1P22A

Structure of a beta-trcp1-skp1-beta-catenin complex: destruction motif binding and lysine specificity on the scfbeta-trcp1 ubiquitin ligase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
411
structure length
402
Chain Sequence
SPAIMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords F-box/WD-repeat protein 1A
publication title Structure of a beta-TrCP1-Skp1-beta-Catenin complex: destruction motif binding and lysine specificity of the SCFbeta-TrCP1 ubiquitin ligase
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 402
sequence length 411
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1p22A01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1p22A02
3SBRA 5EAMA 3SXTD 2OVPB 3OKYB 3C9CA 3OKTA 4QT8A 5HE0B 3SCYA 1N6FA 3EI1B 4J82A 2I0SA 1XHMA 4N14A 3KRXB 3I89A 2E31A 1PEVA 5IJ8E 4CZXA 2CE9A 4QL1A 2H9NA 2GNQA 5EMJB 2PM9A 3EMHA 2P9LC 3RRMC 3UVNA 3UVLA 4EWRA 5I5MA 1B9XA 4ERZA 1LDKE 2P1MB 3MKSB 3SHFA 1RI6A 3BG1A 4L9OA 3FM0A 4X63B 1FWXA 4A0BB 5A2Qg 4CY2A 2OIZA 5HE3B 4O9DA 3AL9A 4E5ZB 4A7JA 3OGKB 3I2NA 3EI4A 4J81A 2I3SA 1ERJA 5FLXg 2BBKH 3L4OD 2J57G 4J73A 4CY3A 5EM2B 3I8CA 4GQ1A 3L2OB 3U4YA 1GG2B 2Z2PA 4FB1D 1S4UX 2H47A 4JSPC 2P9SC 5H17A 4PSWB 3VH0A 4CZYA 3PVWB 4FAVD 3DM0A 3JB9L 1MG3A 3DXKC 4FWWA 2OVRB 1XKSA 2J56H 2P1NB 2Z2OA 4FA1D 4MK0B 2G9AA 2P9PC 4JXMA 4OZUA 5GSAA 5TF2A 3I8EA 2CN2A 3ZWLB 4IA9A 5FXYA 4J86A 4ZN4A 4CC9A 2P1PB 2AH1A 3P4FA 2I0TA 5FKQA 5IBKB 2TRCB 5FKRA 3GREA 4LG9A 3C75H 3PXWD 3SVWD 3SBQA 3I7HA 4J0XA 2P9NC 4I79A 4L3GD 2MTAH 5B4WA 5IJ7E 5TEEA 1N6DA 2IUVA 3EI2B 4GQ2P 2EBSA 3SMRA 2AGWA 4O1QD 1GXRA 3BG0A 4A09B 3PSCB 4ZOZA 4CY5A 4O45A 5C2VB 3FRXA 5I5IA 4J77A 4A11B 5THAA 2H9LA 1SQ9A 3OL2B 3IJ0A 4A0AA 3N0EA 5FA5B 3A0FA 3KRWB 4GGCA 4R7AB 3ODTA 4GZ8A 2IURA 5FKSA 4ES0A 2CE8A 5IGQA 5EMMB 4FA4D 2OVQB 4JSVC 5HQGA 3K26A 1P22A 5EMKB 3OW8A 1JJUB 2AGYA 2BCJB 3DXMC 3SLED 2CN3A 3W15A 5IT9g 3SN6B 3RLMD 2XL2A 3UVMA 4K3JB 3MKQA 4X3EA 3OGMB 3UR4A 2I3TA 3N0DA 4OWRA 4H5IA 4J0WA 4A2MA 3OKYA 5GXHA 2HESX 5TDHB 2AQ5A 3EI3B 3EI1A 3RN0D 3BWSA 4ZOXA 4PC0A 5FQDA 4TZ4A 1GOTB 3UKRC 2E32A 2OJYA 4QRJA 4ERYA 5TEFA 1U4CA 5FKTA 2IWKA 3MZKA 3IKOA 3OKWA 2H6KA 3ORVD 3J80g 2G99A 5HE1B 3HFQA 4E54B 2YB8B 3UKUC 5CXBB 1NEXB 4A0BA 4J8BA 5KDOB 3CFSB 4GMBA 4PXWA 4Z8LA 5CXCB 5GXIA 4E5ZA 3MXXA 3I7OA 5GMKn 5CYKB 4GQBB 4O3UB 3EU7A 2H6QA 3I7LA 1XIPA 4GGDA 3J81g 4NSXA 1SQJA 3F3PA 2B4EA 2HKRA 5EM2A 4L1QD 5EARA 5IGOA 3C6OB 3RN1D 3I7NA 2W18A 2H13A 3AL8B 4JSNC 2IUPA 2H14A 3PE7A 1U2VC 4PSXB 2HKMA 5K1CC 3E0CA 4QQEA 2H9PA 4CZVA 1OLZA 4KFMB 2YNPA 4ZOYA 3L4MD 3OGLB 3JAMg 1L0QA 4U7AA 4A08B 5C2WB 3JRPA 2UZXB 2QXVA 2P9KC 4D0KA 2YMUA 2CO0A 2PM7B 3JZHA 4L3HD 3V9FA 2AH0A 4FA5D 2IUQA 3IJ1A 5SXMA 4CI1A 2HJBA 4X60B 3VGZA 5AMSA 4H5JA 2QC5A 4IMMA 2B5NA 3PVUB 3EI2A 1B9YA 3DSMA 5JWZA 1JOFA 2P1QB 1SHYB 3IIYA 4J84A 4A09A 4BUJC 1PBYB 2UZYB 5H14A 4A11A 3K27A 2PBIB 3NVNA 3F3FA 1VYHC 3OL2A 2OK4A 1JMZB 1TBGA 2PM9B 3V7DB 3UVKA 3JROA 4JSXC 2HYEA 5AFU3 3PSLA 2YNOA 2Z2NA 2XL3A 3I7KA 4ESGA 4J78A 4I6JB 4A2LA 3MMYA 3F3GA 3C6NB 4Y7RA 2O9KA 3IIWA 3NVXA 4GM8A 3V5WB 5I5JA 2J55H 3RFGA 5K19A 3OTTA 3SFZA 1TYQC 3SWSD 4FAND 4D6VA 2GC4A 2AGZA 5AJAA 1R5MA 1NR0A 2H6NA 3EI4B 5EALA 1FS1A 3VA6A 1K32A 2YNNA 4GM9A 4LGNA 2P9IC 2GC7A 3AH8B 4J87A 4PNKB 3EI3A 2PM6B 3SBPA 5H1MA 3CIKB 4CI3A 4XEIC 3B7FA 3MZLA 4HDJA 1MDAH 3C6PB 4ERQA 2XYIA 1Q47A 3EG6A 1YFQA 3IJCA 3GFCA 4GM3A 2AGXA 4E54A 3DWLC 2IWFA 5EAPA 2CNXA 5C9ZB 4FA9D 4O3TB 5CXBA 2OK6A 3RFHA 2B5MA 1PGUA 3CFVA 4CI8A 5CXCA 2IAAA 2Q7QA 4G56B 4JT5C 3C5MA 5CYKA 1PI6A 4CY1A 1K8KC 1A0RB 4Y5RD 2I0RA 4K3ID 3SJLD 2P1OB 2H68A 3I7PA 2H9MA 2CO0C 2B5LA 3PXTD 2YBAA 2H3XA 2AGLA 3RSEC 3C99A 3AL8A 4A0AB 4JD2C 3JPXA 3JZGA 4CI2A 1MG2A 1N6EA 2XU7A 3NVQA 1OMWB 4J8GA 4PBZA 4GGAA 4U1EI 4PBYA 4JT6C 1JMXB 4AOWA 5IC7A 2HJ4A 3EWEA 3AFCA 4BL0A 3FGBA 4UI9R 5HYNB 4J79A 4A08A 3JZNA 2HXCA 4XYIA 4ZOVA 4XYHA 1QNIA 3RMZD 5HE2B 3ULEC 4AEZA 4FHLA 4BH6A 3UVOA 3PXSD 4LG8A 1GP2B 4X61B 2P9UC 4YVDA 3WSOA 5EMLB
chains in the Genus database with same CATH superfamily
