5IBKB

Skp1-f-box in complex with a ubiquitin variant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
QRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inhibition of SCF ubiquitin ligases by engineered ubiquitin variants that target the Cul1 binding site on the Skp1-F-box interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords S-phase kinase-associated protein 1,S-phase kinase-associate
total genus 15
structure length 46
sequence length 46
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 5ibkB00
2P1OB 3L2OB 2E31A 3OGLB 1FS1A 3V7DB 3MKSB 1NEXB 2OVPB 2P1PB 3OGKB 2P1NB 2OVQB 5IBKB 1LDKE 2P1QB 3C6NB 3OGMB 2P1MB 3C6PB 2OVRB 3WSOA 2E32A 4I6JB 3C6OB 1P22A
chains in the Genus database with same CATH superfamily
4KHWA 3QEXA 1FZ9E 3S9HA 3HGKE 3E4YA 4E4BA 2JH9A 4JS5A 2JH8A 4DTPA 3QERA 3UO2A 3QEIA 1XU3E 1XU5E 3OGLB 3SQ1A 4M3UA 4M3YA 2RKHA 4DTNA 2P5OA 3CFRA 4JRPA 4M42A 4I9LA 1JW2A 4HCCA 1CLQA 4ADOA 4J2AA 4JS4A 4DU4A 4FJ9A 3QNOA 3MKSB 2P1PB 4DTSA 2P1NB 2VIXA 4FJXA 3CQ8A 4DTJA 2P1QB 4M41A 1XVEE 1FZ5E 3NCIA 3SQ0A 2LF6A 3QEWA 4X5MA 3LD8A 4HCBA 1FZ4E 3C6NB 1FZ8E 4M3ZA 1XMFE 3RWUA 3E4WA 3C6PB 3QEVA 3WSOA 3RMCA 2OZMA 3BVOA 2VJ5A 4EYWA 4JRQA 3NDKA 4AI6A 4M3TA 1FZ0E 3L0MA 3SUNA 3SJJA 2YB5A 4DTMA 2MZWB 3HGLA 3L2OB 4RL5A 2E31A 2PFVA 2B7MA 1MTYG 2JPNA 3HP9A 4M3RA 4J2BA 1FZ7E 1MMOG 3V7DB 3QETA 1XVBE 3SPZA 1FZ1E 3HL8A 4EP9A 2P5GA 3N1EA 3NGIA 4FJIA 1NEXB 2DY4A 2OVQB 1IG9A 3QESA 1LDKE 3K2OA 4B08A 1XMHE 3KD5E 2VJ4A 3TAGA 2QXFA 4FJMA 2JHCA 2K5SA 2OVRB 4AKIA 1XMGE 2FYOA 4I6JB 4FJ7A 3TL8B 4FJLA 3C6OB 1P22A 3SUOA 3TJYA 3CFOA 3LDBA 2P1OB 3LZIA 3LZJA 4DTUA 3NE6A 4QNDA 2MW2A 3QNNA 4KHUA 4ICGC 4AKGA 5IREA 4RNGA 2DTUA 4FJKA 2JHPA 3L1NA 1FS1A 4KI6A 2FW3A 1FZ2E 4KHSA 1Q9YA 4FJ8A 1MHYG 3J2PA 3TAFA 4IT5A 2H4TA 4KHYA 4DU1A 2B1EA 3UO3A 4KHNA 4GAMC 4KI4A 4DTOA 3SVIA 4FVMA 3SUQA 1FZHE 3SUPA 3SCXA 4DTXA 2OYQA 2OZSA 4J2DA 3OGMB 4DU3A 3C95A 4M3WA 2P1MB 3CFPA 1Q9XA 1N1CA 3SNNA 3RMBA 1FYZE 1FXXA 2JHAA 1XVGE 1XVFE 2MMBA 3TAEA 2HD0A 4M3XA 4FK2A 4AKHA 3SQ2A 5IZ7A 1FPOA 4RG8A 1WAFA 3J27A 3LDSA 3TABA 1FZ6E 4E3SA 3KD1E 4J2EA 3N1BA 3SPYA 4FJHA 4FJ5A 3NHGA 4I9QA 3L8BA 3RMDA 4QNCA 1FZIE 2DEBA 2OVPB 5IBKB 3NAEA 3OGKB 2LF3A 4X5NA 2ATQA 4EPHA 1MHZG 1XL3C 4FK0A 3QEPA 4KHQA 4DTRA 4FJGA 3SI6A 1IH7A 3UIQA 1FZ3E 5H37A 2B8IA 4ADNA 1XVCE 1XVDE 2JQTA 4FJJA 2E32A 4FJNA 2PFTA 3SQ4A 3RMAA 4FK4A 1WAJA 4M45A 2RCUA 3C94A
