1P22A

Structure of a beta-trcp1-skp1-beta-catenin complex: destruction motif binding and lysine specificity on the scfbeta-trcp1 ubiquitin ligase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
411
structure length
402
Chain Sequence
SPAIMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a beta-TrCP1-Skp1-beta-Catenin complex: destruction motif binding and lysine specificity of the SCFbeta-TrCP1 ubiquitin ligase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords F-box/WD-repeat protein 1A
total genus 107
structure length 402
sequence length 411
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1p22A01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1p22A02
3RFHA 5HE3B 3C6OB 4D6VA 4CY1A 5H1MA 5EMJB 4I79A 4JSNC 2E31A 1PBYB 2P9KC 4XYIA 4G56B 4E5ZA 3SXTD 4JSXC 2TRCB 3RLMD 3IKOA 3C6NB 3FRXA 3N0EA 4A09B 5C2WB 3OKYA 1Q47A 3EI1B 4AEZA 3PSLA 4HDJA 5AJAA 4PBYA 1RI6A 4U1EI 1PGUA 5IBKB 5CXBA 5TDHB 2P9SC 4J0XA 3JB9L 4TZ4A 3SBPA 2CE9A 3I2NA 4J79A 2CN2A 5EM2A 4GGDA 1GOTB 5EMKB 4PSXB 4IA9A 1SHYB 1JOFA 5AFU3 3IIWA 5EALA 4GZ8A 3SWSD 2H6KA 3E0CA 4J78A 5THAA 2W18A 4JT6C 4CY3A 3V7DB 1N6EA 4GQ2P 5SXMA 3ZWLB 1SQ9A 2IURA 5FKRA 4ERZA 4CY5A 4CI3A 2H3XA 4ZOYA 4A08B 2QXVA 2Z2PA 2H9MA 4A7JA 3MMYA 3EI4B 4Z8LA 4CI1A 3VH0A 3SFZA 2I0TA 4ERYA 1OMWB 3C75H 3I7KA 2HYEA 2YMUA 5GXHA 3MZKA 4E54B 5H17A 4CY2A 2HJ4A 4JXMA 3EI1A 4L9OA 1XIPA 4J77A 1K8KC 4OZUA 1R5MA 3U4YA 3ULEC 3PXWD 4E54A 3V9FA 4FWWA 5FKSA 4J0WA 4E5ZB 5IGQA 2I0RA 4ESGA 3UVLA 3NVXA 2Z2OA 1PI6A 3I7NA 4FA1D 1SQJA 3I89A 3C99A 4PC0A 5HQGA 4FB1D 2IUVA 3IJ1A 3UKUC 1S4UX 5K19A 5CXBB 2H13A 1XHMA 2I3SA 3AFCA 3B7FA 3I8EA 4JSPC 4J8BA 1L0QA 3SMRA 3J81g 2P1PB 4K3ID 2AGYA 5HE0B 5IT9g 4GGAA 5C2VB 3SBRA 4J8GA 4J81A 4CI8A 4L3HD 3DM0A 1FS1A 3JROA 5CYKA 4O3TB 4GM3A 3PSCB 4N14A 3UVOA 3F3GA 2GC4A 3C9CA 3IIYA 4CZXA 4ERQA 3OKTA 2EBSA 5I5IA 2CNXA 5GSAA 2G99A 4A08A 3RN0D 1B9XA 4A09A 3MXXA 5IGOA 4FA9D 3I7HA 3UVMA 4ZOXA 3GFCA 1U4CA 2CO0C 3I8CA 2B4EA 3PVWB 3F3FA 3JRPA 4Y7RA 2BCJB 3I7PA 3BWSA 4X3EA 2IWFA 2H9PA 3K27A 2CO0A 5IJ7E 3OGMB 1MG3A 3I7LA 3PVUB 3RRMC 5HE1B 2UZYB 3P4FA 2YB8B 1U2VC 2QC5A 1YFQA 3C6PB 3DXKC 5CXCA 3EWEA 1GP2B 2GC7A 3ODTA 2HJBA 2MTAH 4H5IA 4QQEA 2CE8A 2UZXB 5GXIA 4JD2C 1OLZA 4GM9A 3WSOA 2IUQA 2OK4A 2H68A 5JWZA 4U7AA 3J80g 4A0BB 4AOWA 2G9AA 3IJ0A 5I5JA 3A0FA 4X61B 4CI2A 3UKRC 1MG2A 1TYQC 4MK0B 1K32A 3L4MD 3OTTA 3SBQA 3OW8A 3OL2A 2I0SA 4EWRA 4O9DA 2HKMA 4PNKB 5EAMA 2I3TA 3DXMC 2YBAA 2GNQA 3OKWA 2IUPA 3I7OA 4LGNA 2XU7A 2OVRB 1GXRA 4ZN4A 4QT8A 3BG1A 2AGZA 3C5MA 3DSMA 1ERJA 3RSEC 3VA6A 2OVPB 4J84A 4NSXA 2AGLA 2P1MB 3EI3B 3FGBA 1VYHC 3IJCA 4Y5RD 4LG9A 4A11A 4J82A 3AH8B 2IAAA 2IWKA 4JT5C 4FAND 4GGCA 2PM6B 5A2Qg 1B9YA 2BBKH 5EMLB 2H6NA 3L2OB 4BH6A 1FWXA 2H14A 3JZGA 3HFQA 5H14A 3SN6B 3UVKA 5KDOB 3F3PA 3CFSB 2Q7QA 3W15A 3KRXB 2P9IC 1GG2B 2J57G 5FQDA 4PXWA 5TF2A 3EMHA 5FXYA 2P9NC 3K26A 3AL8B 1LDKE 5CXCB 5EMMB 2PM9A 3FM0A 3CFVA 3EG6A 3NVNA 3VGZA 5TEFA 1A0RB 2AH1A 2PBIB 4A11B 2OVQB 4H5JA 5HYNB 4XEIC 2H47A 4CC9A 2P9LC 3EI3A 4J87A 5AMSA 4QRJA 4XYHA 2YNOA 4R7AB 2B5NA 4A0AB 5EM2B 4ES0A 5IC7A 4O45A 4YVDA 1NEXB 2J55H 3RN1D 3SCYA 3BG0A 1XKSA 5IJ8E 1JJUB 3JZHA 5GMKn 3N0DA 4L1QD 4FAVD 2XL2A 2HXCA 2AQ5A 4D0KA 2B5MA 3OL2B 4GQBB 4K3JB 3MKSB 4ZOVA 4FA5D 4FHLA 5HE2B 2YNNA 3MZLA 3RMZD 4L3GD 4X60B 2Z2NA 3EI2A 2H6QA 3UVNA 3EI2B 2B5LA 4A0BA 1QNIA 1TBGA 3SVWD 3JZNA 4PBZA 2P1QB 3OGKB 4OWRA 1P22A 4LG8A 2HESX 2O9KA 3KRWB 3PXTD 3UR4A 2CN3A 5FA5B 3JAMg 2XYIA 5TEEA 2OIZA 4KFMB 4BUJC 5B4WA 4J73A 2P9UC 4GQ1A 3AL8A 2YNPA 4A0AA 1N6DA 1JMXB 5EAPA 2J56H 2AGXA 5FLXg 2H9LA 5K1CC 4JSVC 4A2LA 1MDAH 4I6JB 2P1OB 3NVQA 2HKRA 3CIKB 3DWLC 3OGLB 1N6FA 3L4OD 5I5MA 4J86A 2OK6A 4FA4D 4BL0A 4GM8A 2OJYA 4ZOZA 3SLED 4IMMA 1PEVA 3EU7A 3GREA 4A2MA 4O1QD 3PXSD 5FKTA 5EARA 2E32A 1NR0A 2P9PC 2AH0A 3AL9A 5C9ZB 3V5WB 5FKQA 4O3UB 4GMBA 4CZVA 3MKQA 5CYKB 4PSWB 3JPXA 3EI4A 2PM7B 3SHFA 4QL1A 3ORVD 1JMZB 3OKYB 4X63B 3SJLD 2XL3A 2H9NA 2PM9B 4CZYA 3PE7A 3RFGA 2AGWA 2P1NB 4UI9R
chains in the Genus database with same CATH superfamily