3SBRA 5EAMA 3SXTD 2OVPB 4ADNA 3GC3B 4JS5A 3OKYB 3RMAA 5E6RA 3C9CA 3OKTA 2JHAA 4QT8A 5HE0B 3SCYA 1N6FA 3EI1B 4J82A 2I0SA 4E3SA 1XHMA 2VJ4A 4N14A 3KRXB 3I89A 2E31A 4DTOA 1PEVA 2HD0A 3CQ8A 3QETA 2DTUA 1M1XA 1VZ3A 3NIFA 4CZXA 5IJ8E 5M61A 2CE9A 2OZSA 4QL1A 2H9NA 4IT5A 2GNQA 5EMJB 4J2DA 3KCIA 2PM9A 4B08A 3EMHA 2P9LC 5FFGA 3RRMC 3UVLA 3UVNA 4EWRA 5I5MA 2OYQA 1B9XA 4ERZA 3SCXA 3QERA 4DU4A 3SI6A 4HCCA 1LDKE 2P1MB 1GOFA 3MKSB 2EICA 3SHFA 5E6SA 2RKHA 4FJHA 1RI6A 3BG1A 3FM0A 3IULA 4L9OA 4X63B 3VI3A 3ZE1A 1FWXA 4A0BB 5A2Qg 4CY2A 2OIZA 5HE3B 4O9DA 3QESA 1JW2A 4DNVA 3N1BA 3AL9A 4AKGA 2VZ1A 3NHGA 4E5ZB 2P5OA 4A7JA 1H2WA 3OGKB 3IVMA 3BVOA 3IJEA 5M5UA 1XMGE 1E8NA 1FYZE 3I2NA 3EI4A 4J81A 2I3SA 1ERJA 3MVDK 4RL5A 2XDWA 5FLXg 3C94A 2BBKH 5M5RA 4RNGA 2FW3A 3L4OD 2MW2A 2J57G 2PFVA 4J73A 3E4YA 4CY3A 5EM2B 3I8CA 3QEXA 3L2OB 4GQ1A 3U4YA 1FZIE 1FZ0E 4JRQA 1C9IA 1GG2B 2Z2PA 3TAFA 3QEIA 4WK0A 3LD8A 4UM9A 1S4UX 4FB1D 2VIXA 2H47A 2WQ8A 4JSPC 2P9SC 5H17A 3K71A 4PSWB 3VH0A 4CZYA 3PVWB 4FAVD 3DM0A 3JB9L 1FZ6E 1MG3A 3DXKC 2JH8A 4FWWA 2OVRB 1XKSA 2J56H 2P1NB 2VDPA 2Z2OA 1U8CA 5C86A 4FA1D 3C95A 4MK0B 2G9AA 2P9PC 4JXMA 4WK4A 3K6SA 4OZUA 5GSAA 5TF2A 3I8EA 2CN2A 4NAAA 5IZ7A 3ZWLB 5M5SA 2JHCA 3LDBA 4IA9A 1L5GA 1VE7A 5FXYA 4J86A 2VC2A 1FXXA 4ZN4A 3SQ1A 4CC9A 2P1PB 2AH1A 3P4FA 1I2MB 2I0TA 5FKQA 2QXFA 3ZDZA 4AN1A 5IBKB 2TRCB 4E4BA 4JHNA 5FKRA 3GREA 4LG9A 3C75H 2OZMA 3PXWD 3SVWD 3SBQA 3I7HA 4J0XA 3J2PA 2P9NC 4I79A 4L3GD 2MTAH 3IUNA 5B4WA 5IJ7E 4DTXA 5TEEA 1N6DA 2IUVA 3EI2B 2MZWB 4GQ2P 1QFMA 3RMBA 4QNCA 3SUPA 2EBSA 3CFOA 4NENA 3SMRA 2AGWA 4O1QD 1GOHA 3QNNA 1GXRA 3BG0A 2K5SA 4A09B 3PSCB 4ZOZA 1GOGA 3LZJA 4CY5A 4O45A 5C2VB 3FRXA 5I5IA 4J77A 4A11B 5THAA 2H9LA 4I9QA 1SQ9A 3EQ9A 3OL2B 3IJ0A 1FZ3E 4A0AA 1C9LA 3N0EA 4KHQA 4BP9A 3SQ0A 1O6GA 3A0FA 3NIDA 3KRWB 4GGCA 4R7AB 5FA5B 2RCUA 3ODTA 2HU5A 1QFSA 2IURA 4GZ8A 4M41A 2YB5A 5FKSA 4ES0A 2CE8A 5IGQA 4M3XA 4X5NA 5EMMB 1FPOA 4FA4D 2OVQB 4JSVC 5HQGA 3K26A 1P22A 5EMKB 3OW8A 4RG8A 3L0MA 3NIGA 1CLQA 1JJUB 5M5TA 4FVMA 2AGYA 3QHYB 2BCJB 3DXMC 3SLED 4DNUA 2CN3A 3W15A 4FJ7A 3SN6B 5IT9g 3RLMD 2XL2A 3UVMA 4K3JB 4I9LA 1JTDB 3MKQA 4X3EA 3OGMB 1IG9A 1E8MA 1K3IA 3UR4A 2I3TA 3ZE0A 3N0DA 4OWRA 4H5IA 1VE6A 4J0WA 4MMZA 3OKYA 4ICGC 4A2MA 1Q9XA 5GXHA 3NGIA 2HESX 2BKLA 4X5MA 5TDHB 2AQ5A 3UIQA 3EI3B 3EI1A 4NBMA 1H2XA 3SJJA 3RN0D 3BWSA 4ZOXA 4PC0A 5FQDA 4TZ4A 1GOTB 3UKRC 2E32A 3S9HA 2OJYA 4QRJA 4ERYA 3J27A 4KHUA 5TEFA 1U4CA 3CFRA 2DEBA 5FKTA 2IWKA 3MZKA 3IKOA 3OKWA 1WAJA 1XMHE 2H6KA 3ORVD 3J80g 1O6FA 2G99A 5HE1B 3HFQA 4E54B 1T2XA 2YB8B 3UKUC 3MUOA 5CXBB 1NEXB 4M3TA 4A0BA 1H2YA 4J8BA 5KDOB 1TYEA 3CFSB 4GMBA 4PXWA 4Z8LA 4D9SA 5CXCB 5IREA 5GXIA 4G1MA 4E5ZA 3MXXA 3I7OA 5GMKn 5CYKB 1XVCE 2XE4A 3IUMA 3KD1E 2JPNA 4FJMA 4Z7OA 4GQBB 4O3UB 4FJNA 3ZDXA 3EU7A 5HDBA 2H6QA 4M3WA 4AX4A 2VZ3A 3I7LA 1XIPA 4FJGA 4GGDA 1YR2A 3QEVA 2VDMA 3J81g 1XVDE 4NSXA 1SQJA 3F3PA 4Z7NA 2B4EA 3SNNA 2HKRA 4KHYA 4L1QD 5EM2A 5EARA 4AMZA 3TABA 5IGOA 3C6OB 4FK4A 2HU8A 3RN1D 3I7NA 3IURA 4BCDA 4J2BA 2W18A 4MMXA 2H13A 4KI4A 3AL8B 4JSNC 4RE5A 4RE6A 4FJ8A 2IUPA 3LZIA 1MMOG 2H14A 3PE7A 1U2VC 4PSXB 2HKMA 5K1CC 3E0CA 4QQEA 1FZ1E 1FZ5E 3QEWA 1XVBE 2H9PA 4CZVA 1OLZA 4KFMB 1MTYG 4G1EA 2YNPA 3TAGA 3L4MD 3OGLB 4ZOYA 3JAMg 4KI6A 1L0QA 3IUQA 4GAMC 1FZHE 3SUNA 4FK2A 4U7AA 4BCCA 3V4VA 4A08B 2H4TA 5C2WB 3JRPA 2VDQA 2UZXB 1UOOA 2QXVA 2P9KC 4D0KA 2YMUA 2CO0A 2PM7B 4M3ZA 2EIBA 3JZHA 2QZPA 3QNOA 4L3HD 1XVFE 4QNDA 3SPZA 4JS4A 3RWUA 3V9FA 2AH0A 4FA5D 2IUQA 3IJ1A 5SXMA 4CI1A 4M45A 3N1EA 4FJXA 2HJBA 4X60B 3VGZA 1UOPA 4H5JA 5AMSA 2QC5A 4IMMA 1XL3C 2B5NA 3PVUB 3EI2A 1B9YA 3DSMA 4UM8A 3SUOA 1JOFA 1H2ZA 5JWZA 2P1QB 1SHYB 2VDNA 2VDRA 3IIYA 4J84A 3SQ2A 4A09A 4BUJC 2B7MA 1PBYB 2UZYB 4MMYA 1XVEE 1Q9YA 3K27A 2PBIB 5H14A 2B1EA 4A11A 3NVNA 3HGKE 3F3FA 1VYHC 3IUJA 3OL2A 4FJJA 2OK4A 1FZ9E 4DTNA 4Z7QA 1MHZG 4DTMA 4DTSA 4M3YA 1JMZB 1TBGA 4AKIA 2PM9B 3V7DB 3NAEA 2EIDA 3UVKA 3JROA 4FJKA 3O4IA 1VZ2A 4JSXC 5AFU3 2HYEA 3PSLA 2YNOA 4BCBA 2Z2NA 2XL3A 3VI4A 3I7KA 2VJ5A 4DU3A 4ESGA 4J78A 2JQTA 4I6JB 4FJ5A 3MMYA 4A2LA 3F3GA 3C6NB 3HGLA 4KHWA 1BPOA 4Y7RA 2O9KA 3K2OA 4M3RA 3IIWA 4ADOA 3L8BA 4DU1A 3EQ8A 3NVXA 4GM8A 3V5WB 5I5JA 3NE6A 2J55H 3RFGA 5K19A 3OTTA 3SFZA 1TYQC 3SWSD 4DNWA 4D6VA 4FAND 4BP8A 2GC4A 2AGZA 5AJAA 2XZGA 1R5MA 1NR0A 2H6NA 3EI4B 5EALA 1FS1A 3VA6A 1K32A 3V4PA 3DDUA 3K72A 3L1NA 2YNNA 4GM9A 4DTJA 3CFPA 2P9IC 4LGNA 2GC7A 4EP9A 1FZ2E 3AH8B 4J87A 4PNKB 3EI3A 2PM6B 1XMFE 3SBPA 1N1CA 5H1MA 4DTPA 3SUQA 4AKHA 3NDKA 4EYWA 3CIKB 4L1MA 4CI3A 4XEIC 3SVIA 4FK0A 3B7FA 3MZLA 3O4GA 4HDJA 1MDAH 2VDKA 3C6PB 4ERQA 4J2AA 2XYIA 2PFTA 3UO3A 4AI6A 1Q47A 3EG6A 3HP9A 4G55A 1YFQA 3IJCA 3LDSA 3TJYA 2QR5A 3NCIA 3SQ4A 3GFCA 1A12A 5H37A 2AGXA 4GM3A 4E54A 3DWLC 3O4HA 2IWFA 3FCSA 4IRZA 5EAPA 2CNXA 5C9ZB 4FA9D 4O3TB 5CXBA 4KHSA 