5IBKB

Skp1-f-box in complex with a ubiquitin variant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
QRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords S-phase kinase-associated protein 1,S-phase kinase-associate
publication title Inhibition of SCF ubiquitin ligases by engineered ubiquitin variants that target the Cul1 binding site on the Skp1-F-box interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 46
sequence length 46
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 5ibkB00
3OGMB 2OVPB 1FS1A 3WSOA 2E31A 3OGKB 3MKSB 2OVQB 3OGLB 1P22A 2P1QB 3C6NB 1LDKE 2P1OB 2E32A 2OVRB 2P1NB 1NEXB 2P1MB 3C6OB 3V7DB 3L2OB 5IBKB 3C6PB 4I6JB 2P1PB
chains in the Genus database with same CATH superfamily
2VJ5A 2YB5A 4EYWA 2LF3A 2MZWB 4JRQA 3CFOA 3TL8B 4M3XA 4FJHA 3E4YA 3UO3A 3SQ4A 2OZSA 4ADNA 2E31A 4KHUA 3SVIA 4EPHA 1FZ6E 1WAJA 4AKHA 3OGLB 3SJJA 1FZ0E 1XL3C 2JQTA 4DU3A 3RMAA 4FJMA 1P22A 4FK2A 3HGLA 3NCIA 3K2OA 4ICGC 3QESA 2P1OB 4M45A 3TAGA 4AKGA 1FZ2E 3BVOA 2PFTA 3TJYA 2JHAA 1XU5E 3SPYA 3C95A 3N1BA 4DTOA 1FYZE 2ATQA 2QXFA 3QEPA 4FJGA 3L2OB 3TABA 3LZIA 4FK0A 4AKIA 3L1NA 2P1PB 3HGKE 3HL8A 3TAFA 3SPZA 1XVFE 2MW2A 3OGMB 2P5OA 3SUOA 2JHPA 3E4WA 3NAEA 4M3TA 4FJIA 1FS1A 2RKHA 2OVQB 2JHCA 1FXXA 2FYOA 4M42A 3LDBA 3SUQA 1XVEE 2LF6A 4B08A 3QEIA 4M3UA 1FZ5E 4JS5A 3NDKA 4DTSA 4HCBA 4FK4A 3QEWA 4AI6A 4KHSA 3HP9A 3TAEA 4I9LA 2JPNA 1XU3E 4X5MA 2VIXA 3LDSA 1FZ7E 1MMOG 4E4BA 1MHZG 4FJXA 1WAFA 3C94A 4X5NA 4DU1A 4FJNA 4KHYA 3QNNA 2P1MB 1MHYG 4FJJA 3V7DB 3S9HA 4FJ9A 3SQ1A 4J2DA 4IT5A 2DTUA 4HCCA 2FW3A 3C6PB 4I6JB 4FJ7A 3QEVA 2DEBA 4M3YA 4E3SA 1FZIE 1FZ8E 1MTYG 2OVPB 1JW2A 2JH8A 2JH9A 4J2AA 3WSOA 4DTUA 3L8BA 5IZ7A 4FJKA 3QEXA 3SNNA 3RMDA 1XMHE 3J27A 2DY4A 3CFPA 2B1EA 1CLQA 4QNCA 1IH7A 3SQ0A 4FJ8A 3C6NB 2P5GA 3L0MA 4M3ZA 2OZMA 4KI6A 1LDKE 1XVBE 2MMBA 3SUNA 2E32A 4FVMA 2OVRB 2HD0A 4RG8A 4RL5A 1FZ3E 2P1NB 1N1CA 2PFVA 1NEXB 1XMFE 1XVDE 3N1EA 3NGIA 3QERA 3RMBA 4M41A 3RMCA 3SCXA 1Q9YA 2OYQA 3NE6A 2RCUA 4M3WA 3LD8A 4DTRA 4DTNA 4ADOA 4DTMA 4KHQA 4RNGA 3UO2A 3SQ2A 4JS4A 1FPOA 4FJ5A 4GAMC 1FZ1E 3UIQA 1FZHE 2B8IA 4QNDA 2VJ4A 4M3RA 3OGKB 3MKSB 4KHWA 4DTJA 2B7MA 4EP9A 5H37A 4I9QA 4J2EA 1XVCE 3J2PA 1XMGE 2K5SA 3SI6A 2P1QB 4DTPA 4KHNA 1IG9A 1XVGE 3CFRA 5IREA 1FZ9E 1Q9XA 4J2BA 3CQ8A 3SUPA 4FJLA 4JRPA 3QETA 3KD1E 2H4TA 1FZ4E 3C6OB 3LZJA 4KI4A 3KD5E 4DTXA 3RWUA 3NHGA 5IBKB 4DU4A 3QNOA
