1P22A

Structure of a beta-trcp1-skp1-beta-catenin complex: destruction motif binding and lysine specificity on the scfbeta-trcp1 ubiquitin ligase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
411
structure length
402
Chain Sequence
SPAIMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/WD-repeat protein 1A
publication title Structure of a beta-TrCP1-Skp1-beta-Catenin complex: destruction motif binding and lysine specificity of the SCFbeta-TrCP1 ubiquitin ligase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 107
structure length 402
sequence length 411
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1p22A01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1p22A02
5THAA 2AQ5A 5CXCB 2IWKA 2B5NA 1Q47A 1QNIA 3RSEC 2YMUA 2GC4A 4A11A 4MK0B 2P1MB 3A0FA 2W18A 4QL1A 3UKRC 4ZOYA 4A09B 1B9YA 4JSPC 2OVRB 4ERZA 3IJCA 4JSVC 4GM3A 2CO0A 4LG9A 3ORVD 3I7OA 1JOFA 2H6NA 5C2WB 5JWZA 3UVLA 2CN3A 1PBYB 1SQJA 1U2VC 3MKSB 3PE7A 4A0AA 3C6OB 1TBGA 3BG1A 4L3HD 3DM0A 4R7AB 4E54A 4GQ1A 3RN0D 4OWRA 1R5MA 3KRWB 3RLMD 3OW8A 2Z2OA 4J81A 4A11B 4I79A 3E0CA 3L4MD 4D6VA 2AGZA 3AL9A 2P1NB 1PI6A 3F3PA 4BL0A 5IC7A 4BH6A 4FA4D 5GMKn 2YNPA 5AFU3 3B7FA 4AOWA 3N0DA 3BWSA 5C9ZB 2IUQA 2E31A 3FGBA 3CIKB 3EI4B 3MZKA 2AGLA 5GSAA 3OGKB 5EM2A 4CY1A 1VYHC 4JXMA 4FA5D 5FKQA 5FA5B 3RFGA 3SBPA 3CFSB 4E5ZA 3I7KA 1MG2A 5H1MA 4E54B 4X3EA 4CI3A 3DWLC 3JPXA 5GXHA 2IWFA 4CZYA 3JB9L 3I7LA 5SXMA 2P9UC 3AFCA 3RFHA 2XYIA 3MMYA 2AH1A 2HKMA 3OKYA 4J82A 3U4YA 4OZUA 4HDJA 4IMMA 1FS1A 1N6DA 5H14A 4X61B 3SCYA 3OTTA 3I2NA 4D0KA 2QC5A 2HKRA 3JROA 2H68A 3RRMC 2YBAA 5C2VB 1YFQA 5EM2B 3IIWA 5B4WA 2IAAA 2OIZA 4XYHA 3V9FA 2H6QA 4E5ZB 4I6JB 3PVUB 2GC7A 4LG8A 3F3GA 3SMRA 5K1CC 3J80g 4ZOVA 2I0SA 5HE1B 4O3UB 2P1PB 2Z2NA 4O1QD 3PVWB 4X63B 4QQEA 4PXWA 2IUVA 2CN2A 3SBQA 1GOTB 3I7HA 3OL2A 3F3FA 3PXWD 2H47A 3N0EA 3OKYB 4PBYA 4J8BA 3OGMB 2CE8A 4ESGA 5CYKA 3ZWLB 5FKSA 5IGOA 4ZOZA 4FB1D 2AGWA 4A2LA 4J84A 2OK6A 2BCJB 3C6PB 4A08B 3SFZA 4ES0A 5GXIA 4J0XA 2XL2A 4ZN4A 3JZHA 5EARA 2Z2PA 2H6KA 4L1QD 3EU7A 3I89A 3EI2A 3NVXA 4GM8A 2OVQB 2AGYA 2BBKH 1OMWB 1FWXA 4GM9A 5HQGA 3SBRA 1MG3A 4TZ4A 3SXTD 3I8CA 1PEVA 3EI3A 5I5IA 3IKOA 2CNXA 4U1EI 4A0BA 4FHLA 5CYKB 3PXTD 3K26A 4CI1A 2P9LC 3I8EA 1N6EA 2XU7A 2TRCB 3VH0A 3OGLB 3UVOA 5EMMB 4CY5A 2H9NA 4JT5C 3GFCA 3ULEC 1MDAH 2J55H 3C99A 3DXMC 2HYEA 2J57G 3EI1A 4A0AB 2H13A 3EWEA 2P1QB 2HJ4A 1JMZB 1ERJA 3K27A 4FAND 5CXBA 5KDOB 2P1OB 3IIYA 1P22A 2J56H 4PNKB 5HE2B 3EMHA 4G56B 2YNOA 3UVMA 2P9NC 4GMBA 4O9DA 3EI3B 5EAPA 5FXYA 1U4CA 4CC9A 5FQDA 1TYQC 2OVPB 3GREA 5AMSA 4LGNA 4X60B 2PBIB 4L3GD 2H9LA 1XIPA 4CY3A 4U7AA 3WSOA 4O3TB 1GP2B 4JD2C 1N6FA 3PSLA 4JSNC 3L4OD 4J87A 3C5MA 2I0TA 2UZXB 5IJ8E 3UR4A 2E32A 5EAMA 5FKTA 3EI1B 4J73A 2CO0C 2UZYB 2XL3A 4QRJA 4PSXB 1SHYB 2I3TA 2B5LA 2CE9A 3J81g 5CXBB 5TF2A 1A0RB 3DXKC 1RI6A 2AH0A 4A7JA 5IGQA 1K8KC 4Y7RA 2H3XA 4GGDA 2YNNA 5H17A 5TEEA 4Y5RD 3MKQA 2B5MA 2P9KC 3MXXA 5EMLB 2QXVA 5HE3B 3OKWA 3VA6A 1LDKE 4ERYA 3HFQA 3IJ0A 2YB8B 5FKRA 3W15A 4UI9R 4J79A 4JSXC 3JZGA 4XEIC 4GGAA 4N14A 1S4UX 3AH8B 5IT9g 4PSWB 2H9PA 3KRXB 3RN1D 5EMKB 4ERQA 4Z8LA 3JAMg 4IA9A 3EG6A 4GGCA 3UVKA 3V7DB 4H5IA 1B9XA 3BG0A 2G9AA 5K19A 5TDHB 2HESX 3C6NB 4CY2A 2HXCA 2I0RA 5TEFA 2AGXA 2I3SA 3C75H 3IJ1A 4L9OA 4PBZA 3OL2B 3EI4A 4J0WA 5HYNB 4CZXA 4J78A 4A2MA 1GXRA 3P4FA 1SQ9A 4J8GA 5HE0B 3RMZD 5A2Qg 5I5MA 3SWSD 4K3ID 1GG2B 2G99A 2OK4A 5I5JA 4XYIA 3V5WB 4NSXA 3AL8A 1JMXB 5IJ7E 5EMJB 4FWWA 4EWRA 1NEXB 4JT6C 3SHFA 2IURA 3I7PA 3PXSD 3EI2B 3MZLA 2IUPA 2H9MA 2PM9A 4KFMB 2H14A 4GQ2P 4FA1D 2OJYA 1JJUB 1PGUA 3C9CA 3SJLD 5IBKB 2P9IC 3SN6B 4CZVA 1XKSA 3JRPA 4GQBB 4A0BB 2P9SC 4O45A 2HJBA 1L0QA 3UKUC 1XHMA 2PM6B 3PSCB 3AL8B 3L2OB 5CXCA 2Q7QA 4CI2A 3OKTA 3SLED 5AJAA 3NVNA 4K3JB 5EALA 2MTAH 4ZOXA 4FAVD 4AEZA 4QT8A 4FA9D 4PC0A 3SVWD 1OLZA 4J77A 4BUJC 3DSMA 4H5JA 3CFVA 4A09A 4YVDA 2PM9B 3JZNA 2P9PC 3UVNA 5FLXg 1NR0A 3I7NA 3NVQA 3FRXA 2PM7B 2O9KA 1K32A 3ODTA 4J86A 3VGZA 4A08A 4CI8A 2B4EA 4GZ8A 3FM0A 2EBSA 2GNQA
chains in the Genus database with same CATH superfamily
