1P22A

Structure of a beta-trcp1-skp1-beta-catenin complex: destruction motif binding and lysine specificity on the scfbeta-trcp1 ubiquitin ligase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
411
structure length
402
Chain Sequence
SPAIMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a beta-TrCP1-Skp1-beta-Catenin complex: destruction motif binding and lysine specificity of the SCFbeta-TrCP1 ubiquitin ligase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords F-box/WD-repeat protein 1A
total genus 107
structure length 402
sequence length 411
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1p22A01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1p22A02
5IBKB 2H6NA 4TZ4A 3EU7A 5HE1B 3MKSB 3IJ1A 3JROA 4CZXA 3A0FA 3I8EA 4GMBA 1MG2A 2H9NA 1B9XA 3EG6A 2I3SA 4CC9A 1XHMA 3C75H 4A11A 2PM9B 4XEIC 4A09B 2XU7A 4FA9D 2IURA 4FAVD 2OVRB 3BG1A 2I0TA 3DM0A 2QXVA 3RLMD 2H9PA 4J82A 1P22A 3PXSD 1L0QA 2W18A 4IMMA 5THAA 2AGXA 2PM7B 4PSWB 5HE0B 4KFMB 5FKRA 4J86A 2P9NC 2I3TA 3CFVA 1GOTB 4PBYA 4PC0A 3SMRA 3ULEC 3JB9L 2OJYA 5HE2B 3SBRA 5K19A 1U2VC 3VH0A 4PNKB 2HESX 3JZGA 3NVQA 2CN3A 4FWWA 4H5IA 3EI3B 3FGBA 5TEFA 1NEXB 3OL2B 5I5JA 3ZWLB 3PVUB 1N6FA 3C6PB 4O9DA 5IGOA 1N6EA 5C2WB 4E5ZA 3AL9A 5HQGA 3EI3A 5K1CC 3PXWD 4E5ZB 3OGMB 2H47A 4L1QD 4J77A 3EI1A 2PM6B 4FA4D 3L4MD 1XKSA 2IUQA 5TF2A 1Q47A 3CIKB 3IJCA 4A0BA 3ODTA 4Y5RD 4PSXB 2B5MA 4GM8A 1JOFA 3C5MA 4FHLA 1RI6A 5EM2B 3P4FA 2I0SA 2H68A 3OGKB 4U1EI 1TYQC 2G99A 4J0XA 1MG3A 3UVNA 4JXMA 3OGLB 2P9LC 2HXCA 3OKTA 3SBPA 4JSPC 5CXCA 5FKQA 1XIPA 3SXTD 1PI6A 4PBZA 3EI2A 1GP2B 4QT8A 4X61B 5EALA 3JAMg 2CO0A 3BG0A 4UI9R 4H5JA 3SCYA 5FLXg 3W15A 5CXCB 5H17A 1FS1A 3RMZD 2OVPB 3VGZA 3C6NB 3BWSA 4J79A 2P9UC 3RFGA 1YFQA 4J81A 2HYEA 3UVLA 3AFCA 2YNPA 5FA5B 3RN1D 3JZHA 4CZYA 5SXMA 2G9AA 1GG2B 2CE9A 3J81g 3SBQA 4FAND 3HFQA 3PXTD 3I2NA 4Y7RA 3NVNA 3WSOA 4D6VA 2H9MA 4J87A 4ERZA 3I7OA 5IC7A 3L4OD 4PXWA 4JT5C 3IKOA 4OZUA 3IIYA 3DWLC 4GM3A 4R7AB 2P1OB 5KDOB 3OKWA 1PEVA 2O9KA 5JWZA 2OK6A 3MZKA 5CYKB 5CXBA 3RN0D 4LG9A 2BCJB 3UVKA 2E31A 4E54B 4ZOVA 4JSVC 5H14A 3FM0A 4JT6C 2GNQA 2OVQB 2YNNA 3SN6B 5CYKA 4ERYA 4GQ2P 4MK0B 4E54A 3DXKC 3EI1B 2P9SC 3EI2B 5EMJB 1PBYB 2XL2A 3K26A 4O3TB 3JPXA 4K3ID 5HYNB 3EI4A 3I7HA 2Z2OA 3U4YA 3NVXA 5I5IA 5EAPA 4N14A 4X63B 2P9IC 3JZNA 5FKTA 3SVWD 3J80g 1B9YA 4A11B 4L9OA 2Q7QA 2TRCB 4I79A 5CXBB 5IGQA 1SQ9A 1QNIA 4J78A 3RSEC 4ZOYA 4FB1D 4GZ8A 4FA5D 5B4WA 4OWRA 2J56H 3L2OB 3OTTA 4ERQA 1FWXA 2AGWA 3MZLA 4J73A 5AJAA 4X60B 5GXIA 3OKYA 3I7NA 4CI2A 2CN2A 2IWFA 2YNOA 3EI4B 3B7FA 2YBAA 2E32A 2QC5A 5EM2A 2Z2NA 4A09A 3OKYB 5EAMA 2B4EA 5EMKB 1JJUB 3OW8A 5FQDA 4CY2A 2B5LA 2HKMA 3SLED 1GXRA 2PBIB 4EWRA 4A08B 2AH0A 4GGAA 5TEEA 5A2Qg 4BUJC 2CNXA 2MTAH 4CY5A 4XYHA 5GSAA 1OMWB 5C9ZB 4U7AA 4GGCA 2AGYA 2H6QA 2XYIA 1OLZA 3EMHA 5IJ8E 2H13A 3PVWB 4I6JB 2P1NB 2HKRA 1NR0A 4A0AB 3PSCB 4QQEA 1LDKE 1R5MA 4A08A 4A0BB 4L3GD 2UZYB 3GREA 4IA9A 2EBSA 4BH6A 4A2LA 3SWSD 4BL0A 2UZXB 2P9KC 2YB8B 3UR4A 2AQ5A 3K27A 3IJ0A 4GM9A 1SQJA 3AH8B 3UKRC 2J57G 4NSXA 2P1PB 5HE3B 3GFCA 3AL8A 2B5NA 4FA1D 4JSXC 3KRXB 2AH1A 1U4CA 3CFSB 3V7DB 3ORVD 2OK4A 5GMKn 4A0AA 3VA6A 4G56B 3PE7A 4X3EA 2IUPA 4LGNA 2J55H 4J8BA 5EMMB 2AGZA 2CO0C 4K3JB 2I0RA 2H6KA 3I89A 1TBGA 2H3XA 1PGUA 4A7JA 3I7KA 3UVMA 4Z8LA 4ESGA 5C2VB 2Z2PA 3EWEA 3KRWB 4O1QD 5AFU3 1JMZB 4CI8A 4CZVA 4GGDA 3UVOA 3DSMA 4L3HD 5AMSA 3OL2A 5I5MA 2AGLA 5IJ7E 5FXYA 1ERJA 4CY3A 2IUVA 3V9FA 5TDHB 3PSLA 2P9PC 3N0DA 3I7PA 3F3GA 1K32A 3I7LA 3FRXA 1K8KC 2CE8A 4HDJA 4O3UB 3V5WB 3IIWA 1SHYB 2OIZA 4CY1A 2HJBA 5EARA 3E0CA 4O45A 2HJ4A 2GC7A 3N0EA 1N6DA 4QRJA 3SJLD 4J0WA 1S4UX 2GC4A 4GQ1A 4LG8A 2H9LA 4CI3A 3JRPA 3C99A 4A2MA 4AEZA 3F3PA 4XYIA 2H14A 3MKQA 4YVDA 3AL8B 5IT9g 4QL1A 4ZN4A 5GXHA 3SHFA 1MDAH 2P1QB 2YMUA 2XL3A 4JD2C 4AOWA 4ZOZA 3C6OB 3SFZA 4ES0A 1JMXB 4ZOXA 3MXXA 2IWKA 2IAAA 3RFHA 4D0KA 3C9CA 2PM9A 3RRMC 5H1MA 5FKSA 4J84A 3F3FA 2BBKH 3I8CA 5EMLB 3UKUC 1VYHC 4GQBB 2P1MB 4JSNC 1A0RB 4CI1A 3DXMC 4J8GA 3MMYA
chains in the Genus database with same CATH superfamily
