5HE3B 5CYKA 2H9PA 5CXBB 1B9XA 3CFRA 1GXRA 3OKWA 2H9NA 3JZNA 4RL5A 4CY5A 2IWFA 1FZ5E 1FZHE 2P9KC 3RFHA 3TL8B 2IWKA 4KHSA 4FJ7A 4PBYA 2VIXA 3HGKE 1PBYB 2LF6A 3JB9L 2QC5A 3V7DB 3OKYB 3GREA 2TRCB 3JZHA 4J8BA 3EWEA 3RMZD 2HXCA 2QXVA 2J55H 3EI1A 2H3XA 2LF3A 3QEIA 3DWLC 3NHGA 3C5MA 3I7NA 4DTRA 2PM9B 2XYIA 3I7HA 4CI1A 4E54B 3JPXA 2H9LA 3ODTA 5CYKB 4A0AA 3C75H 3AFCA 3PVWB 3OKTA 4FAND 3DSMA 5GXHA 4J0WA 5HQGA 1FZ0E 3TAFA 4KHNA 2H6KA 4JRQA 3J27A 4GGCA 3L2OB 2PFTA 1U4CA 4A0BA 2IURA 3P4FA 5AFU3 4QL1A 3JZGA 4E5ZA 3EI1B 2MTAH 3KD5E 2BBKH 3I7OA 4H5IA 2I0TA 4J2BA 5HE2B 3C99A 4KHWA 1FWXA 3N1BA 2IUPA 4K3JB 2UZXB 4AEZA 3EI3B 4CI2A 4ZN4A 4A0AB 2B5LA 2I0SA 2CO0C 3QNOA 4J87A 4GGDA 4FK4A 4ESGA 2P9SC 2YNOA 4KHYA 5CXCB 2P9UC 1XU3E 3L4OD 5SXMA 2B5NA 4E5ZB 2AGXA 3E4WA 4M3RA 3SQ1A 2BCJB 1JJUB 1XIPA 3I2NA 2H6NA 5K19A 1LDKE 3RRMC 5GXIA 4LG9A 4BL0A 4A08B 4J2AA 3LZJA 5IGOA 4GAMC 5FXYA 2DEBA 2YNNA 2P9IC 4ADNA 4PSXB 5HE0B 3B7FA 4FA5D 3I8CA 1XMGE 2IAAA 5C9ZB 5IT9g 3RMDA 3PSLA 4U1EI 5A2Qg 2Z2PA 5IGQA 3UKUC 3NE6A 1P22A 3QERA 1Q47A 2GNQA 2AH0A 2CNXA 4JSNC 4J2EA 1IG9A 4IMMA 1XVEE 1JMXB 5IREA 5IZ7A 4GQ2P 4KHUA 4BH6A 3OGLB 4M3WA 4R7AB 1MMOG 3F3FA 4HCCA 4JSVC 1FYZE 4DU3A 3MKSB 4O45A 2Z2OA 3RMAA 3NCIA 4EP9A 3VGZA 2JH8A 3MZLA 3L8BA 3J81g 4ERYA 4M3UA 5I5JA 3SPZA 1FZ8E 4G56B 3L0MA 3PXSD 2OVRB 4Z8LA 5K1CC 5IC7A 4A11B 2HYEA 3IIYA 1N6EA 3I7PA 4GGAA 4J84A 4J86A 3HL8A 2UZYB 4JRPA 3TABA 4KI6A 2PBIB 5AJAA 3DM0A 1OMWB 1FZ1E 3F3PA 1XVDE 1PI6A 2CE9A 3UVNA 2YNPA 3EI4A 2P5GA 4L3HD 4O3TB 4DTUA 4UI9R 3LZIA 4BUJC 3BG0A 4I9LA 3OTTA 5EMMB 3FRXA 5FKQA 3RFGA 4JD2C 2CN2A 4EWRA 4E3SA 4GM8A 1XVFE 4PC0A 3SJLD 2J56H 3RN0D 4OWRA 4X60B 2P1MB 1XVCE 2HD0A 1NEXB 2DTUA 2P1QB 3F3GA 4D0KA 2PM6B 3PVUB 1XVGE 3C95A 4PNKB 2OJYA 2VJ5A 1MHYG 3IIWA 1WAFA 3NVQA 3UIQA 3QNNA 1TYQC 3NDKA 3CQ8A 4FHLA 4FA9D 3EI4B 3SUPA 3MXXA 2AGZA 3RLMD 5FKRA 3RMBA 3HGLA 1XMHE 4FJNA 5B4WA 2OZMA 4ES0A 4K3ID 4FJKA 2FYOA 4A7JA 3QEWA 2OVQB 3KRWB 3CFOA 2JHPA 2XL3A 3IJ1A 2RCUA 2I3SA 3V5WB 5JWZA 4PSWB 3L1NA 3L4MD 4O3UB 4FJHA 4M3TA 4FA4D 5IJ8E 4J78A 4X5NA 3SBRA 3EG6A 4TZ4A 3SI6A 1FZ4E 3PSCB 4ZOZA 3QESA 4CC9A 2OK4A 4E4BA 1XVBE 3HFQA 4Y5RD 4A0BB 5IJ7E 3SQ0A 3SJJA 3EI2A 2OYQA 4GM3A 2GC4A 2H6QA 4JT5C 3C6OB 4RNGA 4J8GA 4AKHA 4DTSA 3OGKB 2ATQA 1K32A 4FJ8A 1XU5E 3HP9A 2AH1A 3JRPA 2B8IA 4ZOVA 4QQEA 1PEVA 4J81A 4DTPA 1GOTB 3JROA 4CY1A 3PXTD 2JHCA 1N6FA 1N6DA 3UVLA 4CZXA 2HKMA 3SWSD 4FJIA 2HKRA 4M45A 4AI6A 4JT6C 4FVMA 5EARA 2XU7A 4FJLA 3I7KA 1CLQA 4X63B 3QEPA 5H17A 4FJXA 3IJ0A 3EI2B 3TAEA 2H13A 3KRXB 4KFMB 4M42A 3W15A 1L0QA 4L3GD 3N0DA 4GQBB 1S4UX 4D6VA 4X3EA 2HJBA 3SXTD 2OK6A 4DTOA 1SHYB 4MK0B 3DXKC 4FB1D 3SQ4A 4I9QA 1U2VC 3K27A 3LDSA 3SNNA 3CIKB 1PGUA 1WAJA 3PE7A 4QNCA 4FJ5A 4DU4A 1QNIA 2HESX 4FA1D 1GP2B 3KD1E 3ORVD 4O1QD 3TAGA 2AGWA 1OLZA 1XHMA 1FZ7E 1JOFA 1K8KC 3SUOA 3EU7A 5EALA 5HYNB 5GMKn 3SVIA 1FZ3E 2JPNA 3VH0A 1GG2B 4JSPC 3CFPA 4M41A 4JS4A 2AGLA 2I0RA 3IJCA 4GM9A 2I3TA 3I8EA 1R5MA 2P9NC 4J82A 2HJ4A 3SFZA 3OKYA 