3RFHA 5HE3B 3C6OB 4D6VA 1E8MA 4CY1A 2ATQA 5H1MA 5EMJB 4I79A 2VDOA 4JSNC 2E31A 1PBYB 2P9KC 4XYIA 4G56B 3CQ8A 3IUJA 4E5ZA 3SXTD 4JSXC 4M3ZA 1O6FA 2TRCB 3RLMD 3KD5E 3IKOA 3C6NB 3FRXA 3N0EA 2VZ1A 4A09B 5C2WB 3OKYA 4FJ8A 2XE4A 1Q47A 3MUOA 3EI1B 4AEZA 3PSLA 4HDJA 3HP9A 5AJAA 1FZ4E 1XU5E 5M5UA 3QEIA 4PBYA 4UM9A 1RI6A 4U1EI 1PGUA 5IBKB 5CXBA 5TDHB 2P9SC 4J0XA 3JB9L 4TZ4A 3SBPA 4BP8A 3HL8A 4M3TA 2CE9A 3I2NA 3ZDXA 1FZ8E 2K5SA 2CN2A 4J79A 3QI0A 5EM2A 4GGDA 2EIBA 1GOTB 5EMKB 4FJGA 4PSXB 4HCCA 1SHYB 4IA9A 1JOFA 1GOGA 5AFU3 1M1XA 3IIWA 5EALA 4GZ8A 3SWSD 3ZDYA 2H6KA 5FFGA 1VZ2A 3E0CA 3SUNA 4J78A 2JPNA 2PFTA 5THAA 2W18A 4JT6C 4CY3A 3V7DB 1N6EA 4GQ2P 2VC2A 5SXMA 3ZWLB 1FXXA 1SQ9A 2IURA 5FKRA 3KCIA 4ERZA 3QEXA 4CY5A 4CI3A 2H3XA 1IG9A 4ZOYA 4A08B 2QXVA 3N1EA 2Z2PA 4IRZA 2H9MA 4A7JA 3MMYA 3EI4B 4Z8LA 4CI1A 3VH0A 3SFZA 3CFRA 2I0TA 4WK2A 4ERYA 1OMWB 4DU4A 3C75H 3I7KA 3RMAA 3NHGA 4QNDA 3LDSA 2HYEA 2YMUA 4RE5A 5GXHA 3MZKA 4E54B 5H17A 4CY2A 4QAMA 2HJ4A 4AKIA 1FYZE 4JXMA 4L9OA 1XIPA 4J77A 1C9LA 1K8KC 4OZUA 3EI1A 1R5MA 3U4YA 3ULEC 4B08A 4NBMA 3PXWD 4JS4A 4E54A 3V9FA 4FWWA 5FKSA 4J0WA 3L8BA 3SUPA 4KHUA 5IGQA 4E5ZB 4FJMA 4KHNA 4FJJA 2I0RA 2VDRA 4ESGA 3FCSA 3UVLA 3NVXA 1FZIE 2Z2OA 1PI6A 4AN1A 1MMOG 1UOPA 1Q9XA 3I7NA 4FA1D 1SQJA 4RG8A 4DTXA 3I89A 3C99A 5E6UA 2EIDA 4PC0A 2VDPA 5HQGA 4Z7QA 3MVDK 4FB1D 2IUVA 3IJ1A 3UKUC 1S4UX 4BCBA 2B1EA 5K19A 5CXBB 1XVBE 4M3YA 1XVCE 4FJ7A 2H13A 5IZ7A 1XHMA 2I3SA 2VDNA 3AFCA 3B7FA 3I8EA 4JSPC 1FZ9E 2JHCA 3V4VA 3ZE1A 4J8BA 1L0QA 3SMRA 3J81g 3TAFA 4DNUA 2P1PB 4K3ID 2AGYA 5HE0B 4J2DA 2VDQA 5IT9g 4BCCA 1N1CA 4GGAA 5C2VB 3SBRA 4J8GA 4J81A 4CI8A 3DM0A 4L3HD 1FS1A 3JROA 4FJXA 5CYKA 4O3TB 4GM3A 4RE6A 3PSCB 1JTDB 4N14A 3UVOA 3F3GA 3SPYA 2EIEA 4ADOA 2GC4A 3C9CA 3IIYA 4WJKA 2FYOA 4CZXA 3VI4A 4ERQA 3SQ0A 3ZDZA 3IUQA 2EBSA 2VDMA 3OKTA 5I5IA 1UOOA 2CNXA 1FZ0E 5GSAA 2G99A 4A08A 3SQ1A 2JKXA 3RN0D 3O4GA 3EQ7A 1B9XA 1QFMA 3SVIA 1U8CA 2P5OA 4A09A 4EP9A 4DTJA 3TL8B 3MXXA 5FFOA 5IGOA 3I7HA 4FA9D 3UVMA 4ZOXA 3GFCA 1U4CA 2CO0C 1FZ5E 3I8CA 4DTSA 2B4EA 4HCBA 1VE7A 3PVWB 4J2AA 5M61A 3TAEA 3QESA 3F3FA 3JRPA 4Y7RA 2BCJB 3I7PA 3BWSA 4X3EA 2IWFA 1WAJA 1GOHA 3NE6A 3QETA 4AMYA 1C9IA 4JHPC 2H9PA 3QERA 3NAEA 3K27A 2CO0A 5IJ7E 3QNNA 3OGMB 5M5SA 2RKHA 1MG3A 3N1BA 4RL5A 3I7LA 2VJ4A 3PVUB 1FZ3E 3RRMC 5HE1B 2UZYB 3P4FA 2YB8B 1U2VC 2QC5A 1YFQA 2VIXA 3NIGA 1BPOA 3C6PB 3DXKC 5CXCA 3EWEA 2LF6A 3L0MA 1GP2B 4KHSA 2GC7A 3VI3A 3ODTA 3TAGA 2HJBA 5C86A 1JV2A 3K72A 3SUQA 4FK2A 2MTAH 3V4PA 4H5IA 4QQEA 3SQ4A 2CE8A 2UZXB 3RWUA 4M41A 3SJJA 5GXIA 1XU3E 4JD2C 1OLZA 4GM9A 3WSOA 2IUQA 2OK4A 2VJ5A 2H68A 5JWZA 1H2ZA 4U7AA 5C92A 3J80g 4A0BB 3SCXA 2BKLA 1UTCA 4AOWA 2G9AA 3IJ0A 5I5JA 3A0FA 4KHWA 4MMXA 4X61B 4D9SA 3UKRC 4CI2A 1MG2A 1TYQC 4MK0B 4FJKA 1K32A 3L4MD 3QEPA 3OTTA 3SBQA 5M5TA 4M3WA 3OW8A 3OL2A 4E3SA 4DTRA 2I0SA 4EWRA 4AN0A 4O9DA 2HKMA 4M45A 4PNKB 3EQ8A 5EAMA 3LZJA 3T3PA 2I3TA 3DXMC 2YBAA 2GNQA 3OKWA 1TYEA 2IUPA 3I7OA 4LGNA 2XU7A 4UM8A 2OVRB 1GXRA 2VZ3A 1H2XA 4QT8A 4Z7NA 4ZN4A 3BG1A 3HGKE 3BVOA 2AGZA 3C5MA 4M3RA 3DSMA 1ERJA 3RSEC 2HU8A 3VA6A 3QEWA 2OVPB 4J84A 4NSXA 2AGLA 2P1MB 3EI3B 3FGBA 2DY4A 3RMBA 1E8NA 1VYHC 1FZ2E 3IJCA 4Y5RD 4LG9A 4A11A 4J82A 3AH8B 3HGLA 3NCIA 3QNOA 2IAAA 2IWKA 4JT5C 4FAND 4GGCA 4BP9A 2PM6B 3IURA 3IUMA 4FJ5A 1B9YA 2BBKH 5A2Qg 2B7MA 1XVFE 2JH9A 1WAFA 3RMCA 3SI6A 2H6NA 2XDWA 5EMLB 3L2OB 4BH6A 1FWXA 4AI6A 4KI6A 2H14A 3S9HA 3JZGA 3HFQA 5H14A 3SN6B 2OZMA 3SQ2A 3UVKA 5KDOB 2QZPA 3ZE2A 3F3PA 4FJLA 4KHQA 3CFSB 4M3UA 2Q7QA 1E5TA 3W15A 1T2XA 4Z7OA 3KRXB 2DEBA 1GG2B 2P9IC 3QEVA 2J57G 5FQDA 5M5VA 4PXWA 5H37A 3K6SA 5TF2A 3EMHA 4X5MA 3UO3A 5FXYA 2P9NC 4NC4A 2OYQA 4KI4A 3K26A 3AL8B 1LDKE 5HDBA 4DTPA 1L5GA 4E4BA 5CXCB 5EMMB 4QNCA 4DTNA 4DTUA 2PM9A 1IH7A 3FM0A 2B8IA 3CFVA 3EG6A 4DNVA 3NVNA 3VGZA 5TEFA 3T3MA 1A0RB 2AH1A 2PBIB 4A11B 4WK0A 3MUNA 4AMZA 4DNWA 2OVQB 4H5JA 3NGIA 5HYNB 4XEIC 2H47A 4CC9A 2P9LC 4I9LA 3EI3A 4DU3A 4J87A 5AMSA 2VDKA 4JHNA 1FZ7E 2HU7A 4DU1A 2YNOA 4QRJA 4R7AB 1XMGE 4XYHA 3NDKA 3LZIA 1YR2A 4AKHA 3LDBA 4AKGA 2B5NA 2EICA 3NIFA 4G1EA 4A0AB 5EM2B 4ES0A 2MZWB 3GD1I 5IC7A 4O45A 4YVDA 1NEXB 2J55H 3CFOA 4M3XA 3FCUA 3RN1D 1H2WA 3BG0A 3SCYA 2FW3A 1XKSA 4DTOA 5IJ8E 1JJUB 3JZHA 5GMKn 2YB5A 3N0DA 4L1QD 4FAVD 1CLQA 3RMDA 2HXCA 2AQ5A 2XL2A 2B5MA 3IUNA 3OL2B 4GQBB 4K3JB 4D0KA 3MKSB 4ZOVA 4FA5D 4FHLA 4G55A 5HE2B 2YNNA 3MZLA 4O2WA 3SUOA 3RMZD 3E4YA 4L3GD 1A12A 4JRPA 3IJEA 4X60B 2Z2NA 2MW2A 3EI2A 2H6QA 1XVDE 2XZGA 3UVNA 1FZ6E 3EI2B 2B5LA 4FJNA 3O4IA 1XVGE 4A0BA 1XMHE 1QNIA 1O6GA 4FJHA 1H2YA 2QXFA 1TBGA 4DTMA 3KD1E 3SVWD 4NENA 2OZSA 3JZNA 4PBZA 3K71A 2P1QB 2P5GA 1XVEE 3OGKB 3UIQA 4OWRA 1P22A 4LG8A 3EQ9A 2HESX 2O9KA 3KRWB 3PXTD 4G1MA 3UR4A 3QHYB 2CN3A 5FA5B 2WQ8A 3C94A 1GOFA 4BCDA 4EYWA 2XYIA 3JAMg 5TEEA 2QR5A 2OIZA 4KFMB 4BUJC 3OF7A 5IREA 4J2BA 