5IBKB 3GC3B 2JPNA 1IH7A 5M5UA 3IULA 2H6NA 3NIGA 4TZ4A 3EU7A 5HE1B 3MKSB 3IJ1A 3QESA 3JROA 4CZXA 3A0FA 1FZIE 1YR2A 4NAAA 3I8EA 4GMBA 1MG2A 2H9NA 3ZDXA 4X5NA 1B9XA 1FYZE 3EG6A 4DTRA 2I3SA 4CC9A 1XHMA 3C75H 2P5GA 4A11A 2PM9B 4XEIC 4DTPA 1Q9YA 4A09B 2XU7A 4DNWA 4NBMA 2IURA 4FA9D 4FAVD 2OVRB 3BG1A 4DTXA 3S9HA 2I0TA 1FZ8E 3DM0A 1XMHE 4M3TA 1UOOA 2QXVA 3RLMD 2H9PA 2EICA 1C9IA 5FFGA 4J82A 1P22A 3QEXA 3O4GA 1L0QA 3QNOA 2W18A 3PXSD 4IMMA 5THAA 2AGXA 2PM7B 4PSWB 5HE0B 4KFMB 4L1MA 4KHWA 5FKRA 4J86A 5M5SA 2P9NC 2I3TA 3CFVA 2PFTA 1GOHA 1GOTB 2JH8A 4PBYA 4BP9A 1N1CA 3QNNA 3SQ0A 4PC0A 3CFPA 3SMRA 3ULEC 4FJ7A 3JB9L 2OJYA 3MUNA 3SJJA 1UTCA 5HE2B 1U2VC 3SBRA 4AN1A 4PNKB 2HESX 4JS4A 3T3MA 5K19A 5C86A 2XE4A 4DTJA 3JZGA 4AMZA 3TAGA 3NVQA 2CN3A 1VE7A 4M3RA 3NIDA 1H2WA 1E8MA 4X5MA 1GOGA 2PFVA 4FWWA 4H5IA 1QFSA 1FZ3E 3NHGA 3EI3B 3FGBA 1WAJA 4FJKA 1NEXB 3OL2B 5I5JA 5TEFA 4DU1A 3SUQA 4JS5A 3PVUB 3ZWLB 3VI4A 1N6FA 3C6PB 3GD1I 4O9DA 5IGOA 1N6EA 1O6GA 5E6RA 5FFOA 5C2WB 3LDBA 3QETA 3RMAA 3K6SA 4E5ZA 2RCUA 3AL9A 4NENA 5HQGA 3EI3A 5K1CC 4I9QA 3PXWD 4E5ZB 3OGMB 2H47A 4FK4A 4L1QD 4J77A 3NDKA 3EI1A 4NC4A 4QNDA 2PM6B 3O4JA 3L4MD 4FA4D 2YB5A 1XKSA 4FJ9A 2IUQA 5TF2A 2JH9A 1M1XA 1Q47A 3TAEA 4AKIA 3CIKB 3IJCA 4A0BA 3ODTA 4Y5RD 3EQ9A 4PSXB 2LF3A 2B5MA 4GM8A 1JOFA 3C5MA 4FHLA 1RI6A 5EM2B 3P4FA 2I0SA 4M3XA 2H68A 3OGKB 4U1EI 1TYQC 1FZ2E 5H37A 4M3ZA 3RMBA 2VDQA 2G99A 3SQ4A 4J0XA 1MG3A 4JHPC 3UVNA 3N1BA 3OGLB 4JXMA 4Z7QA 2P9LC 1XL3C 2HXCA 3OKTA 3SBPA 4JSPC 5CXCA 5FKQA 1XIPA 3SXTD 1PI6A 4EPHA 4PBZA 4EYWA 3EI2A 3SNNA 1GP2B 4QT8A 4X61B 5EALA 3JAMg 2CO0A 3KD5E 3BG0A 3T3PA 4UI9R 4H5JA 3SCYA 5FLXg 3W15A 3QI0A 5CXCB 1JW2A 3ZDYA 3TJYA 4KHSA 3SQ1A 1QFMA 5H17A 4DU3A 1FS1A 1H2XA 3RMZD 4QNCA 4KHYA 3IUMA 2OVPB 4KHNA 1XMFE 4J2DA 2DTUA 3VGZA 3C6NB 3BWSA 4J79A 2P9UC 4WK0A 3RFGA 1YFQA 4J81A 2HYEA 3RMDA 4IRZA 3UVLA 2JHPA 5C92A 4E3SA 2YNPA 3CQ8A 3AFCA 5FA5B 3JZHA 3RN1D 4CZYA 5SXMA 4G1MA 2G9AA 1FZ1E 1GG2B 5E6UA 2CE9A 3NGIA 3J81g 4AMYA 3SBQA 4FAND 3HFQA 1XU5E 1XVFE 3EQ7A 3PXTD 5M5VA 3CFRA 3I2NA 1FZ5E 4Y7RA 3NVNA 3WSOA 1MMOG 3K72A 4D6VA 2H9MA 4J87A 3J2PA 1WAFA 4ERZA 3I7OA 4FJIA 5IC7A 3L4OD 4PXWA 4JT5C 3IKOA 4OZUA 3EQ8A 3IIYA 3DWLC 4GM3A 2BKLA 4R7AB 2P1OB 1FXXA 4I9LA 5KDOB 3OKWA 1PEVA 2O9KA 5JWZA 2OK6A 3MZKA 2HD0A 2VDKA 5CXBA 5CYKB 4M41A 3RN0D 3ZDZA 3VH0A 4LG9A 2BCJB 3BVOA 3UVKA 2E31A 1FZ0E 4E54B 4ZOVA 3QEVA 4JSVC 5H14A 3FM0A 4JT6C 2GNQA 2OVQB 2YNNA 3SN6B 5CYKA 4ERYA 4GQ2P 3TAFA 4MK0B 2EIEA 4E54A 4ADOA 3O4IA 3DXKC 3EI1B 2P9SC 3EI2B 2OZMA 5EMJB 1PBYB 2XL2A 3C95A 4GAMC 3K26A 4O3TB 3JPXA 4M42A 4K3ID 1TYEA 5HYNB 1U8CA 3EI4A 1XVEE 3VI3A 3L8BA 3I7HA 2Z2OA 3U4YA 3NVXA 4FJLA 5I5IA 3ZE1A 5EAPA 4N14A 3IUJA 4X63B 2B1EA 2P9IC 3JZNA 5FKTA 3SVWD 3RWUA 4EP9A 3HGLA 3SVIA 4JRQA 1B9YA 3J80g 4M3WA 2QZPA 4A11B 4L9OA 2Q7QA 4DNUA 2TRCB 4J2BA 4I79A 1VZ2A 5CXBB 5IGQA 1FZ4E 1MHYG 1SQ9A 1QNIA 4J78A 3RSEC 4M3YA 4FB1D 4ZOYA 4FJMA 4GZ8A 3L0MA 2VZ1A 5B4WA 4FA5D 4DNVA 1XVDE 4OWRA 2J56H 1XMGE 1E8NA 3L2OB 3K71A 3OTTA 4ERQA 1FWXA 2AGWA 3MZLA 4J73A 1O6FA 4AKGA 5AJAA 4X60B 4AKHA 5GXIA 3ZE2A 4MMZA 4BCCA 4RNGA 1Q9XA 3IUQA 3OKYA 3I7NA 4CI2A 2CN2A 2IWFA 2YNOA 3EI4B 3B7FA 4G1EA 4B08A 2YBAA 2E32A 2QC5A 3FCSA 4ADNA 1K3IA 5EM2A 2Z2NA 1VE6A 4FVMA 4O2WA 3SPZA 4AN0A 2VDMA 4A09A 3OKYB 5EAMA 2B4EA 5EMKB 3QEWA 4RL5A 3TL8B 1JJUB 3OW8A 5FQDA 4CY2A 1T2XA 2B5LA 2HKMA 4RE6A 3SLED 1GXRA 3LZIA 2PBIB 3E4YA 3V4PA 4EWRA 4A08B 2AH0A 4JHNA 4GGAA 2VC2A 5HDBA 5TEEA 5A2Qg 2HU7A 4BUJC 2VDNA 2CNXA 2MTAH 2DY4A 4XYHA 4BCDA 4CY5A 4WK2A 5GSAA 2RKHA 1MTYG 1OMWB 5C9ZB 4U7AA 4M3UA 1VZ3A 2EIBA 2OZSA 2B8IA 3L1NA 4HCCA 4FJHA 4MMYA 3LZJA 4GGCA 4FJJA 3QHYB 2AGYA 2VDOA 2P5OA 3O4HA 2H6QA 2XYIA 3OF7A 2FW3A 1OLZA 2QR5A 3EMHA 5IJ8E 2H13A 3HP9A 3PVWB 3RMCA 1FZ7E 4I6JB 2P1NB 2HKRA 1NR0A 4G55A 4A0AB 3PSCB 2ATQA 1LDKE 4ICGC 3E4WA 4QQEA 4J2AA 3IVMA 3K2OA 3KCIA 3SPYA 1R5MA 4A08A 4A0BB 4L3GD 2UZYB 2VZ3A 3GREA 4IA9A 3NAEA 2EBSA 4BH6A 4Z7OA 4A2LA 3SWSD 4BL0A 2UZXB 2P9KC 4QAMA 2YB8B 3UR4A 2AQ5A 3MVDK 3K27A 3SI6A 2HU8A 1XVGE 1E5TA 3IJ0A 4GM9A 2LF6A 1SQJA 3AH8B 5IZ7A 4DTUA 3UKRC 2J57G 4NSXA 2P1PB 4KI4A 4KHUA 5HE3B 1FZ6E 3GFCA 2WQ8A 3AL8A 2B5NA 1H2YA 4FA1D 4JSXC 2MZWB 3KRXB 3LD8A 2AH1A 3TABA 1U4CA 3V7DB 3CFSB 3HL8A 3QERA 4WJKA 3SQ2A 4D9SA 1UOQA 3UIQA 3KD1E 3ORVD 2OK4A 3MUOA 5GMKn 3DDUA 4A0AA 4O02A 5E6SA 4G56B 5M5RA 2VIXA 3PE7A 4X3EA 3VA6A 2IUPA 4LGNA 2J55H 2OYQA 2EIDA 4J8BA 5EMMB 3ZE0A 2AGZA 2CO0C 4K3JB 2I0RA 2H6KA 3I89A 1C9LA 1TBGA 2H3XA 4FJNA 2JHCA 1PGUA 4A7JA 3I7KA 3UVMA 4KI6A 4RG8A 1CLQA 2MW2A 3UO3A 4Z8LA 4ESGA 5C2VB 2Z2PA 3EWEA 3KRWB 1GOFA 4UM9A 4BCBA 4O1QD 2JKXA 5AFU3 2MMBA 1JMZB 4CI8A 3J27A 4GGDA 4CZVA 3SUOA 2JHAA 3UVOA 3DSMA 4L3HD 5AMSA 3OL2A 5I5MA 3QEIA 4DTOA 2AGLA 5IJ7E 5FXYA 1ERJA 4CY3A 2IUVA 3FCUA 2K5SA 5TDHB 3V9FA 4FJ8A 3N1EA 3PSLA 2P9PC 