2OK6A 1WAFA 3RFHA 2JHPA 2B5MA 2JKXA 1PGUA 3CFVA 4CI8A 3T3PA 3UO2A 2VDOA 3FCUA 3TL8B 4O02A 5CXCA 4NC4A 2IAAA 4M42A 2Q7QA 4FJLA 4G56B 4JT5C 4AN0A 3C5MA 4WJKA 5CYKA 1PI6A 4CY1A 3SPYA 1K8KC 1A0RB 1FZ8E 4Y5RD 3RMCA 3GD1I 2HU7A 5M5VA 4EPHA 2I0RA 4K3ID 3SJLD 2P1OB 4WK2A 4JRPA 2H68A 4HCBA 3I7PA 2H9MA 2CO0C 1MHYG 3RMDA 5FFOA 3E4WA 2B5LA 3PXTD 1FZ4E 2B8IA 3HL8A 2YBAA 2H3XA 3ZDYA 2AGLA 2JH9A 1FZ7E 3RSEC 4J2EA 2ATQA 3C99A 3AL8A 4JHPC 4A0AB 1XU5E 4JD2C 3JPXA 3JZGA 4CI2A 4QAMA 1MG2A 1N6EA 2XU7A 2EIEA 1OMWB 3NVQA 4J8GA 2P5GA 1E5TA 3O4JA 3T3MA 2VDLA 1IH7A 4PBZA 4GGAA 4KHNA 4U1EI 4PBYA 4DTRA 1UTCA 3QEPA 1UOQA 3EQ7A 5C92A 4JT6C 3OF7A 1JMXB 4AOWA 4O2WA 5IC7A 2DY4A 2HJ4A 3EWEA 4M3UA 3AFCA 1JV2A 4BL0A 3TAEA 3FGBA 4UI9R 5HYNB 3MUNA 4J79A 4A08A 3ZE2A 4AMYA 3QI0A 3JZNA 2LF6A 2HXCA 4XYIA 3KD5E 4ZOVA 4XYHA 1QNIA 3RMZD 4FJ9A 5HE2B 3ULEC 4AEZA 4FHLA 2MMBA 4BH6A 3UVOA 4DTUA 3PXSD 4LG8A 2LF3A 2FYOA 1XU3E 1GP2B 4FJIA 4X61B 2P9UC 4YVDA 3WSOA 5E6UA 5EMLB 1XVGE
chains in the Genus database with same CATH topology
3SBRA 5EAMA 3SXTD 2OVPB 4ADNA 3OKYB 4JS5A 3RMAA 3C9CA 3OKTA 2JHAA 4QT8A 5HE0B 3SCYA 1N6FA 3EI1B 4J82A 2I0SA 4E3SA 1XHMA 2VJ4A 4N14A 3KRXB 3I89A 2E31A 4DTOA 1PEVA 2HD0A 3CQ8A 3QETA 2DTUA 4CZXA 5IJ8E 2CE9A 2OZSA 4QL1A 2H9NA 2GNQA 5EMJB 4J2DA 2PM9A 4B08A 3EMHA 2P9LC 3RRMC 3UVNA 3UVLA 4EWRA 5I5MA 2OYQA 1B9XA 4ERZA 3SCXA 3QERA 4DU4A 3SI6A 4HCCA 1LDKE 2P1MB 3MKSB 3SHFA 4FJHA 1RI6A 3BG1A 3FM0A 4L9OA 4X63B 1FWXA 4A0BB 5A2Qg 4CY2A 2OIZA 5HE3B 4O9DA 3QESA 3N1BA 3AL9A 4AKGA 3NHGA 4E5ZB 2P5OA 4A7JA 3OGKB 1XMGE 1FYZE 3I2NA 3EI4A 4J81A 2I3SA 1ERJA 4RL5A 5FLXg 3C94A 2BBKH 4RNGA 2FW3A 3L4OD 2J57G 2PFVA 4J73A 3E4YA 4CY3A 5EM2B 3I8CA 3QEXA 3L2OB 4GQ1A 3U4YA 1FZIE 1FZ0E 4JRQA 1GG2B 2Z2PA 3TAFA 3QEIA 3LD8A 4FB1D 1S4UX 2VIXA 2H47A 4JSPC 2P9SC 5H17A 4PSWB 3VH0A 4CZYA 3PVWB 4FAVD 3DM0A 3JB9L 1FZ6E 1MG3A 3DXKC 2JH8A 4FWWA 2OVRB 1XKSA 2J56H 2P1NB 2Z2OA 4FA1D 3C95A 4MK0B 2G9AA 2P9PC 4JXMA 4OZUA 5GSAA 5TF2A 3I8EA 2CN2A 5IZ7A 3ZWLB 2JHCA 3LDBA 4IA9A 5FXYA 4J86A 1FXXA 4ZN4A 3SQ1A 4CC9A 2P1PB 2AH1A 3P4FA 2I0TA 5FKQA 2QXFA 5IBKB 2TRCB 4E4BA 5FKRA 3GREA 4LG9A 3C75H 2OZMA 3PXWD 3SVWD 3SBQA 3I7HA 4J0XA 3J2PA 2P9NC 4I79A 4L3GD 2MTAH 5B4WA 5IJ7E 4DTXA 5TEEA 1N6DA 2IUVA 3EI2B 2MZWB 4GQ2P 3RMBA 4QNCA 3SUPA 2EBSA 3CFOA 3SMRA 2AGWA 4O1QD 3QNNA 1GXRA 3BG0A 4A09B 3PSCB 4ZOZA 3LZJA 4CY5A 4O45A 5C2VB 3FRXA 5I5IA 4J77A 4A11B 5THAA 2H9LA 4I9QA 1SQ9A 3OL2B 3IJ0A 1FZ3E 4A0AA 3N0EA 4KHQA 3SQ0A 5FA5B 3A0FA 3KRWB 4GGCA 4R7AB 2RCUA 3ODTA 2IURA 4GZ8A 4M41A 2YB5A 5FKSA 4ES0A 2CE8A 5IGQA 4M3XA 4X5NA 5EMMB 4FA4D 2OVQB 4JSVC 5HQGA 3K26A 1P22A 5EMKB 3OW8A 4RG8A 3L0MA 1CLQA 1JJUB 4FVMA 2AGYA 2BCJB 3DXMC 3SLED 2CN3A 3W15A 4FJ7A 3SN6B 5IT9g 3RLMD 2XL2A 3UVMA 4K3JB 4I9LA 3MKQA 4X3EA 3OGMB 1IG9A 3UR4A 2I3TA 3N0DA 4OWRA 4H5IA 4J0WA 4A2MA 3OKYA 1Q9XA 5GXHA 3NGIA 2HESX 4X5MA 5TDHB 2AQ5A 3UIQA 3EI3B 3EI1A 3SJJA 3RN0D 3BWSA 4ZOXA 4PC0A 5FQDA 4TZ4A 1GOTB 3UKRC 2E32A 3S9HA 2OJYA 4QRJA 4ERYA 3J27A 4KHUA 5TEFA 1U4CA 3CFRA 2DEBA 5FKTA 2IWKA 3MZKA 3IKOA 3OKWA 1WAJA 1XMHE 2H6KA 3ORVD 3J80g 2G99A 5HE1B 3HFQA 4E54B 2YB8B 3UKUC 5CXBB 1NEXB 4M3TA 4A0BA 4J8BA 5KDOB 3CFSB 4GMBA 4PXWA 4Z8LA 5CXCB 5IREA 5GXIA 4E5ZA 3MXXA 3I7OA 5GMKn 5CYKB 1XVCE 3KD1E 2JPNA 4FJMA 4GQBB 4O3UB 4FJNA 3EU7A 2H6QA 4M3WA 3I7LA 1XIPA 4FJGA 4GGDA 3QEVA 3J81g 1XVDE 4NSXA 1SQJA 3F3PA 2B4EA 3SNNA 2HKRA 4KHYA 4L1QD 5EM2A 5EARA 3TABA 5IGOA 3C6OB 4FK4A 3RN1D 3I7NA 4J2BA 2W18A 2H13A 4KI4A 3AL8B 4JSNC 4FJ8A 2IUPA 3LZIA 1MMOG 2H14A 3PE7A 1U2VC 4PSXB 2HKMA 5K1CC 3E0CA 4QQEA 1FZ1E 1FZ5E 3QEWA 1XVBE 2H9PA 4CZVA 1OLZA 4KFMB 1MTYG 2YNPA 3TAGA 3L4MD 3OGLB 4ZOYA 3JAMg 4KI6A 1L0QA 4GAMC 1FZHE 3SUNA 4FK2A 4U7AA 4A08B 2H4TA 5C2WB 3JRPA 2UZXB 2QXVA 2P9KC 4D0KA 2YMUA 2CO0A 2PM7B 4M3ZA 3JZHA 3QNOA 4L3HD 1XVFE 4QNDA 3SPZA 4JS4A 3RWUA 3V9FA 2AH0A 4FA5D 2IUQA 3IJ1A 5SXMA 4CI1A 4M45A 3N1EA 4FJXA 2HJBA 4X60B 3VGZA 5AMSA 4H5JA 2QC5A 4IMMA 1XL3C 2B5NA 3PVUB 3EI2A 1B9YA 3DSMA 5JWZA 3SUOA 1JOFA 2P1QB 1SHYB 3IIYA 4J84A 3SQ2A 4A09A 4BUJC 2B7MA 1PBYB 2UZYB 1XVEE 1Q9YA 3K27A 2PBIB 5H14A 2B1EA 4A11A 3NVNA 3HGKE 3F3FA 1VYHC 3OL2A 4FJJA 2OK4A 1FZ9E 4DTNA 1MHZG 4DTMA 4DTSA 4M3YA 1JMZB 1TBGA 4AKIA 2PM9B 3V7DB 3NAEA 3UVKA 3JROA 4FJKA 4JSXC 2HYEA 5AFU3 3PSLA 2YNOA 2Z2NA 2XL3A 3I7KA 2VJ5A 4DU3A 4ESGA 4J78A 4I6JB 4FJ5A 3MMYA 4A2LA 3F3GA 3C6NB 3HGLA 4KHWA 4Y7RA 2O9KA 3K2OA 4M3RA 3IIWA 4ADOA 3L8BA 4DU1A 3NVXA 4GM8A 3V5WB 