chains in the Genus database with same CATH topology
2VJ5A 2YB5A 4EYWA 2LF3A 2MZWB 4JRQA 3CFOA 3TL8B 4M3XA 4FJHA 3E4YA 3SQ4A 4KHUA 2OZSA 4ADNA 2E31A 3SVIA 4EPHA 1FZ6E 1WAJA 4AKHA 3OGLB 3SJJA 1FZ0E 1XL3C 3RMAA 4DU3A 4FJMA 1P22A 4FK2A 3HGLA 3NCIA 3K2OA 3QESA 2P1OB 4M45A 3TAGA 4AKGA 1FZ2E 2PFTA 3TJYA 3SPYA 2JHAA 1XU5E 3C95A 3N1BA 4DTOA 1FYZE 2ATQA 2QXFA 3QEPA 4FJGA 3L2OB 3TABA 3LZIA 4FK0A 4AKIA 3L1NA 2P1PB 3HGKE 3HL8A 3TAFA 3SPZA 1XVFE 3OGMB 2P5OA 3SUOA 2JHPA 3E4WA 3NAEA 4M3TA 4FJIA 1FS1A 2OVQB 2JHCA 1FXXA 2FYOA 4M42A 3LDBA 3SUQA 1XVEE 2LF6A 4B08A 3QEIA 4M3UA 1FZ5E 4JS5A 3NDKA 4DTSA 4HCBA 4FK4A 3QEWA 4AI6A 4KHSA 3HP9A 3TAEA 4I9LA 2JPNA 1XU3E 4X5MA 2VIXA 3LDSA 1FZ7E 1MMOG 4E4BA 1MHZG 4FJXA 1WAFA 3C94A 4X5NA 4DU1A 4FJNA 4KHYA 3QNNA 2P1MB 1MHYG 4FJJA 3V7DB 3S9HA 4FJ9A 3SQ1A 4J2DA 2DTUA 4HCCA 2FW3A 3C6PB 4I6JB 4FJ7A 3QEVA 2DEBA 4M3YA 4E3SA 1FZIE 1FZ8E 1MTYG 2OVPB 2JH8A 2JH9A 4J2AA 3WSOA 4DTUA 3L8BA 5IZ7A 4FJKA 3QEXA 3SNNA 3RMDA 1XMHE 3J27A 2DY4A 3CFPA 2B1EA 1CLQA 4QNCA 1IH7A 3SQ0A 4FJ8A 3C6NB 2P5GA 3L0MA 4M3ZA 2OZMA 4KI6A 1LDKE 1XVBE 2MMBA 3SUNA 2E32A 4FVMA 2OVRB 2HD0A 4RG8A 4RL5A 1FZ3E 2P1NB 1XVDE 2PFVA 1NEXB 1XMFE 3N1EA 3NGIA 3QERA 3RMBA 3RMCA 4M41A 3SCXA 1Q9YA 2OYQA 3NE6A 2RCUA 4M3WA 3LD8A 4DTRA 4DTNA 4ADOA 4DTMA 4KHQA 4RNGA 3SQ2A 4JS4A 4FJ5A 4GAMC 1FZ1E 3UIQA 1FZHE 2B8IA 4QNDA 2VJ4A 4M3RA 3OGKB 3MKSB 4KHWA 4DTJA 2B7MA 4EP9A 5H37A 4I9QA 4J2EA 1XVCE 3J2PA 1XMGE 3SI6A 2P1QB 4DTPA 4KHNA 1IG9A 1XVGE 3CFRA 5IREA 1FZ9E 1Q9XA 4J2BA 3CQ8A 3SUPA 4FJLA 4JRPA 3QETA 3KD1E 2H4TA 1FZ4E 3C6OB 3LZJA 4KI4A 3KD5E 4DTXA 3RWUA 3NHGA 5IBKB 4DU4A 3QNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGM B;  2OVP B;  1FS1 A;  3WSO A;  2E31 A;  3OGK B;  3MKS B;  2OVQ B;  3OGL B;  1P22 A;  2P1Q B;  3C6N B;  1LDK E;  2P1O B;  2E32 A;  2OVR B;  2P1N B;  1NEX B;  2P1M B;  3C6O B;  3V7D B;  3L2O B;  5IBK B;  3C6P B;  4I6J B;  2P1P B; 
#chains in the Genus database with same CATH topology