3NIDA 5B4WA 4J73A 2P9UC 4GQ1A 4JS5A 3AL8A 2YNPA 4A0AA 1N6DA 1JMXB 5EAPA 1FZ1E 1FZHE 3L1NA 4RNGA 2J56H 4FK0A 4EPHA 2AGXA 5FLXg 2H9LA 3C95A 5K1CC 4JSVC 4A2LA 1MDAH 4I6JB 2HD0A 4L1MA 4FVMA 2P1OB 3NVQA 3SNNA 4AX4A 2HKRA 3CIKB 3DWLC 3OGLB 1N6FA 4WK4A 3DDUA 3L4OD 5I5MA 2H4TA 1K3IA 4FJ9A 3O4JA 1XMFE 5E6SA 4MMZA 4J86A 4X5NA 2OK6A 4FA4D 4BL0A 4GM8A 2RCUA 2OJYA 4JRQA 4ZOZA 3SLED 3UO2A 4IMMA 5M5RA 1PEVA 3EU7A 3GREA 4A2MA 4O1QD 2HU5A 1Q9YA 4NAAA 3J2PA 1UOQA 3PXSD 2JHAA 2MMBA 5FKTA 2JH8A 5EARA 2E32A 1NR0A 2P9PC 2AH0A 1I2MB 3LD8A 3GC3B 3AL9A 1JW2A 1QFSA 5C9ZB 3V5WB 1MHZG 4FJIA 4O02A 4O3UB 4GMBA 5FKQA 3E4WA 3TJYA 4M42A 4CZVA 2PFVA 2VDLA 3MKQA 5CYKB 4PSWB 4IT5A 4I9QA 3JPXA 1XL3C 3EI4A 2PM7B 3K2OA 1FPOA 3SPZA 3SHFA 2JQTA 3CFPA 4J2EA 4QL1A 3ORVD 1JMZB 3IULA 3OKYB 4X63B 3SJLD 2LF3A 2DTUA 4GAMC 3O4HA 2XL3A 4FK4A 2H9NA 5E6RA 1VE6A 4KHYA 4ICGC 2PM9B 3ZE0A 4ADNA 1VZ3A 4CZYA 3PE7A 3RFGA 3TABA 2JHPA 2AGWA 2P1NB 1MHYG 4MMYA 3J27A 1MTYG 3IVMA 4UI9R
chains in the Genus database with same CATH topology
3RFHA 5HE3B 3C6OB 4D6VA 4CY1A 2ATQA 5H1MA 5EMJB 4I79A 4JSNC 2E31A 1PBYB 2P9KC 4XYIA 4G56B 3CQ8A 4E5ZA 3SXTD 4JSXC 4M3ZA 2TRCB 3RLMD 3KD5E 3IKOA 3C6NB 3FRXA 3N0EA 4A09B 5C2WB 3OKYA 4FJ8A 1Q47A 3EI1B 4AEZA 3PSLA 4HDJA 3HP9A 5AJAA 1FZ4E 1XU5E 3QEIA 4PBYA 1RI6A 4U1EI 1PGUA 5IBKB 5CXBA 5TDHB 2P9SC 4J0XA 3JB9L 4TZ4A 3SBPA 3HL8A 4M3TA 2CE9A 3I2NA 1FZ8E 4J79A 2CN2A 5EM2A 4GGDA 1GOTB 5EMKB 4FJGA 4PSXB 4HCCA 1SHYB 4IA9A 1JOFA 5AFU3 3IIWA 5EALA 4GZ8A 3SWSD 2H6KA 3E0CA 3SUNA 4J78A 2JPNA 2PFTA 5THAA 2W18A 4JT6C 4CY3A 3V7DB 1N6EA 4GQ2P 5SXMA 3ZWLB 1FXXA 1SQ9A 2IURA 5FKRA 4ERZA 3QEXA 4CY5A 4CI3A 2H3XA 1IG9A 4ZOYA 4A08B 2QXVA 3N1EA 2Z2PA 2H9MA 4A7JA 3MMYA 3EI4B 4Z8LA 4CI1A 3VH0A 3SFZA 3CFRA 2I0TA 4ERYA 1OMWB 4DU4A 3C75H 3I7KA 3RMAA 3NHGA 4QNDA 3LDSA 2HYEA 2YMUA 5GXHA 3MZKA 4E54B 5H17A 4CY2A 2HJ4A 4AKIA 1FYZE 4JXMA 4L9OA 1XIPA 4J77A 1K8KC 4OZUA 3EI1A 1R5MA 3U4YA 3ULEC 4B08A 3PXWD 4JS4A 4E54A 3V9FA 4FWWA 5FKSA 4J0WA 3L8BA 3SUPA 4KHUA 5IGQA 4E5ZB 4FJMA 4KHNA 4FJJA 2I0RA 4ESGA 3UVLA 3NVXA 1FZIE 2Z2OA 1PI6A 1MMOG 1Q9XA 3I7NA 4FA1D 1SQJA 4RG8A 4DTXA 3I89A 3C99A 4PC0A 5HQGA 4FB1D 2IUVA 3IJ1A 3UKUC 1S4UX 2B1EA 5K19A 5CXBB 1XVBE 4M3YA 1XVCE 4FJ7A 2H13A 5IZ7A 1XHMA 2I3SA 3AFCA 3B7FA 3I8EA 4JSPC 1FZ9E 2JHCA 4J8BA 1L0QA 3SMRA 3J81g 3TAFA 2P1PB 4K3ID 2AGYA 5HE0B 4J2DA 5IT9g 4GGAA 5C2VB 3SBRA 4J8GA 4J81A 4CI8A 3DM0A 4L3HD 1FS1A 3JROA 4FJXA 5CYKA 4O3TB 4GM3A 3PSCB 4N14A 3UVOA 3F3GA 3SPYA 4ADOA 2GC4A 3C9CA 3IIYA 2FYOA 4CZXA 4ERQA 3SQ0A 3OKTA 2EBSA 5I5IA 2CNXA 1FZ0E 5GSAA 2G99A 4A08A 3SQ1A 3RN0D 1B9XA 3SVIA 4A09A 2P5OA 4EP9A 4DTJA 3TL8B 3MXXA 5IGOA 4FA9D 3I7HA 3UVMA 4ZOXA 3GFCA 1U4CA 2CO0C 1FZ5E 3I8CA 4DTSA 2B4EA 4HCBA 3PVWB 4J2AA 3TAEA 3QESA 3F3FA 3JRPA 4Y7RA 2BCJB 3I7PA 3BWSA 4X3EA 2IWFA 1WAJA 3NE6A 3QETA 2H9PA 3QERA 3NAEA 3K27A 2CO0A 5IJ7E 3QNNA 3OGMB 1MG3A 3N1BA 4RL5A 3I7LA 2VJ4A 3PVUB 1FZ3E 3RRMC 5HE1B 2UZYB 3P4FA 2YB8B 1U2VC 2QC5A 1YFQA 2VIXA 3C6PB 3DXKC 5CXCA 3EWEA 2LF6A 3L0MA 1GP2B 4KHSA 2GC7A 3ODTA 3TAGA 2HJBA 3SUQA 4FK2A 2MTAH 4H5IA 4QQEA 3SQ4A 2CE8A 2UZXB 3RWUA 4M41A 3SJJA 5GXIA 1XU3E 4JD2C 1OLZA 4GM9A 3WSOA 2IUQA 2OK4A 2VJ5A 2H68A 5JWZA 4U7AA 3J80g 4A0BB 3SCXA 4AOWA 2G9AA 3IJ0A 5I5JA 3A0FA 4KHWA 4X61B 4CI2A 3UKRC 1MG2A 1TYQC 4MK0B 4FJKA 1K32A 3L4MD 3QEPA 3OTTA 3SBQA 4M3WA 3OW8A 3OL2A 4E3SA 4DTRA 2I0SA 4EWRA 4O9DA 2HKMA 4M45A 4PNKB 5EAMA 3LZJA 2I3TA 3DXMC 2YBAA 2GNQA 3OKWA 2IUPA 3I7OA 4LGNA 2XU7A 2OVRB 1GXRA 4ZN4A 4QT8A 3BG1A 3HGKE 2AGZA 3C5MA 4M3RA 3DSMA 1ERJA 3RSEC 3VA6A 3QEWA 2OVPB 4J84A 4NSXA 2AGLA 2P1MB 3EI3B 3FGBA 2DY4A 3RMBA 1VYHC 1FZ2E 3IJCA 4Y5RD 4LG9A 4A11A 4J82A 3AH8B 3HGLA 3NCIA 3QNOA 2IAAA 2IWKA 4JT5C 4FAND 4GGCA 2PM6B 4FJ5A 1B9YA 2BBKH 5A2Qg 2B7MA 1XVFE 2JH9A 1WAFA 3RMCA 3SI6A 2H6NA 5EMLB 3L2OB 4BH6A 1FWXA 4AI6A 4KI6A 2H14A 3S9HA 3JZGA 3HFQA 5H14A 3SN6B 2OZMA 3SQ2A 3UVKA 5KDOB 3F3PA 4FJLA 4KHQA 3CFSB 4M3UA 2Q7QA 3W15A 3KRXB 2DEBA 1GG2B 2P9IC 3QEVA 2J57G 5FQDA 4PXWA 5H37A 5TF2A 3EMHA 4X5MA 5FXYA 2P9NC 2OYQA 4KI4A 3K26A 3AL8B 1LDKE 4DTPA 4E4BA 5CXCB 5EMMB 4QNCA 4DTNA 4DTUA 2PM9A 1IH7A 3FM0A 2B8IA 3CFVA 3EG6A 3NVNA 3VGZA 5TEFA 1A0RB 2AH1A 2PBIB 4A11B 2OVQB 4H5JA 3NGIA 5HYNB 4XEIC 2H47A 4CC9A 2P9LC 4I9LA 3EI3A 4DU3A 4J87A 5AMSA 1FZ7E 4QRJA 4DU1A 2YNOA 4R7AB 4XYHA 1XMGE 3NDKA 3LZIA 4AKHA 3LDBA 4AKGA 2B5NA 4A0AB 5EM2B 4ES0A 2MZWB 5IC7A 4O45A 4YVDA 1NEXB 2J55H 3CFOA 4M3XA 3RN1D 3SCYA 