5IBKB

Skp1-f-box in complex with a ubiquitin variant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
QRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1,S-phase kinase-associate
publication title Inhibition of SCF ubiquitin ligases by engineered ubiquitin variants that target the Cul1 binding site on the Skp1-F-box interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 46
sequence length 46
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 5ibkB00
1FS1A 3OGKB 5IBKB 2P1NB 1LDKE 2E31A 3C6NB 3MKSB 2OVPB 3C6PB 1NEXB 3OGMB 1P22A 3L2OB 2P1MB 3V7DB 2E32A 2P1PB 2P1QB 2P1OB 3C6OB 3OGLB 4I6JB 2OVQB 3WSOA 2OVRB
chains in the Genus database with same CATH superfamily
1XVFE 2LF3A 3LDBA 4FVMA 2YB5A 5IBKB 1WAJA 2P1NB 4X5NA 3SVIA 3HGKE 3QETA 4FJGA 4DTJA 4KI4A 1FYZE 1XU5E 2PFTA 1MHZG 3NE6A 2K5SA 1Q9YA 3E4WA 2RCUA 2H4TA 3L8BA 3C95A 3NHGA 3L2OB 3SCXA 2QXFA 3TAEA 4ADNA 2OZSA 3N1BA 1FZIE 1XVDE 2RKHA 4J2EA 2P1PB 1MMOG 4KI6A 1XVGE 4AKIA 3NDKA 5IREA 4DU3A 3RMBA 4M3XA 1XMFE 2P1OB 3C6OB 3J2PA 3OGLB 4FK2A 4KHQA 4I6JB 4M45A 4DU1A 1FZ0E 3RMAA 2JHCA 3K2OA 2MW2A 1XVCE 4E4BA 4DTMA 4RL5A 3OGKB 4FJIA 1LDKE 4J2AA 4KHYA 2MZWB 3BVOA 2JH8A 3SUQA 4E3SA 4RG8A 3CFOA 3TL8B 1XU3E 4ICGC 2ATQA 5H37A 4AKGA 2VJ5A 3J27A 3L1NA 4EYWA 2P5OA 4HCCA 4HCBA 3UIQA 1FZ8E 4AI6A 1FZ9E 2P1QB 4JS4A 5IZ7A 4EPHA 2MMBA 2P5GA 2JHAA 1MHYG 4EP9A 4FJMA 2VIXA 3TAGA 3S9HA 3WSOA 2OVRB 4KHNA 3QNOA 1FZ5E 4RNGA 4ADOA 3SUPA 4DTXA 3QESA 1FXXA 2JQTA 4FJ8A 3NCIA 2FYOA 4M3ZA 2B8IA 3CFRA 4M3YA 4M3TA 1FZ1E 2B7MA 2OVPB 3SQ4A 3NAEA 1FZ7E 1XMHE 3SI6A 4KHWA 1FZ4E 3QEWA 2VJ4A 2OZMA 4JRQA 3TAFA 4DTOA 3QNNA 3N1EA 1Q9XA 2PFVA 3V7DB 2DY4A 2B1EA 3NGIA 4FJHA 1FZ3E 3HP9A 4X5MA 3CQ8A 3L0MA 2JPNA 3SJJA 4KHSA 3UO2A 1XMGE 4DTPA 4IT5A 2JHPA 2DTUA 1FZ2E 3QEXA 1N1CA 3LZJA 1IH7A 3QEVA 3KD5E 4FK0A 3SUOA 4QNDA 4J2BA 3QERA 3RMCA 2HD0A 1FS1A 1IG9A 3CFPA 3C6NB 3KD1E 2E31A 4FJ7A 4I9LA 3MKSB 3LDSA 4M3UA 3QEPA 3SQ0A 1FPOA 4DTNA 4M41A 4FJ5A 3C6PB 1NEXB 4M3WA 1JW2A 3OGMB 4DU4A 4FJLA 4M42A 1FZHE 4FJ9A 3SQ2A 4FJNA 4FK4A 3SPZA 4M3RA 2LF6A 3TJYA 2OYQA 1P22A 4JRPA 3RWUA 1CLQA 4JS5A 4AKHA 4DTSA 3QEIA 4KHUA 2P1MB 2JH9A 3C94A 3RMDA 1XVEE 2E32A 3E4YA 4GAMC 3SNNA 4FJXA 3TABA 1WAFA 4QNCA 1MTYG 4FJKA 2FW3A 4DTUA 4I9QA 1XL3C 1FZ6E 2OVQB 4B08A 3UO3A 3LZIA 4DTRA 3HGLA 4FJJA 1XVBE 3SUNA 3SPYA 2DEBA 3HL8A 3SQ1A 4J2DA 3LD8A