5THAA 2AQ5A 4EPHA 4M3ZA 5CXCB 4BCDA 2IWKA 3BVOA 2B5NA 1Q47A 3TAFA 1XVFE 3KD1E 1QNIA 3E4WA 3RSEC 2YMUA 2GC4A 4KHSA 4DTRA 4A11A 2B8IA 3EQ9A 4MK0B 2P1MB 3HP9A 1XMHE 4I9LA 3QEWA 2EIEA 2VDPA 1FZ4E 2VDNA 3A0FA 2W18A 4GAMC 4DTPA 4QL1A 3UKRC 4ZOYA 4A09B 4O2WA 5M5TA 1B9YA 1QFMA 2OVRB 3FCSA 4JSPC 4KI6A 4ERZA 3IJCA 4GM3A 4JSVC 2CO0A 4LG9A 3ORVD 5E6RA 3I7OA 4DTSA 1JOFA 2H6NA 3LD8A 3T3PA 3N1EA 5C2WB 2VDKA 5JWZA 3UVLA 4E4BA 2CN3A 4G1EA 4DNWA 1PBYB 1SQJA 1K3IA 1U2VC 3MKSB 3PE7A 3UO2A 1E8MA 4A0AA 1E8NA 3C6OB 1TBGA 3BG1A 4NENA 4L3HD 3DM0A 4FVMA 4R7AB 4E54A 4GQ1A 4KHNA 3RN0D 4DNUA 3LZJA 4OWRA 1R5MA 3KRWB 3RLMD 4FJJA 3OW8A 2Z2OA 4M3YA 4J81A 4A11B 4I79A 1FZ3E 3CQ8A 3E0CA 2K5SA 3L4MD 4D6VA 2JHPA 2AGZA 3AL9A 3NHGA 5M5SA 4G1MA 2P1NB 1PI6A 3F3PA 3QHYB 4BL0A 5IC7A 3QERA 2ATQA 4BH6A 4FA4D 5GMKn 4MMZA 2YNPA 5AFU3 3B7FA 4FJHA 4AI6A 1WAJA 4AOWA 3N0DA 3BWSA 5C9ZB 2IUQA 1FXXA 2E31A 3FGBA 3CIKB 5M5VA 4M3XA 3QESA 3QNNA 3EI4B 2FYOA 5IZ7A 4ICGC 3MZKA 2AGLA 5M61A 5GSAA 1MTYG 3OGKB 5EM2A 4CY1A 1VYHC 4JXMA 4FA5D 2BKLA 4O02A 2QZPA 5FKQA 3CFPA 5FA5B 2HD0A 3SCXA 1FPOA 3RFGA 3CFSB 3SBPA 4E5ZA 2QXFA 3I7KA 3SNNA 1MG2A 3O4GA 4AKHA 5H1MA 5HDBA 4X3EA 4CI3A 4E54B 3DWLC 1XU3E 3JPXA 4NAAA 5GXHA 2IWFA 4CZYA 4J2EA 3JB9L 3IUNA 3I7LA 2VJ5A 5SXMA 2P9UC 3GC3B 3AFCA 3RFHA 3J2PA 2XYIA 3V4VA 3MMYA 2AH1A 4M41A 2HKMA 2VC2A 3OKYA 3IUMA 4KHQA 3SUNA 4KHWA 3IUJA 4J82A 3TJYA 4HCBA 3U4YA 1FZ1E 4RNGA 4B08A 4MMXA 3KCIA 2VDLA 4OZUA 4AMYA 3NIDA 4HDJA 4IMMA 4NBMA 1FS1A 4ADOA 1N6DA 5H14A 4X61B 3SCYA 3OTTA 3I2NA 4D0KA 2QC5A 4M3WA 2HKRA 3JROA 2H68A 1WAFA 3UIQA 3RRMC 4QNDA 2YBAA 5C2VB 1YFQA 5EM2B 3IIWA 3MVDK 5B4WA 2IAAA 2OIZA 4XYHA 3V9FA 2H6QA 3K71A 4E5ZB 4I6JB 3PVUB 2GC7A 4LG8A 3F3GA 3SMRA 2OZSA 3ZDZA 5K1CC 3J80g 4ZOVA 2I0SA 3DDUA 5HE1B 4O3UB 2P1PB 2Z2NA 4O1QD 3PVWB 4X63B 4QQEA 4PXWA 3J27A 2IUVA 5C86A 2CN2A 3KD5E 4HCCA 3O4HA 4I9QA 3O4JA 4FJIA 4X5MA 3SBQA 1GOTB 2VDQA 3LDSA 3I7HA 3OL2A 3F3FA 3PXWD 4X5NA 2H47A 3N0EA 3OKYB 4PBYA 4J8BA 3OGMB 2HU7A 1GOFA 2CE8A 4ESGA 1MMOG 5CYKA 3ZWLB 5E6UA 3VI4A 1U8CA 3RMBA 5FKSA 5IGOA 4ZOZA 4AX4A 4FB1D 1UTCA 1O6GA 2AGWA 4A2LA 2XDWA 1JV2A 3NIFA 4J84A 3N1BA 1Q9YA 2OK6A 2BCJB 3C6PB 4A08B 3SFZA 2JPNA 4ES0A 5GXIA 2YB5A 3QEIA 4BCCA 4IT5A 3QEPA 4J0XA 4Z7NA 5IREA 2XL2A 4J2DA 4ZN4A 1T2XA 3JZHA 2XZGA 4WK2A 5EARA 4DNVA 3L8BA 2H6KA 2Z2PA 4L1QD 3EU7A 2VDMA 3I89A 3T3MA 3RMAA 3EI2A 3NVXA 4GM8A 2OVQB 3QEXA 2AGYA 2BBKH 4KI4A 1OMWB 2XE4A 1FWXA 3E4YA 4GM9A 4BP9A 5HQGA 4QAMA 3IVMA 3SBRA 1MG3A 3HGLA 4TZ4A 1MHZG 4KHUA 3I8CA 1PEVA 3EI3A 3SXTD 5I5IA 3IKOA 4FJNA 2CNXA 4RE5A 1XVEE 4U1EI 4UM9A 4FHLA 5CYKB 4A0BA 4AMZA 5FFGA 3PXTD 3K26A 4E3SA 4CI1A 2P9LC 3I8EA 1N6EA 2XU7A 2TRCB 3VH0A 3OGLB 2OYQA 4Z7QA 4RL5A 3UVOA 1FZ8E 2VZ3A 1VZ3A 4CY5A 5EMMB 1C9IA 3SQ0A 2H9NA 2P5OA 2JHAA 4JT5C 3GFCA 3ULEC 1MDAH 1VE7A 2J55H 3C99A 3DXMC 2HYEA 1H2XA 2J57G 3EI1A 4A0AB 1Q9XA 2H13A 3EWEA 2P1QB 2HJ4A 4AKIA 4RE6A 1JMZB 1ERJA 4DTUA 3K27A 4ADNA 3MUOA 4FAND 5CXBA 5KDOB 2P1OB 4JRPA 1XMFE 3IIYA 2QR5A 1P22A 4FJ7A 3C95A 2J56H 4PNKB 5HE2B 3EMHA 2RKHA 3SUQA 4FK2A 2YNOA 1H2ZA 3GD1I 4JRQA 2P9NC 3TAGA 3UVMA 4GMBA 4O9DA 3QEVA 3EI3B 4NC4A 5EAPA 1U4CA 5FXYA 5FQDA 4CC9A 1TYQC 2EIDA 2OVPB 3GREA 5AMSA 1FZ6E 4LGNA 4X60B 2PBIB 5E6SA 4L3GD 2EIBA 2H9LA 3SVIA 1XIPA 4DTMA 1JTDB 4CY3A 4U7AA 4AKGA 2EICA 3WSOA 4O3TB 4DTXA 4EYWA 3ZDXA 2LF3A 4KHYA 1GP2B 4JD2C 1N6FA 3PSLA 3NCIA 4M3RA 1FZ5E 4JS4A 3L4OD 4J87A 4JSNC 2LF6A 3RMCA 4DU1A 2I0TA 3C5MA 2UZXB 5IJ8E 2H4TA 3EQ8A 1FYZE 3OF7A 2E32A 2HU8A 4JS5A 1L5GA 5EAMA 5FKTA 3UR4A 3VI3A 4ERYA 3EI1B 4J73A 4BCBA 2HU5A 2JH9A 2CO0C 5M5RA 2UZYB 2XL3A 4QRJA 4PSXB 2OZMA 1SHYB 2I3TA 3QETA 2B5LA 2CE9A 4FJXA 5CXBB 5TF2A 3J81g 1A0RB 3DXKC 3NE6A 3FCUA 3SUOA 1RI6A 2AH0A 3SI6A 4A7JA 5IGQA 1K8KC 1VE6A 4Y7RA 2H3XA 2DEBA 2JH8A 4WK0A 4GGDA 2YNNA 1FZHE 3IUQA 3RMDA 5H17A 5TEEA 4Y5RD 3MKQA 4DU4A 3K2OA 2B5MA 4JHNA 1FZ2E 1UOPA 2P9KC 1H2WA 3MXXA 5EMLB 2QXVA 4QNCA 1I2MB 3OKWA 5HE3B 1LDKE 2VIXA 3VA6A 4AN1A 1FZ7E 3CFRA 1YR2A 3HFQA 3IJ0A 2YB8B 1UOOA 4G55A 5FKRA 3W15A 4UI9R 4J79A 4JSXC 3SQ4A 3JZGA 4XEIC 4GGAA 1CLQA 4N14A 1E5TA 3UO3A 1IG9A 1S4UX 3AH8B 5FFOA 5IT9g 3SQ1A 1XU5E 4PSWB 3EQ7A 3C94A 4FJLA 1UOQA 2H9PA 1IH7A 3KRXB 3RN1D 3NAEA 4FJGA 4DTNA 5H37A 5EMKB 1JW2A 4M3TA 1H2YA 4ERQA 4Z7OA 4Z8LA 3JAMg 1TYEA 4IA9A 3EG6A 4GGCA 5C92A 3UVKA 4DU3A 3V7DB 4H5IA 1B9XA 1FZIE 3BG0A 2G9AA 5K19A 5TDHB 1FZ0E 2HESX 3C6NB 4CY2A 2HXCA 2I0RA 5TEFA 2AGXA 2I3SA 3C75H 3IJ1A 3O4IA 4L9OA 4PBZA 3K6SA 3OL2B 3EI4A 1XMGE 4J0WA 4IRZA 5HYNB 4CZXA 4M45A 3IJEA 4J78A 3LZIA 4A2MA 1FZ9E 1GXRA 2P5GA 2VDRA 2VDOA 2MZWB 4J2AA 3SPYA 3P4FA 1C9LA 1SQ9A 4J8GA 5HE0B 3RMZD 5A2Qg 5I5MA 5M5UA 3SWSD 4K3ID 4RG8A 2B1EA 1GG2B 3S9HA 2G99A 2OK4A 5I5JA 4XYIA 3SPZA 4FJ5A 3QI0A 2FW3A 3V5WB 4NSXA 3AL8A 1JMXB 5IJ7E 2JKXA 4DTJA 5EMJB 3HGKE 1XVBE 4L1MA 4FWWA 