3BG0A 2FW3A 1XKSA 4DTOA 5IJ8E 1JJUB 3JZHA 5GMKn 2YB5A 3N0DA 4L1QD 4FAVD 1CLQA 2HXCA 3RMDA 2AQ5A 2XL2A 2B5MA 3OL2B 4GQBB 4K3JB 4D0KA 3MKSB 4ZOVA 4FA5D 4FHLA 5HE2B 2YNNA 3MZLA 3SUOA 3RMZD 3E4YA 4L3GD 4JRPA 4X60B 2Z2NA 3EI2A 2H6QA 1XVDE 3UVNA 3EI2B 1FZ6E 2B5LA 4FJNA 1XVGE 4A0BA 1XMHE 1QNIA 4FJHA 2QXFA 1TBGA 4DTMA 3KD1E 3SVWD 2OZSA 3JZNA 4PBZA 2P1QB 2P5GA 1XVEE 3OGKB 3UIQA 4OWRA 1P22A 4LG8A 2HESX 2O9KA 3KRWB 3PXTD 3UR4A 2CN3A 5FA5B 3JAMg 3C94A 4EYWA 2XYIA 5TEEA 2OIZA 4KFMB 4BUJC 5IREA 4J2BA 5B4WA 4J73A 2P9UC 4GQ1A 4JS5A 3AL8A 2YNPA 4A0AA 1N6DA 1JMXB 5EAPA 1FZ1E 1FZHE 3L1NA 4RNGA 2J56H 4FK0A 2AGXA 4EPHA 5FLXg 2H9LA 3C95A 5K1CC 4JSVC 4A2LA 1MDAH 4I6JB 2HD0A 4FVMA 2P1OB 3NVQA 3SNNA 2HKRA 3CIKB 3DWLC 3OGLB 1N6FA 3L4OD 5I5MA 2H4TA 4FJ9A 1XMFE 4J86A 4X5NA 2OK6A 4FA4D 4BL0A 4GM8A 2RCUA 2OJYA 4JRQA 4ZOZA 3SLED 4IMMA 1PEVA 3EU7A 3GREA 4A2MA 4O1QD 1Q9YA 3J2PA 3PXSD 2JHAA 2MMBA 5FKTA 2JH8A 5EARA 2E32A 1NR0A 2P9PC 2AH0A 3LD8A 3AL9A 5C9ZB 3V5WB 1MHZG 4FJIA 5FKQA 4O3UB 4GMBA 3E4WA 3TJYA 4M42A 4CZVA 2PFVA 3MKQA 5CYKB 4PSWB 4I9QA 3JPXA 1XL3C 3EI4A 2PM7B 3K2OA 3SHFA 3SPZA 4J2EA 3CFPA 4QL1A 3ORVD 1JMZB 3OKYB 4X63B 3SJLD 2LF3A 2DTUA 4GAMC 2XL3A 4FK4A 2H9NA 4KHYA 2PM9B 4ADNA 4CZYA 3PE7A 3RFGA 3TABA 2JHPA 2AGWA 2P1NB 1MHYG 3J27A 1MTYG 4UI9R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFH A;  5HE3 B;  3C6O B;  4D6V A;  4CY1 A;  5H1M A;  5EMJ B;  4I79 A;  4JSN C;  2E31 A;  1PBY B;  2P9K C;  4XYI A;  4G56 B;  4E5Z A;  3SXT D;  4JSX C;  2TRC B;  3RLM D;  3IKO A;  3C6N B;  3FRX A;  3N0E A;  4A09 B;  5C2W B;  3OKY A;  1Q47 A;  3EI1 B;  4AEZ A;  3PSL A;  4HDJ A;  5AJA A;  4PBY A;  1RI6 A;  4U1E I;  1PGU A;  5IBK B;  5CXB A;  5TDH B;  2P9S C;  4J0X A;  3JB9 L;  4TZ4 A;  3SBP A;  2CE9 A;  3I2N A;  4J79 A;  2CN2 A;  5EM2 A;  4GGD A;  1GOT B;  5EMK B;  4PSX B;  4IA9 A;  1SHY B;  1JOF A;  5AFU 3;  3IIW A;  5EAL A;  4GZ8 A;  3SWS D;  2H6K A;  3E0C A;  4J78 A;  5THA A;  2W18 A;  4JT6 C;  4CY3 A;  3V7D B;  1N6E A;  4GQ2 P;  5SXM A;  3ZWL B;  1SQ9 A;  2IUR A;  5FKR A;  4ERZ A;  4CY5 A;  4CI3 A;  2H3X A;  4ZOY A;  4A08 B;  2QXV A;  2Z2P A;  2H9M A;  4A7J A;  3MMY A;  3EI4 B;  4Z8L A;  4CI1 A;  3VH0 A;  3SFZ A;  2I0T A;  4ERY A;  1OMW B;  3C75 H;  3I7K A;  2HYE A;  2YMU A;  5GXH A;  3MZK A;  4E54 B;  5H17 A;  4CY2 A;  2HJ4 A;  4JXM A;  3EI1 A;  4L9O A;  1XIP A;  4J77 A;  1K8K C;  4OZU A;  1R5M A;  3U4Y A;  3ULE C;  3PXW D;  4E54 A;  3V9F A;  4FWW A;  5FKS A;  4J0W A;  4E5Z B;  5IGQ A;  2I0R A;  4ESG A;  3UVL A;  3NVX A;  2Z2O A;  1PI6 A;  3I7N A;  4FA1 D;  1SQJ A;  3I89 A;  3C99 A;  4PC0 A;  5HQG A;  4FB1 D;  2IUV A;  3IJ1 A;  3UKU C;  1S4U X;  5K19 A;  5CXB B;  2H13 A;  1XHM A;  2I3S A;  3AFC A;  3B7F A;  3I8E A;  4JSP C;  4J8B A;  1L0Q A;  3SMR A;  3J81 g;  2P1P B;  4K3I D;  2AGY A;  5HE0 B;  5IT9 g;  4GGA A;  5C2V B;  3SBR A;  4J8G A;  4J81 A;  4CI8 A;  4L3H D;  3DM0 A;  1FS1 A;  3JRO A;  5CYK A;  4O3T B;  4GM3 A;  3PSC B;  4N14 A;  3UVO A;  3F3G A;  2GC4 A;  3C9C A;  3IIY A;  4CZX A;  4ERQ A;  3OKT A;  2EBS A;  5I5I A;  2CNX A;  5GSA A;  2G99 A;  4A08 A;  3RN0 D;  1B9X A;  4A09 A;  3MXX A;  5IGO A;  4FA9 D;  3I7H A;  3UVM A;  4ZOX A;  3GFC A;  1U4C A;  2CO0 C;  3I8C A;  2B4E A;  3PVW B;  3F3F A;  3JRP A;  4Y7R A;  2BCJ B;  3I7P A;  3BWS A;  4X3E A;  2IWF A;  2H9P A;  3K27 A;  2CO0 A;  5IJ7 E;  3OGM B;  1MG3 A;  3I7L A;  3PVU B;  3RRM C;  5HE1 B;  2UZY B;  3P4F A;  2YB8 B;  1U2V C;  2QC5 A;  1YFQ A;  3C6P B;  3DXK C;  5CXC A;  3EWE A;  1GP2 B;  2GC7 A;  3ODT A;  2HJB A;  2MTA H;  4H5I A;  4QQE A;  2CE8 A;  2UZX B;  5GXI A;  4JD2 C;  1OLZ A;  4GM9 A;  3WSO A;  2IUQ A;  2OK4 A;  2H68 A;  5JWZ A;  4U7A A;  3J80 g;  4A0B B;  4AOW A;  2G9A A;  3IJ0 A;  5I5J A;  3A0F A;  4X61 B;  4CI2 A;  3UKR C;  1MG2 A;  1TYQ C;  4MK0 B;  1K32 A;  3L4M D;  3OTT A;  3SBQ A;  3OW8 A;  3OL2 A;  2I0S A;  4EWR A;  4O9D A;  2HKM A;  4PNK B;  5EAM A;  2I3T A;  3DXM C;  2YBA A;  2GNQ A;  3OKW A;  2IUP A;  3I7O A;  4LGN A;  2XU7 A;  2OVR B;  1GXR A;  4ZN4 A;  4QT8 A;  3BG1 A;  2AGZ A;  3C5M A;  3DSM A;  1ERJ A;  3RSE C;  3VA6 A;  2OVP B;  4J84 A;  4NSX A;  2AGL A;  2P1M B;  3EI3 B;  3FGB A;  1VYH C;  3IJC A;  4Y5R D;  4LG9 A;  4A11 A;  4J82 A;  3AH8 B;  2IAA A;  2IWK A;  4JT5 C;  4FAN D;  4GGC A;  2PM6 B;  5A2Q g;  1B9Y A;  2BBK H;  5EML B;  2H6N A;  3L2O B;  4BH6 A;  1FWX A;  2H14 A;  3JZG A;  3HFQ A;  