chains in the Genus database with same CATH topology
1XVFE 2LF3A 3LDBA 4FVMA 2YB5A 5IBKB 1WAJA 2P1NB 4X5NA 3SVIA 3HGKE 3QETA 4FJGA 4DTJA 4KI4A 1FYZE 1XU5E 2PFTA 1MHZG 3NE6A 1Q9YA 3E4WA 2RCUA 2H4TA 3L8BA 3C95A 3NHGA 3L2OB 3SCXA 2QXFA 3TAEA 4ADNA 2OZSA 3N1BA 1FZIE 1XVDE 4KI6A 4J2EA 2P1PB 1MMOG 4AKIA 1XVGE 3NDKA 5IREA 4DU3A 3RMBA 4M3XA 1XMFE 2P1OB 3C6OB 3J2PA 3OGLB 4FK2A 4KHQA 4I6JB 4M45A 4DU1A 1FZ0E 3RMAA 2JHCA 3K2OA 1XVCE 4E4BA 4DTMA 4RL5A 3OGKB 4FJIA 1LDKE 4J2AA 4KHYA 2MZWB 2JH8A 3SUQA 4E3SA 4RG8A 3CFOA 3TL8B 1XU3E 2ATQA 5H37A 4AKGA 2VJ5A 3J27A 3L1NA 4EYWA 2P5OA 4HCCA 4HCBA 3UIQA 1FZ8E 4AI6A 1FZ9E 2P1QB 4JS4A 5IZ7A 4EPHA 2MMBA 2P5GA 2JHAA 1MHYG 4EP9A 4FJMA 2VIXA 3TAGA 3S9HA 3WSOA 2OVRB 4KHNA 3QNOA 1FZ5E 4RNGA 4ADOA 3SUPA 4DTXA 3QESA 1FXXA 4FJ8A 4M3ZA 3NCIA 2FYOA 4M3TA 2B8IA 3CFRA 4M3YA 1FZ1E 2B7MA 2OVPB 3SQ4A 3NAEA 1FZ7E 1XMHE 3SI6A 4KHWA 1FZ4E 3QEWA 2VJ4A 2OZMA 4JRQA 3TAFA 4DTOA 3QNNA 3N1EA 1Q9XA 2PFVA 3V7DB 2DY4A 2B1EA 3NGIA 4FJHA 1FZ3E 3HP9A 4X5MA 3CQ8A 3L0MA 2JPNA 3SJJA 4KHSA 1XMGE 4DTPA 2JHPA 2DTUA 1FZ2E 3QEXA 3LZJA 1IH7A 3QEVA 3KD5E 4FK0A 3SUOA 4QNDA 4J2BA 3QERA 3RMCA 2HD0A 1FS1A 1IG9A 3CFPA 3C6NB 3KD1E 2E31A 4FJ7A 4I9LA 3MKSB 3LDSA 4M3UA 3QEPA 3SQ0A 4FJ5A 4DTNA 4M41A 3C6PB 1NEXB 4M3WA 3OGMB 4DU4A 4FJLA 4M42A 1FZHE 4FJ9A 3SQ2A 4FJNA 4FK4A 3SPZA 4M3RA 2LF6A 3TJYA 2OYQA 1P22A 4JRPA 3RWUA 1CLQA 4JS5A 4AKHA 4DTSA 3QEIA 4KHUA 3C94A 2P1MB 2JH9A 3RMDA 1XVEE 2E32A 3E4YA 4GAMC 3SNNA 4FJXA 3TABA 1WAFA 4QNCA 1MTYG 4FJKA 2FW3A 4DTUA 4I9QA 1XL3C 1FZ6E 2OVQB 4B08A 3LZIA 4DTRA 4FJJA 3HGLA 1XVBE 3SUNA 3SPYA 2DEBA 3HL8A 3SQ1A 4J2DA 3LD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FS1 A;  3OGK B;  5IBK B;  2P1N B;  1LDK E;  2E31 A;  3C6N B;  3MKS B;  2OVP B;  3C6P B;  1NEX B;  3OGM B;  1P22 A;  3L2O B;  2P1M B;  3V7D B;  2E32 A;  2P1P B;  2P1Q B;  2P1O B;  3C6O B;  3OGL B;  4I6J B;  2OVQ B;  3WSO A;  2OVR B; 
#chains in the Genus database with same CATH topology