3WSOA 4LG8A 3VA6A 2IUVA 2AGYA 4JS5A 4ADOA 2E32A 4Y7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GQ1 A;  2P1P B;  4A09 A;  1XKS A;  3NVX A;  5EMJ B;  5GSA A;  3UKR C;  5KDO B;  4AOW A;  3AL9 A;  1MG2 A;  3SHF A;  3OW8 A;  4U7A A;  5I5I A;  3MZK A;  2H14 A;  3SBQ A;  5TEE A;  3IKO A;  3A0F A;  4J0X A;  4YVD A;  3C6P B;  1ERJ A;  5TEF A;  4ZOY A;  2W18 A;  4A09 B;  3V9F A;  3BG1 A;  5EML B;  4O9D A;  2Z2N A;  2P9L C;  4XYH A;  5EMK B;  3E0C A;  3EI3 A;  2B5M A;  3SN6 B;  3ULE C;  3OL2 A;  5HE1 B;  4XEI C;  1VYH C;  3MKQ A;  1TBG A;  4IA9 A;  1SQJ A;  4PXW A;  4L1Q D;  5CXC A;  4QT8 A;  3ZWL B;  3MMY A;  3NVN A;  2O9K A;  3N0E A;  3FGB A;  1RI6 A;  4A08 A;  5EAM A;  4FAV D;  2CO0 A;  2CE8 A;  4CZY A;  4I6J B;  2XL2 A;  1YFQ A;  3PXW D;  4J77 A;  4X61 B;  4PBZ A;  3OL2 B;  4A2M A;  3FM0 A;  5IBK B;  3SBP A;  4GMB A;  5TDH B;  5C2W B;  4XYI A;  4N14 A;  3SVW D;  3J80 g;  4QRJ A;  4J73 A;  3SCY A;  5I5M A;  5TF2 A;  4ZOX A;  2H68 A;  5AMS A;  4ERQ A;  4CI8 A;  3UVK A;  3I7L A;  3UR4 A;  2E31 A;  3DXM C;  4HDJ A;  4ERZ A;  1B9Y A;  3SLE D;  2CN3 A;  3U4Y A;  4FWW A;  4OZU A;  2Q7Q A;  2P9P C;  1MG3 A;  3K26 A;  4LGN A;  3RN1 D;  3UVO A;  2EBS A;  5THA A;  4JSX C;  2YMU A;  3CFV A;  4L9O A;  4J79 A;  4I79 A;  3C9C A;  2AQ5 A;  2PM7 B;  3CFS B;  1SQ9 A;  2YBA A;  4A2L A;  3RSE C;  3JAM g;  3EMH A;  2H9M A;  3AL8 A;  5FKT A;  4A11 A;  2G99 A;  4H5J A;  5H1M A;  1A0R B;  5EM2 A;  2J57 G;  1JMZ B;  5CXB A;  3BWS A;  5C2V B;  1MDA H;  2B4E A;  5EAP A;  2G9A A;  4CY3 A;  2P1N B;  3AH8 B;  4GZ8 A;  3C6N B;  3UVM A;  3I89 A;  2OVP B;  2IUQ A;  2YB8 B;  4CI3 A;  1NR0 A;  3OGM B;  4JXM A;  3AL8 B;  5FA5 B;  4CY2 A;  2P1O B;  3SMR A;  2GC7 A;  5FKS A;  4NSX A;  3GFC A;  4CZV A;  5EM2 B;  2OIZ A;  2PM9 A;  2H47 A;  5FQD A;  4E54 A;  5H14 A;  1FS1 A;  5FLX g;  5HE3 B;  5CYK A;  2H9P A;  5CXB B;  1B9X A;  1GXR A;  3OKW A;  2H9N A;  3JZN A;  4CY5 A;  2IWF A;  2P9K C;  3RFH A;  2IWK A;  4PBY A;  1PBY B;  3JB9 L;  2QC5 A;  3V7D B;  3OKY B;  3GRE A;  2TRC B;  3JZH A;  4J8B A;  3EWE A;  3RMZ D;  2HXC A;  2QXV A;  2J55 H;  3EI1 A;  2H3X A;  3DWL C;  3C5M A;  3I7N A;  2PM9 B;  2XYI A;  3I7H A;  4CI1 A;  4E54 B;  3JPX A;  2H9L A;  3ODT A;  5CYK B;  4A0A A;  3C75 H;  3AFC A;  3PVW B;  3OKT A;  4FAN D;  3DSM A;  5GXH A;  4J0W A;  5HQG A;  4GGC A;  2H6K A;  3L2O B;  1U4C A;  4A0B A;  2IUR A;  3P4F A;  5AFU 3;  4QL1 A;  3JZG A;  4E5Z A;  3EI1 B;  2MTA H;  2BBK H;  3I7O A;  4H5I A;  2I0T A;  5HE2 B;  3C99 A;  1FWX A;  2IUP A;  4K3J B;  2UZX B;  4AEZ A;  3EI3 B;  4CI2 A;  4ZN4 A;  4A0A B;  2B5L A;  2I0S A;  2CO0 C;  4J87 A;  4GGD A;  4ESG A;  2P9S C;  2YNO A;  5CXC B;  2P9U C;  3L4O D;  5SXM A;  2B5N A;  4E5Z B;  2AGX A;  2BCJ B;  1JJU B;  1XIP A;  3I2N A;  2H6N A;  5K19 A;  1LDK E;  3RRM C;  5GXI A;  4LG9 A;  4BL0 A;  4A08 B;  5IGO A;  5FXY A;  2YNN A;  2P9I C;  4PSX B;  5HE0 B;  3B7F A;  4FA5 D;  3I8C A;  2IAA A;  5C9Z