4FJ8A 1XVDE 4EWRA 3V4PA 3L0MA 4DTOA 1NEXB 4JT6C 3SHFA 1BPOA 2IURA 4FK0A 1MHYG 3MUNA 3I7PA 2JQTA 3PXSD 3EI2B 3MZLA 2MMBA 3NGIA 1M1XA 3HL8A 2B7MA 4WK4A 2IUPA 1N1CA 4G56B 2RCUA 2VJ4A 3CFOA 2JHCA 3LDBA 2H9MA 2PM9A 4UM8A 4KFMB 2H14A 4GQ2P 4FA1D 4FJKA 2MW2A 2OJYA 1JJUB 1PGUA 1GOHA 3ZE1A 3TAEA 4M3UA 3C9CA 1QFSA 3SJLD 5IBKB 2P9IC 3SN6B 4AN0A 2DY4A 1XKSA 4CZVA 3JRPA 4GQBB 2PFTA 4JHPC 4M42A 2P9SC 4A0BB 4O45A 2HJBA 1L0QA 3UKUC 1XHMA 3TABA 3ZE0A 2PM6B 3SQ2A 1GOGA 3PSCB 3AL8B 3L2OB 5CXCA 2Q7QA 4CI2A 3IURA 4BP8A 3OKTA 3SLED 4FJMA 3NVNA 4K3JB 1VZ2A 5AJAA 5EALA 2MTAH 4FJ9A 4ZOXA 4FAVD 2PFVA 3ZE2A 1O6FA 4AEZA 4QT8A 3RWUA 4WJKA 1XVCE 4FA9D 4PC0A 3SVWD 1A12A 1OLZA 4J77A 3QNOA 2DTUA 3DSMA 4H5JA 4BUJC 2WQ8A 3CFVA 3L1NA 4A09A 4YVDA 3NDKA 4D9SA 1XVGE 4FK4A 2PM9B 3NIGA 3IULA 3JZNA 4J2BA 2P9PC 3UVNA 5FLXg 1NR0A 3I7NA 3NVQA 3K72A 3FRXA 2PM7B 3SUPA 2O9KA 1K32A 3ODTA 4J86A 4MMYA 3VGZA 4CI8A 4A08A 2B4EA 4EP9A 2VZ1A 4GZ8A 3ZDYA 3FM0A 1XL3C 2EBSA 3SJJA 2GNQA 3TL8B
chains in the Genus database with same CATH topology
5THAA 2AQ5A 4EPHA 4M3ZA 5CXCB 2IWKA 2B5NA 1Q47A 3TAFA 1XVFE 3KD1E 1QNIA 3E4WA 3RSEC 2YMUA 2GC4A 4KHSA 4DTRA 4A11A 2B8IA 4MK0B 2P1MB 3HP9A 1XMHE 4I9LA 3QEWA 1FZ4E 3A0FA 2W18A 4GAMC 4DTPA 4QL1A 3UKRC 4ZOYA 4A09B 1B9YA 4JSPC 2OVRB 4KI6A 4ERZA 3IJCA 4GM3A 4JSVC 2CO0A 4LG9A 3ORVD 3I7OA 4DTSA 1JOFA 2H6NA 3LD8A 3N1EA 5C2WB 5JWZA 3UVLA 4E4BA 2CN3A 1PBYB 1SQJA 1U2VC 3MKSB 3PE7A 4A0AA 3C6OB 1TBGA 3BG1A 4L3HD 3DM0A 4FVMA 4R7AB 4E54A 4GQ1A 4KHNA 3RN0D 3LZJA 4OWRA 1R5MA 3KRWB 3RLMD 4FJJA 3OW8A 2Z2OA 4M3YA 4J81A 4A11B 4I79A 1FZ3E 3CQ8A 3E0CA 3L4MD 4D6VA 2JHPA 2AGZA 3AL9A 3NHGA 2P1NB 1PI6A 3F3PA 4BL0A 5IC7A 3QERA 2ATQA 4BH6A 4FA4D 5GMKn 2YNPA 5AFU3 3B7FA 4FJHA 4AI6A 1WAJA 4AOWA 3N0DA 3BWSA 5C9ZB 2IUQA 1FXXA 2E31A 3FGBA 3CIKB 4M3XA 3QESA 3QNNA 3EI4B 2FYOA 5IZ7A 3MZKA 2AGLA 5GSAA 1MTYG 3OGKB 5EM2A 4CY1A 1VYHC 4JXMA 4FA5D 5FKQA 3CFPA 5FA5B 2HD0A 3SCXA 3RFGA 3SBPA 3CFSB 4E5ZA 2QXFA 3I7KA 3SNNA 1MG2A 5H1MA 4AKHA 4E54B 4X3EA 4CI3A 3DWLC 1XU3E 3JPXA 5GXHA 2IWFA 4CZYA 4J2EA 3JB9L 3I7LA 2VJ5A 5SXMA 2P9UC 3AFCA 3RFHA 3J2PA 2XYIA 3MMYA 2AH1A 4M41A 2HKMA 3OKYA 4KHQA 3SUNA 4KHWA 4J82A 3TJYA 4HCBA 3U4YA 1FZ1E 4RNGA 4B08A 4OZUA 4HDJA 4IMMA 1FS1A 4ADOA 1N6DA 5H14A 4X61B 3SCYA 3OTTA 3I2NA 4D0KA 2QC5A 4M3WA 2HKRA 3JROA 2H68A 1WAFA 3UIQA 3RRMC 4QNDA 2YBAA 5C2VB 1YFQA 5EM2B 3IIWA 5B4WA 2IAAA 2OIZA 4XYHA 3V9FA 2H6QA 4E5ZB 4I6JB 3PVUB 2GC7A 4LG8A 3F3GA 3SMRA 2OZSA 5K1CC 3J80g 4ZOVA 2I0SA 5HE1B 4O3UB 2P1PB 2Z2NA 4O1QD 3PVWB 4X63B 4QQEA 4PXWA 3J27A 2IUVA 2CN2A 3KD5E 4HCCA 4I9QA 4FJIA 4X5MA 3SBQA 1GOTB 3I7HA 3LDSA 3OL2A 3F3FA 3PXWD 4X5NA 2H47A 3N0EA 3OKYB 4PBYA 4J8BA 3OGMB 2CE8A 4ESGA 1MMOG 5CYKA 3ZWLB 3RMBA 5FKSA 5IGOA 4ZOZA 4FB1D 2AGWA 4A2LA 4J84A 3N1BA 1Q9YA 2OK6A 2BCJB 3C6PB 4A08B 3SFZA 2JPNA 4ES0A 5GXIA 2YB5A 3QEIA 3QEPA 4J0XA 5IREA 2XL2A 4J2DA 4ZN4A 3JZHA 5EARA 3L8BA 2H6KA 2Z2PA 4L1QD 3EU7A 3I89A 3RMAA 3EI2A 3NVXA 4GM8A 2OVQB 3QEXA 2BBKH 2AGYA 4KI4A 1OMWB 1FWXA 3E4YA 4GM9A 5HQGA 3SBRA 1MG3A 3HGLA 4TZ4A 1MHZG 4KHUA 3I8CA 1PEVA 3EI3A 3SXTD 5I5IA 3IKOA 4FJNA 2CNXA 1XVEE 4U1EI 4A0BA 4FHLA 5CYKB 3PXTD 3K26A 4E3SA 4CI1A 2P9LC 3I8EA 1N6EA 2XU7A 2TRCB 3VH0A 3OGLB 2OYQA 4RL5A 3UVOA 1FZ8E 5EMMB 4CY5A 3SQ0A 2H9NA 2P5OA 2JHAA 4JT5C 3GFCA 3ULEC 1MDAH 2J55H 3C99A 3DXMC 2HYEA 2J57G 3EI1A 4A0AB 1Q9XA 2H13A 3EWEA 2P1QB 2HJ4A 4AKIA 1JMZB 1ERJA 4DTUA 3K27A 4ADNA 4FAND 5CXBA 5KDOB 2P1OB 4JRPA 1XMFE 3IIYA 1P22A 4FJ7A 3C95A 2J56H 4PNKB 5HE2B 3EMHA 3SUQA 2YNOA 4FK2A 4G56B 3UVMA 4JRQA 2P9NC 3TAGA 4GMBA 4O9DA 3QEVA 3EI3B 5EAPA 5FXYA 1U4CA 4CC9A 5FQDA 1TYQC 2OVPB 3GREA 5AMSA 1FZ6E 4LGNA 4X60B 2PBIB 4L3GD 2H9LA 3SVIA 1XIPA 4DTMA 4CY3A 4U7AA 4AKGA 3WSOA 4O3TB 4DTXA 4EYWA 2LF3A 4KHYA 1GP2B 4JD2C 1N6FA 3PSLA 3NCIA 4M3RA 1FZ5E 4JS4A 3L4OD 4J87A 4JSNC 2LF6A 3RMCA 4DU1A 2I0TA 3C5MA 2UZXB 5IJ8E 2H4TA 1FYZE 3UR4A 2E32A 5EAMA 4JS5A 5FKTA 3EI1B 4J73A 2JH9A 2CO0C 2UZYB 2XL3A 4QRJA 4PSXB 2OZMA 1SHYB 2I3TA 3QETA 2B5LA 2CE9A 4FJXA 5CXBB 5TF2A 3J81g 1A0RB 3DXKC 3NE6A 3SUOA 1RI6A 2AH0A 3SI6A 4A7JA 5IGQA 1K8KC 4Y7RA 2H3XA 2DEBA 2JH8A 4GGDA 2YNNA 1FZHE 3RMDA 5H17A 5TEEA 4Y5RD 3MKQA 4DU4A 3K2OA 2B5MA 1FZ2E 2P9KC 3MXXA 5EMLB 2QXVA 4QNCA 5HE3B 3OKWA 3VA6A 1LDKE 2VIXA 1FZ7E 3CFRA 3HFQA 3IJ0A 4ERYA 2YB8B 5FKRA 3W15A 4UI9R 4J79A 4JSXC 3SQ4A 3JZGA 4XEIC 4GGAA 1CLQA 4N14A 1IG9A 1S4UX 3AH8B 5IT9g 3SQ1A 1XU5E 4PSWB 3C94A 4FJLA 2H9PA 1IH7A 3KRXB 3RN1D 