 1XVF E;  2LF3 A;  3LDB A;  4FVM A;  2YB5 A;  5IBK B;  1WAJ A;  2P1N B;  4X5N A;  3SVI A;  3HGK E;  3QET A;  4FJG A;  4DTJ A;  4KI4 A;  1FYZ E;  1XU5 E;  2PFT A;  1MHZ G;  3NE6 A;  2K5S A;  1Q9Y A;  3E4W A;  2RCU A;  2H4T A;  3L8B A;  3C95 A;  3NHG A;  3L2O B;  3SCX A;  2QXF A;  3TAE A;  4ADN A;  2OZS A;  3N1B A;  1FZI E;  1XVD E;  2RKH A;  4J2E A;  2P1P B;  1MMO G;  4KI6 A;  1XVG E;  4AKI A;  3NDK A;  5IRE A;  4DU3 A;  3RMB A;  4M3X A;  1XMF E;  2P1O B;  3C6O B;  3J2P A;  3OGL B;  4FK2 A;  4KHQ A;  4I6J B;  4M45 A;  4DU1 A;  1FZ0 E;  3RMA A;  2JHC A;  3K2O A;  2MW2 A;  1XVC E;  4E4B A;  4DTM A;  4RL5 A;  3OGK B;  4FJI A;  1LDK E;  4J2A A;  4KHY A;  2MZW B;  3BVO A;  2JH8 A;  3SUQ A;  4E3S A;  4RG8 A;  3CFO A;  3TL8 B;  1XU3 E;  4ICG C;  2ATQ A;  5H37 A;  4AKG A;  2VJ5 A;  3J27 A;  3L1N A;  4EYW A;  2P5O A;  4HCC A;  4HCB A;  3UIQ A;  1FZ8 E;  4AI6 A;  1FZ9 E;  2P1Q B;  4JS4 A;  5IZ7 A;  4EPH A;  2MMB A;  2P5G A;  2JHA A;  1MHY G;  4EP9 A;  4FJM A;  2VIX A;  3TAG A;  3S9H A;  3WSO A;  2OVR B;  4KHN A;  3QNO A;  1FZ5 E;  4RNG A;  4ADO A;  3SUP A;  4DTX A;  3QES A;  1FXX A;  2JQT A;  4FJ8 A;  3NCI A;  2FYO A;  4M3Z A;  2B8I A;  3CFR A;  4M3Y A;  4M3T A;  1FZ1 E;  2B7M A;  2OVP B;  3SQ4 A;  3NAE A;  1FZ7 E;  1XMH E;  3SI6 A;  4KHW A;  1FZ4 E;  3QEW A;  2VJ4 A;  2OZM A;  4JRQ A;  3TAF A;  4DTO A;  3QNN A;  3N1E A;  1Q9X A;  2PFV A;  3V7D B;  2DY4 A;  2B1E A;  3NGI A;  4FJH A;  1FZ3 E;  3HP9 A;  4X5M A;  3CQ8 A;  3L0M A;  2JPN A;  3SJJ A;  4KHS A;  3UO2 A;  1XMG E;  4DTP A;  4IT5 A;  2JHP A;  2DTU A;  1FZ2 E;  3QEX A;  1N1C A;  3LZJ A;  1IH7 A;  3QEV A;  3KD5 E;  4FK0 A;  3SUO A;  4QND A;  4J2B A;  3QER A;  3RMC A;  2HD0 A;  1FS1 A;  1IG9 A;  3CFP A;  3C6N B;  3KD1 E;  2E31 A;  4FJ7 A;  4I9L A;  3MKS B;  3LDS A;  4M3U A;  3QEP A;  3SQ0 A;  1FPO A;  4DTN A;  4M41 A;  4FJ5 A;  3C6P B;  1NEX B;  4M3W A;  1JW2 A;  3OGM B;  4DU4 A;  4FJL A;  4M42 A;  1FZH E;  4FJ9 A;  3SQ2 A;  4FJN A;  4FK4 A;  3SPZ A;  4M3R A;  2LF6 A;  3TJY A;  2OYQ A;  1P22 A;  4JRP A;  3RWU A;  1CLQ A;  4JS5 A;  4AKH A;  4DTS A;  3QEI A;  4KHU A;  2P1M B;  2JH9 A;  3C94 A;  3RMD A;  1XVE E;  2E32 A;  3E4Y A;  4GAM C;  3SNN A;  4FJX A;  3TAB A;  1WAF A;  4QNC A;  1MTY G;  4FJK A;  2FW3 A;  4DTU A;  4I9Q A;  1XL3 C;  1FZ6 E;  2OVQ B;  4B08 A;  3UO3 A;  3LZI A;  4DTR A;  3HGL A;  4FJJ A;  1XVB E;  3SUN A;  3SPY A;  2DEB A;  3HL8 A;  3SQ1 A;  4J2D A;  3LD8 A; 
#chains in the Genus database with same CATH homology
