5IBKB

Skp1-f-box in complex with a ubiquitin variant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
QRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1,S-phase kinase-associate
publication title Inhibition of SCF ubiquitin ligases by engineered ubiquitin variants that target the Cul1 binding site on the Skp1-F-box interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 46
sequence length 46
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 5ibkB00
3C6PB 2E32A 3WSOA 3OGLB 3MKSB 2OVRB 2P1MB 3OGMB 1FS1A 5IBKB 2P1QB 2E31A 3L2OB 2P1NB 3V7DB 1P22A 2OVQB 2OVPB 2P1PB 3C6OB 1NEXB 3C6NB 4I6JB 3OGKB 2P1OB 1LDKE
chains in the Genus database with same CATH superfamily
2DEBA 1CLQA 2P5OA 4FJJA 4FJNA 1FZ4E 4FK2A 4KHYA 2FYOA 4M3RA 3C6PB 2E32A 4X5MA 3WSOA 1XMHE 3BVOA 4DTRA 3QEIA 4KHWA 3SPZA 3HL8A 4DU3A 3TABA 1XVDE 3SUPA 3L2OB 4KHSA 3SQ4A 3E4WA 3V7DB 1FZ5E 2YB5A 1P22A 2VJ5A 1XMFE 1MTYG 4J2DA 2OVPB 3CFPA 3C6NB 2B7MA 4M45A 3L1NA 2OZSA 4KHNA 3KD1E 3NE6A 4AI6A 3NCIA 3SUQA 2JHPA 1JW2A 3HP9A 4ADNA 3RMCA 2MMBA 3RMBA 4X5NA 4EPHA 1MMOG 1FZ9E 4DTOA 2LF6A 2P1OB 1WAJA 4QNCA 1XU5E 3LD8A 1LDKE 2K5SA 1FZHE 3SUNA 4J2EA 4DTSA 3C94A 3QESA 3SI6A 2MZWB 3E4YA 2P1MB 3TAFA 3SQ1A 3UIQA 1FS1A 2RCUA 4EP9A 3QEXA 4M3XA 1FZ2E 2PFVA 3LZJA 2P1NB 4EYWA 4DU4A 1XVCE 1FZIE 2FW3A 1XVBE 4DTMA 3QEPA 2JH8A 2P1PB 1NEXB 3HGLA 2LF3A 4RL5A 3LDBA 4DTUA 3RMAA 4ICGC 3KD5E 3QEWA 4J2AA 2JHAA 2DTUA 4M42A 3CFRA 3NAEA 4FJ5A 4JS4A 3TAEA 2B1EA 4M3WA 3RWUA 4KI6A 4M3UA 3SUOA 5H37A 4DTJA 5IREA 4IT5A 4DTXA 3UO2A 4I9LA 1XMGE 3NGIA 4FK0A 4FJ8A 4M41A 4J2BA 3QNOA 3J27A 3OGLB 4DU1A 2JQTA 4GAMC 2PFTA 2MW2A 5IBKB 4JRQA 3N1EA 3TJYA 3SCXA 1FYZE 4FJXA 3TL8B 2RKHA 2ATQA 3S9HA 3SVIA 1IH7A 4FJIA 2OVQB 1XL3C 1XVEE 3C6OB 3QEVA 1Q9YA 4DTNA 3SJJA 1Q9XA 2VJ4A 3LZIA 4AKIA 1FZ0E 4HCCA 4FVMA 3CQ8A 4M3ZA 3QNNA 3TAGA 3LDSA 2OZMA 4FJKA 4FJ9A 1XVGE 2HD0A 2VIXA 4M3TA 3NHGA 4AKGA 1FXXA 4E3SA 1MHYG 3CFOA 4RG8A 1FZ8E 4FJGA 3J2PA 1N1CA 2QXFA 3UO3A 2B8IA 4ADOA 1WAFA 2JH9A 4FJHA 4E4BA 4KHUA 3MKSB 2OVRB 4RNGA 3QETA 4FJLA 3SNNA 3OGMB 4KI4A 4I9QA 4QNDA 2P1QB 3RMDA 2E31A 4JRPA 4FK4A 1FZ1E 3L8BA 3SPYA 3SQ0A 3QERA 4KHQA 2DY4A 1FZ6E 1FZ7E 1XVFE 3K2OA 4B08A 4M3YA 4AKHA 1FZ3E 2P5GA 1FPOA 4I6JB 2OYQA 3NDKA 3SQ2A 2H4TA 1IG9A 4JS5A 3HGKE 3OGKB 4FJMA 1XU3E 5IZ7A 4DTPA 4HCBA 3C95A 2JHCA 3N1BA 4FJ7A 3L0MA 2JPNA 1MHZG