4FK0A 2VJ5A 3N0DA 3NIFA 3I7PA 3F3GA 1K32A 4DTSA 3I7LA 5M61A 3C94A 1XU3E 5M5TA 3FRXA 1K8KC 2XDWA 2CE8A 4HDJA 1JV2A 5IREA 4O3UB 4RE5A 3V5WB 3SUNA 3IIWA 3IUNA 1SHYB 2OIZA 4CY1A 2HJBA 5EARA 4WK4A 4E4BA 3E0CA 2HJ4A 4O45A 2GC7A 3N0EA 1N6DA 4QRJA 3SJLD 4J0WA 1S4UX 4FK2A 2GC4A 4GQ1A 4LG8A 3IURA 2H9LA 1I2MB 3SUPA 2DEBA 3JRPA 4CI3A 4UM8A 3C99A 4A2MA 1FPOA 1L5GA 4AEZA 4Z7NA 4M45A 3NCIA 3F3PA 4XYIA 2FYOA 1XVCE 2H14A 3MKQA 4YVDA 1JTDB 3AL8B 4MMXA 5IT9g 4QL1A 4ZN4A 5GXHA 4AI6A 4HCBA 3SHFA 1MDAH 2H4TA 2P1QB 2QXFA 2YMUA 2XL3A 4JD2C 4AOWA 4FJGA 1A12A 4ZOZA 1UOPA 2VDLA 3C6OB 2B7MA 4KHQA 4BP8A 3SFZA 4IT5A 4ES0A 2VDPA 3NE6A 3LDSA 1JMXB 4ZOXA 3MXXA 2IWKA 2IAAA 1XVBE 3RFHA 3V4VA 4D0KA 1FZ9E 3SCXA 3C9CA 2PM9A 1MHZG 3RRMC 4DTMA 1FZHE 5H1MA 5FKSA 1H2ZA 2JQTA 4J84A 3HGKE 3QEPA 3F3FA 4FJ5A 4JRPA 3UO2A 2BBKH 3I8CA 4DTNA 3IJEA 2XZGA 4AX4A 5EMLB 3UKUC 1VYHC 4GQBB 2P1MB 2HU5A 4JSNC 4J2EA 1A0RB 1BPOA 2VJ4A 4FJXA 2VDRA 4CI1A 3CFOA 3DXMC 1IG9A 4DU4A 4J8GA 3MMYA
chains in the Genus database with same CATH topology
5IBKB 2JPNA 1IH7A 2H6NA 4TZ4A 3EU7A 5HE1B 3MKSB 3IJ1A 3QESA 3JROA 4CZXA 3A0FA 1FZIE 3I8EA 4GMBA 1MG2A 2H9NA 4X5NA 1B9XA 1FYZE 3EG6A 4DTRA 2I3SA 4CC9A 1XHMA 3C75H 2P5GA 4A11A 2PM9B 4XEIC 4DTPA 1Q9YA 4A09B 2XU7A 4FA9D 2IURA 4FAVD 2OVRB 3BG1A 4DTXA 3S9HA 2I0TA 1FZ8E 3DM0A 1XMHE 4M3TA 2QXVA 3RLMD 2H9PA 4J82A 1P22A 3QEXA 3PXSD 1L0QA 3QNOA 2W18A 4IMMA 5THAA 2AGXA 2PM7B 4PSWB 5HE0B 4KFMB 4KHWA 5FKRA 4J86A 2P9NC 2I3TA 3CFVA 2PFTA 1GOTB 2JH8A 4PBYA 3QNNA 3SQ0A 4PC0A 3CFPA 3SMRA 3ULEC 4FJ7A 3JB9L 2OJYA 3SJJA 5HE2B 3SBRA 1U2VC 5K19A 3VH0A 4PNKB 2HESX 4JS4A 4DTJA 3JZGA 3TAGA 3NVQA 2CN3A 4M3RA 4X5MA 2PFVA 4FWWA 4H5IA 1FZ3E 3NHGA 3EI3B 3FGBA 1WAJA 4FJKA 1NEXB 3OL2B 5I5JA 5TEFA 4DU1A 3SUQA 4JS5A 3PVUB 3ZWLB 1N6FA 3C6PB 4O9DA 5IGOA 1N6EA 5C2WB 3LDBA 3QETA 3RMAA 4E5ZA 2RCUA 3AL9A 5HQGA 3EI3A 5K1CC 4I9QA 3PXWD 4E5ZB 3OGMB 2H47A 4FK4A 4L1QD 4J77A 3NDKA 3EI1A 4QNDA 2PM6B 4FA4D 3L4MD 2YB5A 1XKSA 4FJ9A 2IUQA 5TF2A 2JH9A 1Q47A 3TAEA 4AKIA 3CIKB 3IJCA 4A0BA 3ODTA 4Y5RD 4PSXB 2LF3A 2B5MA 4GM8A 1JOFA 3C5MA 4FHLA 1RI6A 5EM2B 3P4FA 2I0SA 4M3XA 2H68A 3OGKB 4U1EI 1TYQC 1FZ2E 5H37A 4M3ZA 3RMBA 2G99A 3SQ4A 4J0XA 1MG3A 3UVNA 3N1BA 3OGLB 4JXMA 2P9LC 1XL3C 2HXCA 3OKTA 3SBPA 4JSPC 5CXCA 5FKQA 1XIPA 3SXTD 1PI6A 4EPHA 4PBZA 4EYWA 3EI2A 3SNNA 1GP2B 4QT8A 4X61B 5EALA 3JAMg 2CO0A 3KD5E 3BG0A 4UI9R 4H5JA 3SCYA 5FLXg 3W15A 5CXCB 3TJYA 4KHSA 3SQ1A 5H17A 4DU3A 1FS1A 3RMZD 4QNCA 4KHYA 2OVPB 4KHNA 1XMFE 4J2DA 2DTUA 3VGZA 3C6NB 3BWSA 4J79A 2P9UC 3RFGA 1YFQA 4J81A 2HYEA 3RMDA 3UVLA 2JHPA 4E3SA 2YNPA 3CQ8A 3AFCA 5FA5B 3JZHA 3RN1D 4CZYA 5SXMA 2G9AA 1FZ1E 1GG2B 2CE9A 3NGIA 3J81g 3SBQA 4FAND 3HFQA 1XU5E 1XVFE 3PXTD 3CFRA 3I2NA 1FZ5E 4Y7RA 3NVNA 3WSOA 1MMOG 4D6VA 2H9MA 4J87A 3J2PA 1WAFA 4ERZA 3I7OA 4FJIA 5IC7A 3L4OD 4PXWA 4JT5C 3IKOA 4OZUA 3IIYA 3DWLC 4GM3A 4R7AB 2P1OB 1FXXA 4I9LA 5KDOB 3OKWA 1PEVA 2O9KA 5JWZA 2OK6A 3MZKA 2HD0A 5CYKB 5CXBA 4M41A 3RN0D 4LG9A 2BCJB 3UVKA 2E31A 1FZ0E 4E54B 4ZOVA 3QEVA 4JSVC 5H14A 3FM0A 4JT6C 2GNQA 2OVQB 2YNNA 3SN6B 5CYKA 4ERYA 4GQ2P 3TAFA 4MK0B 4E54A 4ADOA 3DXKC 3EI1B 2P9SC 3EI2B 2OZMA 5EMJB 1PBYB 2XL2A 3C95A 4GAMC 3K26A 4O3TB 3JPXA 4M42A 4K3ID 5HYNB 3EI4A 1XVEE 3L8BA 3I7HA 2Z2OA 3U4YA 3NVXA 4FJLA 5I5IA 5EAPA 4N14A 4X63B 2B1EA 2P9IC 3JZNA 5FKTA 3SVWD 3RWUA 4EP9A 3HGLA 3SVIA 4JRQA 1B9YA 3J80g 4M3WA 4A11B 4L9OA 2Q7QA 2TRCB 4J2BA 4I79A 5CXBB 5IGQA 1FZ4E 1MHYG 1SQ9A 1QNIA 4J78A 3RSEC 4M3YA 4FB1D 4ZOYA 4FJMA 4GZ8A 3L0MA 4FA5D 5B4WA 1XVDE 4OWRA 2J56H 1XMGE 3L2OB 3OTTA 4ERQA 1FWXA 2AGWA 3MZLA 4J73A 4AKGA 5AJAA 4X60B 4AKHA 5GXIA 4RNGA 1Q9XA 3OKYA 3I7NA 4CI2A 2CN2A 2IWFA 2YNOA 3EI4B 3B7FA 4B08A 2YBAA 2E32A 2QC5A 4ADNA 5EM2A 2Z2NA 4FVMA 3SPZA 4A09A 3OKYB 5EAMA 2B4EA 5EMKB 3QEWA 4RL5A 3TL8B 1JJUB 3OW8A 5FQDA 4CY2A 2B5LA 2HKMA 3SLED 1GXRA 3LZIA 2PBIB 3E4YA 4EWRA 4A08B 2AH0A 4GGAA 5TEEA 5A2Qg 4BUJC 2CNXA 2MTAH 2DY4A 4XYHA 4CY5A 5GSAA 1MTYG 1OMWB 5C9ZB 4U7AA 4M3UA 2OZSA 2B8IA 3L1NA 4HCCA 4FJHA 3LZJA 4GGCA 4FJJA 2AGYA 2P5OA 2H6QA 2XYIA 2FW3A 1OLZA 3EMHA 5IJ8E 2H13A 3HP9A 3PVWB 3RMCA 1FZ7E 4I6JB 2P1NB 2HKRA 1NR0A 4A0AB 3PSCB 2ATQA 1LDKE 4QQEA 3E4WA 4J2AA 3K2OA 3SPYA 1R5MA 4A08A 4A0BB 4L3GD 2UZYB 3GREA 4IA9A 3NAEA 2EBSA 4BH6A 4A2LA 3SWSD 4BL0A 2UZXB 2P9KC 2YB8B 3UR4A 2AQ5A 3K27A 3SI6A 1XVGE 3IJ0A 4GM9A 2LF6A 1SQJA 3AH8B 5IZ7A 4DTUA 3UKRC 2J57G 4NSXA 2P1PB 4KI4A 4KHUA 5HE3B 1FZ6E 3GFCA 3AL8A 2B5NA 4FA1D 4JSXC 