5I5JA 3NE6A 2J55H 3RFGA 5K19A 3OTTA 3SFZA 1TYQC 3SWSD 4FAND 4D6VA 2GC4A 2AGZA 5AJAA 1R5MA 1NR0A 2H6NA 3EI4B 5EALA 1FS1A 3VA6A 1K32A 3L1NA 2YNNA 4GM9A 4DTJA 3CFPA 2P9IC 4LGNA 2GC7A 4EP9A 1FZ2E 3AH8B 4J87A 4PNKB 3EI3A 2PM6B 1XMFE 3SBPA 5H1MA 4DTPA 3SUQA 4AKHA 3NDKA 4EYWA 3CIKB 4CI3A 4XEIC 3SVIA 4FK0A 3B7FA 3MZLA 4HDJA 1MDAH 3C6PB 4ERQA 4J2AA 2XYIA 2PFTA 4AI6A 1Q47A 3EG6A 3HP9A 1YFQA 3IJCA 3LDSA 3TJYA 3NCIA 3SQ4A 3GFCA 5H37A 2AGXA 4GM3A 4E54A 3DWLC 2IWFA 5EAPA 2CNXA 5C9ZB 4FA9D 4O3TB 5CXBA 4KHSA 2OK6A 1WAFA 3RFHA 2JHPA 2B5MA 1PGUA 3CFVA 4CI8A 3TL8B 5CXCA 2IAAA 4M42A 2Q7QA 4FJLA 4G56B 4JT5C 3C5MA 5CYKA 1PI6A 4CY1A 3SPYA 1K8KC 1A0RB 1FZ8E 4Y5RD 3RMCA 4EPHA 2I0RA 4K3ID 3SJLD 2P1OB 4JRPA 2H68A 4HCBA 3I7PA 2H9MA 2CO0C 1MHYG 3RMDA 3E4WA 2B5LA 3PXTD 1FZ4E 2B8IA 3HL8A 2YBAA 2H3XA 2AGLA 2JH9A 1FZ7E 3RSEC 4J2EA 2ATQA 3C99A 3AL8A 4A0AB 1XU5E 4JD2C 3JPXA 3JZGA 4CI2A 1MG2A 1N6EA 2XU7A 3NVQA 1OMWB 4J8GA 2P5GA 1IH7A 4PBZA 4GGAA 4KHNA 4U1EI 4PBYA 4DTRA 3QEPA 4JT6C 1JMXB 4AOWA 5IC7A 2DY4A 2HJ4A 3EWEA 4M3UA 3AFCA 4BL0A 3TAEA 3FGBA 4UI9R 5HYNB 4J79A 4A08A 3JZNA 2LF6A 2HXCA 4XYIA 3KD5E 4ZOVA 4XYHA 1QNIA 3RMZD 4FJ9A 5HE2B 3ULEC 4AEZA 4FHLA 2MMBA 4BH6A 3UVOA 4DTUA 3PXSD 4LG8A 2LF3A 2FYOA 1XU3E 1GP2B 4FJIA 4X61B 2P9UC 4YVDA 3WSOA 5EMLB 1XVGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBR A;  5EAM A;  3SXT D;  2OVP B;  3OKY B;  3C9C A;  3OKT A;  4QT8 A;  5HE0 B;  3SCY A;  1N6F A;  3EI1 B;  4J82 A;  2I0S A;  1XHM A;  4N14 A;  3KRX B;  3I89 A;  2E31 A;  1PEV A;  5IJ8 E;  4CZX A;  2CE9 A;  4QL1 A;  2H9N A;  2GNQ A;  5EMJ B;  2PM9 A;  3EMH A;  2P9L C;  3RRM C;  3UVN A;  3UVL A;  4EWR A;  5I5M A;  1B9X A;  4ERZ A;  1LDK E;  2P1M B;  3MKS B;  3SHF A;  1RI6 A;  3BG1 A;  4L9O A;  3FM0 A;  4X63 B;  1FWX A;  4A0B B;  5A2Q g;  4CY2 A;  2OIZ A;  5HE3 B;  4O9D A;  3AL9 A;  4E5Z B;  4A7J A;  3OGK B;  3I2N A;  3EI4 A;  4J81 A;  2I3S A;  1ERJ A;  5FLX g;  2BBK H;  3L4O D;  2J57 G;  4J73 A;  4CY3 A;  5EM2 B;  3I8C A;  4GQ1 A;  3L2O B;  3U4Y A;  1GG2 B;  2Z2P A;  4FB1 D;  1S4U X;  2H47 A;  4JSP C;  2P9S C;  5H17 A;  4PSW B;  3VH0 A;  4CZY A;  3PVW B;  4FAV D;  3DM0 A;  3JB9 L;  1MG3 A;  3DXK C;  4FWW A;  2OVR B;  1XKS A;  2J56 H;  2P1N B;  2Z2O A;  4FA1 D;  4MK0 B;  2G9A A;  2P9P C;  4JXM A;  4OZU A;  5GSA A;  5TF2 A;  3I8E A;  2CN2 A;  3ZWL B;  4IA9 A;  5FXY A;  4J86 A;  4ZN4 A;  4CC9 A;  2P1P B;  2AH1 A;  3P4F A;  2I0T A;  5FKQ A;  5IBK B;  2TRC B;  5FKR A;  3GRE A;  4LG9 A;  3C75 H;  3PXW D;  3SVW D;  3SBQ A;  3I7H A;  4J0X A;  2P9N C;  4I79 A;  4L3G D;  2MTA H;  5B4W A;  5IJ7 E;  5TEE A;  1N6D A;  2IUV A;  3EI2 B;  4GQ2 P;  2EBS A;  3SMR A;  2AGW A;  4O1Q D;  1GXR A;  3BG0 A;  4A09 B;  3PSC B;  4ZOZ A;  4CY5 A;  4O45 A;  5C2V B;  3FRX A;  5I5I A;  4J77 A;  4A11 B;  5THA A;  2H9L A;  1SQ9 A;  3OL2 B;  3IJ0 A;  4A0A A;  3N0E A;  5FA5 B;  3A0F A;  3KRW B;  4GGC A;  4R7A B;  3ODT A;  4GZ8 A;  2IUR A;  5FKS A;  4ES0 A;  2CE8 A;  5IGQ A;  5EMM B;  4FA4 D;  2OVQ B;  4JSV C;  5HQG A;  3K26 A;  1P22 A;  5EMK B;  3OW8 A;  1JJU B;  2AGY A;  2BCJ B;  3DXM C;  3SLE D;  2CN3 A;  3W15 A;  5IT9 g;  3SN6 B;  3RLM D;  2XL2 A;  3UVM A;  4K3J B;  3MKQ A;  4X3E A;  3OGM B;  3UR4 A;  2I3T A;  3N0D A;  4OWR A;  4H5I A;  4J0W A;  4A2M A;  3OKY A;  5GXH A;  2HES X;  5TDH B;  2AQ5 A;  3EI3 B;  3EI1 A;  3RN0 D;  3BWS A;  4ZOX A;  4PC0 A;  5FQD A;  4TZ4 A;  1GOT B;  3UKR C;  2E32 A;  2OJY A;  4QRJ A;  4ERY A;  5TEF A;  1U4C A;  5FKT A;  2IWK A;  3MZK A;  3IKO A;  3OKW A;  2H6K A;  3ORV D;  3J80 g;  2G99 A;  5HE1 B;  3HFQ A;  4E54 B;  2YB8 B;  3UKU C;  5CXB B;  1NEX B;  4A0B A;  4J8B A;  5KDO B;  3CFS B;  4GMB A;  4PXW A;  4Z8L A;  5CXC B;  5GXI A;  4E5Z A;  3MXX A;  3I7O A;  5GMK n;  5CYK B;  4GQB B;  4O3U B;  3EU7 A;  2H6Q A;  3I7L A;  1XIP A;  4GGD A;  3J81 g;  4NSX A;  1SQJ A;  3F3P A;  2B4E A;  2HKR A;  5EM2 A;  4L1Q D;  5EAR A;  5IGO A;  3C6O B;  3RN1 D;  3I7N A;  2W18 A;  2H13 A;  3AL8 B;  4JSN C;  2IUP A;  2H14 A;  3PE7 A;  1U2V C;  4PSX B;  2HKM A;  5K1C C;  3E0C A;  4QQE A;  2H9P A;  4CZV A;  1OLZ A;  4KFM B;  2YNP A;  4ZOY A;  3L4M D;  3OGL B;  3JAM g;  1L0Q A;  4U7A A;  4A08 B;  5C2W B;  3JRP A;  2UZX B;  2QXV A;  2P9K C;  4D0K A;  2YMU A;  2CO0 A;  2PM7 B;  3JZH A;  4L3H D;  3V9F A;  2AH0 A;  4FA5 D;  2IUQ A;  3IJ1 A;  5SXM A;  4CI1 A;  2HJB A;  4X60 B;  3VGZ A;  5AMS A;  4H5J A;  2QC5 A;  