 1XVF E;  2LF3 A;  3LDB A;  4FVM A;  2YB5 A;  5IBK B;  1WAJ A;  2P1N B;  4X5N A;  3SVI A;  3HGK E;  3QET A;  4FJG A;  4DTJ A;  4KI4 A;  1FYZ E;  1XU5 E;  2PFT A;  1MHZ G;  3NE6 A;  1Q9Y A;  3E4W A;  2RCU A;  2H4T A;  3L8B A;  3C95 A;  3NHG A;  3L2O B;  3SCX A;  2QXF A;  3TAE A;  4ADN A;  2OZS A;  3N1B A;  1FZI E;  1XVD E;  4KI6 A;  4J2E A;  2P1P B;  1MMO G;  4AKI A;  1XVG E;  3NDK A;  5IRE A;  4DU3 A;  3RMB A;  4M3X A;  1XMF E;  2P1O B;  3C6O B;  3J2P A;  3OGL B;  4FK2 A;  4KHQ A;  4I6J B;  4M45 A;  4DU1 A;  1FZ0 E;  3RMA A;  2JHC A;  3K2O A;  1XVC E;  4E4B A;  4DTM A;  4RL5 A;  3OGK B;  4FJI A;  1LDK E;  4J2A A;  4KHY A;  2MZW B;  2JH8 A;  3SUQ A;  4E3S A;  4RG8 A;  3CFO A;  3TL8 B;  1XU3 E;  2ATQ A;  5H37 A;  4AKG A;  2VJ5 A;  3J27 A;  3L1N A;  4EYW A;  2P5O A;  4HCC A;  4HCB A;  3UIQ A;  1FZ8 E;  4AI6 A;  1FZ9 E;  2P1Q B;  4JS4 A;  5IZ7 A;  4EPH A;  2MMB A;  2P5G A;  2JHA A;  1MHY G;  4EP9 A;  4FJM A;  2VIX A;  3TAG A;  3S9H A;  3WSO A;  2OVR B;  4KHN A;  3QNO A;  1FZ5 E;  4RNG A;  4ADO A;  3SUP A;  4DTX A;  3QES A;  1FXX A;  4FJ8 A;  4M3Z A;  3NCI A;  2FYO A;  4M3T A;  2B8I A;  3CFR A;  4M3Y A;  1FZ1 E;  2B7M A;  2OVP B;  3SQ4 A;  3NAE A;  1FZ7 E;  1XMH E;  3SI6 A;  4KHW A;  1FZ4 E;  3QEW A;  2VJ4 A;  2OZM A;  4JRQ A;  3TAF A;  4DTO A;  3QNN A;  3N1E A;  1Q9X A;  2PFV A;  3V7D B;  2DY4 A;  2B1E A;  3NGI A;  4FJH A;  1FZ3 E;  3HP9 A;  4X5M A;  3CQ8 A;  3L0M A;  2JPN A;  3SJJ A;  4KHS A;  1XMG E;  4DTP A;  2JHP A;  2DTU A;  1FZ2 E;  3QEX A;  3LZJ A;  1IH7 A;  3QEV A;  3KD5 E;  4FK0 A;  3SUO A;  4QND A;  4J2B A;  3QER A;  3RMC A;  2HD0 A;  1FS1 A;  1IG9 A;  3CFP A;  3C6N B;  3KD1 E;  2E31 A;  4FJ7 A;  4I9L A;  3MKS B;  3LDS A;  4M3U A;  3QEP A;  3SQ0 A;  4FJ5 A;  4DTN A;  4M41 A;  3C6P B;  1NEX B;  4M3W A;  3OGM B;  4DU4 A;  4FJL A;  4M42 A;  1FZH E;  4FJ9 A;  3SQ2 A;  4FJN A;  4FK4 A;  3SPZ A;  4M3R A;  2LF6 A;  3TJY A;  2OYQ A;  1P22 A;  4JRP A;  3RWU A;  1CLQ A;  4JS5 A;  4AKH A;  4DTS A;  3QEI A;  4KHU A;  3C94 A;  2P1M B;  2JH9 A;  3RMD A;  1XVE E;  2E32 A;  3E4Y A;  4GAM C;  3SNN A;  4FJX A;  3TAB A;  1WAF A;  4QNC A;  1MTY G;  4FJK A;  2FW3 A;  4DTU A;  4I9Q A;  1XL3 C;  1FZ6 E;  2OVQ B;  4B08 A;  3LZI A;  4DTR A;  4FJJ A;  3HGL A;  1XVB E;  3SUN A;  3SPY A;  2DEB A;  3HL8 A;  3SQ1 A;  4J2D A;  3LD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...