chains in the Genus database with same CATH topology
2DEBA 1CLQA 2P5OA 4FJJA 4FJNA 1FZ4E 4FK2A 4KHYA 2FYOA 4M3RA 3C6PB 2E32A 4X5MA 3WSOA 1XMHE 3QEIA 4DTRA 4KHWA 3SPZA 3HL8A 4DU3A 3TABA 1XVDE 3SUPA 3L2OB 4KHSA 3SQ4A 3E4WA 3V7DB 2YB5A 1FZ5E 1P22A 2VJ5A 1XMFE 1MTYG 4J2DA 2OVPB 3CFPA 3C6NB 2B7MA 4M45A 3L1NA 2OZSA 4KHNA 3KD1E 3NE6A 4AI6A 3NCIA 3SUQA 2JHPA 3HP9A 4ADNA 3RMCA 2MMBA 3RMBA 4X5NA 4EPHA 1MMOG 1FZ9E 4DTOA 2LF6A 2P1OB 1WAJA 4QNCA 1XU5E 3LD8A 1LDKE 1FZHE 3SUNA 4J2EA 4DTSA 3C94A 3QESA 3SI6A 2MZWB 3E4YA 2P1MB 3TAFA 3SQ1A 3UIQA 1FS1A 2RCUA 4EP9A 3QEXA 4M3XA 1FZ2E 2PFVA 3LZJA 2P1NB 4EYWA 4DU4A 1XVCE 1FZIE 2FW3A 1XVBE 4DTMA 3QEPA 2JH8A 2P1PB 1NEXB 3HGLA 2LF3A 4RL5A 3LDBA 4DTUA 3RMAA 3KD5E 3QEWA 4J2AA 2JHAA 2DTUA 4M42A 3CFRA 3NAEA 4FJ5A 4JS4A 3TAEA 2B1EA 4M3WA 3RWUA 4KI6A 4M3UA 3SUOA 5H37A 4DTJA 5IREA 4DTXA 4I9LA 1XMGE 3NGIA 4FK0A 4FJ8A 4M41A 4J2BA 3QNOA 3J27A 3OGLB 4DU1A 4GAMC 2PFTA 5IBKB 4JRQA 3N1EA 3TJYA 3SCXA 1FYZE 4FJXA 3TL8B 2ATQA 3S9HA 3SVIA 1IH7A 4FJIA 2OVQB 1XL3C 1XVEE 3C6OB 3QEVA 1Q9YA 4DTNA 3SJJA 1Q9XA 2VJ4A 3LZIA 4AKIA 1FZ0E 4HCCA 4FVMA 3CQ8A 4M3ZA 3QNNA 3TAGA 3LDSA 2OZMA 4FJKA 4FJ9A 1XVGE 2HD0A 2VIXA 4M3TA 3NHGA 4AKGA 1FXXA 4E3SA 1MHYG 3CFOA 4RG8A 1FZ8E 4FJGA 3J2PA 2QXFA 2B8IA 4ADOA 1WAFA 2JH9A 4FJHA 4E4BA 4KHUA 3MKSB 2OVRB 4RNGA 3QETA 4FJLA 3SNNA 3OGMB 4KI4A 4I9QA 4QNDA 2P1QB 3RMDA 2E31A 4JRPA 4FK4A 1FZ1E 3L8BA 3SPYA 3SQ0A 3QERA 4KHQA 2DY4A 1FZ6E 1FZ7E 1XVFE 3K2OA 4B08A 4M3YA 4AKHA 1FZ3E 2P5GA 4I6JB 2OYQA 3NDKA 3SQ2A 2H4TA 1IG9A 4JS5A 3HGKE 3OGKB 4FJMA 1XU3E 5IZ7A 4DTPA 4HCBA 3C95A 2JHCA 3N1BA 4FJ7A 3L0MA 2JPNA 1MHZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C6P B;  2E32 A;  3WSO A;  3OGL B;  3MKS B;  2OVR B;  2P1M B;  3OGM B;  1FS1 A;  5IBK B;  2P1Q B;  2E31 A;  3L2O B;  2P1N B;  3V7D B;  1P22 A;  2OVQ B;  2OVP B;  2P1P B;  3C6O B;  1NEX B;  3C6N B;  4I6J B;  3OGK B;  2P1O B;  1LDK E; 
#chains in the Genus database with same CATH topology