 2VJ5 A;  2YB5 A;  4EYW A;  2LF3 A;  2MZW B;  4JRQ A;  3CFO A;  3TL8 B;  4M3X A;  4FJH A;  3E4Y A;  3UO3 A;  3SQ4 A;  2OZS A;  4ADN A;  2E31 A;  4KHU A;  3SVI A;  4EPH A;  1FZ6 E;  1WAJ A;  4AKH A;  3OGL B;  3SJJ A;  1FZ0 E;  1XL3 C;  2JQT A;  4DU3 A;  3RMA A;  4FJM A;  1P22 A;  4FK2 A;  3HGL A;  3NCI A;  3K2O A;  4ICG C;  3QES A;  2P1O B;  4M45 A;  3TAG A;  4AKG A;  1FZ2 E;  3BVO A;  2PFT A;  3TJY A;  2JHA A;  1XU5 E;  3SPY A;  3C95 A;  3N1B A;  4DTO A;  1FYZ E;  2ATQ A;  2QXF A;  3QEP A;  4FJG A;  3L2O B;  3TAB A;  3LZI A;  4FK0 A;  4AKI A;  3L1N A;  2P1P B;  3HGK E;  3HL8 A;  3TAF A;  3SPZ A;  1XVF E;  2MW2 A;  3OGM B;  2P5O A;  3SUO A;  2JHP A;  3E4W A;  3NAE A;  4M3T A;  4FJI A;  1FS1 A;  2RKH A;  2OVQ B;  2JHC A;  1FXX A;  2FYO A;  4M42 A;  3LDB A;  3SUQ A;  1XVE E;  2LF6 A;  4B08 A;  3QEI A;  4M3U A;  1FZ5 E;  4JS5 A;  3NDK A;  4DTS A;  4HCB A;  4FK4 A;  3QEW A;  4AI6 A;  4KHS A;  3HP9 A;  3TAE A;  4I9L A;  2JPN A;  1XU3 E;  4X5M A;  2VIX A;  3LDS A;  1FZ7 E;  1MMO G;  4E4B A;  1MHZ G;  4FJX A;  1WAF A;  3C94 A;  4X5N A;  4DU1 A;  4FJN A;  4KHY A;  3QNN A;  2P1M B;  1MHY G;  4FJJ A;  3V7D B;  3S9H A;  4FJ9 A;  3SQ1 A;  4J2D A;  4IT5 A;  2DTU A;  4HCC A;  2FW3 A;  3C6P B;  4I6J B;  4FJ7 A;  3QEV A;  2DEB A;  4M3Y A;  4E3S A;  1FZI E;  1FZ8 E;  1MTY G;  2OVP B;  1JW2 A;  2JH8 A;  2JH9 A;  4J2A A;  3WSO A;  4DTU A;  3L8B A;  5IZ7 A;  4FJK A;  3QEX A;  3SNN A;  3RMD A;  1XMH E;  3J27 A;  2DY4 A;  3CFP A;  2B1E A;  1CLQ A;  4QNC A;  1IH7 A;  3SQ0 A;  4FJ8 A;  3C6N B;  2P5G A;  3L0M A;  4M3Z A;  2OZM A;  4KI6 A;  1LDK E;  1XVB E;  2MMB A;  3SUN A;  2E32 A;  4FVM A;  2OVR B;  2HD0 A;  4RG8 A;  4RL5 A;  1FZ3 E;  2P1N B;  1N1C A;  2PFV A;  1NEX B;  1XMF E;  1XVD E;  3N1E A;  3NGI A;  3QER A;  3RMB A;  4M41 A;  3RMC A;  3SCX A;  1Q9Y A;  2OYQ A;  3NE6 A;  2RCU A;  4M3W A;  3LD8 A;  4DTR A;  4DTN A;  4ADO A;  4DTM A;  4KHQ A;  4RNG A;  3UO2 A;  3SQ2 A;  4JS4 A;  1FPO A;  4FJ5 A;  4GAM C;  1FZ1 E;  3UIQ A;  1FZH E;  2B8I A;  4QND A;  2VJ4 A;  4M3R A;  3OGK B;  3MKS B;  4KHW A;  4DTJ A;  2B7M A;  4EP9 A;  5H37 A;  4I9Q A;  4J2E A;  1XVC E;  3J2P A;  1XMG E;  2K5S A;  3SI6 A;  2P1Q B;  4DTP A;  4KHN A;  1IG9 A;  1XVG E;  3CFR A;  5IRE A;  1FZ9 E;  1Q9X A;  4J2B A;  3CQ8 A;  3SUP A;  4FJL A;  4JRP A;  3QET A;  3KD1 E;  2H4T A;  1FZ4 E;  3C6O B;  3LZJ A;  4KI4 A;  3KD5 E;  4DTX A;  3RWU A;  3NHG A;  5IBK B;  4DU4 A;  3QNO A; 
#chains in the Genus database with same CATH homology