2MZWB 3KRXB 3LD8A 2AH1A 3TABA 1U4CA 3V7DB 3CFSB 3HL8A 3QERA 3SQ2A 3UIQA 3KD1E 3ORVD 2OK4A 5GMKn 4A0AA 3VA6A 4G56B 2VIXA 3PE7A 4X3EA 2IUPA 4LGNA 2J55H 2OYQA 4J8BA 5EMMB 2AGZA 2CO0C 4K3JB 2I0RA 2H6KA 3I89A 1TBGA 2H3XA 4FJNA 2JHCA 1PGUA 4A7JA 3I7KA 3UVMA 4KI6A 4RG8A 1CLQA 4Z8LA 4ESGA 5C2VB 2Z2PA 3EWEA 3KRWB 4O1QD 5AFU3 2MMBA 1JMZB 4CI8A 3J27A 4GGDA 4CZVA 3SUOA 2JHAA 3UVOA 3DSMA 4L3HD 5AMSA 3OL2A 5I5MA 3QEIA 4DTOA 2AGLA 5IJ7E 5FXYA 1ERJA 4CY3A 2IUVA 3V9FA 5TDHB 4FJ8A 3N1EA 3PSLA 2P9PC 4FK0A 2VJ5A 3N0DA 3I7PA 3F3GA 1K32A 4DTSA 3I7LA 3C94A 1XU3E 3FRXA 1K8KC 2CE8A 4HDJA 5IREA 4O3UB 3V5WB 3SUNA 3IIWA 1SHYB 2OIZA 4CY1A 2HJBA 5EARA 4E4BA 3E0CA 2HJ4A 4O45A 2GC7A 3N0EA 1N6DA 4QRJA 3SJLD 4J0WA 1S4UX 4FK2A 2GC4A 4GQ1A 4LG8A 2H9LA 3SUPA 2DEBA 3JRPA 4CI3A 3C99A 4A2MA 4AEZA 4M45A 3NCIA 3F3PA 4XYIA 2FYOA 1XVCE 2H14A 3MKQA 4YVDA 3AL8B 5IT9g 4QL1A 4ZN4A 5GXHA 4AI6A 4HCBA 3SHFA 1MDAH 2H4TA 2P1QB 2QXFA 2YMUA 2XL3A 4JD2C 4AOWA 4FJGA 4ZOZA 3C6OB 2B7MA 4KHQA 3SFZA 4ES0A 3NE6A 3LDSA 1JMXB 4ZOXA 3MXXA 2IWKA 2IAAA 1XVBE 3RFHA 4D0KA 1FZ9E 3SCXA 3C9CA 2PM9A 1MHZG 3RRMC 4DTMA 1FZHE 5H1MA 5FKSA 4J84A 3HGKE 3QEPA 3F3FA 4FJ5A 4JRPA 2BBKH 3I8CA 4DTNA 5EMLB 3UKUC 1VYHC 4GQBB 2P1MB 4JSNC 4J2EA 1A0RB 2VJ4A 4FJXA 4CI1A 3CFOA 3DXMC 1IG9A 4DU4A 4J8GA 3MMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IBK B;  2H6N A;  4TZ4 A;  3EU7 A;  5HE1 B;  3MKS B;  3IJ1 A;  3JRO A;  4CZX A;  3A0F A;  3I8E A;  4GMB A;  1MG2 A;  2H9N A;  1B9X A;  3EG6 A;  2I3S A;  4CC9 A;  1XHM A;  3C75 H;  4A11 A;  2PM9 B;  4XEI C;  4A09 B;  2XU7 A;  4FA9 D;  2IUR A;  4FAV D;  2OVR B;  3BG1 A;  2I0T A;  3DM0 A;  2QXV A;  3RLM D;  2H9P A;  4J82 A;  1P22 A;  3PXS D;  1L0Q A;  2W18 A;  4IMM A;  5THA A;  2AGX A;  2PM7 B;  4PSW B;  5HE0 B;  4KFM B;  5FKR A;  4J86 A;  2P9N C;  2I3T A;  3CFV A;  1GOT B;  4PBY A;  4PC0 A;  3SMR A;  3ULE C;  3JB9 L;  2OJY A;  5HE2 B;  3SBR A;  5K19 A;  1U2V C;  3VH0 A;  4PNK B;  2HES X;  3JZG A;  3NVQ A;  2CN3 A;  4FWW A;  4H5I A;  3EI3 B;  3FGB A;  5TEF A;  1NEX B;  3OL2 B;  5I5J A;  3ZWL B;  3PVU B;  1N6F A;  3C6P B;  4O9D A;  5IGO A;  1N6E A;  5C2W B;  4E5Z A;  3AL9 A;  5HQG A;  3EI3 A;  5K1C C;  3PXW D;  4E5Z B;  3OGM B;  2H47 A;  4L1Q D;  4J77 A;  3EI1 A;  2PM6 B;  4FA4 D;  3L4M D;  1XKS A;  2IUQ A;  5TF2 A;  1Q47 A;  3CIK B;  3IJC A;  4A0B A;  3ODT A;  4Y5R D;  4PSX B;  2B5M A;  4GM8 A;  1JOF A;  3C5M A;  4FHL A;  1RI6 A;  5EM2 B;  3P4F A;  2I0S A;  2H68 A;  3OGK B;  4U1E I;  1TYQ C;  2G99 A;  4J0X A;  1MG3 A;  3UVN A;  4JXM A;  3OGL B;  2P9L C;  2HXC A;  3OKT A;  3SBP A;  4JSP C;  5CXC A;  5FKQ A;  1XIP A;  3SXT D;  1PI6 A;  4PBZ A;  3EI2 A;  1GP2 B;  4QT8 A;  4X61 B;  5EAL A;  3JAM g;  2CO0 A;  3BG0 A;  4UI9 R;  4H5J A;  3SCY A;  5FLX g;  3W15 A;  5CXC B;  5H17 A;  1FS1 A;  3RMZ D;  2OVP B;  3VGZ A;  3C6N B;  3BWS A;  4J79 A;  2P9U C;  3RFG A;  1YFQ A;  4J81 A;  2HYE A;  3UVL A;  3AFC A;  2YNP A;  5FA5 B;  3RN1 D;  3JZH A;  4CZY A;  5SXM A;  2G9A A;  1GG2 B;  2CE9 A;  3J81 g;  3SBQ A;  4FAN D;  3HFQ A;  3PXT D;  3I2N A;  4Y7R A;  3NVN A;  3WSO A;  4D6V A;  2H9M A;  4J87 A;  4ERZ A;  3I7O A;  5IC7 A;  3L4O D;  4PXW A;  4JT5 C;  3IKO A;  4OZU A;  3IIY A;  3DWL C;  4GM3 A;  4R7A B;  2P1O B;  5KDO B;  3OKW A;  1PEV A;  2O9K A;  5JWZ A;  2OK6 A;  3MZK A;  5CYK B;  5CXB A;  3RN0 D;  4LG9 A;  2BCJ B;  3UVK A;  2E31 A;  4E54 B;  4ZOV A;  4JSV C;  5H14 A;  3FM0 A;  4JT6 C;  2GNQ A;  2OVQ B;  2YNN A;  3SN6 B;  5CYK A;  4ERY A;  4GQ2 P;  4MK0 B;  4E54 A;  3DXK C;  3EI1 B;  2P9S C;  3EI2 B;  5EMJ B;  1PBY B;  2XL2 A;  3K26 A;  4O3T B;  3JPX A;  4K3I D;  5HYN B;  3EI4 A;  3I7H A;  2Z2O A;  3U4Y A;  3NVX A;  5I5I A;  5EAP A;  4N14 A;  4X63 B;  2P9I C;  3JZN A;  5FKT A;  3SVW D;  3J80 g;  1B9Y A;  4A11 B;  4L9O A;  2Q7Q A;  2TRC B;  4I79 A;  5CXB B;  5IGQ A;  1SQ9 A;  1QNI A;  4J78 A;  3RSE C;  4ZOY A;  4FB1 D;  4GZ8 A;  4FA5 D;  5B4W A;  4OWR A;  2J56 H;  3L2O B;  3OTT A;  4ERQ A;  1FWX A;  2AGW A;  3MZL A;  4J73 A;  5AJA A;  4X60 B;  5GXI A;  3OKY A;  3I7N A;  4CI2 A;  2CN2 A;  2IWF A;  2YNO A;  3EI4 B;  3B7F A;  2YBA A;  2E32 A;  2QC5 A;  5EM2 A;  2Z2N A;  4A09 A;  3OKY B;  5EAM A;  2B4E A;  5EMK B;  1JJU B;  3OW8 A;  5FQD A;  4CY2 A;  2B5L A;  2HKM A;  3SLE D;  1GXR A;  2PBI B;  4EWR A;  4A08 B;  2AH0 A;  4GGA A;  5TEE A;  5A2Q g;  4BUJ C;  2CNX A;  2MTA H;  4CY5 A;  4XYH A;  5GSA