B;  5IT9 g;  3PSL A;  4U1E I;  5A2Q g;  2Z2P A;  5IGQ A;  3UKU C;  1P22 A;  1Q47 A;  2GNQ A;  2AH0 A;  2CNX A;  4JSN C;  4IMM A;  1JMX B;  4GQ2 P;  4BH6 A;  3OGL B;  4R7A B;  3F3F A;  4JSV C;  3MKS B;  4O45 A;  2Z2O A;  3VGZ A;  3MZL A;  3J81 g;  4ERY A;  5I5J A;  4G56 B;  3PXS D;  2OVR B;  4Z8L A;  5K1C C;  5IC7 A;  4A11 B;  2HYE A;  3IIY A;  1N6E A;  3I7P A;  4GGA A;  4J84 A;  4J86 A;  2UZY B;  2PBI B;  5AJA A;  3DM0 A;  1OMW B;  3F3P A;  1PI6 A;  2CE9 A;  3UVN A;  2YNP A;  3EI4 A;  4O3T B;  4L3H D;  4UI9 R;  4BUJ C;  3BG0 A;  3OTT A;  5EMM B;  3FRX A;  5FKQ A;  3RFG A;  4JD2 C;  2CN2 A;  4EWR A;  4GM8 A;  4PC0 A;  3SJL D;  2J56 H;  3RN0 D;  4OWR A;  4X60 B;  2P1M B;  1NEX B;  2P1Q B;  3F3G A;  4D0K A;  2PM6 B;  3PVU B;  4PNK B;  2OJY A;  3IIW A;  3NVQ A;  1TYQ C;  4FHL A;  4FA9 D;  3EI4 B;  3MXX A;  2AGZ A;  3RLM D;  5FKR A;  5B4W A;  4ES0 A;  4K3I D;  4A7J A;  2OVQ B;  3KRW B;  2XL3 A;  3IJ1 A;  2I3S A;  3V5W B;  5JWZ A;  4PSW B;  3L4M D;  4O3U B;  4FA4 D;  5IJ8 E;  4J78 A;  3SBR A;  3EG6 A;  4TZ4 A;  3PSC B;  4ZOZ A;  4CC9 A;  2OK4 A;  4Y5R D;  3HFQ A;  4A0B B;  5IJ7 E;  3EI2 A;  4GM3 A;  2GC4 A;  2H6Q A;  4JT5 C;  3C6O B;  4J8G A;  3OGK B;  1K32 A;  2AH1 A;  3JRP A;  4ZOV A;  4QQE A;  1PEV A;  4J81 A;  1GOT B;  3JRO A;  4CY1 A;  3PXT D;  1N6F A;  1N6D A;  3UVL A;  4CZX A;  2HKM A;  3SWS D;  2HKR A;  4JT6 C;  5EAR A;  2XU7 A;  3I7K A;  4X63 B;  5H17 A;  3IJ0 A;  3EI2 B;  2H13 A;  3KRX B;  4KFM B;  3W15 A;  1L0Q A;  4L3G D;  3N0D A;  4GQB B;  1S4U X;  4D6V A;  4X3E A;  2HJB A;  3SXT D;  2OK6 A;  1SHY B;  4MK0 B;  3DXK C;  4FB1 D;  1U2V C;  3K27 A;  3CIK B;  1PGU A;  3PE7 A;  1QNI A;  4FA1 D;  2HES X;  1GP2 B;  3ORV D;  4O1Q D;  2AGW A;  1OLZ A;  1XHM A;  1JOF A;  1K8K C;  3EU7 A;  5EAL A;  5HYN B;  5GMK n;  3VH0 A;  4JSP C;  1GG2 B;  4GM9 A;  2AGL A;  2I0R A;  3IJC A;  2I3T A;  3I8E A;  4J82 A;  1R5M A;  2P9N C;  2HJ4 A;  3SFZ A;  3OKY A;  3WSO A;  4LG8 A;  3VA6 A;  2IUV A;  2AGY A;  2E32 A;  4Y7R A; 
#chains in the Genus database with same CATH topology
 4FK0 A;  3T3P A;  4GQ1 A;  2P1P B;  1GOG A;  3MUO A;  1XKS A;  4A09 A;  1IH7 A;  1GOH A;  2MZW B;  3NVX A;  4WK0 A;  3NIF A;  5EMJ B;  5GSA A;  1XMF E;  3NAE A;  3C94 A;  4M3Z A;  4AN0 A;  3UKR C;  5KDO B;  4AOW A;  4UM8 A;  3AL9 A;  1MG2 A;  3SHF A;  4DU1 A;  2VJ4 A;  4AKG A;  1O6F A;  1FZ2 E;  3OW8 A;  2VDN A;  4U7A A;  4FK2 A;  5I5I A;  3MZK A;  4B08 A;  2H14 A;  3SBQ A;  4FJJ A;  5TEE A;  2JH9 A;  3A0F A;  3IKO A;  4FJ9 A;  4J0X A;  4RE5 A;  3QEX A;  4FJM A;  3C6P B;  3TJY A;  1ERJ A;  4YVD A;  3O4H A;  1UTC A;  5TEF A;  4ZOY A;  1FXX A;  2W18 A;  3SCX A;  3ZE2 A;  4G55 A;  1E5T A;  4A09 B;  3SUQ A;  2QXF A;  4BP8 A;  3V9F A;  3BG1 A;  1Q9Y A;  5EML B;  3IVM A;  4O9D A;  2Z2N A;  2P9L C;  4XYH A;  5EMK B;  3LDB A;  3E0C A;  3EI3 A;  1FZ6 E;  2RKH A;  2B5M A;  3IUL A;  5FFO A;  3SN6 B;  3ULE C;  3VI4 A;  3VI3 A;  3QET A;  3OL2 A;  4XEI