3NAEA 4FJGA 4DTNA 5H37A 5EMKB 4M3TA 4ERQA 4Z8LA 3JAMg 4IA9A 3EG6A 4GGCA 3UVKA 4DU3A 3V7DB 4H5IA 1B9XA 1FZIE 3BG0A 2G9AA 5K19A 5TDHB 1FZ0E 2HESX 3C6NB 4CY2A 2HXCA 2I0RA 5TEFA 2AGXA 2I3SA 3C75H 3IJ1A 4L9OA 4PBZA 3OL2B 3EI4A 1XMGE 4J0WA 5HYNB 4CZXA 4M45A 4J78A 3LZIA 4A2MA 1FZ9E 1GXRA 2P5GA 2MZWB 4J2AA 3SPYA 3P4FA 1SQ9A 4J8GA 5HE0B 3RMZD 5A2Qg 5I5MA 3SWSD 4K3ID 4RG8A 2B1EA 1GG2B 3S9HA 2G99A 2OK4A 5I5JA 4XYIA 3SPZA 4FJ5A 2FW3A 3V5WB 4NSXA 3AL8A 1JMXB 5IJ7E 4DTJA 5EMJB 3HGKE 1XVBE 4FWWA 4FJ8A 1XVDE 4EWRA 3L0MA 4DTOA 1NEXB 4JT6C 3SHFA 2IURA 4FK0A 1MHYG 3I7PA 3PXSD 3EI2B 3MZLA 2MMBA 3NGIA 3HL8A 2B7MA 2IUPA 2RCUA 2VJ4A 3CFOA 2JHCA 3LDBA 2H9MA 2PM9A 4KFMB 2H14A 4GQ2P 4FA1D 4FJKA 2OJYA 1JJUB 1PGUA 3TAEA 4M3UA 3C9CA 3SJLD 5IBKB 2P9IC 3SN6B 4CZVA 2DY4A 1XKSA 3JRPA 4GQBB 2PFTA 4A0BB 4M42A 2P9SC 4O45A 2HJBA 1L0QA 3UKUC 1XHMA 3TABA 2PM6B 3SQ2A 3PSCB 3AL8B 3L2OB 5CXCA 2Q7QA 4CI2A 3OKTA 3SLED 4FJMA 3NVNA 4K3JB 5AJAA 5EALA 2MTAH 4FJ9A 4ZOXA 4FAVD 2PFVA 4AEZA 4QT8A 3RWUA 1XVCE 4FA9D 4PC0A 3SVWD 1OLZA 4J77A 4BUJC 3QNOA 2DTUA 3DSMA 4H5JA 3CFVA 3L1NA 4A09A 4YVDA 3NDKA 1XVGE 4FK4A 2PM9B 3JZNA 4J2BA 2P9PC 3UVNA 5FLXg 1NR0A 3I7NA 3NVQA 3FRXA 2PM7B 3SUPA 2O9KA 1K32A 3ODTA 4J86A 3VGZA 4A08A 4CI8A 2B4EA 4EP9A 4GZ8A 3FM0A 1XL3C 2EBSA 3SJJA 2GNQA 3TL8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5THA A;  2AQ5 A;  5CXC B;  2IWK A;  2B5N A;  1Q47 A;  1QNI A;  3RSE C;  2YMU A;  2GC4 A;  4A11 A;  4MK0 B;  2P1M B;  3A0F A;  2W18 A;  4QL1 A;  3UKR C;  4ZOY A;  4A09 B;  1B9Y A;  4JSP C;  2OVR B;  4ERZ A;  3IJC A;  4JSV C;  4GM3 A;  2CO0 A;  4LG9 A;  3ORV D;  3I7O A;  1JOF A;  2H6N A;  5C2W B;  5JWZ A;  3UVL A;  2CN3 A;  1PBY B;  1SQJ A;  1U2V C;  3MKS B;  3PE7 A;  4A0A A;  3C6O B;  1TBG A;  3BG1 A;  4L3H D;  3DM0 A;  4R7A B;  4E54 A;  4GQ1 A;  3RN0 D;  4OWR A;  1R5M A;  3KRW B;  3RLM D;  3OW8 A;  2Z2O A;  4J81 A;  4A11 B;  4I79 A;  3E0C A;  3L4M D;  4D6V A;  2AGZ A;  3AL9 A;  2P1N B;  1PI6 A;  3F3P A;  4BL0 A;  5IC7 A;  4BH6 A;  4FA4 D;  5GMK n;  2YNP A;  5AFU 3;  3B7F A;  4AOW A;  3N0D A;  3BWS A;  5C9Z B;  2IUQ A;  2E31 A;  3FGB A;  3CIK B;  3EI4 B;  3MZK A;  2AGL A;  5GSA A;  3OGK B;  5EM2 A;  4CY1 A;  1VYH C;  4JXM A;  4FA5 D;  5FKQ A;  5FA5 B;  3RFG A;  3SBP A;  3CFS B;  4E5Z A;  3I7K A;  1MG2 A;  5H1M A;  4E54 B;  4X3E A;  4CI3 A;  3DWL C;  3JPX A;  5GXH A;  2IWF A;  4CZY A;  3JB9 L;  3I7L A;  5SXM A;  2P9U C;  3AFC A;  3RFH A;  2XYI A;  3MMY A;  2AH1 A;  2HKM A;  3OKY A;  4J82 A;  3U4Y A;  4OZU A;  4HDJ A;  4IMM A;  1FS1 A;  1N6D A;  5H14 A;  4X61 B;  3SCY A;  3OTT A;  3I2N A;  4D0K A;  2QC5 A;  2HKR A;  3JRO A;  2H68 A;  3RRM C;  2YBA A;  5C2V B;  1YFQ A;  5EM2 B;  3IIW A;  5B4W A;  2IAA A;  2OIZ A;  4XYH A;  3V9F A;  2H6Q A;  4E5Z B;  4I6J B;  3PVU B;  2GC7 A;  4LG8 A;  3F3G A;  3SMR A;  5K1C C;  3J80 g;  4ZOV A;  2I0S A;  5HE1 B;  4O3U B;  2P1P B;  2Z2N A;  4O1Q D;  3PVW B;  4X63 B;  4QQE A;  4PXW A;  2IUV A;  2CN2 A;  3SBQ A;  1GOT B;  3I7H A;  3OL2 A;  3F3F A;  3PXW D;  2H47 A;  3N0E A;  3OKY B;  4PBY A;  4J8B A;  3OGM B;  2CE8 A;  4ESG A;  5CYK A;  3ZWL B;  5FKS A;  5IGO A;  4ZOZ A;  4FB1 D;  2AGW A;  4A2L A;  4J84 A;  2OK6 A;  2BCJ B;  3C6P B;  4A08 B;  3SFZ A;  4ES0 A;  5GXI A;  4J0X A;  2XL2 A;  4ZN4 A;  3JZH A;  5EAR A;  2Z2P A;  2H6K A;  4L1Q D;  3EU7 A;  3I89 A;  3EI2 A;  3NVX A;  4GM8 A;  2OVQ B;  2AGY A;  2BBK H;  1OMW B;  1FWX A;  4GM9 A;  5HQG A;  3SBR A;  1MG3 A;  4TZ4 A;  3SXT D;  3I8C A;  1PEV A;  3EI3 A;  5I5I A;  3IKO A;  2CNX A;  4U1E I;  4A0B A;  4FHL A;  5CYK B;  3PXT D;  3K26 A;  4CI1 A;  2P9L C;  3I8E A;  1N6E A;  2XU7 A;  2TRC B;  3VH0 A;  3OGL B;  3UVO A;  5EMM B;  4CY5 A;  2H9N A;  4JT5 C;  3GFC A;  3ULE C;  1MDA H;  2J55 H;  3C99 A;  3DXM C;  2HYE A;  2J57 G;  3EI1 A;  4A0A B;  2H13 A;  3EWE A;  2P1Q B;  2HJ4 A;  1JMZ B;  1ERJ A;  3K27 A;  4FAN D;  5CXB A;  5KDO B;  2P1O B;  3IIY A;  1P22 A;  2J56 H;  4PNK B;  5HE2 B;  3EMH A;  4G56 B;  2YNO A;  3UVM A;  2P9N C;  4GMB A;  4O9D A;  3EI3 B;  5EAP A;  5FXY A;  1U4C A;  4CC9 A;  5FQD A;  1TYQ C;  2OVP B;  3GRE A;  5AMS A;  4LGN A;  4X60 B;  2PBI B;  4L3G D;  2H9L A;  1XIP A;  4CY3 A;  4U7A A;  3WSO A;  4O3T B;  1GP2 B;  4JD2 C;  1N6F A;  3PSL A;  4JSN C;  3L4O D;  4J87 A;  3C5M A;  2I0T A;  2UZX B;  5IJ8 E;  3UR4 A;  2E32 A;  5EAM A;  5FKT A;  3EI1 B;  4J73 A;  2CO0 C;  2UZY B;  2XL3 A;  