A;  1OMW B;  5C9Z B;  4U7A A;  4GGC A;  2AGY A;  2H6Q A;  2XYI A;  1OLZ A;  3EMH A;  5IJ8 E;  2H13 A;  3PVW B;  4I6J B;  2P1N B;  2HKR A;  1NR0 A;  4A0A B;  3PSC B;  4QQE A;  1LDK E;  1R5M A;  4A08 A;  4A0B B;  4L3G D;  2UZY B;  3GRE A;  4IA9 A;  2EBS A;  4BH6 A;  4A2L A;  3SWS D;  4BL0 A;  2UZX B;  2P9K C;  2YB8 B;  3UR4 A;  2AQ5 A;  3K27 A;  3IJ0 A;  4GM9 A;  1SQJ A;  3AH8 B;  3UKR C;  2J57 G;  4NSX A;  2P1P B;  5HE3 B;  3GFC A;  3AL8 A;  2B5N A;  4FA1 D;  4JSX C;  3KRX B;  2AH1 A;  1U4C A;  3CFS B;  3V7D B;  3ORV D;  2OK4 A;  5GMK n;  4A0A A;  3VA6 A;  4G56 B;  3PE7 A;  4X3E A;  2IUP A;  4LGN A;  2J55 H;  4J8B A;  5EMM B;  2AGZ A;  2CO0 C;  4K3J B;  2I0R A;  2H6K A;  3I89 A;  1TBG A;  2H3X A;  1PGU A;  4A7J A;  3I7K A;  3UVM A;  4Z8L A;  4ESG A;  5C2V B;  2Z2P A;  3EWE A;  3KRW B;  4O1Q D;  5AFU 3;  1JMZ B;  4CI8 A;  4CZV A;  4GGD A;  3UVO A;  3DSM A;  4L3H D;  5AMS A;  3OL2 A;  5I5M A;  2AGL A;  5IJ7 E;  5FXY A;  1ERJ A;  4CY3 A;  2IUV A;  3V9F A;  5TDH B;  3PSL A;  2P9P C;  3N0D A;  3I7P A;  3F3G A;  1K32 A;  3I7L A;  3FRX A;  1K8K C;  2CE8 A;  4HDJ A;  4O3U B;  3V5W B;  3IIW A;  1SHY B;  2OIZ A;  4CY1 A;  2HJB A;  5EAR A;  3E0C A;  4O45 A;  2HJ4 A;  2GC7 A;  3N0E A;  1N6D A;  4QRJ A;  3SJL D;  4J0W A;  1S4U X;  2GC4 A;  4GQ1 A;  4LG8 A;  2H9L A;  4CI3 A;  3JRP A;  3C99 A;  4A2M A;  4AEZ A;  3F3P A;  4XYI A;  2H14 A;  3MKQ A;  4YVD A;  3AL8 B;  5IT9 g;  4QL1 A;  4ZN4 A;  5GXH A;  3SHF A;  1MDA H;  2P1Q B;  2YMU A;  2XL3 A;  4JD2 C;  4AOW A;  4ZOZ A;  3C6O B;  3SFZ A;  4ES0 A;  1JMX B;  4ZOX A;  3MXX A;  2IWK A;  2IAA A;  3RFH A;  4D0K A;  3C9C A;  2PM9 A;  3RRM C;  5H1M A;  5FKS A;  4J84 A;  3F3F A;  2BBK H;  3I8C A;  5EML B;  3UKU C;  1VYH C;  4GQB B;  2P1M B;  4JSN C;  1A0R B;  4CI1 A;  3DXM C;  4J8G A;  3MMY A; 
#chains in the Genus database with same CATH topology
 5IBK B;  3GC3 B;  2JPN A;  1IH7 A;  5M5U A;  3IUL A;  2H6N A;  3NIG A;  4TZ4 A;  3EU7 A;  5HE1 B;  3MKS B;  3IJ1 A;  3QES A;  3JRO A;  4CZX A;  3A0F A;  1FZI E;  1YR2 A;  4NAA A;  3I8E A;  4GMB A;  1MG2 A;  2H9N A;  3ZDX A;  4X5N A;  1B9X A;  1FYZ E;  3EG6 A;  4DTR A;  2I3S A;  4CC9 A;  1XHM A;  3C75 H;  2P5G A;  4A11 A;  2PM9 B;  4XEI C;  4DTP A;  1Q9Y A;  4A09 B;  2XU7 A;  4DNW A;  4NBM A;  2IUR A;  4FA9 D;  4FAV D;  2OVR B;  3BG1 A;  4DTX A;  3S9H A;  2I0T A;  1FZ8 E;  3DM0 A;  1XMH E;  4M3T A;  1UOO A;  2QXV A;  3RLM D;  2H9P A;  2EIC A;  1C9I A;  5FFG A;  4J82 A;  1P22 A;  3QEX A;  3O4G A;  1L0Q A;  3QNO A;  2W18 A;  3PXS D;  4IMM A;  5THA A;  2AGX A;  2PM7 B;  4PSW B;  5HE0 B;  4KFM B;  4L1M A;  4KHW A;  5FKR A;  4J86 A;  5M5S A;  2P9N C;  2I3T A;  3CFV A;  2PFT A;  1GOH A;  1GOT B;  2JH8 A;  4PBY A;  4BP9 A;  1N1C A;  3QNN A;  3SQ0 A;  4PC0 A;  3CFP A;  3SMR A;  3ULE C;  4FJ7 A;  3JB9 L;  2OJY A;  3MUN A;  3SJJ A;  1UTC A;  5HE2 B;  1U2V C;  3SBR A;  4AN1 A;  4PNK B;  2HES X;  4JS4 A;  3T3M A;  5K19 A;  5C86 A;  2XE4 A;  4DTJ A;  3JZG A;  4AMZ A;  3TAG A;  3NVQ A;  2CN3 A;  1VE7 A;  4M3R A;  3NID A;  1H2W A;  1E8M A;  4X5M A;  1GOG A;  2PFV A;  4FWW A;  4H5I A;  1QFS A;  1FZ3 E;  3NHG A;  3EI3 B;  3FGB A;  1WAJ A;  4FJK A;  1NEX B;  3OL2 B;  5I5J A;  5TEF A;  4DU1 A;  3SUQ A;  4JS5 A;  3PVU B;  3ZWL B;  3VI4 A;  1N6F A;  3C6P B;  3GD1 I;  4O9D A;  5IGO A;  1N6E A;  1O6G A;  5E6R A;  5FFO A;  5C2W B;  3LDB A;  3QET A;  3RMA A;  3K6S A;  4E5Z A;  2RCU A;  3AL9 A;  4NEN A;  5HQG A;  3EI3 A;  5K1C C;  4I9Q A;  3PXW D;  4E5Z B;  3OGM B;  2H47 A;  4FK4 A;  4L1Q D;  4J77 A;  3NDK A;  3EI1 A;  4NC4 A;  4QND A;  2PM6 B;  3O4J A;  3L4M D;  4FA4 D;  2YB5 A;  1XKS A;  4FJ9 A;  2IUQ A;  5TF2 A;  2JH9 A;  1M1X A;  1Q47 A;  3TAE A;  4AKI A;  3CIK B;  3IJC A;  4A0B A;  3ODT A;  4Y5R D;  3EQ9 A;  4PSX B;  2LF3 A;  2B5M A;  4GM8 A;  1JOF A;  3C5M A;  4FHL A;  1RI6 A;  5EM2 B;  3P4F A;  2I0S A;  4M3X A;  2H68 A;  3OGK B;  4U1E I;  1TYQ C;  1FZ2 E;  5H37 A;  4M3Z A;  3RMB A;  2VDQ A;  2G99 A;  3SQ4 A;  4J0X A;  1MG3 A;  4JHP C;  3UVN A;  3N1B A;  3OGL B;  4JXM A;  4Z7Q A;  2P9L C;  1XL3 C;  2HXC A;  3OKT A;  3SBP A;  4JSP C;  5CXC A;  5FKQ A;  1XIP A;  3SXT D;  1PI6 A;  4EPH A;  4PBZ A;  4EYW A;  3EI2 A;  3SNN A;  1GP2 B;  4QT8 A;  4X61 B;  5EAL A;  3JAM g;  2CO0 A;  3KD5 E;  3BG0 A;  3T3P A;  4UI9 R;  4H5J A;  3SCY A;  5FLX g;  3W15 A;  3QI0 A;  5CXC B;  1JW2 A;  3ZDY A;  3TJY A;  4KHS