C;  5HE1 B;  1VYH C;  2EIE A;  1TBG A;  3MKQ A;  4IA9 A;  1SQJ A;  4PXW A;  2HU7 A;  3QEV A;  4L1Q D;  3QI0 A;  3SPY A;  4AKI A;  5CXC A;  4QT8 A;  3ZWL B;  3MMY A;  1C9I A;  3NVN A;  2O9K A;  3N0E A;  1Q9X A;  2DY4 A;  1UOQ A;  1XL3 C;  3RWU A;  2FW3 A;  3QHY B;  3FGB A;  3EQ8 A;  1RI6 A;  1O6G A;  4A08 A;  5H37 A;  5EAM A;  2HU8 A;  2EIB A;  4FAV D;  2CO0 A;  2CE8 A;  4CZY A;  4I6J B;  4J2D A;  2VDL A;  2XL2 A;  4ICG C;  3LD8 A;  3UO2 A;  1YFQ A;  4Z7N A;  4AMY A;  3PXW D;  4J77 A;  2P5O A;  4KHQ A;  2VDQ A;  4X61 B;  1A12 A;  4PBZ A;  3OL2 B;  4A2M A;  3FM0 A;  5IBK B;  3SBP A;  4DTX A;  2VC2 A;  3SUN A;  4GMB A;  3GC3 B;  4NC4 A;  4XYI A;  4KI4 A;  5TDH B;  5C2W B;  4N14 A;  3SVW D;  3J80 g;  4QRJ A;  4DTM A;  4J73 A;  3SCY A;  5I5M A;  3O4I A;  2PFV A;  5TF2 A;  4ZOX A;  2H68 A;  5AMS A;  4ERQ A;  4CI8 A;  3UVK A;  3I7L A;  2OZS A;  2E31 A;  3UR4 A;  3DXM C;  4HDJ A;  4ERZ A;  1B9Y A;  4M3X A;  3SLE D;  2CN3 A;  3U4Y A;  4FWW A;  4OZU A;  4BCB A;  2Q7Q A;  1GOF A;  2P9P C;  1MG3 A;  3K26 A;  4LGN A;  3J2P A;  3RN1 D;  3UVO A;  2EBS A;  5THA A;  5M5S A;  4JSX C;  2YMU A;  3CFV A;  4L9O A;  4I79 A;  3C9C A;  4J79 A;  2AQ5 A;  2PM7 B;  3CFS B;  1SQ9 A;  2YBA A;  4A2L A;  3RSE C;  3JAM g;  4QND A;  3EMH A;  1H2Z A;  3IUN A;  2H9M A;  4G1E A;  3AL8 A;  2H4T A;  3DDU A;  2B7M A;  3BVO A;  4DNU A;  4EPH A;  2VZ3 A;  5FKT A;  4A11 A;  2G99 A;  4H5J A;  2JHA A;  5H1M A;  4DTJ A;  1A0R B;  5EM2 A;  1K3I A;  3SQ2 A;  4AN1 A;  3N1E A;  2J57 G;  4RE6 A;  1JMZ B;  2VZ1 A;  4FJG A;  5CXB A;  3BWS A;  5C2V B;  2QZP A;  1MDA H;  1E8M A;  3K2O A;  2B4E A;  5EAP A;  2G9A A;  4CY3 A;  2P1N B;  2VDM A;  3AH8 B;  4JHP C;  4WJK A;  1MHZ G;  2B1E A;  3IUJ A;  4GZ8 A;  3RMC A;  3C6N B;  3UVM A;  3I89 A;  2OVP B;  2IUQ A;  2YB8 B;  4CI3 A;  4EYW A;  1FZ9 E;  1NR0 A;  3OGM B;  4JXM A;  4RG8 A;  4X5M A;  3AL8 B;  5FA5 B;  4CY2 A;  2P1O B;  3SMR A;  2GC7 A;  5FKS A;  4NSX A;  3GFC A;  4HCB A;  4CZV A;  2EIC A;  3E4Y A;  2YB5 A;  5EM2 B;  4DTN A;  4M3Y A;  2OIZ A;  2PM9 A;  2H47 A;  5FQD A;  2MMB A;  4E54 A;  5H14 A;  1MTY G;  1FS1 A;  1FZI E;  3NGI A;  5HDB A;  3V4V A;  5FLX g;  3S9H A;  5HE3 B;  5CYK A;  2H9P A;  5CXB B;  1B9X A;  3CFR A;  1GXR A;  3OKW A;  2H9N A;  2XE4 A;  4RL5 A;  3JZN A;  3ZE0 A;  4CY5 A;  2HU5 A;  2IWF A;  1FZ5 E;  4AX4 A;  1FZH E;  4G1M A;  2P9K C;  3RFH A;  3TL8 B;  2IWK A;  4KHS A;  4FJ7 A;  4PBY A;  2VIX A;  3HGK E;  1PBY B;  2VDR A;  2LF6 A;  3JB9 L;  2BKL A;  2QC5 A;  3V7D B;  3OKY B;  3GRE A;  2TRC B;  3JZH A;  4J8B A;  3EWE A;  3RMZ D;  2HXC A;  2QXV A;  2J55 H;  3EI1 A;  2H3X A;  2LF3 A;  4Z7O A;  3QEI A;  3DWL C;  3NHG A;  3C5M A;  3I7N A;  4DTR A;  2PM9 B;  2XYI A;  3I7H A;  4CI1 A;  4E54 B;  3JPX A;  2H9L A;  3ODT A;  5CYK B;  4A0A A;  3C75 H;  3AFC A;  3PVW B;  3OKT A;  3EQ7 A;  3ZE1 A;  4FAN D;  3DSM A;  2VDO A;  5GXH A;  3GD1 I;  4J0W A;  5HQG A;  1FZ0 E;  3TAF A;  4KHN A;  2H6K