5H14 A;  3SN6 B;  3UVK A;  5KDO B;  3F3P A;  3CFS B;  2Q7Q A;  3W15 A;  3KRX B;  2P9I C;  1GG2 B;  2J57 G;  5FQD A;  4PXW A;  5TF2 A;  3EMH A;  5FXY A;  2P9N C;  3K26 A;  3AL8 B;  1LDK E;  5CXC B;  5EMM B;  2PM9 A;  3FM0 A;  3CFV A;  3EG6 A;  3NVN A;  3VGZ A;  5TEF A;  1A0R B;  2AH1 A;  2PBI B;  4A11 B;  2OVQ B;  4H5J A;  5HYN B;  4XEI C;  2H47 A;  4CC9 A;  2P9L C;  3EI3 A;  4J87 A;  5AMS A;  4QRJ A;  4XYH A;  2YNO A;  4R7A B;  2B5N A;  4A0A B;  5EM2 B;  4ES0 A;  5IC7 A;  4O45 A;  4YVD A;  1NEX B;  2J55 H;  3RN1 D;  3SCY A;  3BG0 A;  1XKS A;  5IJ8 E;  1JJU B;  3JZH A;  5GMK n;  3N0D A;  4L1Q D;  4FAV D;  2XL2 A;  2HXC A;  2AQ5 A;  4D0K A;  2B5M A;  3OL2 B;  4GQB B;  4K3J B;  3MKS B;  4ZOV A;  4FA5 D;  4FHL A;  5HE2 B;  2YNN A;  3MZL A;  3RMZ D;  4L3G D;  4X60 B;  2Z2N A;  3EI2 A;  2H6Q A;  3UVN A;  3EI2 B;  2B5L A;  4A0B A;  1QNI A;  1TBG A;  3SVW D;  3JZN A;  4PBZ A;  2P1Q B;  3OGK B;  4OWR A;  1P22 A;  4LG8 A;  2HES X;  2O9K A;  3KRW B;  3PXT D;  3UR4 A;  2CN3 A;  5FA5 B;  3JAM g;  2XYI A;  5TEE A;  2OIZ A;  4KFM B;  4BUJ C;  5B4W A;  4J73 A;  2P9U C;  4GQ1 A;  3AL8 A;  2YNP A;  4A0A A;  1N6D A;  1JMX B;  5EAP A;  2J56 H;  2AGX A;  5FLX g;  2H9L A;  5K1C C;  4JSV C;  4A2L A;  1MDA H;  4I6J B;  2P1O B;  3NVQ A;  2HKR A;  3CIK B;  3DWL C;  3OGL B;  1N6F A;  3L4O D;  5I5M A;  4J86 A;  2OK6 A;  4FA4 D;  4BL0 A;  4GM8 A;  2OJY A;  4ZOZ A;  3SLE D;  4IMM A;  1PEV A;  3EU7 A;  3GRE A;  4A2M A;  4O1Q D;  3PXS D;  5FKT A;  5EAR A;  2E32 A;  1NR0 A;  2P9P C;  2AH0 A;  3AL9 A;  5C9Z B;  3V5W B;  5FKQ A;  4O3U B;  4GMB A;  4CZV A;  3MKQ A;  5CYK B;  4PSW B;  3JPX A;  3EI4 A;  2PM7 B;  3SHF A;  4QL1 A;  3ORV D;  1JMZ B;  3OKY B;  4X63 B;  3SJL D;  2XL3 A;  2H9N A;  2PM9 B;  4CZY A;  3PE7 A;  3RFG A;  2AGW A;  2P1N B;  4UI9 R; 
#chains in the Genus database with same CATH topology
 3RFH A;  5HE3 B;  3C6O B;  4D6V A;  1E8M A;  4CY1 A;  2ATQ A;  5H1M A;  5EMJ B;  4I79 A;  2VDO A;  4JSN C;  2E31 A;  1PBY B;  2P9K C;  4XYI A;  4G56 B;  3CQ8 A;  3IUJ A;  4E5Z A;  3SXT D;  4JSX C;  4M3Z A;  1O6F A;  2TRC B;  3RLM D;  3KD5 E;  3IKO A;  3C6N B;  3FRX A;  3N0E A;  2VZ1 A;  4A09 B;  5C2W B;  3OKY A;  4FJ8 A;  2XE4 A;  1Q47 A;  3MUO A;  3EI1 B;  4AEZ A;  3PSL A;  4HDJ A;  3HP9 A;  5AJA A;  1FZ4 E;  1XU5 E;  5M5U A;  3QEI A;  4PBY A;  4UM9 A;  1RI6 A;  4U1E I;  1PGU A;  5IBK B;  5CXB A;  5TDH B;  2P9S C;  4J0X A;  3JB9 L;  4TZ4 A;  3SBP A;  4BP8 A;  3HL8 A;  4M3T A;  2CE9 A;  3I2N A;  3ZDX A;  1FZ8 E;  2K5S A;  2CN2 A;  4J79 A;  3QI0 A;  5EM2 A;  4GGD A;  2EIB A;  1GOT B;  5EMK B;  4FJG A;  4PSX B;  4HCC A;  1SHY B;  4IA9 A;  1JOF A;  1GOG A;  5AFU 3;  1M1X A;  3IIW A;  5EAL A;  4GZ8 A;  3SWS D;  3ZDY A;  2H6K A;  5FFG A;  1VZ2 A;  3E0C A;  3SUN A;  4J78 A;  2JPN A;  2PFT A;  5THA A;  2W18 A;  4JT6 C;  4CY3 A;  3V7D B;  1N6E A;  4GQ2 P;  2VC2 A;  5SXM A;  3ZWL B;  1FXX A;  1SQ9 A;  2IUR A;  5FKR A;  3KCI A;  4ERZ A;  3QEX A;  4CY5 A;  4CI3 A;  2H3X A;  1IG9 A;  4ZOY A;  4A08 B;  2QXV A;  3N1E A;  2Z2P A;  4IRZ A;  2H9M A;  4A7J A;  3MMY A;  3EI4 B;  4Z8L A;  4CI1 A;  3VH0 A;  3SFZ A;  3CFR A;  2I0T A;  4WK2 A;  4ERY A;  1OMW B;  4DU4 A;  3C75 H;  3I7K A;  3RMA A;  3NHG A;  4QND A;  3LDS A;  2HYE A;  2YMU A;  4RE5 A;  5GXH A;  3MZK A;  4E54 B;  5H17 A;  4CY2 A;  4QAM A;  2HJ4 A;  4AKI A;  1FYZ E;  4JXM A;  4L9O A;  1XIP A;  4J77 A;  1C9L A;  1K8K C;  4OZU A;  3EI1 A;  1R5M A;  3U4Y A;  3ULE C;  4B08 A;  4NBM A;  3PXW D;  4JS4 A;  4E54 A;  3V9F A;  4FWW A;  5FKS A;  4J0W A;  3L8B A;  3SUP A;  4KHU A;  5IGQ A;  4E5Z B;  4FJM A;  4KHN A;  4FJJ A;  2I0R A;  2VDR A;  4ESG A;  3FCS A;  3UVL A;  3NVX A;  1FZI E;  2Z2O A;  1PI6 A;  4AN1 A;  1MMO G;  1UOP A;  1Q9X A;  3I7N A;  4FA1 D;  1SQJ A;  4RG8 A;  4DTX A;  3I89 A;  3C99 A;  5E6U A;  2EID A;  4PC0 A;  2VDP A;  5HQG A;  4Z7Q A;  3MVD K;  4FB1 D;  2IUV A;  3IJ1 A;  3UKU C;  1S4U X;  4BCB A;  2B1E A;  5K19 A;  5CXB B;  1XVB E;  4M3Y A;  1XVC E;  4FJ7 A;  2H13 A;  5IZ7 A;  1XHM A;  2I3S A;  2VDN A;  3AFC A;  3B7F A;  3I8E A;  4JSP C;  1FZ9 E;  2JHC A;  3V4V A;  3ZE1 A;  4J8B A;  1L0Q A;  3SMR A;  3J81 g;  3TAF A;  4DNU A;  2P1P B;  4K3I D;  2AGY A;  5HE0 B;  4J2D A;  2VDQ A;  5IT9 g;  4BCC A;  1N1C A;  4GGA A;  5C2V B;  3SBR A;  4J8G A;  4J81 A;  4CI8 A;  3DM0 A;  4L3H D;  1FS1 A;  3JRO A;  4FJX A;  5CYK A;  4O3T B;  4GM3 