 2DEB A;  1CLQ A;  2P5O A;  4FJJ A;  4FJN A;  1FZ4 E;  4FK2 A;  4KHY A;  2FYO A;  4M3R A;  3C6P B;  2E32 A;  4X5M A;  3WSO A;  1XMH E;  3BVO A;  4DTR A;  3QEI A;  4KHW A;  3SPZ A;  3HL8 A;  4DU3 A;  3TAB A;  1XVD E;  3SUP A;  3L2O B;  4KHS A;  3SQ4 A;  3E4W A;  3V7D B;  1FZ5 E;  2YB5 A;  1P22 A;  2VJ5 A;  1XMF E;  1MTY G;  4J2D A;  2OVP B;  3CFP A;  3C6N B;  2B7M A;  4M45 A;  3L1N A;  2OZS A;  4KHN A;  3KD1 E;  3NE6 A;  4AI6 A;  3NCI A;  3SUQ A;  2JHP A;  1JW2 A;  3HP9 A;  4ADN A;  3RMC A;  2MMB A;  3RMB A;  4X5N A;  4EPH A;  1MMO G;  1FZ9 E;  4DTO A;  2LF6 A;  2P1O B;  1WAJ A;  4QNC A;  1XU5 E;  3LD8 A;  1LDK E;  2K5S A;  1FZH E;  3SUN A;  4J2E A;  4DTS A;  3C94 A;  3QES A;  3SI6 A;  2MZW B;  3E4Y A;  2P1M B;  3TAF A;  3SQ1 A;  3UIQ A;  1FS1 A;  2RCU A;  4EP9 A;  3QEX A;  4M3X A;  1FZ2 E;  2PFV A;  3LZJ A;  2P1N B;  4EYW A;  4DU4 A;  1XVC E;  1FZI E;  2FW3 A;  1XVB E;  4DTM A;  3QEP A;  2JH8 A;  2P1P B;  1NEX B;  3HGL A;  2LF3 A;  4RL5 A;  3LDB A;  4DTU A;  3RMA A;  4ICG C;  3KD5 E;  3QEW A;  4J2A A;  2JHA A;  2DTU A;  4M42 A;  3CFR A;  3NAE A;  4FJ5 A;  4JS4 A;  3TAE A;  2B1E A;  4M3W A;  3RWU A;  4KI6 A;  4M3U A;  3SUO A;  5H37 A;  4DTJ A;  5IRE A;  4IT5 A;  4DTX A;  3UO2 A;  4I9L A;  1XMG E;  3NGI A;  4FK0 A;  4FJ8 A;  4M41 A;  4J2B A;  3QNO A;  3J27 A;  3OGL B;  4DU1 A;  2JQT A;  4GAM C;  2PFT A;  2MW2 A;  5IBK B;  4JRQ A;  3N1E A;  3TJY A;  3SCX A;  1FYZ E;  4FJX A;  3TL8 B;  2RKH A;  2ATQ A;  3S9H A;  3SVI A;  1IH7 A;  4FJI A;  2OVQ B;  1XL3 C;  1XVE E;  3C6O B;  3QEV A;  1Q9Y A;  4DTN A;  3SJJ A;  1Q9X A;  2VJ4 A;  3LZI A;  4AKI A;  1FZ0 E;  4HCC A;  4FVM A;  3CQ8 A;  4M3Z A;  3QNN A;  3TAG A;  3LDS A;  2OZM A;  4FJK A;  4FJ9 A;  1XVG E;  2HD0 A;  2VIX A;  4M3T A;  3NHG A;  4AKG A;  1FXX A;  4E3S A;  1MHY G;  3CFO A;  4RG8 A;  1FZ8 E;  4FJG A;  3J2P A;  1N1C A;  2QXF A;  3UO3 A;  2B8I A;  4ADO A;  1WAF A;  2JH9 A;  4FJH A;  4E4B A;  4KHU A;  3MKS B;  2OVR B;  4RNG A;  3QET A;  4FJL A;  3SNN A;  3OGM B;  4KI4 A;  4I9Q A;  4QND A;  2P1Q B;  3RMD A;  2E31 A;  4JRP A;  4FK4 A;  1FZ1 E;  3L8B A;  3SPY A;  3SQ0 A;  3QER A;  4KHQ A;  2DY4 A;  1FZ6 E;  1FZ7 E;  1XVF E;  3K2O A;  4B08 A;  4M3Y A;  4AKH A;  1FZ3 E;  2P5G A;  1FPO A;  4I6J B;  2OYQ A;  3NDK A;  3SQ2 A;  2H4T A;  1IG9 A;  4JS5 A;  3HGK E;  3OGK B;  4FJM A;  1XU3 E;  5IZ7 A;  4DTP A;  4HCB A;  3C95 A;  2JHC A;  3N1B A;  4FJ7 A;  3L0M A;  2JPN A;  1MHZ G; 
#chains in the Genus database with same CATH homology