A;  4JRQ A;  3J27 A;  4GGC A;  3L2O B;  2PFT A;  1U4C A;  4A0B A;  2IUR A;  3P4F A;  3K72 A;  5AFU 3;  4QL1 A;  3JZG A;  4E5Z A;  3EI1 B;  2MTA H;  3KD5 E;  2BBK H;  3I7O A;  3MUN A;  4H5I A;  2I0T A;  4J2B A;  5HE2 B;  3C99 A;  4KHW A;  1FWX A;  3N1B A;  4AMZ A;  2IUP A;  1C9L A;  1L5G A;  4K3J B;  1VE7 A;  2UZX B;  4AEZ A;  2K5S A;  3EQ9 A;  3EI3 B;  4CI2 A;  4ZN4 A;  4A0A B;  2B5L A;  2I0S A;  3UO3 A;  2CO0 C;  3QNO A;  5M61 A;  4J87 A;  4GGD A;  4FK4 A;  4ESG A;  2P9S C;  2YNO A;  4KHY A;  5CXC B;  2P9U C;  4L1M A;  1VZ3 A;  1XU3 E;  3L4O D;  5SXM A;  2B5N A;  4E5Z B;  2AGX A;  4O02 A;  3E4W A;  4M3R A;  3SQ1 A;  3OF7 A;  2BCJ B;  1JJU B;  1XIP A;  3I2N A;  2H6N A;  5K19 A;  1LDK E;  3RRM C;  5GXI A;  4LG9 A;  4BL0 A;  4A08 B;  4J2A A;  3LZJ A;  5IGO A;  4GAM C;  5FXY A;  2EID A;  2DEB A;  2YNN A;  2P9I C;  4ADN A;  4PSX B;  5HE0 B;  4BCD A;  4NEN A;  3B7F A;  4FA5 D;  3I8C A;  1XMG E;  1VE6 A;  2IAA A;  5C9Z B;  5IT9 g;  3RMD A;  3PSL A;  5C86 A;  4U1E I;  1FPO A;  5A2Q g;  2XZG A;  2Z2P A;  5IGQ A;  3UKU C;  3NE6 A;  1E8N A;  1P22 A;  3QER A;  1Q47 A;  2GNQ A;  2MW2 A;  2AH0 A;  5E6S A;  2CNX A;  4JSN C;  2VDP A;  1JTD B;  4J2E A;  1IG9 A;  4IMM A;  1XVE E;  1JMX B;  5IRE A;  5IZ7 A;  4GQ2 P;  4KHU A;  2JQT A;  4BH6 A;  5M5R A;  3OGL B;  4M3W A;  4R7A B;  1MMO G;  3F3F A;  4HCC A;  4JSV C;  1FYZ E;  4DU3 A;  3MKS B;  4O45 A;  2Z2O A;  3ZDZ A;  3RMA A;  3NCI A;  4EP9 A;  3VGZ A;  1QFM A;  2JH8 A;  3MZL A;  3L8B A;  3J81 g;  4ERY A;  4M3U A;  4DNV A;  5I5J A;  3SPZ A;  1FZ8 E;  4G56 B;  3L0M A;  1H2X A;  3PXS D;  2OVR B;  4Z8L A;  5K1C C;  5IC7 A;  4A11 B;  2HYE A;  3IIY A;  1M1X A;  1N6E A;  3I7P A;  4GGA A;  4J84 A;  4J86 A;  3HL8 A;  1YR2 A;  1H2Y A;  4JRP A;  3TAB A;  4KI6 A;  2PBI B;  2UZY B;  5AJA A;  5E6U A;  3DM0 A;  1OMW B;  1FZ1 E;  1H2W A;  3F3P A;  1XVD E;  1PI6 A;  2CE9 A;  3UVN A;  2YNP A;  3EI4 A;  2P5G A;  4L3H D;  4O3T B;  4DTU A;  4UI9 R;  3LZI A;  4BUJ C;  3BG0 A;  4I9L A;  3OTT A;  5EMM B;  3FRX A;  5FKQ A;  3RFG A;  3K71 A;  4JD2 C;  2CN2 A;  1UOO A;  4EWR A;  4NBM A;  4E3S A;  4GM8 A;  1XVF E;  3IUQ A;  4PC0 A;  3SJL D;  2J56 H;  3RN0 D;  4OWR A;  4BCC A;  4X60 B;  2P1M B;  1XVC E;  5E6R A;  4BP9 A;  2HD0 A;  1NEX B;  2DTU A;  2P1Q B;  3F3G A;  4D0K A;  2PM6 B;  3ZDY A;  3PVU B;  1XVG E;  4Z7Q A;  3C95 A;  4PNK B;  2OJY A;  2VJ5 A;  1MHY G;  3IIW A;  1WAF A;  1I2M B;  5M5V A;  3NVQ A;  3UIQ A;  3KCI A;  3QNN A;  1TYQ C;  3NDK A;  3CQ8 A;  4FHL A;  4UM9 A;  4FA9 D;  3EI4 B;  3SUP A;  3MXX A;  2AGZ A;  3IJE A;  3RLM D;  5FKR A;  3RMB A;  5C92 A;  3HGL A;  1XMH E;  4FJN A;  5B4W A;  2OZM A;  4ES0 A;  4K3I D;  4FJK A;  2FYO A;  4A7J A;  3QEW A;  2OVQ B;  3KRW B;  2XDW A;  3CFO A;  2JHP A;  2XL3 A;  3IJ1 A;  2RCU A;  2I3S A;  3V5W B;  5JWZ A;  4PSW B;  3L1N A;  3ZDX A;  3L4M D;  4O3U B;  4FJH A;  4M3T A;  4FA4 D;  5IJ8 E;  4J78 A;  4X5N A;  4D9S A;  3SBR A;  3EG6 A;  4TZ4 