A;  4RE6 A;  3PSC B;  1JTD B;  4N14 A;  3UVO A;  3F3G A;  3SPY A;  2EIE A;  4ADO A;  2GC4 A;  3C9C A;  3IIY A;  4WJK A;  2FYO A;  4CZX A;  3VI4 A;  4ERQ A;  3SQ0 A;  3ZDZ A;  3IUQ A;  2EBS A;  2VDM A;  3OKT A;  5I5I A;  1UOO A;  2CNX A;  1FZ0 E;  5GSA A;  2G99 A;  4A08 A;  3SQ1 A;  2JKX A;  3RN0 D;  3O4G A;  3EQ7 A;  1B9X A;  1QFM A;  3SVI A;  1U8C A;  2P5O A;  4A09 A;  4EP9 A;  4DTJ A;  3TL8 B;  3MXX A;  5FFO A;  5IGO A;  3I7H A;  4FA9 D;  3UVM A;  4ZOX A;  3GFC A;  1U4C A;  2CO0 C;  1FZ5 E;  3I8C A;  4DTS A;  2B4E A;  4HCB A;  1VE7 A;  3PVW B;  4J2A A;  5M61 A;  3TAE A;  3QES A;  3F3F A;  3JRP A;  4Y7R A;  2BCJ B;  3I7P A;  3BWS A;  4X3E A;  2IWF A;  1WAJ A;  1GOH A;  3NE6 A;  3QET A;  4AMY A;  1C9I A;  4JHP C;  2H9P A;  3QER A;  3NAE A;  3K27 A;  2CO0 A;  5IJ7 E;  3QNN A;  3OGM B;  5M5S A;  2RKH A;  1MG3 A;  3N1B A;  4RL5 A;  3I7L A;  2VJ4 A;  3PVU B;  1FZ3 E;  3RRM C;  5HE1 B;  2UZY B;  3P4F A;  2YB8 B;  1U2V C;  2QC5 A;  1YFQ A;  2VIX A;  3NIG A;  1BPO A;  3C6P B;  3DXK C;  5CXC A;  3EWE A;  2LF6 A;  3L0M A;  1GP2 B;  4KHS A;  2GC7 A;  3VI3 A;  3ODT A;  3TAG A;  2HJB A;  5C86 A;  1JV2 A;  3K72 A;  3SUQ A;  4FK2 A;  2MTA H;  3V4P A;  4H5I A;  4QQE A;  3SQ4 A;  2CE8 A;  2UZX B;  3RWU A;  4M41 A;  3SJJ A;  5GXI A;  1XU3 E;  4JD2 C;  1OLZ A;  4GM9 A;  3WSO A;  2IUQ A;  2OK4 A;  2VJ5 A;  2H68 A;  5JWZ A;  1H2Z A;  4U7A A;  5C92 A;  3J80 g;  4A0B B;  3SCX A;  2BKL A;  1UTC A;  4AOW A;  2G9A A;  3IJ0 A;  5I5J A;  3A0F A;  4KHW A;  4MMX A;  4X61 B;  4D9S A;  3UKR C;  4CI2 A;  1MG2 A;  1TYQ C;  4MK0 B;  4FJK A;  1K32 A;  3L4M D;  3QEP A;  3OTT A;  3SBQ A;  5M5T A;  4M3W A;  3OW8 A;  3OL2 A;  4E3S A;  4DTR A;  2I0S A;  4EWR A;  4AN0 A;  4O9D A;  2HKM A;  4M45 A;  4PNK B;  3EQ8 A;  5EAM A;  3LZJ A;  3T3P A;  2I3T A;  3DXM C;  2YBA A;  2GNQ A;  3OKW A;  1TYE A;  2IUP A;  3I7O A;  4LGN A;  2XU7 A;  4UM8 A;  2OVR B;  1GXR A;  2VZ3 A;  1H2X A;  4QT8 A;  4Z7N A;  4ZN4 A;  3BG1 A;  3HGK E;  3BVO A;  2AGZ A;  3C5M A;  4M3R A;  3DSM A;  1ERJ A;  3RSE C;  2HU8 A;  3VA6 A;  3QEW A;  2OVP B;  4J84 A;  4NSX A;  2AGL A;  2P1M B;  3EI3 B;  3FGB A;  2DY4 A;  3RMB A;  1E8N A;  1VYH C;  1FZ2 E;  3IJC A;  4Y5R D;  4LG9 A;  4A11 A;  4J82 A;  3AH8 B;  3HGL A;  3NCI A;  3QNO A;  2IAA A;  2IWK A;  4JT5 C;  4FAN D;  4GGC A;  4BP9 A;  2PM6 B;  3IUR A;  3IUM A;  4FJ5 A;  1B9Y A;  2BBK H;  5A2Q g;  2B7M A;  1XVF E;  2JH9 A;  1WAF A;  3RMC A;  3SI6 A;  2H6N A;  2XDW A;  5EML B;  3L2O B;  4BH6 A;  1FWX A;  4AI6 A;  4KI6 A;  2H14 A;  3S9H A;  3JZG A;  3HFQ A;  5H14 A;  3SN6 B;  2OZM A;  3SQ2 A;  3UVK A;  5KDO B;  2QZP A;  3ZE2 A;  3F3P A;  4FJL A;  4KHQ A;  3CFS B;  4M3U A;  2Q7Q A;  1E5T A;  3W15 A;  1T2X A;  4Z7O A;  3KRX B;  2DEB A;  1GG2 B;  2P9I C;  3QEV A;  2J57 G;  5FQD A;  5M5V A;  4PXW A;  5H37 A;  3K6S A;  5TF2 A;  3EMH A;  4X5M A;  3UO3 A;  5FXY A;  2P9N C;  4NC4 A;  2OYQ A;  4KI4 A;  3K26 A;  3AL8 B;  1LDK E;  5HDB A;  4DTP A;  1L5G A;  4E4B A;  5CXC B;  5EMM B;  4QNC A;  4DTN A;  4DTU A;  2PM9 A;  1IH7 A;  3FM0 A;  2B8I A;  3CFV A;  3EG6 A;  4DNV A;  3NVN A;  3VGZ A;  5TEF A;  3T3M A;  1A0R B;  2AH1 A;  2PBI B;  4A11 B;  4WK0 A;  3MUN A;  4AMZ A;  4DNW A;  2OVQ B;  4H5J A;  3NGI A;  5HYN B;  4XEI C;  2H47 A;  4CC9 A;  2P9L C;  4I9L A;  3EI3 A;  4DU3 A;  4J87 A;  5AMS A;  2VDK A;  4JHN A;  1FZ7 E;  2HU7 A;  4DU1 A;  2YNO A;  4QRJ A;  4R7A B;  1XMG E;  4XYH A;  3NDK A;  3LZI A;  1YR2 A;  4AKH A;  3LDB A;  4AKG A;  2B5N A;  2EIC A;  3NIF A;  4G1E A;  4A0A B;  5EM2 B;  4ES0 A;  2MZW B;  3GD1 I;  5IC7 A;  4O45 A;  4YVD A;  1NEX B;  2J55 H;  3CFO A;  4M3X A;  3FCU A;  3RN1 D;  1H2W A;  3BG0 A;  3SCY A;  2FW3 A;  1XKS A;  4DTO A;  5IJ8 E;  1JJU B;  3JZH A;  5GMK n;  2YB5 A;  3N0D A;  4L1Q D;  4FAV D;  1CLQ A;  3RMD A;  2HXC A;  2AQ5 A;  2XL2 A;  2B5M A;  3IUN A;  3OL2 B;  4GQB B;  4K3J B;  4D0K A;  3MKS B;  4ZOV A;  4FA5 D;  4FHL A;  4G55 A;  5HE2 B;  2YNN A;  3MZL A;  4O2W A;  3SUO A;  3RMZ D;  3E4Y A;  4L3G D;  1A12 A;  4JRP A;  3IJE A;  4X60 B;  2Z2N A;  2MW2 A;  3EI2 A;  2H6Q A;  1XVD E;  2XZG A;  3UVN A;  1FZ6 E;  3EI2 B;  2B5L A;  4FJN A;  3O4I A;  1XVG E;  4A0B A;  1XMH E;  1QNI A;  1O6G A;  4FJH A;  1H2Y A;  2QXF A;  1TBG A;  4DTM A;  3KD1 E;  3SVW D;  4NEN A;  2OZS A;  3JZN A;  4PBZ A;  3K71 A;  2P1Q B;  2P5G A;  1XVE E;  3OGK B;  3UIQ A;  4OWR A;  1P22 A;  4LG8 