4QRJ A;  4PSX B;  1SHY B;  2I3T A;  2B5L A;  2CE9 A;  3J81 g;  5CXB B;  5TF2 A;  1A0R B;  3DXK C;  1RI6 A;  2AH0 A;  4A7J A;  5IGQ A;  1K8K C;  4Y7R A;  2H3X A;  4GGD A;  2YNN A;  5H17 A;  5TEE A;  4Y5R D;  3MKQ A;  2B5M A;  2P9K C;  3MXX A;  5EML B;  2QXV A;  5HE3 B;  3OKW A;  3VA6 A;  1LDK E;  4ERY A;  3HFQ A;  3IJ0 A;  2YB8 B;  5FKR A;  3W15 A;  4UI9 R;  4J79 A;  4JSX C;  3JZG A;  4XEI C;  4GGA A;  4N14 A;  1S4U X;  3AH8 B;  5IT9 g;  4PSW B;  2H9P A;  3KRX B;  3RN1 D;  5EMK B;  4ERQ A;  4Z8L A;  3JAM g;  4IA9 A;  3EG6 A;  4GGC A;  3UVK A;  3V7D B;  4H5I A;  1B9X A;  3BG0 A;  2G9A A;  5K19 A;  5TDH B;  2HES X;  3C6N B;  4CY2 A;  2HXC A;  2I0R A;  5TEF A;  2AGX A;  2I3S A;  3C75 H;  3IJ1 A;  4L9O A;  4PBZ A;  3OL2 B;  3EI4 A;  4J0W A;  5HYN B;  4CZX A;  4J78 A;  4A2M A;  1GXR A;  3P4F A;  1SQ9 A;  4J8G A;  5HE0 B;  3RMZ D;  5A2Q g;  5I5M A;  3SWS D;  4K3I D;  1GG2 B;  2G99 A;  2OK4 A;  5I5J A;  4XYI A;  3V5W B;  4NSX A;  3AL8 A;  1JMX B;  5IJ7 E;  5EMJ B;  4FWW A;  4EWR A;  1NEX B;  4JT6 C;  3SHF A;  2IUR A;  3I7P A;  3PXS D;  3EI2 B;  3MZL A;  2IUP A;  2H9M A;  2PM9 A;  4KFM B;  2H14 A;  4GQ2 P;  4FA1 D;  2OJY A;  1JJU B;  1PGU A;  3C9C A;  3SJL D;  5IBK B;  2P9I C;  3SN6 B;  4CZV A;  1XKS A;  3JRP A;  4GQB B;  4A0B B;  2P9S C;  4O45 A;  2HJB A;  1L0Q A;  3UKU C;  1XHM A;  2PM6 B;  3PSC B;  3AL8 B;  3L2O B;  5CXC A;  2Q7Q A;  4CI2 A;  3OKT A;  3SLE D;  5AJA A;  3NVN A;  4K3J B;  5EAL A;  2MTA H;  4ZOX A;  4FAV D;  4AEZ A;  4QT8 A;  4FA9 D;  4PC0 A;  3SVW D;  1OLZ A;  4J77 A;  4BUJ C;  3DSM A;  4H5J A;  3CFV A;  4A09 A;  4YVD A;  2PM9 B;  3JZN A;  2P9P C;  3UVN A;  5FLX g;  1NR0 A;  3I7N A;  3NVQ A;  3FRX A;  2PM7 B;  2O9K A;  1K32 A;  3ODT A;  4J86 A;  3VGZ A;  4A08 A;  4CI8 A;  2B4E A;  4GZ8 A;  3FM0 A;  2EBS A;  2GNQ A; 
#chains in the Genus database with same CATH topology
 5THA A;  2AQ5 A;  4EPH A;  4M3Z A;  5CXC B;  4BCD A;  2IWK A;  3BVO A;  2B5N A;  1Q47 A;  3TAF A;  1XVF E;  3KD1 E;  1QNI A;  3E4W A;  3RSE C;  2YMU A;  2GC4 A;  4KHS A;  4DTR A;  4A11 A;  2B8I A;  3EQ9 A;  4MK0 B;  2P1M B;  3HP9 A;  1XMH E;  4I9L A;  3QEW A;  2EIE A;  2VDP A;  1FZ4 E;  2VDN A;  3A0F A;  2W18 A;  4GAM C;  4DTP A;  4QL1 A;  3UKR C;  4ZOY A;  4A09 B;  4O2W A;  5M5T A;  1B9Y A;  1QFM A;  2OVR B;  3FCS A;  4JSP C;  4KI6 A;  4ERZ A;  3IJC A;  4GM3 A;  4JSV C;  2CO0 A;  4LG9 A;  3ORV D;  5E6R A;  3I7O A;  4DTS A;  1JOF A;  2H6N A;  3LD8 A;  3T3P A;  3N1E A;  5C2W B;  2VDK A;  5JWZ A;  3UVL A;  4E4B A;  2CN3 A;  4G1E A;  4DNW A;  1PBY B;  1SQJ A;  1K3I A;  1U2V C;  3MKS B;  3PE7 A;  3UO2 A;  1E8M A;  4A0A A;  1E8N A;  3C6O B;  1TBG A;  3BG1 A;  4NEN A;  4L3H D;  3DM0 A;  4FVM A;  4R7A B;  4E54 A;  4GQ1 A;  4KHN A;  3RN0 D;  4DNU A;  3LZJ A;  4OWR A;  1R5M A;  3KRW B;  3RLM D;  4FJJ A;  3OW8 A;  2Z2O A;  4M3Y A;  4J81 A;  4A11 B;  4I79 A;  1FZ3 E;  3CQ8 A;  3E0C A;  2K5S A;  3L4M D;  4D6V A;  2JHP A;  2AGZ A;  3AL9 A;  3NHG A;  5M5S A;  4G1M A;  2P1N B;  1PI6 A;  3F3P A;  3QHY B;  4BL0 A;  5IC7 A;  3QER A;  2ATQ A;  4BH6 A;  4FA4 D;  5GMK n;  4MMZ A;  2YNP A;  5AFU 3;  3B7F A;  4FJH A;  4AI6 A;  1WAJ A;  4AOW A;  3N0D A;  3BWS A;  5C9Z B;  2IUQ A;  1FXX A;  2E31 A;  3FGB A;  3CIK B;  5M5V A;  4M3X A;  3QES A;  3QNN A;  3EI4 B;  2FYO A;  5IZ7 A;  4ICG C;  3MZK A;  2AGL A;  5M61 A;  5GSA A;  1MTY G;  3OGK B;  5EM2 A;  4CY1 A;  1VYH C;  4JXM A;  4FA5 D;  2BKL A;  4O02 A;  2QZP A;  5FKQ A;  3CFP A;  5FA5 B;  2HD0 A;  3SCX A;  1FPO A;  3RFG A;  3CFS B;  3SBP A;  4E5Z A;  2QXF A;  3I7K A;  3SNN A;  1MG2 A;  3O4G A;  4AKH A;  5H1M A;  5HDB A;  4X3E A;  4CI3 A;  4E54 B;  3DWL C;  1XU3 E;  3JPX A;  4NAA A;  5GXH A;  2IWF A;  4CZY A;  4J2E A;  3JB9 L;  3IUN A;  3I7L A;  2VJ5 A;  5SXM A;  2P9U C;  3GC3 B;  3AFC A;  3RFH A;  3J2P A;  2XYI A;  3V4V A;  3MMY A;  2AH1 A;  4M41 A;  2HKM A;  2VC2 A;  3OKY A;  3IUM A;  4KHQ A;  3SUN A;  4KHW A;  3IUJ A;  4J82 A;  3TJY A;  4HCB A;  3U4Y A;  1FZ1 E;  4RNG A;  4B08 A;  4MMX A;  3KCI A;  2VDL A;  4OZU A;  4AMY A;  3NID A;  4HDJ A;  4IMM A;  4NBM A;  1FS1 A;  4ADO A;  1N6D A;  5H14 A;  4X61 B;  3SCY A;  3OTT A;  3I2N A;  4D0K A;  2QC5 A;  4M3W A;  2HKR A;  3JRO A;  2H68 A;  1WAF A;  3UIQ A;  3RRM C;  4QND A;  2YBA A;  5C2V B;  1YFQ A;  5EM2 B;  3IIW A;  3MVD K;  5B4W A;  2IAA A;  2OIZ A;  4XYH A;  3V9F A;  2H6Q A;  3K71 A;  4E5Z B;  