A;  3SI6 A;  1FZ4 E;  3PSC B;  3O4J A;  4ZOZ A;  4O2W A;  4WK4 A;  3QES A;  4NAA A;  4CC9 A;  2OK4 A;  4E4B A;  1XVB E;  3HFQ A;  4Y5R D;  4A0B B;  5IJ7 E;  3SQ0 A;  3SJJ A;  3EI2 A;  1JV2 A;  2OYQ A;  4GM3 A;  4IRZ A;  2GC4 A;  2H6Q A;  1VZ2 A;  4JT5 C;  4MMY A;  5M5T A;  3C6O B;  4RNG A;  4MMZ A;  4J8G A;  1T2X A;  3MVD K;  3V4P A;  4AKH A;  4DTS A;  3IUR A;  3OGK B;  1N1C A;  2ATQ A;  1K32 A;  4FJ8 A;  3T3M A;  1XU5 E;  3HP9 A;  2AH1 A;  3JRP A;  2B8I A;  4ZOV A;  4QQE A;  1PEV A;  4J81 A;  4DTP A;  1GOT B;  3JRO A;  4CY1 A;  3PXT D;  2JHC A;  1N6F A;  1N6D A;  2QR5 A;  3UVL A;  2HKM A;  4CZX A;  1QFS A;  3SWS D;  2WQ8 A;  4FJI A;  2HKR A;  4M45 A;  4AI6 A;  1UOP A;  3FCS A;  4JT6 C;  4FVM A;  5EAR A;  2XU7 A;  4WK2 A;  4FJL A;  3I7K A;  1CLQ A;  4X63 B;  3QEP A;  5H17 A;  4FJX A;  3IJ0 A;  3EI2 B;  3TAE A;  2H13 A;  3KRX B;  4KFM B;  5FFG A;  5M5U A;  4M42 A;  3IUM A;  3W15 A;  1L0Q A;  4L3G D;  4IT5 A;  3N0D A;  4GQB B;  1S4U X;  3K6S A;  4D6V A;  4X3E A;  2HJB A;  3SXT D;  2OK6 A;  4DTO A;  1SHY B;  4MK0 B;  3DXK C;  2VDK A;  4DNW A;  4FB1 D;  3SQ4 A;  4I9Q A;  1U2V C;  3K27 A;  3LDS A;  3SNN A;  3CIK B;  3O4G A;  1PGU A;  4JHN A;  1WAJ A;  3PE7 A;  4QNC A;  4QAM A;  3FCU A;  4FJ5 A;  4DU4 A;  1QNI A;  2HES X;  4FA1 D;  1GP2 B;  3KD1 E;  3ORV D;  3NIG A;  4O1Q D;  3TAG A;  2AGW A;  1OLZ A;  1XHM A;  1FZ7 E;  1JOF A;  1K8K C;  3SUO A;  1JW2 A;  1BPO A;  3EU7 A;  5EAL A;  5HYN B;  5GMK n;  3SVI A;  1FZ3 E;  3NID A;  2JPN A;  3VH0 A;  1GG2 B;  4JSP C;  3CFP A;  4M41 A;  4JS4 A;  2AGL A;  2I0R A;  3IJC A;  4GM9 A;  2I3T A;  3I8E A;  1R5M A;  2P9N C;  4J82 A;  2HJ4 A;  3SFZ A;  3OKY A;  3WSO A;  4LG8 A;  3VA6 A;  4MMX A;  2IUV A;  1TYE A;  4JS5 A;  1U8C A;  2AGY A;  2JKX A;  4ADO A;  2E32 A;  4Y7R A; 
#chains in the Genus database with same CATH homology
 4FK0 A;  4GQ1 A;  2P1P B;  4A09 A;  1XKS A;  1IH7 A;  2MZW B;  3NVX A;  5EMJ B;  5GSA A;  1XMF E;  3NAE A;  3C94 A;  4M3Z A;  3UKR C;  5KDO B;  4AOW A;  3AL9 A;  1MG2 A;  3SHF A;  4DU1 A;  2VJ4 A;  4AKG A;  1FZ2 E;  3OW8 A;  4U7A A;  4FK2 A;  5I5I A;  3MZK A;  4B08 A;  2H14 A;  3SBQ A;  4FJJ A;  5TEE A;  2JH9 A;  3A0F A;  3IKO A;  4FJ9 A;  4J0X A;  3QEX A;  4FJM A;  3C6P B;  3TJY A;  1ERJ A;  4YVD A;  5TEF A;  4ZOY A;  1FXX A;  2W18 A;  3SCX A;  4A09 B;  3SUQ A;  2QXF A;  3V9F A;  3BG1 A;  1Q9Y A;  5EML B;  4O9D A;  2Z2N A;  2P9L C;  4XYH A;  5EMK B;  3LDB A;  3E0C A;  3EI3 A;  1FZ6 E;  2B5M A;  3SN6 B;  3ULE C;  3QET A;  3OL2 A;  4XEI C;  5HE1 B;  1VYH C;  3MKQ A;  1TBG A;  4IA9 A;  1SQJ A;  4PXW A;  3QEV A;  4L1Q D;  3SPY A;  4AKI A;  5CXC A;  4QT8 A;  3ZWL B;  3MMY A;  3NVN A;  2O9K A;  3N0E A;  1Q9X A;  2DY4 A;  1XL3 C;  3RWU A;  2FW3 A;  3FGB A;  1RI6 A;  4A08 A;  5H37 A;  5EAM A;  4FAV D;  2CO0 A;  2CE8 A;  4CZY A;  4I6J B;  4J2D A;  2XL2 A;  3LD8 A;  1YFQ A;  3PXW D;  4J77 A;  2P5O A;  4KHQ A;  4X61 B;  4PBZ A;  3OL2 B;  4A2M A;  3FM0 