A;  3SQ1 A;  1QFM A;  5H17 A;  4DU3 A;  1FS1 A;  1H2X A;  3RMZ D;  4QNC A;  4KHY A;  3IUM A;  2OVP B;  4KHN A;  1XMF E;  4J2D A;  2DTU A;  3VGZ A;  3C6N B;  3BWS A;  4J79 A;  2P9U C;  4WK0 A;  3RFG A;  1YFQ A;  4J81 A;  2HYE A;  3RMD A;  4IRZ A;  3UVL A;  2JHP A;  5C92 A;  4E3S A;  2YNP A;  3CQ8 A;  3AFC A;  5FA5 B;  3JZH A;  3RN1 D;  4CZY A;  5SXM A;  4G1M A;  2G9A A;  1FZ1 E;  1GG2 B;  5E6U A;  2CE9 A;  3NGI A;  3J81 g;  4AMY A;  3SBQ A;  4FAN D;  3HFQ A;  1XU5 E;  1XVF E;  3EQ7 A;  3PXT D;  5M5V A;  3CFR A;  3I2N A;  1FZ5 E;  4Y7R A;  3NVN A;  3WSO A;  1MMO G;  3K72 A;  4D6V A;  2H9M A;  4J87 A;  3J2P A;  1WAF A;  4ERZ A;  3I7O A;  4FJI A;  5IC7 A;  3L4O D;  4PXW A;  4JT5 C;  3IKO A;  4OZU A;  3EQ8 A;  3IIY A;  3DWL C;  4GM3 A;  2BKL A;  4R7A B;  2P1O B;  1FXX A;  4I9L A;  5KDO B;  3OKW A;  1PEV A;  2O9K A;  5JWZ A;  2OK6 A;  3MZK A;  2HD0 A;  2VDK A;  5CXB A;  5CYK B;  4M41 A;  3RN0 D;  3ZDZ A;  3VH0 A;  4LG9 A;  2BCJ B;  3BVO A;  3UVK A;  2E31 A;  1FZ0 E;  4E54 B;  4ZOV A;  3QEV A;  4JSV C;  5H14 A;  3FM0 A;  4JT6 C;  2GNQ A;  2OVQ B;  2YNN A;  3SN6 B;  5CYK A;  4ERY A;  4GQ2 P;  3TAF A;  4MK0 B;  2EIE A;  4E54 A;  4ADO A;  3O4I A;  3DXK C;  3EI1 B;  2P9S C;  3EI2 B;  2OZM A;  5EMJ B;  1PBY B;  2XL2 A;  3C95 A;  4GAM C;  3K26 A;  4O3T B;  3JPX A;  4M42 A;  4K3I D;  1TYE A;  5HYN B;  1U8C A;  3EI4 A;  1XVE E;  3VI3 A;  3L8B A;  3I7H A;  2Z2O A;  3U4Y A;  3NVX A;  4FJL A;  5I5I A;  3ZE1 A;  5EAP A;  4N14 A;  3IUJ A;  4X63 B;  2B1E A;  2P9I C;  3JZN A;  5FKT A;  3SVW D;  3RWU A;  4EP9 A;  3HGL A;  3SVI A;  4JRQ A;  1B9Y A;  3J80 g;  4M3W A;  2QZP A;  4A11 B;  4L9O A;  2Q7Q A;  4DNU A;  2TRC B;  4J2B A;  4I79 A;  1VZ2 A;  5CXB B;  5IGQ A;  1FZ4 E;  1MHY G;  1SQ9 A;  1QNI A;  4J78 A;  3RSE C;  4M3Y A;  4FB1 D;  4ZOY A;  4FJM A;  4GZ8 A;  3L0M A;  2VZ1 A;  5B4W A;  4FA5 D;  4DNV A;  1XVD E;  4OWR A;  2J56 H;  1XMG E;  1E8N A;  3L2O B;  3K71 A;  3OTT A;  4ERQ A;  1FWX A;  2AGW A;  3MZL A;  4J73 A;  1O6F A;  4AKG A;  5AJA A;  4X60 B;  4AKH A;  5GXI A;  3ZE2 A;  4MMZ A;  4BCC A;  4RNG A;  1Q9X A;  3IUQ A;  3OKY A;  3I7N A;  4CI2 A;  2CN2 A;  2IWF A;  2YNO A;  3EI4 B;  3B7F A;  4G1E A;  4B08 A;  2YBA A;  2E32 A;  2QC5 A;  3FCS A;  4ADN A;  1K3I A;  5EM2 A;  2Z2N A;  1VE6 A;  4FVM A;  4O2W A;  3SPZ A;  4AN0 A;  2VDM A;  4A09 A;  3OKY B;  5EAM A;  2B4E A;  5EMK B;  3QEW A;  4RL5 A;  3TL8 B;  1JJU B;  3OW8 A;  5FQD A;  4CY2 A;  1T2X A;  2B5L A;  2HKM A;  4RE6 A;  3SLE D;  1GXR A;  3LZI A;  2PBI B;  3E4Y A;  3V4P A;  4EWR A;  4A08 B;  2AH0 A;  4JHN A;  4GGA A;  2VC2 A;  5HDB A;  5TEE A;  5A2Q g;  2HU7 A;  4BUJ C;  2VDN A;  2CNX A;  2MTA H;  2DY4 A;  4XYH A;  4BCD A;  4CY5 A;  4WK2 A;  5GSA A;  2RKH A;  1MTY G;  1OMW B;  5C9Z B;  4U7A A;  4M3U A;  1VZ3 A;  2EIB A;  2OZS A;  2B8I A;  3L1N A;  4HCC A;  4FJH A;  4MMY A;  3LZJ A;  4GGC A;  4FJJ A;  3QHY B;  2AGY A;  2VDO A;  2P5O A;  3O4H A;  2H6Q A;  2XYI A;  3OF7 A;  2FW3 A;  1OLZ A;  2QR5 A;  3EMH A;  5IJ8 E;  2H13 A;  3HP9 A;  3PVW B;  3RMC A;  1FZ7 E;  4I6J B;  2P1N B;  2HKR A;  1NR0 A;  4G55 A;  4A0A B;  3PSC B;  2ATQ A;  1LDK E;  4ICG C;  3E4W A;  4QQE A;  4J2A A;  3IVM A;  3K2O A;  3KCI A;  3SPY A;  1R5M A;  4A08 A;  4A0B B;  4L3G D;  2UZY B;  2VZ3 A;  3GRE A;  4IA9 A;  3NAE A;  2EBS A;  4BH6 A;  4Z7O A;  4A2L A;  3SWS D;  4BL0 A;  2UZX B;  2P9K C;  4QAM A;  2YB8 B;  3UR4 A;  2AQ5 A;  3MVD K;  3K27 A;  3SI6 A;  2HU8 A;  1XVG E;  1E5T A;  3IJ0 A;  4GM9 A;  2LF6 A;  1SQJ A;  3AH8 B;  5IZ7 A;  4DTU A;  3UKR C;  2J57 G;  4NSX A;  2P1P B;  4KI4 A;  4KHU A;  5HE3 B;  1FZ6 E;  3GFC A;  2WQ8 A;  3AL8 A;  2B5N A;  1H2Y A;  4FA1 D;  4JSX C;  2MZW B;  3KRX B;  3LD8 A;  2AH1 A;  3TAB A;  1U4C A;  3V7D B;  3CFS B;  3HL8 A;  3QER A;  4WJK A;  3SQ2 A;  4D9S A;  1UOQ A;  3UIQ A;  3KD1 E;  3ORV D;  2OK4 A;  3MUO A;  5GMK n;  3DDU A;  4A0A A;  4O02 A;  5E6S A;  4G56 B;  5M5R A;  2VIX A;  3PE7 A;  4X3E A;  3VA6 A;  2IUP A;  4LGN A;  2J55 H;  2OYQ A;  2EID A;  4J8B A;  5EMM B;  3ZE0 A;  2AGZ A;  2CO0 C;  4K3J B;  2I0R A;  2H6K A;  3I89 A;  1C9L A;  1TBG A;  2H3X A;  4FJN A;  2JHC A;  1PGU A;  4A7J A;  3I7K A;  3UVM A;  4KI6 A;  4RG8 A;  1CLQ A;  2MW2 A;  3UO3 A;  4Z8L A;  4ESG A;  5C2V B;  2Z2P A;  3EWE A;  3KRW B;  1GOF A;  4UM9 A;  4BCB A;  4O1Q D;  2JKX A;  5AFU 3;  2MMB A;  1JMZ B;  4CI8 A;  3J27 A;  4GGD A;  