chains in the Genus database with same CATH topology
4KHWA 3QEXA 1FZ9E 3S9HA 3HGKE 3E4YA 4E4BA 2JH9A 4JS5A 2JH8A 4DTPA 3QERA 4M3UA 3QEIA 1XU3E 1XU5E 3OGLB 3SQ1A 4M3YA 4DTNA 2P5OA 3CFRA 4JRPA 4M42A 4I9LA 4HCCA 1CLQA 4ADOA 4J2AA 4JS4A 4DU4A 4FJ9A 3QNOA 3MKSB 2P1PB 4DTSA 2P1NB 2VIXA 4FJXA 3CQ8A 4DTJA 2P1QB 4M41A 1XVEE 1FZ5E 3NCIA 3SQ0A 2LF6A 3QEWA 4X5MA 3LD8A 4HCBA 1FZ4E 3C6NB 1FZ8E 4M3ZA 1XMFE 3RWUA 3E4WA 3C6PB 3QEVA 3WSOA 3RMCA 2OZMA 2VJ5A 4EYWA 4JRQA 3NDKA 4AI6A 4M3TA 1FZ0E 3L0MA 3SUNA 3SJJA 2YB5A 4DTMA 2MZWB 3HGLA 3L2OB 4RL5A 2E31A 2PFVA 2B7MA 1MTYG 2JPNA 3HP9A 4M3RA 4J2BA 1FZ7E 1MMOG 3V7DB 3QETA 1XVBE 3SPZA 1FZ1E 3HL8A 4EP9A 2P5GA 3N1EA 3NGIA 4FJIA 1NEXB 2DY4A 2OVQB 1IG9A 3QESA 1LDKE 3K2OA 4B08A 1XMHE 3KD5E 2VJ4A 3TAGA 2QXFA 4FJMA 2JHCA 2OVRB 4AKIA 1XMGE 2FYOA 4I6JB 4FJ7A 3TL8B 4FJLA 3C6OB 1P22A 3SUOA 3TJYA 3CFOA 3LDBA 2P1OB 3LZIA 3LZJA 4DTUA 3NE6A 4QNDA 3QNNA 4KHUA 4AKGA 5IREA 4RNGA 2DTUA 4FJKA 2JHPA 3L1NA 1FS1A 4KI6A 2FW3A 1FZ2E 4KHSA 1Q9YA 4FJ8A 1MHYG 3J2PA 3TAFA 4KHYA 2H4TA 4DU1A 2B1EA 4KHNA 4KI4A 4GAMC 4DTOA 3SVIA 4FVMA 3SUQA 1FZHE 3SUPA 3SCXA 4DTXA 2OYQA 2OZSA 4J2DA 3OGMB 4DU3A 3C95A 4M3WA 2P1MB 3CFPA 1Q9XA 3SNNA 3RMBA 1FYZE 1FXXA 2JHAA 1XVGE 1XVFE 2MMBA 3TAEA 2HD0A 4M3XA 4FK2A 4AKHA 3SQ2A 5IZ7A 4RG8A 1WAFA 3J27A 3LDSA 3TABA 1FZ6E 4E3SA 3KD1E 4J2EA 3N1BA 3SPYA 4FJHA 4FJ5A 3NHGA 4I9QA 3L8BA 3RMDA 4QNCA 1FZIE 2DEBA 2OVPB 5IBKB 3NAEA 3OGKB 2LF3A 4X5NA 2ATQA 4EPHA 1MHZG 1XL3C 4FK0A 3QEPA 4KHQA 4DTRA 4FJGA 3SI6A 1IH7A 3UIQA 1FZ3E 5H37A 2B8IA 4ADNA 1XVCE 1XVDE 4FJJA 2E32A 4FJNA 2PFTA 3SQ4A 3RMAA 4FK4A 1WAJA 4M45A 2RCUA 3C94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1O B;  3L2O B;  2E31 A;  3OGL B;  1FS1 A;  3V7D B;  3MKS B;  1NEX B;  2OVP B;  2P1P B;  3OGK B;  2P1N B;  2OVQ B;  5IBK B;  1LDK E;  2P1Q B;  3C6N B;  3OGM B;  2P1M B;  3C6P B;  2OVR B;  3WSO A;  2E32 A;  4I6J B;  3C6O B;  1P22 A; 
#chains in the Genus database with same CATH topology