A;  5IBK B;  3SBP A;  4DTX A;  3SUN A;  4GMB A;  5TDH B;  5C2W B;  4XYI A;  4KI4 A;  4N14 A;  3SVW D;  3J80 g;  4QRJ A;  4DTM A;  4J73 A;  3SCY A;  5I5M A;  5TF2 A;  2PFV A;  4ZOX A;  2H68 A;  5AMS A;  4ERQ A;  4CI8 A;  3UVK A;  3I7L A;  2OZS A;  2E31 A;  3UR4 A;  3DXM C;  4HDJ A;  4ERZ A;  1B9Y A;  4M3X A;  3SLE D;  2CN3 A;  3U4Y A;  4FWW A;  4OZU A;  2Q7Q A;  2P9P C;  1MG3 A;  3K26 A;  4LGN A;  3J2P A;  3RN1 D;  3UVO A;  2EBS A;  5THA A;  4JSX C;  2YMU A;  3CFV A;  4L9O A;  4I79 A;  3C9C A;  4J79 A;  2AQ5 A;  2PM7 B;  3CFS B;  1SQ9 A;  2YBA A;  4A2L A;  3RSE C;  3JAM g;  4QND A;  3EMH A;  2H9M A;  3AL8 A;  2H4T A;  2B7M A;  4EPH A;  5FKT A;  4A11 A;  2G99 A;  4H5J A;  2JHA A;  5H1M A;  4DTJ A;  1A0R B;  5EM2 A;  3SQ2 A;  3N1E A;  2J57 G;  1JMZ B;  4FJG A;  5CXB A;  3BWS A;  5C2V B;  1MDA H;  3K2O A;  2B4E A;  5EAP A;  2G9A A;  4CY3 A;  2P1N B;  3AH8 B;  1MHZ G;  2B1E A;  4GZ8 A;  3RMC A;  3C6N B;  3UVM A;  3I89 A;  2OVP B;  2IUQ A;  2YB8 B;  4CI3 A;  4EYW A;  1FZ9 E;  1NR0 A;  3OGM B;  4JXM A;  4RG8 A;  4X5M A;  3AL8 B;  5FA5 B;  4CY2 A;  2P1O B;  3SMR A;  2GC7 A;  5FKS A;  4NSX A;  3GFC A;  4HCB A;  4CZV A;  3E4Y A;  2YB5 A;  5EM2 B;  4DTN A;  4M3Y A;  2OIZ A;  2PM9 A;  2H47 A;  5FQD A;  2MMB A;  4E54 A;  5H14 A;  1MTY G;  1FS1 A;  1FZI E;  3NGI A;  5FLX g;  3S9H A;  5HE3 B;  5CYK A;  2H9P A;  5CXB B;  1B9X A;  3CFR A;  1GXR A;  3OKW A;  2H9N A;  3JZN A;  4RL5 A;  4CY5 A;  2IWF A;  1FZ5 E;  1FZH E;  2P9K C;  3RFH A;  3TL8 B;  2IWK A;  4KHS A;  4FJ7 A;  4PBY A;  2VIX A;  3HGK E;  1PBY B;  2LF6 A;  3JB9 L;  2QC5 A;  3V7D B;  3OKY B;  3GRE A;  2TRC B;  3JZH A;  4J8B A;  3EWE A;  3RMZ D;  2HXC A;  2QXV A;  2J55 H;  3EI1 A;  2H3X A;  2LF3 A;  3QEI A;  3DWL C;  3NHG A;  3C5M A;  3I7N A;  4DTR A;  2PM9 B;  2XYI A;  3I7H A;  4CI1 A;  4E54 B;  3JPX A;  2H9L A;  3ODT A;  5CYK B;  4A0A A;  3C75 H;  3AFC A;  3PVW B;  3OKT A;  4FAN D;  3DSM A;  5GXH A;  4J0W A;  5HQG A;  1FZ0 E;  3TAF A;  4KHN A;  2H6K A;  4JRQ A;  3J27 A;  4GGC A;  3L2O B;  2PFT A;  1U4C A;  4A0B A;  2IUR A;  3P4F A;  5AFU 3;  4QL1 A;  3JZG A;  4E5Z A;  3EI1 B;  2MTA H;  3KD5 E;  2BBK H;  3I7O A;  4H5I A;  2I0T A;  4J2B A;  5HE2 B;  3C99 A;  4KHW A;  1FWX A;  3N1B A;  2IUP A;  4K3J B;  2UZX B;  4AEZ A;  3EI3 B;  4CI2 A;  4ZN4 A;  4A0A B;  2B5L A;  2I0S A;  2CO0 C;  3QNO A;  4J87 A;  4GGD A;  4FK4 A;  4ESG A;  2P9S C;  2YNO A;  4KHY A;  5CXC B;  2P9U C;  1XU3 E;  3L4O D;  5SXM A;  2B5N A;  4E5Z B;  2AGX A;  3E4W A;  4M3R A;  3SQ1 A;  2BCJ B;  1JJU B;  1XIP A;  3I2N A;  2H6N A;  5K19 A;  1LDK E;  3RRM C;  5GXI A;  4LG9 A;  4BL0 A;  4A08 B;  4J2A A;  3LZJ A;  5IGO A;  4GAM C;  5FXY A;  2DEB A;  2YNN A;  2P9I C;  4ADN A;  4PSX B;  5HE0 B;  3B7F A;  4FA5 D;  3I8C A;  1XMG E;  2IAA A;  5C9Z B;  5IT9 g;  3RMD A;  3PSL A;  4U1E I;  5A2Q g;  2Z2P A;  5IGQ A;  3UKU C;  3NE6 A;  1P22 A;  3QER A;  1Q47 A;  2GNQ A;  2AH0 A;  2CNX A;  4JSN C;  4J2E