4IMM A;  2B5N A;  3PVU B;  3EI2 A;  1B9Y A;  3DSM A;  5JWZ A;  1JOF A;  2P1Q B;  1SHY B;  3IIY A;  4J84 A;  4A09 A;  4BUJ C;  1PBY B;  2UZY B;  5H14 A;  4A11 A;  3K27 A;  2PBI B;  3NVN A;  3F3F A;  1VYH C;  3OL2 A;  2OK4 A;  1JMZ B;  1TBG A;  2PM9 B;  3V7D B;  3UVK A;  3JRO A;  4JSX C;  2HYE A;  5AFU 3;  3PSL A;  2YNO A;  2Z2N A;  2XL3 A;  3I7K A;  4ESG A;  4J78 A;  4I6J B;  4A2L A;  3MMY A;  3F3G A;  3C6N B;  4Y7R A;  2O9K A;  3IIW A;  3NVX A;  4GM8 A;  3V5W B;  5I5J A;  2J55 H;  3RFG A;  5K19 A;  3OTT A;  3SFZ A;  1TYQ C;  3SWS D;  4FAN D;  4D6V A;  2GC4 A;  2AGZ A;  5AJA A;  1R5M A;  1NR0 A;  2H6N A;  3EI4 B;  5EAL A;  1FS1 A;  3VA6 A;  1K32 A;  2YNN A;  4GM9 A;  4LGN A;  2P9I C;  2GC7 A;  3AH8 B;  4J87 A;  4PNK B;  3EI3 A;  2PM6 B;  3SBP A;  5H1M A;  3CIK B;  4CI3 A;  4XEI C;  3B7F A;  3MZL A;  4HDJ A;  1MDA H;  3C6P B;  4ERQ A;  2XYI A;  1Q47 A;  3EG6 A;  1YFQ A;  3IJC A;  3GFC A;  4GM3 A;  2AGX A;  4E54 A;  3DWL C;  2IWF A;  5EAP A;  2CNX A;  5C9Z B;  4FA9 D;  4O3T B;  5CXB A;  2OK6 A;  3RFH A;  2B5M A;  1PGU A;  3CFV A;  4CI8 A;  5CXC A;  2IAA A;  2Q7Q A;  4G56 B;  4JT5 C;  3C5M A;  5CYK A;  1PI6 A;  4CY1 A;  1K8K C;  1A0R B;  4Y5R D;  2I0R A;  4K3I D;  3SJL D;  2P1O B;  2H68 A;  3I7P A;  2H9M A;  2CO0 C;  2B5L A;  3PXT D;  2YBA A;  2H3X A;  2AGL A;  3RSE C;  3C99 A;  3AL8 A;  4A0A B;  4JD2 C;  3JPX A;  3JZG A;  4CI2 A;  1MG2 A;  1N6E A;  2XU7 A;  3NVQ A;  1OMW B;  4J8G A;  4PBZ A;  4GGA A;  4U1E I;  4PBY A;  4JT6 C;  1JMX B;  4AOW A;  5IC7 A;  2HJ4 A;  3EWE A;  3AFC A;  4BL0 A;  3FGB A;  4UI9 R;  5HYN B;  4J79 A;  4A08 A;  3JZN A;  2HXC A;  4XYI A;  4ZOV A;  4XYH A;  1QNI A;  3RMZ D;  5HE2 B;  3ULE C;  4AEZ A;  4FHL A;  4BH6 A;  3UVO A;  3PXS D;  4LG8 A;  1GP2 B;  4X61 B;  2P9U C;  4YVD A;  3WSO A;  5EML B; 
#chains in the Genus database with same CATH topology
 3SBR A;  5EAM A;  3SXT D;  2OVP B;  4ADN A;  3GC3 B;  4JS5 A;  3OKY B;  3RMA A;  5E6R A;  3C9C A;  3OKT A;  2JHA A;  4QT8 A;  5HE0 B;  3SCY A;  1N6F A;  3EI1 B;  4J82 A;  2I0S A;  4E3S A;  1XHM A;  2VJ4 A;  4N14 A;  3KRX B;  3I89 A;  2E31 A;  4DTO A;  1PEV A;  2HD0 A;  3CQ8 A;  3QET A;  2DTU A;  1M1X A;  1VZ3 A;  3NIF A;  4CZX A;  5IJ8 E;  5M61 A;  2CE9 A;  2OZS A;  4QL1 A;  2H9N A;  4IT5 A;  2GNQ A;  5EMJ B;  4J2D A;  3KCI A;  2PM9 A;  4B08 A;  3EMH A;  2P9L C;  5FFG A;  3RRM C;  3UVL A;  3UVN A;  4EWR A;  5I5M A;  2OYQ A;  1B9X A;  4ERZ A;  3SCX A;  3QER A;  4DU4 A;  3SI6 A;  4HCC A;  1LDK E;  2P1M B;  1GOF A;  3MKS B;  2EIC A;  3SHF A;  5E6S A;  2RKH A;  4FJH A;  1RI6 A;  3BG1 A;  3FM0 A;  3IUL A;  4L9O A;  4X63 B;  3VI3 A;  3ZE1 A;  1FWX A;  4A0B B;  5A2Q g;  4CY2 A;  2OIZ A;  5HE3 B;  4O9D A;  3QES A;  1JW2 A;  4DNV A;  3N1B A;  3AL9 A;  4AKG A;  2VZ1 A;  3NHG A;  4E5Z B;  2P5O A;  4A7J A;  1H2W A;  3OGK B;  3IVM A;  3BVO A;  3IJE A;  5M5U A;  1XMG E;  1E8N A;  1FYZ E;  3I2N A;  3EI4 A;  4J81 A;  2I3S A;  1ERJ A;  3MVD K;  4RL5 A;  2XDW A;  5FLX g;  3C94 A;  2BBK H;  5M5R A;  4RNG A;  2FW3 A;  3L4O D;  2MW2 A;  2J57 G;  2PFV A;  4J73 A;  3E4Y A;  4CY3 A;  5EM2 B;  3I8C A;  3QEX A;  3L2O B;  4GQ1 A;  3U4Y A;  1FZI E;  1FZ0 E;  4JRQ A;  1C9I A;  1GG2 B;  2Z2P A;  3TAF A;  3QEI A;  4WK0 A;  3LD8 A;  4UM9 A;  1S4U X;  4FB1 D;  2VIX A;  2H47 A;  2WQ8 A;  4JSP C;  2P9S C;  5H17 A;  3K71 A;  4PSW B;  3VH0 A;  4CZY A;  3PVW B;  4FAV D;  3DM0 A;  3JB9 L;  1FZ6 E;  1MG3 A;  3DXK C;  2JH8 A;  4FWW A;  2OVR B;  1XKS A;  2J56 H;  2P1N B;  2VDP A;  2Z2O A;  1U8C A;  5C86 A;  4FA1 D;  3C95 A;  4MK0 B;  2G9A A;  2P9P C;  4JXM A;  4WK4 A;  3K6S A;  4OZU A;  5GSA A;  5TF2 A;  3I8E A;  2CN2 A;  4NAA A;  5IZ7 A;  3ZWL B;  5M5S A;  2JHC A;  3LDB A;  4IA9 A;  1L5G A;  1VE7 A;  5FXY A;  4J86 A;  2VC2 A;  1FXX A;  4ZN4 A;  3SQ1 A;  4CC9 A;  2P1P B;  2AH1 A;  3P4F A;  1I2M B;  2I0T A;  5FKQ A;  2QXF A;  3ZDZ A;  4AN1 A;  5IBK B;  2TRC B;  4E4B A;  4JHN A;  5FKR A;  3GRE A;  4LG9 A;  3C75 H;  2OZM A;  3PXW D;  3SVW D;  3SBQ A;  3I7H A;  4J0X A;  3J2P A;  2P9N C;  4I79 A;  4L3G D;  2MTA H;  3IUN A;  5B4W A;  5IJ7 E;  4DTX A;  5TEE A;  1N6D A;  2IUV A;  3EI2 B;  2MZW B;  4GQ2 P;  1QFM A;  3RMB A;  4QNC A;  3SUP A;  2EBS A;  3CFO A;  4NEN A;  3SMR A;  2AGW A;  4O1Q D;  1GOH A;  3QNN A;  1GXR A;  3BG0 A;  2K5S A;  4A09 B;  3PSC B;  4ZOZ A;  1GOG A;  3LZJ A;  4CY5 A;  4O45 A;  5C2V B;  3FRX A;  5I5I