 2VJ5 A;  2YB5 A;  4EYW A;  2LF3 A;  2MZW B;  4JRQ A;  3CFO A;  3TL8 B;  4M3X A;  4FJH A;  3E4Y A;  3SQ4 A;  4KHU A;  2OZS A;  4ADN A;  2E31 A;  3SVI A;  4EPH A;  1FZ6 E;  1WAJ A;  4AKH A;  3OGL B;  3SJJ A;  1FZ0 E;  1XL3 C;  3RMA A;  4DU3 A;  4FJM A;  1P22 A;  4FK2 A;  3HGL A;  3NCI A;  3K2O A;  3QES A;  2P1O B;  4M45 A;  3TAG A;  4AKG A;  1FZ2 E;  2PFT A;  3TJY A;  3SPY A;  2JHA A;  1XU5 E;  3C95 A;  3N1B A;  4DTO A;  1FYZ E;  2ATQ A;  2QXF A;  3QEP A;  4FJG A;  3L2O B;  3TAB A;  3LZI A;  4FK0 A;  4AKI A;  3L1N A;  2P1P B;  3HGK E;  3HL8 A;  3TAF A;  3SPZ A;  1XVF E;  3OGM B;  2P5O A;  3SUO A;  2JHP A;  3E4W A;  3NAE A;  4M3T A;  4FJI A;  1FS1 A;  2OVQ B;  2JHC A;  1FXX A;  2FYO A;  4M42 A;  3LDB A;  3SUQ A;  1XVE E;  2LF6 A;  4B08 A;  3QEI A;  4M3U A;  1FZ5 E;  4JS5 A;  3NDK A;  4DTS A;  4HCB A;  4FK4 A;  3QEW A;  4AI6 A;  4KHS A;  3HP9 A;  3TAE A;  4I9L A;  2JPN A;  1XU3 E;  4X5M A;  2VIX A;  3LDS A;  1FZ7 E;  1MMO G;  4E4B A;  1MHZ G;  4FJX A;  1WAF A;  3C94 A;  4X5N A;  4DU1 A;  4FJN A;  4KHY A;  3QNN A;  2P1M B;  1MHY G;  4FJJ A;  3V7D B;  3S9H A;  4FJ9 A;  3SQ1 A;  4J2D A;  2DTU A;  4HCC A;  2FW3 A;  3C6P B;  4I6J B;  4FJ7 A;  3QEV A;  2DEB A;  4M3Y A;  4E3S A;  1FZI E;  1FZ8 E;  1MTY G;  2OVP B;  2JH8 A;  2JH9 A;  4J2A A;  3WSO A;  4DTU A;  3L8B A;  5IZ7 A;  4FJK A;  3QEX A;  3SNN A;  3RMD A;  1XMH E;  3J27 A;  2DY4 A;  3CFP A;  2B1E A;  1CLQ A;  4QNC A;  1IH7 A;  3SQ0 A;  4FJ8 A;  3C6N B;  2P5G A;  3L0M A;  4M3Z A;  2OZM A;  4KI6 A;  1LDK E;  1XVB E;  2MMB A;  3SUN A;  2E32 A;  4FVM A;  2OVR B;  2HD0 A;  4RG8 A;  4RL5 A;  1FZ3 E;  2P1N B;  1XVD E;  2PFV A;  1NEX B;  1XMF E;  3N1E A;  3NGI A;  3QER A;  3RMB A;  3RMC A;  4M41 A;  3SCX A;  1Q9Y A;  2OYQ A;  3NE6 A;  2RCU A;  4M3W A;  3LD8 A;  4DTR A;  4DTN A;  4ADO A;  4DTM A;  4KHQ A;  4RNG A;  3SQ2 A;  4JS4 A;  4FJ5 A;  4GAM C;  1FZ1 E;  3UIQ A;  1FZH E;  2B8I A;  4QND A;  2VJ4 A;  4M3R A;  3OGK B;  3MKS B;  4KHW A;  4DTJ A;  2B7M A;  4EP9 A;  5H37 A;  4I9Q A;  4J2E A;  1XVC E;  3J2P A;  1XMG E;  3SI6 A;  2P1Q B;  4DTP A;  4KHN A;  1IG9 A;  1XVG E;  3CFR A;  5IRE A;  1FZ9 E;  1Q9X A;  4J2B A;  3CQ8 A;  3SUP A;  4FJL A;  4JRP A;  3QET A;  3KD1 E;  2H4T A;  1FZ4 E;  3C6O B;  3LZJ A;  4KI4 A;  3KD5 E;  4DTX A;  3RWU A;  3NHG A;  5IBK B;  4DU4 A;  3QNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...