4I6J B;  3PVU B;  2GC7 A;  4LG8 A;  3F3G A;  3SMR A;  2OZS A;  3ZDZ A;  5K1C C;  3J80 g;  4ZOV A;  2I0S A;  3DDU A;  5HE1 B;  4O3U B;  2P1P B;  2Z2N A;  4O1Q D;  3PVW B;  4X63 B;  4QQE A;  4PXW A;  3J27 A;  2IUV A;  5C86 A;  2CN2 A;  3KD5 E;  4HCC A;  3O4H A;  4I9Q A;  3O4J A;  4FJI A;  4X5M A;  3SBQ A;  1GOT B;  2VDQ A;  3LDS A;  3I7H A;  3OL2 A;  3F3F A;  3PXW D;  4X5N A;  2H47 A;  3N0E A;  3OKY B;  4PBY A;  4J8B A;  3OGM B;  2HU7 A;  1GOF A;  2CE8 A;  4ESG A;  1MMO G;  5CYK A;  3ZWL B;  5E6U A;  3VI4 A;  1U8C A;  3RMB A;  5FKS A;  5IGO A;  4ZOZ A;  4AX4 A;  4FB1 D;  1UTC A;  1O6G A;  2AGW A;  4A2L A;  2XDW A;  1JV2 A;  3NIF A;  4J84 A;  3N1B A;  1Q9Y A;  2OK6 A;  2BCJ B;  3C6P B;  4A08 B;  3SFZ A;  2JPN A;  4ES0 A;  5GXI A;  2YB5 A;  3QEI A;  4BCC A;  4IT5 A;  3QEP A;  4J0X A;  4Z7N A;  5IRE A;  2XL2 A;  4J2D A;  4ZN4 A;  1T2X A;  3JZH A;  2XZG A;  4WK2 A;  5EAR A;  4DNV A;  3L8B A;  2H6K A;  2Z2P A;  4L1Q D;  3EU7 A;  2VDM A;  3I89 A;  3T3M A;  3RMA A;  3EI2 A;  3NVX A;  4GM8 A;  2OVQ B;  3QEX A;  2AGY A;  2BBK H;  4KI4 A;  1OMW B;  2XE4 A;  1FWX A;  3E4Y A;  4GM9 A;  4BP9 A;  5HQG A;  4QAM A;  3IVM A;  3SBR A;  1MG3 A;  3HGL A;  4TZ4 A;  1MHZ G;  4KHU A;  3I8C A;  1PEV A;  3EI3 A;  3SXT D;  5I5I A;  3IKO A;  4FJN A;  2CNX A;  4RE5 A;  1XVE E;  4U1E I;  4UM9 A;  4FHL A;  5CYK B;  4A0B A;  4AMZ A;  5FFG A;  3PXT D;  3K26 A;  4E3S A;  4CI1 A;  2P9L C;  3I8E A;  1N6E A;  2XU7 A;  2TRC B;  3VH0 A;  3OGL B;  2OYQ A;  4Z7Q A;  4RL5 A;  3UVO A;  1FZ8 E;  2VZ3 A;  1VZ3 A;  4CY5 A;  5EMM B;  1C9I A;  3SQ0 A;  2H9N A;  2P5O A;  2JHA A;  4JT5 C;  3GFC A;  3ULE C;  1MDA H;  1VE7 A;  2J55 H;  3C99 A;  3DXM C;  2HYE A;  1H2X A;  2J57 G;  3EI1 A;  4A0A B;  1Q9X A;  2H13 A;  3EWE A;  2P1Q B;  2HJ4 A;  4AKI A;  4RE6 A;  1JMZ B;  1ERJ A;  4DTU A;  3K27 A;  4ADN A;  3MUO A;  4FAN D;  5CXB A;  5KDO B;  2P1O B;  4JRP A;  1XMF E;  3IIY A;  2QR5 A;  1P22 A;  4FJ7 A;  3C95 A;  2J56 H;  4PNK B;  5HE2 B;  3EMH A;  2RKH A;  3SUQ A;  4FK2 A;  2YNO A;  1H2Z A;  3GD1 I;  4JRQ A;  2P9N C;  3TAG A;  3UVM A;  4GMB A;  4O9D A;  3QEV A;  3EI3 B;  4NC4 A;  5EAP A;  1U4C A;  5FXY A;  5FQD A;  4CC9 A;  1TYQ C;  2EID A;  2OVP B;  3GRE A;  5AMS A;  1FZ6 E;  4LGN A;  4X60 B;  2PBI B;  5E6S A;  4L3G D;  2EIB A;  2H9L A;  3SVI A;  1XIP A;  4DTM A;  1JTD B;  4CY3 A;  4U7A A;  4AKG A;  2EIC A;  3WSO A;  4O3T B;  4DTX A;  4EYW A;  3ZDX A;  2LF3 A;  4KHY A;  1GP2 B;  4JD2 C;  1N6F A;  3PSL A;  3NCI A;  4M3R A;  1FZ5 E;  4JS4 A;  3L4O D;  4J87 A;  4JSN C;  2LF6 A;  3RMC A;  4DU1 A;  2I0T A;  3C5M A;  2UZX B;  5IJ8 E;  2H4T A;  3EQ8 A;  1FYZ E;  3OF7 A;  2E32 A;  2HU8 A;  4JS5 A;  1L5G A;  5EAM A;  5FKT A;  3UR4 A;  3VI3 A;  4ERY A;  3EI1 B;  4J73 A;  4BCB A;  2HU5 A;  2JH9 A;  2CO0 C;  5M5R A;  2UZY B;  2XL3 A;  4QRJ A;  4PSX B;  2OZM A;  1SHY B;  2I3T A;  3QET A;  2B5L A;  2CE9 A;  4FJX A;  5CXB B;  5TF2 A;  3J81 g;  1A0R B;  3DXK C;  3NE6 A;  3FCU A;  3SUO A;  1RI6 A;  2AH0 A;  3SI6 A;  4A7J A;  5IGQ A;  1K8K C;  1VE6 A;  4Y7R A;  2H3X A;  2DEB A;  2JH8 A;  4WK0 A;  4GGD A;  2YNN A;  1FZH E;  3IUQ A;  3RMD A;  5H17 A;  5TEE A;  4Y5R D;  3MKQ A;  4DU4 A;  3K2O A;  2B5M A;  4JHN A;  1FZ2 E;  1UOP A;  2P9K C;  1H2W A;  3MXX A;  5EML B;  2QXV A;  4QNC A;  1I2M B;  3OKW A;  5HE3 B;  1LDK E;  2VIX A;  3VA6 A;  4AN1 A;  1FZ7 E;  3CFR A;  1YR2 A;  3HFQ A;  3IJ0 A;  2YB8 B;  1UOO A;  4G55 A;  5FKR A;  3W15 A;  4UI9 R;  4J79 A;  4JSX C;  3SQ4 A;  3JZG A;  4XEI C;  4GGA A;  1CLQ A;  4N14 A;  1E5T A;  3UO3 A;  1IG9 A;  1S4U X;  3AH8 B;  5FFO A;  5IT9 g;  3SQ1 A;  1XU5 E;  4PSW B;  3EQ7 A;  3C94 A;  4FJL A;  1UOQ A;  2H9P A;  1IH7 A;  3KRX B;  3RN1 D;  3NAE A;  4FJG A;  4DTN A;  5H37 A;  5EMK B;  1JW2 A;  4M3T A;  1H2Y A;  4ERQ A;  4Z7O A;  4Z8L A;  3JAM g;  1TYE A;  4IA9 A;  3EG6 A;  4GGC A;  5C92 A;  3UVK A;  4DU3 A;  3V7D B;  4H5I A;  1B9X A;  1FZI E;  3BG0 A;  2G9A A;  5K19 A;  5TDH B;  1FZ0 E;  2HES X;  3C6N B;  4CY2 A;  2HXC A;  2I0R A;  5TEF A;  2AGX A;  2I3S A;  3C75 H;  3IJ1 A;  3O4I A;  4L9O A;  4PBZ A;  3K6S A;  3OL2 B;  3EI4 A;  1XMG E;  4J0W A;  4IRZ A;  5HYN B;  4CZX A;  4M45 A;  3IJE A;  4J78 A;  3LZI A;  4A2M A;  1FZ9 E;  1GXR A;  2P5G A;  2VDR A;  2VDO A;  2MZW B;  4J2A A;  3SPY A;  3P4F A;  1C9L A;  1SQ9 A;  4J8G A;  5HE0 B;  3RMZ D;  5A2Q g;  5I5M A;  5M5U A;  3SWS D;  4K3I D;  