4CZV A;  3SUO A;  2JHA A;  3UVO A;  3DSM A;  4L3H D;  5AMS A;  3OL2 A;  5I5M A;  3QEI A;  4DTO A;  2AGL A;  5IJ7 E;  5FXY A;  1ERJ A;  4CY3 A;  2IUV A;  3FCU A;  2K5S A;  5TDH B;  3V9F A;  4FJ8 A;  3N1E A;  3PSL A;  2P9P C;  4FK0 A;  2VJ5 A;  3N0D A;  3NIF A;  3I7P A;  3F3G A;  1K32 A;  4DTS A;  3I7L A;  5M61 A;  3C94 A;  1XU3 E;  5M5T A;  3FRX A;  1K8K C;  2XDW A;  2CE8 A;  4HDJ A;  1JV2 A;  5IRE A;  4O3U B;  4RE5 A;  3V5W B;  3SUN A;  3IIW A;  3IUN A;  1SHY B;  2OIZ A;  4CY1 A;  2HJB A;  5EAR A;  4WK4 A;  4E4B A;  3E0C A;  2HJ4 A;  4O45 A;  2GC7 A;  3N0E A;  1N6D A;  4QRJ A;  3SJL D;  4J0W A;  1S4U X;  4FK2 A;  2GC4 A;  4GQ1 A;  4LG8 A;  3IUR A;  2H9L A;  1I2M B;  3SUP A;  2DEB A;  3JRP A;  4CI3 A;  4UM8 A;  3C99 A;  4A2M A;  1FPO A;  1L5G A;  4AEZ A;  4Z7N A;  4M45 A;  3NCI A;  3F3P A;  4XYI A;  2FYO A;  1XVC E;  2H14 A;  3MKQ A;  4YVD A;  1JTD B;  3AL8 B;  4MMX A;  5IT9 g;  4QL1 A;  4ZN4 A;  5GXH A;  4AI6 A;  4HCB A;  3SHF A;  1MDA H;  2H4T A;  2P1Q B;  2QXF A;  2YMU A;  2XL3 A;  4JD2 C;  4AOW A;  4FJG A;  1A12 A;  4ZOZ A;  1UOP A;  2VDL A;  3C6O B;  2B7M A;  4KHQ A;  4BP8 A;  3SFZ A;  4IT5 A;  4ES0 A;  2VDP A;  3NE6 A;  3LDS A;  1JMX B;  4ZOX A;  3MXX A;  2IWK A;  2IAA A;  1XVB E;  3RFH A;  3V4V A;  4D0K A;  1FZ9 E;  3SCX A;  3C9C A;  2PM9 A;  1MHZ G;  3RRM C;  4DTM A;  1FZH E;  5H1M A;  5FKS A;  1H2Z A;  2JQT A;  4J84 A;  3HGK E;  3QEP A;  3F3F A;  4FJ5 A;  4JRP A;  3UO2 A;  2BBK H;  3I8C A;  4DTN A;  3IJE A;  2XZG A;  4AX4 A;  5EML B;  3UKU C;  1VYH C;  4GQB B;  2P1M B;  2HU5 A;  4JSN C;  4J2E A;  1A0R B;  1BPO A;  2VJ4 A;  4FJX A;  2VDR A;  4CI1 A;  3CFO A;  3DXM C;  1IG9 A;  4DU4 A;  4J8G A;  3MMY A; 
#chains in the Genus database with same CATH homology
 5IBK B;  2JPN A;  1IH7 A;  2H6N A;  4TZ4 A;  3EU7 A;  5HE1 B;  3MKS B;  3IJ1 A;  3QES A;  3JRO A;  4CZX A;  3A0F A;  1FZI E;  3I8E A;  4GMB A;  1MG2 A;  2H9N A;  4X5N A;  1B9X A;  1FYZ E;  3EG6 A;  4DTR A;  2I3S A;  4CC9 A;  1XHM A;  3C75 H;  2P5G A;  4A11 A;  2PM9 B;  4XEI C;  4DTP A;  1Q9Y A;  4A09 B;  2XU7 A;  4FA9 D;  2IUR A;  4FAV D;  2OVR B;  3BG1 A;  4DTX A;  3S9H A;  2I0T A;  1FZ8 E;  3DM0 A;  1XMH E;  4M3T A;  2QXV A;  3RLM D;  2H9P A;  4J82 A;  1P22 A;  3QEX A;  3PXS D;  1L0Q A;  3QNO A;  2W18 A;  4IMM A;  5THA A;  2AGX A;  2PM7 B;  4PSW B;  5HE0 B;  4KFM B;  4KHW A;  5FKR A;  4J86 A;  2P9N C;  2I3T A;  3CFV A;  2PFT A;  1GOT B;  2JH8 A;  4PBY A;  3QNN A;  3SQ0 A;  4PC0 A;  3CFP A;  3SMR A;  3ULE C;  4FJ7 A;  3JB9 L;  2OJY A;  3SJJ A;  5HE2 B;  3SBR A;  1U2V C;  5K19 A;  3VH0 A;  4PNK B;  2HES X;  4JS4 A;  4DTJ A;  3JZG A;  3TAG A;  3NVQ A;  2CN3 A;  4M3R A;  4X5M A;  2PFV A;  4FWW A;  4H5I A;  1FZ3 E;  3NHG A;  3EI3 B;  3FGB A;  1WAJ A;  4FJK A;  1NEX B;  3OL2 B;  5I5J A;  5TEF A;  4DU1 A;  3SUQ A;  4JS5 A;  3PVU B;  3ZWL B;  1N6F A;  3C6P B;  4O9D A;  5IGO A;  1N6E A;  5C2W B;  3LDB A;  3QET A;  3RMA A;  4E5Z A;  2RCU A;  3AL9 A;  5HQG A;  3EI3 A;  5K1C C;  4I9Q A;  3PXW D;  4E5Z B;  3OGM B;  2H47 A;  4FK4 A;  4L1Q D;  4J77 A;  3NDK A;  3EI1 A;  4QND A;  2PM6 B;  4FA4 D;  3L4M D;  2YB5 A;  1XKS A;  4FJ9 A;  2IUQ A;  5TF2 A;  2JH9 A;  1Q47 A;  3TAE A;  4AKI A;  3CIK B;  3IJC A;  4A0B A;  3ODT A;  4Y5R D;  4PSX B;  2LF3 A;  2B5M A;  4GM8 A;  1JOF A;  3C5M A;  4FHL A;  1RI6 A;  5EM2 B;  3P4F A;  2I0S A;  4M3X A;  2H68 A;  3OGK B;  4U1E I;  1TYQ C;  1FZ2 E;  5H37 A;  4M3Z A;  3RMB A;  2G99 A;  3SQ4 A;  4J0X A;  1MG3 A;  3UVN A;  3N1B A;  3OGL B;  4JXM A;  2P9L C;  1XL3 C;  2HXC A;  3OKT A;  3SBP A;  4JSP C;  5CXC A;  5FKQ A;  1XIP A;  3SXT D;  1PI6 A;  4EPH A;  4PBZ A;  4EYW A;  3EI2 A;  3SNN A;  1GP2 B;  4QT8 A;  4X61 B;  5EAL A;  3JAM g;  2CO0 A;  3KD5 E;  3BG0 A;  4UI9 R;  4H5J A;  3SCY A;  5FLX g;  3W15 A;  5CXC B;  3TJY A;  4KHS A;  3SQ1 A;  5H17 A;  4DU3 A;  1FS1 A;  3RMZ D;  4QNC A;  4KHY A;  2OVP B;  4KHN A;  1XMF E;  4J2D A;  2DTU A;  3VGZ A;  3C6N B;  3BWS A;  4J79 A;  2P9U C;  3RFG A;  1YFQ A;  4J81 A;  2HYE A;  3RMD A;  3UVL A;  2JHP A;  4E3S A;  2YNP A;  3CQ8 A;  3AFC A;  5FA5 B;  3JZH A;  3RN1 D;  4CZY A;  5SXM A;  2G9A A;  1FZ1 E;  1GG2 B;  2CE9 A;  3NGI A;  3J81 g;  3SBQ A;  4FAN D;  3HFQ A;  1XU5 E;  1XVF E;  3PXT D;  3CFR A;  3I2N A;  1FZ5 E;  4Y7R A;  3NVN A;  3WSO A;  1MMO G;  4D6V A;  2H9M A;  4J87 A;  3J2P A;  1WAF A;  4ERZ A;  3I7O A;  4FJI A;  5IC7 A;  