 4KHW A;  3QEX A;  1FZ9 E;  3S9H A;  3HGK E;  3E4Y A;  4E4B A;  2JH9 A;  4JS5 A;  2JH8 A;  4DTP A;  3QER A;  3UO2 A;  3QEI A;  1XU3 E;  1XU5 E;  3OGL B;  3SQ1 A;  4M3U A;  4M3Y A;  2RKH A;  4DTN A;  2P5O A;  3CFR A;  4JRP A;  4M42 A;  4I9L A;  1JW2 A;  4HCC A;  1CLQ A;  4ADO A;  4J2A A;  4JS4 A;  4DU4 A;  4FJ9 A;  3QNO A;  3MKS B;  2P1P B;  4DTS A;  2P1N B;  2VIX A;  4FJX A;  3CQ8 A;  4DTJ A;  2P1Q B;  4M41 A;  1XVE E;  1FZ5 E;  3NCI A;  3SQ0 A;  2LF6 A;  3QEW A;  4X5M A;  3LD8 A;  4HCB A;  1FZ4 E;  3C6N B;  1FZ8 E;  4M3Z A;  1XMF E;  3RWU A;  3E4W A;  3C6P B;  3QEV A;  3WSO A;  3RMC A;  2OZM A;  3BVO A;  2VJ5 A;  4EYW A;  4JRQ A;  3NDK A;  4AI6 A;  4M3T A;  1FZ0 E;  3L0M A;  3SUN A;  3SJJ A;  2YB5 A;  4DTM A;  2MZW B;  3HGL A;  3L2O B;  4RL5 A;  2E31 A;  2PFV A;  2B7M A;  1MTY G;  2JPN A;  3HP9 A;  4M3R A;  4J2B A;  1FZ7 E;  1MMO G;  3V7D B;  3QET A;  1XVB E;  3SPZ A;  1FZ1 E;  3HL8 A;  4EP9 A;  2P5G A;  3N1E A;  3NGI A;  4FJI A;  1NEX B;  2DY4 A;  2OVQ B;  1IG9 A;  3QES A;  1LDK E;  3K2O A;  4B08 A;  1XMH E;  3KD5 E;  2VJ4 A;  3TAG A;  2QXF A;  4FJM A;  2JHC A;  2K5S A;  2OVR B;  4AKI A;  1XMG E;  2FYO A;  4I6J B;  4FJ7 A;  3TL8 B;  4FJL A;  3C6O B;  1P22 A;  3SUO A;  3TJY A;  3CFO A;  3LDB A;  2P1O B;  3LZI A;  3LZJ A;  4DTU A;  3NE6 A;  4QND A;  2MW2 A;  3QNN A;  4KHU A;  4ICG C;  4AKG A;  5IRE A;  4RNG A;  2DTU A;  4FJK A;  2JHP A;  3L1N A;  1FS1 A;  4KI6 A;  2FW3 A;  1FZ2 E;  4KHS A;  1Q9Y A;  4FJ8 A;  1MHY G;  3J2P A;  3TAF A;  4IT5 A;  2H4T A;  4KHY A;  4DU1 A;  2B1E A;  3UO3 A;  4KHN A;  4GAM C;  4KI4 A;  4DTO A;  3SVI A;  4FVM A;  3SUQ A;  1FZH E;  3SUP A;  3SCX A;  4DTX A;  2OYQ A;  2OZS A;  4J2D A;  3OGM B;  4DU3 A;  3C95 A;  4M3W A;  2P1M B;  3CFP A;  1Q9X A;  1N1C A;  3SNN A;  3RMB A;  1FYZ E;  1FXX A;  2JHA A;  1XVG E;  1XVF E;  2MMB A;  3TAE A;  2HD0 A;  4M3X A;  4FK2 A;  4AKH A;  3SQ2 A;  5IZ7 A;  1FPO A;  4RG8 A;  1WAF A;  3J27 A;  3LDS A;  3TAB A;  1FZ6 E;  4E3S A;  3KD1 E;  4J2E A;  3N1B A;  3SPY A;  4FJH A;  4FJ5 A;  3NHG A;  4I9Q A;  3L8B A;  3RMD A;  4QNC A;  1FZI E;  2DEB A;  2OVP B;  5IBK B;  3NAE A;  3OGK B;  2LF3 A;  4X5N A;  2ATQ A;  4EPH A;  1MHZ G;  1XL3 C;  4FK0 A;  3QEP A;  4KHQ A;  4DTR A;  4FJG A;  3SI6 A;  1IH7 A;  3UIQ A;  1FZ3 E;  5H37 A;  2B8I A;  4ADN A;  1XVC E;  1XVD E;  2JQT A;  4FJJ A;  2E32 A;  4FJN A;  2PFT A;  3SQ4 A;  3RMA A;  4FK4 A;  1WAJ A;  4M45 A;  2RCU A;  3C94 A; 
#chains in the Genus database with same CATH homology