4RG8 A;  2B1E A;  1GG2 B;  3S9H A;  2G99 A;  2OK4 A;  5I5J A;  4XYI A;  3SPZ A;  4FJ5 A;  3QI0 A;  2FW3 A;  3V5W B;  4NSX A;  3AL8 A;  1JMX B;  5IJ7 E;  2JKX A;  4DTJ A;  5EMJ B;  3HGK E;  1XVB E;  4L1M A;  4FWW A;  4FJ8 A;  1XVD E;  4EWR A;  3V4P A;  3L0M A;  4DTO A;  1NEX B;  4JT6 C;  3SHF A;  1BPO A;  2IUR A;  4FK0 A;  1MHY G;  3MUN A;  3I7P A;  2JQT A;  3PXS D;  3EI2 B;  3MZL A;  2MMB A;  3NGI A;  1M1X A;  3HL8 A;  2B7M A;  4WK4 A;  2IUP A;  1N1C A;  4G56 B;  2RCU A;  2VJ4 A;  3CFO A;  2JHC A;  3LDB A;  2H9M A;  2PM9 A;  4UM8 A;  4KFM B;  2H14 A;  4GQ2 P;  4FA1 D;  4FJK A;  2MW2 A;  2OJY A;  1JJU B;  1PGU A;  1GOH A;  3ZE1 A;  3TAE A;  4M3U A;  3C9C A;  1QFS A;  3SJL D;  5IBK B;  2P9I C;  3SN6 B;  4AN0 A;  2DY4 A;  1XKS A;  4CZV A;  3JRP A;  4GQB B;  2PFT A;  4JHP C;  4M42 A;  2P9S C;  4A0B B;  4O45 A;  2HJB A;  1L0Q A;  3UKU C;  1XHM A;  3TAB A;  3ZE0 A;  2PM6 B;  3SQ2 A;  1GOG A;  3PSC B;  3AL8 B;  3L2O B;  5CXC A;  2Q7Q A;  4CI2 A;  3IUR A;  4BP8 A;  3OKT A;  3SLE D;  4FJM A;  3NVN A;  4K3J B;  1VZ2 A;  5AJA A;  5EAL A;  2MTA H;  4FJ9 A;  4ZOX A;  4FAV D;  2PFV A;  3ZE2 A;  1O6F A;  4AEZ A;  4QT8 A;  3RWU A;  4WJK A;  1XVC E;  4FA9 D;  4PC0 A;  3SVW D;  1A12 A;  1OLZ A;  4J77 A;  3QNO A;  2DTU A;  3DSM A;  4H5J A;  4BUJ C;  2WQ8 A;  3CFV A;  3L1N A;  4A09 A;  4YVD A;  3NDK A;  4D9S A;  1XVG E;  4FK4 A;  2PM9 B;  3NIG A;  3IUL A;  3JZN A;  4J2B A;  2P9P C;  3UVN A;  5FLX g;  1NR0 A;  3I7N A;  3NVQ A;  3K72 A;  3FRX A;  2PM7 B;  3SUP A;  2O9K A;  1K32 A;  3ODT A;  4J86 A;  4MMY A;  3VGZ A;  4CI8 A;  4A08 A;  2B4E A;  4EP9 A;  2VZ1 A;  4GZ8 A;  3ZDY A;  3FM0 A;  1XL3 C;  2EBS A;  3SJJ A;  2GNQ A;  3TL8 B; 
#chains in the Genus database with same CATH homology
 5THA A;  2AQ5 A;  4EPH A;  4M3Z A;  5CXC B;  2IWK A;  2B5N A;  1Q47 A;  3TAF A;  1XVF E;  3KD1 E;  1QNI A;  3E4W A;  3RSE C;  2YMU A;  2GC4 A;  4KHS A;  4DTR A;  4A11 A;  2B8I A;  4MK0 B;  2P1M B;  3HP9 A;  1XMH E;  4I9L A;  3QEW A;  1FZ4 E;  3A0F A;  2W18 A;  4GAM C;  4DTP A;  4QL1 A;  3UKR C;  4ZOY A;  4A09 B;  1B9Y A;  4JSP C;  2OVR B;  4KI6 A;  4ERZ A;  3IJC A;  4GM3 A;  4JSV C;  2CO0 A;  4LG9 A;  3ORV D;  3I7O A;  4DTS A;  1JOF A;  2H6N A;  3LD8 A;  3N1E A;  5C2W B;  5JWZ A;  3UVL A;  4E4B A;  2CN3 A;  1PBY B;  1SQJ A;  1U2V C;  3MKS B;  3PE7 A;  4A0A A;  3C6O B;  1TBG A;  3BG1 A;  4L3H D;  3DM0 A;  4FVM A;  4R7A B;  4E54 A;  4GQ1 A;  4KHN A;  3RN0 D;  3LZJ A;  4OWR A;  1R5M A;  3KRW B;  3RLM D;  4FJJ A;  3OW8 A;  2Z2O A;  4M3Y A;  4J81 A;  4A11 B;  4I79 A;  1FZ3 E;  3CQ8 A;  3E0C A;  3L4M D;  4D6V A;  2JHP A;  2AGZ A;  3AL9 A;  3NHG A;  2P1N B;  1PI6 A;  3F3P A;  4BL0 A;  5IC7 A;  3QER A;  2ATQ A;  4BH6 A;  4FA4 D;  5GMK n;  2YNP A;  5AFU 3;  3B7F A;  4FJH A;  4AI6 A;  1WAJ A;  4AOW A;  3N0D A;  3BWS A;  5C9Z B;  2IUQ A;  1FXX A;  2E31 A;  3FGB A;  3CIK B;  4M3X A;  3QES A;  3QNN A;  3EI4 B;  2FYO A;  5IZ7 A;  3MZK A;  2AGL A;  5GSA A;  1MTY G;  3OGK B;  5EM2 A;  4CY1 A;  1VYH C;  4JXM A;  4FA5 D;  5FKQ A;  3CFP A;  5FA5 B;  2HD0 A;  3SCX A;  3RFG A;  3SBP A;  3CFS B;  4E5Z A;  2QXF A;  3I7K A;  3SNN A;  1MG2 A;  5H1M A;  4AKH A;  4E54 B;  4X3E A;  4CI3 A;  3DWL C;  1XU3 E;  3JPX A;  5GXH A;  2IWF A;  4CZY A;  4J2E A;  3JB9 L;  3I7L A;  2VJ5 A;  5SXM A;  2P9U C;  3AFC A;  3RFH A;  3J2P A;  2XYI A;  3MMY A;  2AH1 A;  4M41 A;  2HKM A;  3OKY A;  4KHQ A;  3SUN A;  4KHW A;  4J82 A;  3TJY A;  4HCB A;  3U4Y A;  1FZ1 E;  4RNG A;  4B08 A;  4OZU A;  4HDJ A;  4IMM A;  1FS1 A;  4ADO A;  1N6D A;  5H14 A;  4X61 B;  3SCY A;  3OTT A;  3I2N A;  4D0K A;  2QC5 A;  4M3W A;  2HKR A;  3JRO A;  2H68 A;  1WAF A;  3UIQ A;  3RRM C;  4QND A;  2YBA A;  5C2V B;  1YFQ A;  5EM2 B;  3IIW A;  5B4W A;  2IAA A;  2OIZ A;  4XYH A;  3V9F A;  2H6Q A;  4E5Z B;  4I6J B;  3PVU B;  2GC7 A;  4LG8 A;  3F3G A;  3SMR A;  2OZS A;  5K1C C;  3J80 g;  4ZOV A;  2I0S A;  5HE1 B;  4O3U B;  2P1P B;  2Z2N A;  4O1Q D;  3PVW B;  4X63 B;  4QQE A;  4PXW A;  3J27 A;  2IUV A;  2CN2 A;  3KD5 E;  4HCC A;  4I9Q A;  4FJI A;  4X5M A;  3SBQ A;  1GOT B;  3I7H A;  3LDS A;  3OL2 A;  3F3F A;  3PXW D;  4X5N A;  2H47 A;  3N0E A;  3OKY B;  4PBY A;  4J8B A;  3OGM B;  2CE8 A;  4ESG A;  1MMO G;  5CYK A;  3ZWL B;  3RMB A;  5FKS A;  5IGO A;  4ZOZ A;  4FB1 D;  2AGW A;  4A2L A;  4J84 A;  3N1B A;  1Q9Y A;  2OK6 A;  2BCJ B;  3C6P B;  4A08 B;  3SFZ A;  2JPN