A;  4J77 A;  4A11 B;  5THA A;  2H9L A;  4I9Q A;  1SQ9 A;  3EQ9 A;  3OL2 B;  3IJ0 A;  1FZ3 E;  4A0A A;  1C9L A;  3N0E A;  4KHQ A;  4BP9 A;  3SQ0 A;  1O6G A;  3A0F A;  3NID A;  3KRW B;  4GGC A;  4R7A B;  5FA5 B;  2RCU A;  3ODT A;  2HU5 A;  1QFS A;  2IUR A;  4GZ8 A;  4M41 A;  2YB5 A;  5FKS A;  4ES0 A;  2CE8 A;  5IGQ A;  4M3X A;  4X5N A;  5EMM B;  1FPO A;  4FA4 D;  2OVQ B;  4JSV C;  5HQG A;  3K26 A;  1P22 A;  5EMK B;  3OW8 A;  4RG8 A;  3L0M A;  3NIG A;  1CLQ A;  1JJU B;  5M5T A;  4FVM A;  2AGY A;  3QHY B;  2BCJ B;  3DXM C;  3SLE D;  4DNU A;  2CN3 A;  3W15 A;  4FJ7 A;  3SN6 B;  5IT9 g;  3RLM D;  2XL2 A;  3UVM A;  4K3J B;  4I9L A;  1JTD B;  3MKQ A;  4X3E A;  3OGM B;  1IG9 A;  1E8M A;  1K3I A;  3UR4 A;  2I3T A;  3ZE0 A;  3N0D A;  4OWR A;  4H5I A;  1VE6 A;  4J0W A;  4MMZ A;  3OKY A;  4ICG C;  4A2M A;  1Q9X A;  5GXH A;  3NGI A;  2HES X;  2BKL A;  4X5M A;  5TDH B;  2AQ5 A;  3UIQ A;  3EI3 B;  3EI1 A;  4NBM A;  1H2X A;  3SJJ A;  3RN0 D;  3BWS A;  4ZOX A;  4PC0 A;  5FQD A;  4TZ4 A;  1GOT B;  3UKR C;  2E32 A;  3S9H A;  2OJY A;  4QRJ A;  4ERY A;  3J27 A;  4KHU A;  5TEF A;  1U4C A;  3CFR A;  2DEB A;  5FKT A;  2IWK A;  3MZK A;  3IKO A;  3OKW A;  1WAJ A;  1XMH E;  2H6K A;  3ORV D;  3J80 g;  1O6F A;  2G99 A;  5HE1 B;  3HFQ A;  4E54 B;  1T2X A;  2YB8 B;  3UKU C;  3MUO A;  5CXB B;  1NEX B;  4M3T A;  4A0B A;  1H2Y A;  4J8B A;  5KDO B;  1TYE A;  3CFS B;  4GMB A;  4PXW A;  4Z8L A;  4D9S A;  5CXC B;  5IRE A;  5GXI A;  4G1M A;  4E5Z A;  3MXX A;  3I7O A;  5GMK n;  5CYK B;  1XVC E;  2XE4 A;  3IUM A;  3KD1 E;  2JPN A;  4FJM A;  4Z7O A;  4GQB B;  4O3U B;  4FJN A;  3ZDX A;  3EU7 A;  5HDB A;  2H6Q A;  4M3W A;  4AX4 A;  2VZ3 A;  3I7L A;  1XIP A;  4FJG A;  4GGD A;  1YR2 A;  3QEV A;  2VDM A;  3J81 g;  1XVD E;  4NSX A;  1SQJ A;  3F3P A;  4Z7N A;  2B4E A;  3SNN A;  2HKR A;  4KHY A;  4L1Q D;  5EM2 A;  5EAR A;  4AMZ A;  3TAB A;  5IGO A;  3C6O B;  4FK4 A;  2HU8 A;  3RN1 D;  3I7N A;  3IUR A;  4BCD A;  4J2B A;  2W18 A;  4MMX A;  2H13 A;  4KI4 A;  3AL8 B;  4JSN C;  4RE5 A;  4RE6 A;  4FJ8 A;  2IUP A;  3LZI A;  1MMO G;  2H14 A;  3PE7 A;  1U2V C;  4PSX B;  2HKM A;  5K1C C;  3E0C A;  4QQE A;  1FZ1 E;  1FZ5 E;  3QEW A;  1XVB E;  2H9P A;  4CZV A;  1OLZ A;  4KFM B;  1MTY G;  4G1E A;  2YNP A;  3TAG A;  3L4M D;  3OGL B;  4ZOY A;  3JAM g;  4KI6 A;  1L0Q A;  3IUQ A;  4GAM C;  1FZH E;  3SUN A;  4FK2 A;  4U7A A;  4BCC A;  3V4V A;  4A08 B;  2H4T A;  5C2W B;  3JRP A;  2VDQ A;  2UZX B;  1UOO A;  2QXV A;  2P9K C;  4D0K A;  2YMU A;  2CO0 A;  2PM7 B;  4M3Z A;  2EIB A;  3JZH A;  2QZP A;  3QNO A;  4L3H D;  1XVF E;  4QND A;  3SPZ A;  4JS4 A;  3RWU A;  3V9F A;  2AH0 A;  4FA5 D;  2IUQ A;  3IJ1 A;  5SXM A;  4CI1 A;  4M45 A;  3N1E A;  4FJX A;  2HJB A;  4X60 B;  3VGZ A;  1UOP A;  4H5J A;  5AMS A;  2QC5 A;  4IMM A;  1XL3 C;  2B5N A;  3PVU B;  3EI2 A;  1B9Y A;  3DSM A;  4UM8 A;  3SUO A;  1JOF A;  1H2Z A;  5JWZ A;  2P1Q B;  1SHY B;  2VDN A;  2VDR A;  3IIY A;  4J84 A;  3SQ2 A;  4A09 A;  4BUJ C;  2B7M A;  1PBY B;  2UZY B;  4MMY A;  1XVE E;  1Q9Y A;  3K27 A;  2PBI B;  5H14 A;  2B1E A;  4A11 A;  3NVN A;  3HGK E;  3F3F A;  1VYH C;  3IUJ A;  3OL2 A;  4FJJ A;  2OK4 A;  1FZ9 E;  4DTN A;  4Z7Q A;  1MHZ G;  4DTM A;  4DTS A;  4M3Y A;  1JMZ B;  1TBG A;  4AKI A;  2PM9 B;  3V7D B;  3NAE A;  2EID A;  3UVK A;  3JRO A;  4FJK A;  3O4I A;  1VZ2 A;  4JSX C;  5AFU 3;  2HYE A;  3PSL A;  2YNO A;  4BCB A;  2Z2N A;  2XL3 A;  3VI4 A;  3I7K A;  2VJ5 A;  4DU3 A;  4ESG A;  4J78 A;  2JQT A;  4I6J B;  4FJ5 A;  3MMY A;  4A2L A;  3F3G A;  3C6N B;  3HGL A;  4KHW A;  1BPO A;  4Y7R A;  2O9K A;  3K2O A;  4M3R A;  3IIW A;  4ADO A;  3L8B A;  4DU1 A;  3EQ8 A;  3NVX A;  4GM8 A;  3V5W B;  5I5J A;  3NE6 A;  2J55 H;  3RFG A;  5K19 A;  3OTT A;  3SFZ A;  1TYQ C;  3SWS D;  4DNW A;  4D6V A;  4FAN D;  4BP8 A;  2GC4 A;  2AGZ A;  5AJA A;  2XZG A;  1R5M A;  1NR0 A;  2H6N A;  3EI4 B;  5EAL A;  1FS1 A;  3VA6 A;  1K32 A;  3V4P A;  3DDU A;  3K72 A;  3L1N A;  2YNN A;  4GM9 A;  4DTJ A;  3CFP A;  2P9I C;  4LGN A;  2GC7 A;  4EP9 A;  1FZ2 E;  3AH8 B;  4J87 A;  4PNK B;  3EI3 A;  2PM6 B;  1XMF E;  3SBP A;  1N1C A;  5H1M A;  4DTP A;  3SUQ A;  4AKH A;  3NDK A;  4EYW A;  3CIK B;  4L1M A;  4CI3 A;  4XEI C;  3SVI A;  4FK0 A;  3B7F A;  3MZL A;  3O4G A;  4HDJ A;  1MDA H;  2VDK A;  3C6P B;  4ERQ A;  4J2A A;  2XYI A;  2PFT A;  3UO3 A;  4AI6 A;  1Q47 A;  3EG6 A;  3HP9 A;  4G55 A;  