3L4O D;  4PXW A;  4JT5 C;  3IKO A;  4OZU A;  3IIY A;  3DWL C;  4GM3 A;  4R7A B;  2P1O B;  1FXX A;  4I9L A;  5KDO B;  3OKW A;  1PEV A;  2O9K A;  5JWZ A;  2OK6 A;  3MZK A;  2HD0 A;  5CYK B;  5CXB A;  4M41 A;  3RN0 D;  4LG9 A;  2BCJ B;  3UVK A;  2E31 A;  1FZ0 E;  4E54 B;  4ZOV A;  3QEV A;  4JSV C;  5H14 A;  3FM0 A;  4JT6 C;  2GNQ A;  2OVQ B;  2YNN A;  3SN6 B;  5CYK A;  4ERY A;  4GQ2 P;  3TAF A;  4MK0 B;  4E54 A;  4ADO A;  3DXK C;  3EI1 B;  2P9S C;  3EI2 B;  2OZM A;  5EMJ B;  1PBY B;  2XL2 A;  3C95 A;  4GAM C;  3K26 A;  4O3T B;  3JPX A;  4M42 A;  4K3I D;  5HYN B;  3EI4 A;  1XVE E;  3L8B A;  3I7H A;  2Z2O A;  3U4Y A;  3NVX A;  4FJL A;  5I5I A;  5EAP A;  4N14 A;  4X63 B;  2B1E A;  2P9I C;  3JZN A;  5FKT A;  3SVW D;  3RWU A;  4EP9 A;  3HGL A;  3SVI A;  4JRQ A;  1B9Y A;  3J80 g;  4M3W A;  4A11 B;  4L9O A;  2Q7Q A;  2TRC B;  4J2B A;  4I79 A;  5CXB B;  5IGQ A;  1FZ4 E;  1MHY G;  1SQ9 A;  1QNI A;  4J78 A;  3RSE C;  4M3Y A;  4FB1 D;  4ZOY A;  4FJM A;  4GZ8 A;  3L0M A;  4FA5 D;  5B4W A;  1XVD E;  4OWR A;  2J56 H;  1XMG E;  3L2O B;  3OTT A;  4ERQ A;  1FWX A;  2AGW A;  3MZL A;  4J73 A;  4AKG A;  5AJA A;  4X60 B;  4AKH A;  5GXI A;  4RNG A;  1Q9X A;  3OKY A;  3I7N A;  4CI2 A;  2CN2 A;  2IWF A;  2YNO A;  3EI4 B;  3B7F A;  4B08 A;  2YBA A;  2E32 A;  2QC5 A;  4ADN A;  5EM2 A;  2Z2N A;  4FVM A;  3SPZ A;  4A09 A;  3OKY B;  5EAM A;  2B4E A;  5EMK B;  3QEW A;  4RL5 A;  3TL8 B;  1JJU B;  3OW8 A;  5FQD A;  4CY2 A;  2B5L A;  2HKM A;  3SLE D;  1GXR A;  3LZI A;  2PBI B;  3E4Y A;  4EWR A;  4A08 B;  2AH0 A;  4GGA A;  5TEE A;  5A2Q g;  4BUJ C;  2CNX A;  2MTA H;  2DY4 A;  4XYH A;  4CY5 A;  5GSA A;  1MTY G;  1OMW B;  5C9Z B;  4U7A A;  4M3U A;  2OZS A;  2B8I A;  3L1N A;  4HCC A;  4FJH A;  3LZJ A;  4GGC A;  4FJJ A;  2AGY A;  2P5O A;  2H6Q A;  2XYI A;  2FW3 A;  1OLZ A;  3EMH A;  5IJ8 E;  2H13 A;  3HP9 A;  3PVW B;  3RMC A;  1FZ7 E;  4I6J B;  2P1N B;  2HKR A;  1NR0 A;  4A0A B;  3PSC B;  2ATQ A;  1LDK E;  4QQE A;  3E4W A;  4J2A A;  3K2O A;  3SPY A;  1R5M A;  4A08 A;  4A0B B;  4L3G D;  2UZY B;  3GRE A;  4IA9 A;  3NAE A;  2EBS A;  4BH6 A;  4A2L A;  3SWS D;  4BL0 A;  2UZX B;  2P9K C;  2YB8 B;  3UR4 A;  2AQ5 A;  3K27 A;  3SI6 A;  1XVG E;  3IJ0 A;  4GM9 A;  2LF6 A;  1SQJ A;  3AH8 B;  5IZ7 A;  4DTU A;  3UKR C;  2J57 G;  4NSX A;  2P1P B;  4KI4 A;  4KHU A;  5HE3 B;  1FZ6 E;  3GFC A;  3AL8 A;  2B5N A;  4FA1 D;  4JSX C;  2MZW B;  3KRX B;  3LD8 A;  2AH1 A;  3TAB A;  1U4C A;  3V7D B;  3CFS B;  3HL8 A;  3QER A;  3SQ2 A;  3UIQ A;  3KD1 E;  3ORV D;  2OK4 A;  5GMK n;  4A0A A;  3VA6 A;  4G56 B;  2VIX A;  3PE7 A;  4X3E A;  2IUP A;  4LGN A;  2J55 H;  2OYQ A;  4J8B A;  5EMM B;  2AGZ A;  2CO0 C;  4K3J B;  2I0R A;  2H6K A;  3I89 A;  1TBG A;  2H3X A;  4FJN A;  2JHC A;  1PGU A;  4A7J A;  3I7K A;  3UVM A;  4KI6 A;  4RG8 A;  1CLQ A;  4Z8L A;  4ESG A;  5C2V B;  2Z2P A;  3EWE A;  3KRW B;  4O1Q D;  5AFU 3;  2MMB A;  1JMZ B;  4CI8 A;  3J27 A;  4GGD A;  4CZV A;  3SUO A;  2JHA A;  3UVO A;  3DSM A;  4L3H D;  5AMS A;  3OL2 A;  5I5M A;  3QEI A;  4DTO A;  2AGL A;  5IJ7 E;  5FXY A;  1ERJ A;  4CY3 A;  2IUV A;  3V9F A;  5TDH B;  4FJ8 A;  3N1E A;  3PSL A;  2P9P C;  4FK0 A;  2VJ5 A;  3N0D A;  3I7P A;  3F3G A;  1K32 A;  4DTS A;  3I7L A;  3C94 A;  1XU3 E;  3FRX A;  1K8K C;  2CE8 A;  4HDJ A;  5IRE A;  4O3U B;  3V5W B;  3SUN A;  3IIW A;  1SHY B;  2OIZ A;  4CY1 A;  2HJB A;  5EAR A;  4E4B A;  3E0C A;  2HJ4 A;  4O45 A;  2GC7 A;  3N0E A;  1N6D A;  4QRJ A;  3SJL D;  4J0W A;  1S4U X;  4FK2 A;  2GC4 A;  4GQ1 A;  4LG8 A;  2H9L A;  3SUP A;  2DEB A;  3JRP A;  4CI3 A;  3C99 A;  4A2M A;  4AEZ A;  4M45 A;  3NCI A;  3F3P A;  4XYI A;  2FYO A;  1XVC E;  2H14 A;  3MKQ A;  4YVD A;  3AL8 B;  5IT9 g;  4QL1 A;  4ZN4 A;  5GXH A;  4AI6 A;  4HCB A;  3SHF A;  1MDA H;  2H4T A;  2P1Q B;  2QXF A;  2YMU A;  2XL3 A;  4JD2 C;  4AOW A;  4FJG A;  4ZOZ A;  3C6O B;  2B7M A;  4KHQ A;  3SFZ A;  4ES0 A;  3NE6 A;  3LDS A;  1JMX B;  4ZOX A;  3MXX A;  2IWK A;  2IAA A;  1XVB E;  3RFH A;  4D0K A;  1FZ9 E;  3SCX A;  3C9C A;  2PM9 A;  1MHZ G;  3RRM C;  4DTM A;  1FZH E;  5H1M A;  5FKS A;  4J84 A;  3HGK E;  3QEP A;  3F3F A;  4FJ5 A;  4JRP A;  2BBK H;  3I8C A;  4DTN A;  5EML B;  3UKU C;  1VYH C;  4GQB B;  2P1M B;  4JSN C;  4J2E A;  1A0R B;  2VJ4 A;  4FJX A;  4CI1 A;  3CFO A;  3DXM C;  1IG9 A;  4DU4 A;  4J8G A;  3MMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...