A;  1IG9 A;  4IMM A;  1XVE E;  1JMX B;  5IRE A;  5IZ7 A;  4GQ2 P;  4KHU A;  4BH6 A;  3OGL B;  4M3W A;  4R7A B;  1MMO G;  3F3F A;  4HCC A;  4JSV C;  1FYZ E;  4DU3 A;  3MKS B;  4O45 A;  2Z2O A;  3RMA A;  3NCI A;  4EP9 A;  3VGZ A;  2JH8 A;  3MZL A;  3L8B A;  3J81 g;  4ERY A;  4M3U A;  5I5J A;  3SPZ A;  1FZ8 E;  4G56 B;  3L0M A;  3PXS D;  2OVR B;  4Z8L A;  5K1C C;  5IC7 A;  4A11 B;  2HYE A;  3IIY A;  1N6E A;  3I7P A;  4GGA A;  4J84 A;  4J86 A;  3HL8 A;  2UZY B;  4JRP A;  3TAB A;  4KI6 A;  2PBI B;  5AJA A;  3DM0 A;  1OMW B;  1FZ1 E;  3F3P A;  1XVD E;  1PI6 A;  2CE9 A;  3UVN A;  2YNP A;  3EI4 A;  2P5G A;  4L3H D;  4O3T B;  4DTU A;  4UI9 R;  3LZI A;  4BUJ C;  3BG0 A;  4I9L A;  3OTT A;  5EMM B;  3FRX A;  5FKQ A;  3RFG A;  4JD2 C;  2CN2 A;  4EWR A;  4E3S A;  4GM8 A;  1XVF E;  4PC0 A;  3SJL D;  2J56 H;  3RN0 D;  4OWR A;  4X60 B;  2P1M B;  1XVC E;  2HD0 A;  1NEX B;  2DTU A;  2P1Q B;  3F3G A;  4D0K A;  2PM6 B;  3PVU B;  1XVG E;  3C95 A;  4PNK B;  2OJY A;  2VJ5 A;  1MHY G;  3IIW A;  1WAF A;  3NVQ A;  3UIQ A;  3QNN A;  1TYQ C;  3NDK A;  3CQ8 A;  4FHL A;  4FA9 D;  3EI4 B;  3SUP A;  3MXX A;  2AGZ A;  3RLM D;  5FKR A;  3RMB A;  3HGL A;  1XMH E;  4FJN A;  5B4W A;  2OZM A;  4ES0 A;  4K3I D;  4FJK A;  2FYO A;  4A7J A;  3QEW A;  2OVQ B;  3KRW B;  3CFO A;  2JHP A;  2XL3 A;  3IJ1 A;  2RCU A;  2I3S A;  3V5W B;  5JWZ A;  4PSW B;  3L1N A;  3L4M D;  4O3U B;  4FJH A;  4M3T A;  4FA4 D;  5IJ8 E;  4J78 A;  4X5N A;  3SBR A;  3EG6 A;  4TZ4 A;  3SI6 A;  1FZ4 E;  3PSC B;  4ZOZ A;  3QES A;  4CC9 A;  2OK4 A;  4E4B A;  1XVB E;  3HFQ A;  4Y5R D;  4A0B B;  5IJ7 E;  3SQ0 A;  3SJJ A;  3EI2 A;  2OYQ A;  4GM3 A;  2GC4 A;  2H6Q A;  4JT5 C;  3C6O B;  4RNG A;  4J8G A;  4AKH A;  4DTS A;  3OGK B;  2ATQ A;  1K32 A;  4FJ8 A;  1XU5 E;  3HP9 A;  2AH1 A;  3JRP A;  2B8I A;  4ZOV A;  4QQE A;  1PEV A;  4J81 A;  4DTP A;  1GOT B;  3JRO A;  4CY1 A;  3PXT D;  2JHC A;  1N6F A;  1N6D A;  3UVL A;  4CZX A;  2HKM A;  3SWS D;  4FJI A;  2HKR A;  4M45 A;  4AI6 A;  4JT6 C;  4FVM A;  5EAR A;  2XU7 A;  4FJL A;  3I7K A;  1CLQ A;  4X63 B;  3QEP A;  5H17 A;  4FJX A;  3IJ0 A;  3EI2 B;  3TAE A;  2H13 A;  3KRX B;  4KFM B;  4M42 A;  3W15 A;  1L0Q A;  4L3G D;  3N0D A;  4GQB B;  1S4U X;  4D6V A;  4X3E A;  2HJB A;  3SXT D;  2OK6 A;  4DTO A;  1SHY B;  4MK0 B;  3DXK C;  4FB1 D;  3SQ4 A;  4I9Q A;  1U2V C;  3K27 A;  3LDS A;  3SNN A;  3CIK B;  1PGU A;  1WAJ A;  3PE7 A;  4QNC A;  4FJ5 A;  4DU4 A;  1QNI A;  2HES X;  4FA1 D;  1GP2 B;  3KD1 E;  3ORV D;  4O1Q D;  3TAG A;  2AGW A;  1OLZ A;  1XHM A;  1FZ7 E;  1JOF A;  1K8K C;  3SUO A;  3EU7 A;  5EAL A;  5HYN B;  5GMK n;  3SVI A;  1FZ3 E;  2JPN A;  3VH0 A;  1GG2 B;  4JSP C;  3CFP A;  4M41 A;  4JS4 A;  2AGL A;  2I0R A;  3IJC A;  4GM9 A;  2I3T A;  3I8E A;  1R5M A;  2P9N C;  4J82 A;  2HJ4 A;  3SFZ A;  3OKY A;  3WSO A;  4LG8 A;  3VA6 A;  2IUV A;  2AGY A;  4JS5 A;  4ADO A;  2E32 A;  4Y7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...