 2DEB A;  1CLQ A;  2P5O A;  4FJJ A;  4FJN A;  1FZ4 E;  4FK2 A;  4KHY A;  2FYO A;  4M3R A;  3C6P B;  2E32 A;  4X5M A;  3WSO A;  1XMH E;  3QEI A;  4DTR A;  4KHW A;  3SPZ A;  3HL8 A;  4DU3 A;  3TAB A;  1XVD E;  3SUP A;  3L2O B;  4KHS A;  3SQ4 A;  3E4W A;  3V7D B;  2YB5 A;  1FZ5 E;  1P22 A;  2VJ5 A;  1XMF E;  1MTY G;  4J2D A;  2OVP B;  3CFP A;  3C6N B;  2B7M A;  4M45 A;  3L1N A;  2OZS A;  4KHN A;  3KD1 E;  3NE6 A;  4AI6 A;  3NCI A;  3SUQ A;  2JHP A;  3HP9 A;  4ADN A;  3RMC A;  2MMB A;  3RMB A;  4X5N A;  4EPH A;  1MMO G;  1FZ9 E;  4DTO A;  2LF6 A;  2P1O B;  1WAJ A;  4QNC A;  1XU5 E;  3LD8 A;  1LDK E;  1FZH E;  3SUN A;  4J2E A;  4DTS A;  3C94 A;  3QES A;  3SI6 A;  2MZW B;  3E4Y A;  2P1M B;  3TAF A;  3SQ1 A;  3UIQ A;  1FS1 A;  2RCU A;  4EP9 A;  3QEX A;  4M3X A;  1FZ2 E;  2PFV A;  3LZJ A;  2P1N B;  4EYW A;  4DU4 A;  1XVC E;  1FZI E;  2FW3 A;  1XVB E;  4DTM A;  3QEP A;  2JH8 A;  2P1P B;  1NEX B;  3HGL A;  2LF3 A;  4RL5 A;  3LDB A;  4DTU A;  3RMA A;  3KD5 E;  3QEW A;  4J2A A;  2JHA A;  2DTU A;  4M42 A;  3CFR A;  3NAE A;  4FJ5 A;  4JS4 A;  3TAE A;  2B1E A;  4M3W A;  3RWU A;  4KI6 A;  4M3U A;  3SUO A;  5H37 A;  4DTJ A;  5IRE A;  4DTX A;  4I9L A;  1XMG E;  3NGI A;  4FK0 A;  4FJ8 A;  4M41 A;  4J2B A;  3QNO A;  3J27 A;  3OGL B;  4DU1 A;  4GAM C;  2PFT A;  5IBK B;  4JRQ A;  3N1E A;  3TJY A;  3SCX A;  1FYZ E;  4FJX A;  3TL8 B;  2ATQ A;  3S9H A;  3SVI A;  1IH7 A;  4FJI A;  2OVQ B;  1XL3 C;  1XVE E;  3C6O B;  3QEV A;  1Q9Y A;  4DTN A;  3SJJ A;  1Q9X A;  2VJ4 A;  3LZI A;  4AKI A;  1FZ0 E;  4HCC A;  4FVM A;  3CQ8 A;  4M3Z A;  3QNN A;  3TAG A;  3LDS A;  2OZM A;  4FJK A;  4FJ9 A;  1XVG E;  2HD0 A;  2VIX A;  4M3T A;  3NHG A;  4AKG A;  1FXX A;  4E3S A;  1MHY G;  3CFO A;  4RG8 A;  1FZ8 E;  4FJG A;  3J2P A;  2QXF A;  2B8I A;  4ADO A;  1WAF A;  2JH9 A;  4FJH A;  4E4B A;  4KHU A;  3MKS B;  2OVR B;  4RNG A;  3QET A;  4FJL A;  3SNN A;  3OGM B;  4KI4 A;  4I9Q A;  4QND A;  2P1Q B;  3RMD A;  2E31 A;  4JRP A;  4FK4 A;  1FZ1 E;  3L8B A;  3SPY A;  3SQ0 A;  3QER A;  4KHQ A;  2DY4 A;  1FZ6 E;  1FZ7 E;  1XVF E;  3K2O A;  4B08 A;  4M3Y A;  4AKH A;  1FZ3 E;  2P5G A;  4I6J B;  2OYQ A;  3NDK A;  3SQ2 A;  2H4T A;  1IG9 A;  4JS5 A;  3HGK E;  3OGK B;  4FJM A;  1XU3 E;  5IZ7 A;  4DTP A;  4HCB A;  3C95 A;  2JHC A;  3N1B A;  4FJ7 A;  3L0M A;  2JPN A;  1MHZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...