A;  4ES0 A;  5GXI A;  2YB5 A;  3QEI A;  3QEP A;  4J0X A;  5IRE A;  2XL2 A;  4J2D A;  4ZN4 A;  3JZH A;  5EAR A;  3L8B A;  2H6K A;  2Z2P A;  4L1Q D;  3EU7 A;  3I89 A;  3RMA A;  3EI2 A;  3NVX A;  4GM8 A;  2OVQ B;  3QEX A;  2BBK H;  2AGY A;  4KI4 A;  1OMW B;  1FWX A;  3E4Y A;  4GM9 A;  5HQG A;  3SBR A;  1MG3 A;  3HGL A;  4TZ4 A;  1MHZ G;  4KHU A;  3I8C A;  1PEV A;  3EI3 A;  3SXT D;  5I5I A;  3IKO A;  4FJN A;  2CNX A;  1XVE E;  4U1E I;  4A0B A;  4FHL A;  5CYK B;  3PXT D;  3K26 A;  4E3S A;  4CI1 A;  2P9L C;  3I8E A;  1N6E A;  2XU7 A;  2TRC B;  3VH0 A;  3OGL B;  2OYQ A;  4RL5 A;  3UVO A;  1FZ8 E;  5EMM B;  4CY5 A;  3SQ0 A;  2H9N A;  2P5O A;  2JHA A;  4JT5 C;  3GFC A;  3ULE C;  1MDA H;  2J55 H;  3C99 A;  3DXM C;  2HYE A;  2J57 G;  3EI1 A;  4A0A B;  1Q9X A;  2H13 A;  3EWE A;  2P1Q B;  2HJ4 A;  4AKI A;  1JMZ B;  1ERJ A;  4DTU A;  3K27 A;  4ADN A;  4FAN D;  5CXB A;  5KDO B;  2P1O B;  4JRP A;  1XMF E;  3IIY A;  1P22 A;  4FJ7 A;  3C95 A;  2J56 H;  4PNK B;  5HE2 B;  3EMH A;  3SUQ A;  2YNO A;  4FK2 A;  4G56 B;  3UVM A;  4JRQ A;  2P9N C;  3TAG A;  4GMB A;  4O9D A;  3QEV A;  3EI3 B;  5EAP A;  5FXY A;  1U4C A;  4CC9 A;  5FQD A;  1TYQ C;  2OVP B;  3GRE A;  5AMS A;  1FZ6 E;  4LGN A;  4X60 B;  2PBI B;  4L3G D;  2H9L A;  3SVI A;  1XIP A;  4DTM A;  4CY3 A;  4U7A A;  4AKG A;  3WSO A;  4O3T B;  4DTX A;  4EYW A;  2LF3 A;  4KHY A;  1GP2 B;  4JD2 C;  1N6F A;  3PSL A;  3NCI A;  4M3R A;  1FZ5 E;  4JS4 A;  3L4O D;  4J87 A;  4JSN C;  2LF6 A;  3RMC A;  4DU1 A;  2I0T A;  3C5M A;  2UZX B;  5IJ8 E;  2H4T A;  1FYZ E;  3UR4 A;  2E32 A;  5EAM A;  4JS5 A;  5FKT A;  3EI1 B;  4J73 A;  2JH9 A;  2CO0 C;  2UZY B;  2XL3 A;  4QRJ A;  4PSX B;  2OZM A;  1SHY B;  2I3T A;  3QET A;  2B5L A;  2CE9 A;  4FJX A;  5CXB B;  5TF2 A;  3J81 g;  1A0R B;  3DXK C;  3NE6 A;  3SUO A;  1RI6 A;  2AH0 A;  3SI6 A;  4A7J A;  5IGQ A;  1K8K C;  4Y7R A;  2H3X A;  2DEB A;  2JH8 A;  4GGD A;  2YNN A;  1FZH E;  3RMD A;  5H17 A;  5TEE A;  4Y5R D;  3MKQ A;  4DU4 A;  3K2O A;  2B5M A;  1FZ2 E;  2P9K C;  3MXX A;  5EML B;  2QXV A;  4QNC A;  5HE3 B;  3OKW A;  3VA6 A;  1LDK E;  2VIX A;  1FZ7 E;  3CFR A;  3HFQ A;  3IJ0 A;  4ERY A;  2YB8 B;  5FKR A;  3W15 A;  4UI9 R;  4J79 A;  4JSX C;  3SQ4 A;  3JZG A;  4XEI C;  4GGA A;  1CLQ A;  4N14 A;  1IG9 A;  1S4U X;  3AH8 B;  5IT9 g;  3SQ1 A;  1XU5 E;  4PSW B;  3C94 A;  4FJL A;  2H9P A;  1IH7 A;  3KRX B;  3RN1 D;  3NAE A;  4FJG A;  4DTN A;  5H37 A;  5EMK B;  4M3T A;  4ERQ A;  4Z8L A;  3JAM g;  4IA9 A;  3EG6 A;  4GGC A;  3UVK A;  4DU3 A;  3V7D B;  4H5I A;  1B9X A;  1FZI E;  3BG0 A;  2G9A A;  5K19 A;  5TDH B;  1FZ0 E;  2HES X;  3C6N B;  4CY2 A;  2HXC A;  2I0R A;  5TEF A;  2AGX A;  2I3S A;  3C75 H;  3IJ1 A;  4L9O A;  4PBZ A;  3OL2 B;  3EI4 A;  1XMG E;  4J0W A;  5HYN B;  4CZX A;  4M45 A;  4J78 A;  3LZI A;  4A2M A;  1FZ9 E;  1GXR A;  2P5G A;  2MZW B;  4J2A A;  3SPY A;  3P4F A;  1SQ9 A;  4J8G A;  5HE0 B;  3RMZ D;  5A2Q g;  5I5M A;  3SWS D;  4K3I D;  4RG8 A;  2B1E A;  1GG2 B;  3S9H A;  2G99 A;  2OK4 A;  5I5J A;  4XYI A;  3SPZ A;  4FJ5 A;  2FW3 A;  3V5W B;  4NSX A;  3AL8 A;  1JMX B;  5IJ7 E;  4DTJ A;  5EMJ B;  3HGK E;  1XVB E;  4FWW A;  4FJ8 A;  1XVD E;  4EWR A;  3L0M A;  4DTO A;  1NEX B;  4JT6 C;  3SHF A;  2IUR A;  4FK0 A;  1MHY G;  3I7P A;  3PXS D;  3EI2 B;  3MZL A;  2MMB A;  3NGI A;  3HL8 A;  2B7M A;  2IUP A;  2RCU A;  2VJ4 A;  3CFO A;  2JHC A;  3LDB A;  2H9M A;  2PM9 A;  4KFM B;  2H14 A;  4GQ2 P;  4FA1 D;  4FJK A;  2OJY A;  1JJU B;  1PGU A;  3TAE A;  4M3U A;  3C9C A;  3SJL D;  5IBK B;  2P9I C;  3SN6 B;  4CZV A;  2DY4 A;  1XKS A;  3JRP A;  4GQB B;  2PFT A;  4A0B B;  4M42 A;  2P9S C;  4O45 A;  2HJB A;  1L0Q A;  3UKU C;  1XHM A;  3TAB A;  2PM6 B;  3SQ2 A;  3PSC B;  3AL8 B;  3L2O B;  5CXC A;  2Q7Q A;  4CI2 A;  3OKT A;  3SLE D;  4FJM A;  3NVN A;  4K3J B;  5AJA A;  5EAL A;  2MTA H;  4FJ9 A;  4ZOX A;  4FAV D;  2PFV A;  4AEZ A;  4QT8 A;  3RWU A;  1XVC E;  4FA9 D;  4PC0 A;  3SVW D;  1OLZ A;  4J77 A;  4BUJ C;  3QNO A;  2DTU A;  3DSM A;  4H5J A;  3CFV A;  3L1N A;  4A09 A;  4YVD A;  3NDK A;  1XVG E;  4FK4 A;  2PM9 B;  3JZN A;  4J2B A;  2P9P C;  3UVN A;  5FLX g;  1NR0 A;  3I7N A;  3NVQ A;  3FRX A;  2PM7 B;  3SUP A;  2O9K A;  1K32 A;  3ODT A;  4J86 A;  3VGZ A;  4A08 A;  4CI8 A;  2B4E A;  4EP9 A;  4GZ8 A;  3FM0 A;  1XL3 C;  2EBS A;  3SJJ A;  2GNQ A;  3TL8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...