A;  3EQ9 A;  2HES X;  2O9K A;  3KRW B;  3PXT D;  4G1M A;  3UR4 A;  3QHY B;  2CN3 A;  5FA5 B;  2WQ8 A;  3C94 A;  1GOF A;  4BCD A;  4EYW A;  2XYI A;  3JAM g;  5TEE A;  2QR5 A;  2OIZ A;  4KFM B;  4BUJ C;  3OF7 A;  5IRE A;  4J2B A;  3NID A;  5B4W A;  4J73 A;  2P9U C;  4GQ1 A;  4JS5 A;  3AL8 A;  2YNP A;  4A0A A;  1N6D A;  1JMX B;  5EAP A;  1FZ1 E;  1FZH E;  3L1N A;  4RNG A;  2J56 H;  4FK0 A;  4EPH A;  2AGX A;  5FLX g;  2H9L A;  3C95 A;  5K1C C;  4JSV C;  4A2L A;  1MDA H;  4I6J B;  2HD0 A;  4L1M A;  4FVM A;  2P1O B;  3NVQ A;  3SNN A;  4AX4 A;  2HKR A;  3CIK B;  3DWL C;  3OGL B;  1N6F A;  4WK4 A;  3DDU A;  3L4O D;  5I5M A;  2H4T A;  1K3I A;  4FJ9 A;  3O4J A;  1XMF E;  5E6S A;  4MMZ A;  4J86 A;  4X5N A;  2OK6 A;  4FA4 D;  4BL0 A;  4GM8 A;  2RCU A;  2OJY A;  4JRQ A;  4ZOZ A;  3SLE D;  3UO2 A;  4IMM A;  5M5R A;  1PEV A;  3EU7 A;  3GRE A;  4A2M A;  4O1Q D;  2HU5 A;  1Q9Y A;  4NAA A;  3J2P A;  1UOQ A;  3PXS D;  2JHA A;  2MMB A;  5FKT A;  2JH8 A;  5EAR A;  2E32 A;  1NR0 A;  2P9P C;  2AH0 A;  1I2M B;  3LD8 A;  3GC3 B;  3AL9 A;  1JW2 A;  1QFS A;  5C9Z B;  3V5W B;  1MHZ G;  4FJI A;  4O02 A;  4O3U B;  4GMB A;  5FKQ A;  3E4W A;  3TJY A;  4M42 A;  4CZV A;  2PFV A;  2VDL A;  3MKQ A;  5CYK B;  4PSW B;  4IT5 A;  4I9Q A;  3JPX A;  1XL3 C;  3EI4 A;  2PM7 B;  3K2O A;  1FPO A;  3SPZ A;  3SHF A;  2JQT A;  3CFP A;  4J2E A;  4QL1 A;  3ORV D;  1JMZ B;  3IUL A;  3OKY B;  4X63 B;  3SJL D;  2LF3 A;  2DTU A;  4GAM C;  3O4H A;  2XL3 A;  4FK4 A;  2H9N A;  5E6R A;  1VE6 A;  4KHY A;  4ICG C;  2PM9 B;  3ZE0 A;  4ADN A;  1VZ3 A;  4CZY A;  3PE7 A;  3RFG A;  3TAB A;  2JHP A;  2AGW A;  2P1N B;  1MHY G;  4MMY A;  3J27 A;  1MTY G;  3IVM A;  4UI9 R; 
#chains in the Genus database with same CATH homology
 3RFH A;  5HE3 B;  3C6O B;  4D6V A;  4CY1 A;  2ATQ A;  5H1M A;  5EMJ B;  4I79 A;  4JSN C;  2E31 A;  1PBY B;  2P9K C;  4XYI A;  4G56 B;  3CQ8 A;  4E5Z A;  3SXT D;  4JSX C;  4M3Z A;  2TRC B;  3RLM D;  3KD5 E;  3IKO A;  3C6N B;  3FRX A;  3N0E A;  4A09 B;  5C2W B;  3OKY A;  4FJ8 A;  1Q47 A;  3EI1 B;  4AEZ A;  3PSL A;  4HDJ A;  3HP9 A;  5AJA A;  1FZ4 E;  1XU5 E;  3QEI A;  4PBY A;  1RI6 A;  4U1E I;  1PGU A;  5IBK B;  5CXB A;  5TDH B;  2P9S C;  4J0X A;  3JB9 L;  4TZ4 A;  3SBP A;  3HL8 A;  4M3T A;  2CE9 A;  3I2N A;  1FZ8 E;  4J79 A;  2CN2 A;  5EM2 A;  4GGD A;  1GOT B;  5EMK B;  4FJG A;  4PSX B;  4HCC A;  1SHY B;  4IA9 A;  1JOF A;  5AFU 3;  3IIW A;  5EAL A;  4GZ8 A;  3SWS D;  2H6K A;  3E0C A;  3SUN A;  4J78 A;  2JPN A;  2PFT A;  5THA A;  2W18 A;  4JT6 C;  4CY3 A;  3V7D B;  1N6E A;  4GQ2 P;  5SXM A;  3ZWL B;  1FXX A;  1SQ9 A;  2IUR A;  5FKR A;  4ERZ A;  3QEX A;  4CY5 A;  4CI3 A;  2H3X A;  1IG9 A;  4ZOY A;  4A08 B;  2QXV A;  3N1E A;  2Z2P A;  2H9M A;  4A7J A;  3MMY A;  3EI4 B;  4Z8L A;  4CI1 A;  3VH0 A;  3SFZ A;  3CFR A;  2I0T A;  4ERY A;  1OMW B;  4DU4 A;  3C75 H;  3I7K A;  3RMA A;  3NHG A;  4QND A;  3LDS A;  2HYE A;  2YMU A;  5GXH A;  3MZK A;  4E54 B;  5H17 A;  4CY2 A;  2HJ4 A;  4AKI A;  1FYZ E;  4JXM A;  4L9O A;  1XIP A;  4J77 A;  1K8K C;  4OZU A;  3EI1 A;  1R5M A;  3U4Y A;  3ULE C;  4B08 A;  3PXW D;  4JS4 A;  4E54 A;  3V9F A;  4FWW A;  5FKS A;  4J0W A;  3L8B A;  3SUP A;  4KHU A;  5IGQ A;  4E5Z B;  4FJM A;  4KHN A;  4FJJ A;  2I0R A;  4ESG A;  3UVL A;  3NVX A;  1FZI E;  2Z2O A;  1PI6 A;  1MMO G;  1Q9X A;  3I7N A;  4FA1 D;  1SQJ A;  4RG8 A;  4DTX A;  3I89 A;  3C99 A;  4PC0 A;  5HQG A;  4FB1 D;  2IUV A;  3IJ1 A;  3UKU C;  1S4U X;  2B1E A;  5K19 A;  5CXB B;  1XVB E;  4M3Y A;  1XVC E;  4FJ7 A;  2H13 A;  5IZ7 A;  1XHM A;  2I3S A;  3AFC A;  3B7F A;  3I8E A;  4JSP C;  1FZ9 E;  2JHC A;  4J8B A;  1L0Q A;  3SMR A;  3J81 g;  3TAF A;  2P1P B;  4K3I D;  2AGY A;  5HE0 B;  4J2D A;  5IT9 g;  4GGA A;  5C2V B;  3SBR A;  4J8G A;  4J81 A;  4CI8 A;  3DM0 A;  4L3H D;  1FS1 A;  3JRO A;  4FJX A;  5CYK A;  4O3T B;  4GM3 A;  3PSC B;  4N14 A;  3UVO A;  3F3G A;  3SPY A;  4ADO A;  2GC4 A;  3C9C A;  3IIY A;  2FYO A;  4CZX A;  4ERQ A;  3SQ0 A;  3OKT A;  2EBS A;  5I5I A;  2CNX A;  1FZ0 E;  5GSA A;  2G99 A;  4A08 A;  3SQ1 A;  3RN0 D;  1B9X A;  3SVI A;  4A09 A;  2P5O A;  4EP9 A;  4DTJ A;  3TL8 B;  3MXX A;  5IGO A;  4FA9 D;  3I7H A;  3UVM A;  4ZOX A;  3GFC A;  1U4C A;  2CO0 C;  1FZ5 E;  3I8C A;  4DTS A;  2B4E A;  4HCB A;  3PVW B;  4J2A A;  3TAE A;  3QES A;  3F3F A;  3JRP A;  4Y7R A;  2BCJ B;  3I7P A;  3BWS A;  4X3E A;  2IWF A;  