1YFQ A;  3IJC A;  3LDS A;  3TJY A;  2QR5 A;  3NCI A;  3SQ4 A;  3GFC A;  1A12 A;  5H37 A;  2AGX A;  4GM3 A;  4E54 A;  3DWL C;  3O4H A;  2IWF A;  3FCS A;  4IRZ A;  5EAP A;  2CNX A;  5C9Z B;  4FA9 D;  4O3T B;  5CXB A;  4KHS A;  2OK6 A;  1WAF A;  3RFH A;  2JHP A;  2B5M A;  2JKX A;  1PGU A;  3CFV A;  4CI8 A;  3T3P A;  3UO2 A;  2VDO A;  3FCU A;  3TL8 B;  4O02 A;  5CXC A;  4NC4 A;  2IAA A;  4M42 A;  2Q7Q A;  4FJL A;  4G56 B;  4JT5 C;  4AN0 A;  3C5M A;  4WJK A;  5CYK A;  1PI6 A;  4CY1 A;  3SPY A;  1K8K C;  1A0R B;  1FZ8 E;  4Y5R D;  3RMC A;  3GD1 I;  2HU7 A;  5M5V A;  4EPH A;  2I0R A;  4K3I D;  3SJL D;  2P1O B;  4WK2 A;  4JRP A;  2H68 A;  4HCB A;  3I7P A;  2H9M A;  2CO0 C;  1MHY G;  3RMD A;  5FFO A;  3E4W A;  2B5L A;  3PXT D;  1FZ4 E;  2B8I A;  3HL8 A;  2YBA A;  2H3X A;  3ZDY A;  2AGL A;  2JH9 A;  1FZ7 E;  3RSE C;  4J2E A;  2ATQ A;  3C99 A;  3AL8 A;  4JHP C;  4A0A B;  1XU5 E;  4JD2 C;  3JPX A;  3JZG A;  4CI2 A;  4QAM A;  1MG2 A;  1N6E A;  2XU7 A;  2EIE A;  1OMW B;  3NVQ A;  4J8G A;  2P5G A;  1E5T A;  3O4J A;  3T3M A;  2VDL A;  1IH7 A;  4PBZ A;  4GGA A;  4KHN A;  4U1E I;  4PBY A;  4DTR A;  1UTC A;  3QEP A;  1UOQ A;  3EQ7 A;  5C92 A;  4JT6 C;  3OF7 A;  1JMX B;  4AOW A;  4O2W A;  5IC7 A;  2DY4 A;  2HJ4 A;  3EWE A;  4M3U A;  3AFC A;  1JV2 A;  4BL0 A;  3TAE A;  3FGB A;  4UI9 R;  5HYN B;  3MUN A;  4J79 A;  4A08 A;  3ZE2 A;  4AMY A;  3QI0 A;  3JZN A;  2LF6 A;  2HXC A;  4XYI A;  3KD5 E;  4ZOV A;  4XYH A;  1QNI A;  3RMZ D;  4FJ9 A;  5HE2 B;  3ULE C;  4AEZ A;  4FHL A;  2MMB A;  4BH6 A;  3UVO A;  4DTU A;  3PXS D;  4LG8 A;  2LF3 A;  2FYO A;  1XU3 E;  1GP2 B;  4FJI A;  4X61 B;  2P9U C;  4YVD A;  3WSO A;  5E6U A;  5EML B;  1XVG E; 
#chains in the Genus database with same CATH homology
 3SBR A;  5EAM A;  3SXT D;  2OVP B;  4ADN A;  3OKY B;  4JS5 A;  3RMA A;  3C9C A;  3OKT A;  2JHA A;  4QT8 A;  5HE0 B;  3SCY A;  1N6F A;  3EI1 B;  4J82 A;  2I0S A;  4E3S A;  1XHM A;  2VJ4 A;  4N14 A;  3KRX B;  3I89 A;  2E31 A;  4DTO A;  1PEV A;  2HD0 A;  3CQ8 A;  3QET A;  2DTU A;  4CZX A;  5IJ8 E;  2CE9 A;  2OZS A;  4QL1 A;  2H9N A;  2GNQ A;  5EMJ B;  4J2D A;  2PM9 A;  4B08 A;  3EMH A;  2P9L C;  3RRM C;  3UVN A;  3UVL A;  4EWR A;  5I5M A;  2OYQ A;  1B9X A;  4ERZ A;  3SCX A;  3QER A;  4DU4 A;  3SI6 A;  4HCC A;  1LDK E;  2P1M B;  3MKS B;  3SHF A;  4FJH A;  1RI6 A;  3BG1 A;  3FM0 A;  4L9O A;  4X63 B;  1FWX A;  4A0B B;  5A2Q g;  4CY2 A;  2OIZ A;  5HE3 B;  4O9D A;  3QES A;  3N1B A;  3AL9 A;  4AKG A;  3NHG A;  4E5Z B;  2P5O A;  4A7J A;  3OGK B;  1XMG E;  1FYZ E;  3I2N A;  3EI4 A;  4J81 A;  2I3S A;  1ERJ A;  4RL5 A;  5FLX g;  3C94 A;  2BBK H;  4RNG A;  2FW3 A;  3L4O D;  2J57 G;  2PFV A;  4J73 A;  3E4Y A;  4CY3 A;  5EM2 B;  3I8C A;  3QEX A;  3L2O B;  4GQ1 A;  3U4Y A;  1FZI E;  1FZ0 E;  4JRQ A;  1GG2 B;  2Z2P A;  3TAF A;  3QEI A;  3LD8 A;  4FB1 D;  1S4U X;  2VIX A;  2H47 A;  4JSP C;  2P9S C;  5H17 A;  4PSW B;  3VH0 A;  4CZY A;  3PVW B;  4FAV D;  3DM0 A;  3JB9 L;  1FZ6 E;  1MG3 A;  3DXK C;  2JH8 A;  4FWW A;  2OVR B;  1XKS A;  2J56 H;  2P1N B;  2Z2O A;  4FA1 D;  3C95 A;  4MK0 B;  2G9A A;  2P9P C;  4JXM A;  4OZU A;  5GSA A;  5TF2 A;  3I8E A;  2CN2 A;  5IZ7 A;  3ZWL B;  2JHC A;  3LDB A;  4IA9 A;  5FXY A;  4J86 A;  1FXX A;  4ZN4 A;  3SQ1 A;  4CC9 A;  2P1P B;  2AH1 A;  3P4F A;  2I0T A;  5FKQ A;  2QXF A;  5IBK B;  2TRC B;  4E4B A;  5FKR A;  3GRE A;  4LG9 A;  3C75 H;  2OZM A;  3PXW D;  3SVW D;  3SBQ A;  3I7H A;  4J0X A;  3J2P A;  2P9N C;  4I79 A;  4L3G D;  2MTA H;  5B4W A;  5IJ7 E;  4DTX A;  5TEE A;  1N6D A;  2IUV A;  3EI2 B;  2MZW B;  4GQ2 P;  3RMB A;  4QNC A;  3SUP A;  2EBS A;  3CFO A;  3SMR A;  2AGW A;  4O1Q D;  3QNN A;  1GXR A;  3BG0 A;  4A09 B;  3PSC B;  4ZOZ A;  3LZJ A;  4CY5 A;  4O45 A;  5C2V B;  3FRX A;  5I5I A;  4J77 A;  4A11 B;  5THA A;  2H9L A;  4I9Q A;  1SQ9 A;  3OL2 B;  3IJ0 A;  1FZ3 E;  4A0A A;  3N0E A;  4KHQ A;  3SQ0 A;  5FA5 B;  3A0F A;  3KRW B;  4GGC A;  4R7A B;  2RCU A;  3ODT A;  2IUR A;  4GZ8 A;  4M41 A;  2YB5 A;  5FKS A;  4ES0 A;  2CE8 A;  5IGQ A;  4M3X A;  4X5N A;  5EMM B;  4FA4 D;  2OVQ B;  4JSV C;  5HQG A;  3K26 A;  1P22 A;  5EMK B;  3OW8 A;  4RG8 A;  3L0M A;  1CLQ A;  1JJU B;  4FVM A;  2AGY A;  2BCJ B;  3DXM C;  3SLE D;  2CN3 A;  3W15 A;  4FJ7 A;  3SN6 B;  5IT9 g;  3RLM D;  2XL2 A;  3UVM A;  4K3J B;  4I9L A;  3MKQ A;  4X3E A;  3OGM B;  1IG9 A;  3UR4 A;  2I3T A;  3N0D A;  4OWR A;  