 4KHW A;  3QEX A;  1FZ9 E;  3S9H A;  3HGK E;  3E4Y A;  4E4B A;  2JH9 A;  4JS5 A;  2JH8 A;  4DTP A;  3QER A;  4M3U A;  3QEI A;  1XU3 E;  1XU5 E;  3OGL B;  3SQ1 A;  4M3Y A;  4DTN A;  2P5O A;  3CFR A;  4JRP A;  4M42 A;  4I9L A;  4HCC A;  1CLQ A;  4ADO A;  4J2A A;  4JS4 A;  4DU4 A;  4FJ9 A;  3QNO A;  3MKS B;  2P1P B;  4DTS A;  2P1N B;  2VIX A;  4FJX A;  3CQ8 A;  4DTJ A;  2P1Q B;  4M41 A;  1XVE E;  1FZ5 E;  3NCI A;  3SQ0 A;  2LF6 A;  3QEW A;  4X5M A;  3LD8 A;  4HCB A;  1FZ4 E;  3C6N B;  1FZ8 E;  4M3Z A;  1XMF E;  3RWU A;  3E4W A;  3C6P B;  3QEV A;  3WSO A;  3RMC A;  2OZM A;  2VJ5 A;  4EYW A;  4JRQ A;  3NDK A;  4AI6 A;  4M3T A;  1FZ0 E;  3L0M A;  3SUN A;  3SJJ A;  2YB5 A;  4DTM A;  2MZW B;  3HGL A;  3L2O B;  4RL5 A;  2E31 A;  2PFV A;  2B7M A;  1MTY G;  2JPN A;  3HP9 A;  4M3R A;  4J2B A;  1FZ7 E;  1MMO G;  3V7D B;  3QET A;  1XVB E;  3SPZ A;  1FZ1 E;  3HL8 A;  4EP9 A;  2P5G A;  3N1E A;  3NGI A;  4FJI A;  1NEX B;  2DY4 A;  2OVQ B;  1IG9 A;  3QES A;  1LDK E;  3K2O A;  4B08 A;  1XMH E;  3KD5 E;  2VJ4 A;  3TAG A;  2QXF A;  4FJM A;  2JHC A;  2OVR B;  4AKI A;  1XMG E;  2FYO A;  4I6J B;  4FJ7 A;  3TL8 B;  4FJL A;  3C6O B;  1P22 A;  3SUO A;  3TJY A;  3CFO A;  3LDB A;  2P1O B;  3LZI A;  3LZJ A;  4DTU A;  3NE6 A;  4QND A;  3QNN A;  4KHU A;  4AKG A;  5IRE A;  4RNG A;  2DTU A;  4FJK A;  2JHP A;  3L1N A;  1FS1 A;  4KI6 A;  2FW3 A;  1FZ2 E;  4KHS A;  1Q9Y A;  4FJ8 A;  1MHY G;  3J2P A;  3TAF A;  4KHY A;  2H4T A;  4DU1 A;  2B1E A;  4KHN A;  4KI4 A;  4GAM C;  4DTO A;  3SVI A;  4FVM A;  3SUQ A;  1FZH E;  3SUP A;  3SCX A;  4DTX A;  2OYQ A;  2OZS A;  4J2D A;  3OGM B;  4DU3 A;  3C95 A;  4M3W A;  2P1M B;  3CFP A;  1Q9X A;  3SNN A;  3RMB A;  1FYZ E;  1FXX A;  2JHA A;  1XVG E;  1XVF E;  2MMB A;  3TAE A;  2HD0 A;  4M3X A;  4FK2 A;  4AKH A;  3SQ2 A;  5IZ7 A;  4RG8 A;  1WAF A;  3J27 A;  3LDS A;  3TAB A;  1FZ6 E;  4E3S A;  3KD1 E;  4J2E A;  3N1B A;  3SPY A;  4FJH A;  4FJ5 A;  3NHG A;  4I9Q A;  3L8B A;  3RMD A;  4QNC A;  1FZI E;  2DEB A;  2OVP B;  5IBK B;  3NAE A;  3OGK B;  2LF3 A;  4X5N A;  2ATQ A;  4EPH A;  1MHZ G;  1XL3 C;  4FK0 A;  3QEP A;  4KHQ A;  4DTR A;  4FJG A;  3SI6 A;  1IH7 A;  3UIQ A;  1FZ3 E;  5H37 A;  2B8I A;  4ADN A;  1XVC E;  1XVD E;  4FJJ A;  2E32 A;  4FJN A;  2PFT A;  3SQ4 A;  3RMA A;  4FK4 A;  1WAJ A;  4M45 A;  2RCU A;  3C94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...