1WAJ A;  3NE6 A;  3QET A;  2H9P A;  3QER A;  3NAE A;  3K27 A;  2CO0 A;  5IJ7 E;  3QNN A;  3OGM B;  1MG3 A;  3N1B A;  4RL5 A;  3I7L A;  2VJ4 A;  3PVU B;  1FZ3 E;  3RRM C;  5HE1 B;  2UZY B;  3P4F A;  2YB8 B;  1U2V C;  2QC5 A;  1YFQ A;  2VIX A;  3C6P B;  3DXK C;  5CXC A;  3EWE A;  2LF6 A;  3L0M A;  1GP2 B;  4KHS A;  2GC7 A;  3ODT A;  3TAG A;  2HJB A;  3SUQ A;  4FK2 A;  2MTA H;  4H5I A;  4QQE A;  3SQ4 A;  2CE8 A;  2UZX B;  3RWU A;  4M41 A;  3SJJ A;  5GXI A;  1XU3 E;  4JD2 C;  1OLZ A;  4GM9 A;  3WSO A;  2IUQ A;  2OK4 A;  2VJ5 A;  2H68 A;  5JWZ A;  4U7A A;  3J80 g;  4A0B B;  3SCX A;  4AOW A;  2G9A A;  3IJ0 A;  5I5J A;  3A0F A;  4KHW A;  4X61 B;  4CI2 A;  3UKR C;  1MG2 A;  1TYQ C;  4MK0 B;  4FJK A;  1K32 A;  3L4M D;  3QEP A;  3OTT A;  3SBQ A;  4M3W A;  3OW8 A;  3OL2 A;  4E3S A;  4DTR A;  2I0S A;  4EWR A;  4O9D A;  2HKM A;  4M45 A;  4PNK B;  5EAM A;  3LZJ A;  2I3T A;  3DXM C;  2YBA A;  2GNQ A;  3OKW A;  2IUP A;  3I7O A;  4LGN A;  2XU7 A;  2OVR B;  1GXR A;  4ZN4 A;  4QT8 A;  3BG1 A;  3HGK E;  2AGZ A;  3C5M A;  4M3R A;  3DSM A;  1ERJ A;  3RSE C;  3VA6 A;  3QEW A;  2OVP B;  4J84 A;  4NSX A;  2AGL A;  2P1M B;  3EI3 B;  3FGB A;  2DY4 A;  3RMB A;  1VYH C;  1FZ2 E;  3IJC A;  4Y5R D;  4LG9 A;  4A11 A;  4J82 A;  3AH8 B;  3HGL A;  3NCI A;  3QNO A;  2IAA A;  2IWK A;  4JT5 C;  4FAN D;  4GGC A;  2PM6 B;  4FJ5 A;  1B9Y A;  2BBK H;  5A2Q g;  2B7M A;  1XVF E;  2JH9 A;  1WAF A;  3RMC A;  3SI6 A;  2H6N A;  5EML B;  3L2O B;  4BH6 A;  1FWX A;  4AI6 A;  4KI6 A;  2H14 A;  3S9H A;  3JZG A;  3HFQ A;  5H14 A;  3SN6 B;  2OZM A;  3SQ2 A;  3UVK A;  5KDO B;  3F3P A;  4FJL A;  4KHQ A;  3CFS B;  4M3U A;  2Q7Q A;  3W15 A;  3KRX B;  2DEB A;  1GG2 B;  2P9I C;  3QEV A;  2J57 G;  5FQD A;  4PXW A;  5H37 A;  5TF2 A;  3EMH A;  4X5M A;  5FXY A;  2P9N C;  2OYQ A;  4KI4 A;  3K26 A;  3AL8 B;  1LDK E;  4DTP A;  4E4B A;  5CXC B;  5EMM B;  4QNC A;  4DTN A;  4DTU A;  2PM9 A;  1IH7 A;  3FM0 A;  2B8I A;  3CFV A;  3EG6 A;  3NVN A;  3VGZ A;  5TEF A;  1A0R B;  2AH1 A;  2PBI B;  4A11 B;  2OVQ B;  4H5J A;  3NGI A;  5HYN B;  4XEI C;  2H47 A;  4CC9 A;  2P9L C;  4I9L A;  3EI3 A;  4DU3 A;  4J87 A;  5AMS A;  1FZ7 E;  4QRJ A;  4DU1 A;  2YNO A;  4R7A B;  4XYH A;  1XMG E;  3NDK A;  3LZI A;  4AKH A;  3LDB A;  4AKG A;  2B5N A;  4A0A B;  5EM2 B;  4ES0 A;  2MZW B;  5IC7 A;  4O45 A;  4YVD A;  1NEX B;  2J55 H;  3CFO A;  4M3X A;  3RN1 D;  3SCY A;  3BG0 A;  2FW3 A;  1XKS A;  4DTO A;  5IJ8 E;  1JJU B;  3JZH A;  5GMK n;  2YB5 A;  3N0D A;  4L1Q D;  4FAV D;  1CLQ A;  2HXC A;  3RMD A;  2AQ5 A;  2XL2 A;  2B5M A;  3OL2 B;  4GQB B;  4K3J B;  4D0K A;  3MKS B;  4ZOV A;  4FA5 D;  4FHL A;  5HE2 B;  2YNN A;  3MZL A;  3SUO A;  3RMZ D;  3E4Y A;  4L3G D;  4JRP A;  4X60 B;  2Z2N A;  3EI2 A;  2H6Q A;  1XVD E;  3UVN A;  3EI2 B;  1FZ6 E;  2B5L A;  4FJN A;  1XVG E;  4A0B A;  1XMH E;  1QNI A;  4FJH A;  2QXF A;  1TBG A;  4DTM A;  3KD1 E;  3SVW D;  2OZS A;  3JZN A;  4PBZ A;  2P1Q B;  2P5G A;  1XVE E;  3OGK B;  3UIQ A;  4OWR A;  1P22 A;  4LG8 A;  2HES X;  2O9K A;  3KRW B;  3PXT D;  3UR4 A;  2CN3 A;  5FA5 B;  3JAM g;  3C94 A;  4EYW A;  2XYI A;  5TEE A;  2OIZ A;  4KFM B;  4BUJ C;  5IRE A;  4J2B A;  5B4W A;  4J73 A;  2P9U C;  4GQ1 A;  4JS5 A;  3AL8 A;  2YNP A;  4A0A A;  1N6D A;  1JMX B;  5EAP A;  1FZ1 E;  1FZH E;  3L1N A;  4RNG A;  2J56 H;  4FK0 A;  2AGX A;  4EPH A;  5FLX g;  2H9L A;  3C95 A;  5K1C C;  4JSV C;  4A2L A;  1MDA H;  4I6J B;  2HD0 A;  4FVM A;  2P1O B;  3NVQ A;  3SNN A;  2HKR A;  3CIK B;  3DWL C;  3OGL B;  1N6F A;  3L4O D;  5I5M A;  2H4T A;  4FJ9 A;  1XMF E;  4J86 A;  4X5N A;  2OK6 A;  4FA4 D;  4BL0 A;  4GM8 A;  2RCU A;  2OJY A;  4JRQ A;  4ZOZ A;  3SLE D;  4IMM A;  1PEV A;  3EU7 A;  3GRE A;  4A2M A;  4O1Q D;  1Q9Y A;  3J2P A;  3PXS D;  2JHA A;  2MMB A;  5FKT A;  2JH8 A;  5EAR A;  2E32 A;  1NR0 A;  2P9P C;  2AH0 A;  3LD8 A;  3AL9 A;  5C9Z B;  3V5W B;  1MHZ G;  4FJI A;  5FKQ A;  4O3U B;  4GMB A;  3E4W A;  3TJY A;  4M42 A;  4CZV A;  2PFV A;  3MKQ A;  5CYK B;  4PSW B;  4I9Q A;  3JPX A;  1XL3 C;  3EI4 A;  2PM7 B;  3K2O A;  3SHF A;  3SPZ A;  4J2E A;  3CFP A;  4QL1 A;  3ORV D;  1JMZ B;  3OKY B;  4X63 B;  3SJL D;  2LF3 A;  2DTU A;  4GAM C;  2XL3 A;  4FK4 A;  2H9N A;  4KHY A;  2PM9 B;  4ADN A;  4CZY A;  3PE7 A;  3RFG A;  3TAB A;  2JHP A;  2AGW A;  2P1N B;  1MHY G;  3J27 A;  1MTY G;  4UI9 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...