4H5I A;  4J0W A;  4A2M A;  3OKY A;  1Q9X A;  5GXH A;  3NGI A;  2HES X;  4X5M A;  5TDH B;  2AQ5 A;  3UIQ A;  3EI3 B;  3EI1 A;  3SJJ A;  3RN0 D;  3BWS A;  4ZOX A;  4PC0 A;  5FQD A;  4TZ4 A;  1GOT B;  3UKR C;  2E32 A;  3S9H A;  2OJY A;  4QRJ A;  4ERY A;  3J27 A;  4KHU A;  5TEF A;  1U4C A;  3CFR A;  2DEB A;  5FKT A;  2IWK A;  3MZK A;  3IKO A;  3OKW A;  1WAJ A;  1XMH E;  2H6K A;  3ORV D;  3J80 g;  2G99 A;  5HE1 B;  3HFQ A;  4E54 B;  2YB8 B;  3UKU C;  5CXB B;  1NEX B;  4M3T A;  4A0B A;  4J8B A;  5KDO B;  3CFS B;  4GMB A;  4PXW A;  4Z8L A;  5CXC B;  5IRE A;  5GXI A;  4E5Z A;  3MXX A;  3I7O A;  5GMK n;  5CYK B;  1XVC E;  3KD1 E;  2JPN A;  4FJM A;  4GQB B;  4O3U B;  4FJN A;  3EU7 A;  2H6Q A;  4M3W A;  3I7L A;  1XIP A;  4FJG A;  4GGD A;  3QEV A;  3J81 g;  1XVD E;  4NSX A;  1SQJ A;  3F3P A;  2B4E A;  3SNN A;  2HKR A;  4KHY A;  4L1Q D;  5EM2 A;  5EAR A;  3TAB A;  5IGO A;  3C6O B;  4FK4 A;  3RN1 D;  3I7N A;  4J2B A;  2W18 A;  2H13 A;  4KI4 A;  3AL8 B;  4JSN C;  4FJ8 A;  2IUP A;  3LZI A;  1MMO G;  2H14 A;  3PE7 A;  1U2V C;  4PSX B;  2HKM A;  5K1C C;  3E0C A;  4QQE A;  1FZ1 E;  1FZ5 E;  3QEW A;  1XVB E;  2H9P A;  4CZV A;  1OLZ A;  4KFM B;  1MTY G;  2YNP A;  3TAG A;  3L4M D;  3OGL B;  4ZOY A;  3JAM g;  4KI6 A;  1L0Q A;  4GAM C;  1FZH E;  3SUN A;  4FK2 A;  4U7A A;  4A08 B;  2H4T A;  5C2W B;  3JRP A;  2UZX B;  2QXV A;  2P9K C;  4D0K A;  2YMU A;  2CO0 A;  2PM7 B;  4M3Z A;  3JZH A;  3QNO A;  4L3H D;  1XVF E;  4QND A;  3SPZ A;  4JS4 A;  3RWU A;  3V9F A;  2AH0 A;  4FA5 D;  2IUQ A;  3IJ1 A;  5SXM A;  4CI1 A;  4M45 A;  3N1E A;  4FJX A;  2HJB A;  4X60 B;  3VGZ A;  5AMS A;  4H5J A;  2QC5 A;  4IMM A;  1XL3 C;  2B5N A;  3PVU B;  3EI2 A;  1B9Y A;  3DSM A;  5JWZ A;  3SUO A;  1JOF A;  2P1Q B;  1SHY B;  3IIY A;  4J84 A;  3SQ2 A;  4A09 A;  4BUJ C;  2B7M A;  1PBY B;  2UZY B;  1XVE E;  1Q9Y A;  3K27 A;  2PBI B;  5H14 A;  2B1E A;  4A11 A;  3NVN A;  3HGK E;  3F3F A;  1VYH C;  3OL2 A;  4FJJ A;  2OK4 A;  1FZ9 E;  4DTN A;  1MHZ G;  4DTM A;  4DTS A;  4M3Y A;  1JMZ B;  1TBG A;  4AKI A;  2PM9 B;  3V7D B;  3NAE A;  3UVK A;  3JRO A;  4FJK A;  4JSX C;  2HYE A;  5AFU 3;  3PSL A;  2YNO A;  2Z2N A;  2XL3 A;  3I7K A;  2VJ5 A;  4DU3 A;  4ESG A;  4J78 A;  4I6J B;  4FJ5 A;  3MMY A;  4A2L A;  3F3G A;  3C6N B;  3HGL A;  4KHW A;  4Y7R A;  2O9K A;  3K2O A;  4M3R A;  3IIW A;  4ADO A;  3L8B A;  4DU1 A;  3NVX A;  4GM8 A;  3V5W B;  5I5J A;  3NE6 A;  2J55 H;  3RFG A;  5K19 A;  3OTT A;  3SFZ A;  1TYQ C;  3SWS D;  4FAN D;  4D6V A;  2GC4 A;  2AGZ A;  5AJA A;  1R5M A;  1NR0 A;  2H6N A;  3EI4 B;  5EAL A;  1FS1 A;  3VA6 A;  1K32 A;  3L1N A;  2YNN A;  4GM9 A;  4DTJ A;  3CFP A;  2P9I C;  4LGN A;  2GC7 A;  4EP9 A;  1FZ2 E;  3AH8 B;  4J87 A;  4PNK B;  3EI3 A;  2PM6 B;  1XMF E;  3SBP A;  5H1M A;  4DTP A;  3SUQ A;  4AKH A;  3NDK A;  4EYW A;  3CIK B;  4CI3 A;  4XEI C;  3SVI A;  4FK0 A;  3B7F A;  3MZL A;  4HDJ A;  1MDA H;  3C6P B;  4ERQ A;  4J2A A;  2XYI A;  2PFT A;  4AI6 A;  1Q47 A;  3EG6 A;  3HP9 A;  1YFQ A;  3IJC A;  3LDS A;  3TJY A;  3NCI A;  3SQ4 A;  3GFC A;  5H37 A;  2AGX A;  4GM3 A;  4E54 A;  3DWL C;  2IWF A;  5EAP A;  2CNX A;  5C9Z B;  4FA9 D;  4O3T B;  5CXB A;  4KHS A;  2OK6 A;  1WAF A;  3RFH A;  2JHP A;  2B5M A;  1PGU A;  3CFV A;  4CI8 A;  3TL8 B;  5CXC A;  2IAA A;  4M42 A;  2Q7Q A;  4FJL A;  4G56 B;  4JT5 C;  3C5M A;  5CYK A;  1PI6 A;  4CY1 A;  3SPY A;  1K8K C;  1A0R B;  1FZ8 E;  4Y5R D;  3RMC A;  4EPH A;  2I0R A;  4K3I D;  3SJL D;  2P1O B;  4JRP A;  2H68 A;  4HCB A;  3I7P A;  2H9M A;  2CO0 C;  1MHY G;  3RMD A;  3E4W A;  2B5L A;  3PXT D;  1FZ4 E;  2B8I A;  3HL8 A;  2YBA A;  2H3X A;  2AGL A;  2JH9 A;  1FZ7 E;  3RSE C;  4J2E A;  2ATQ A;  3C99 A;  3AL8 A;  4A0A B;  1XU5 E;  4JD2 C;  3JPX A;  3JZG A;  4CI2 A;  1MG2 A;  1N6E A;  2XU7 A;  3NVQ A;  1OMW B;  4J8G A;  2P5G A;  1IH7 A;  4PBZ A;  4GGA A;  4KHN A;  4U1E I;  4PBY A;  4DTR A;  3QEP A;  4JT6 C;  1JMX B;  4AOW A;  5IC7 A;  2DY4 A;  2HJ4 A;  3EWE A;  4M3U A;  3AFC A;  4BL0 A;  3TAE A;  3FGB A;  4UI9 R;  5HYN B;  4J79 A;  4A08 A;  3JZN A;  2LF6 A;  2HXC A;  4XYI A;  3KD5 E;  4ZOV A;  4XYH A;  1QNI A;  3RMZ D;  4FJ9 A;  5HE2 B;  3ULE C;  4AEZ A;  4FHL A;  2MMB A;  4BH6 A;  3UVO A;  4DTU A;  3PXS D;  4LG8 A;  2LF3 A;  2FYO A;  1XU3 E;  1GP2 B;  4FJI A;  4X61 B;  2P9U C;  4YVD A;  3WSO A;  5EML B;  1XVG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...