4RL5A

Crystal structure of the arabidopsis exocyst subunit exo70 family protein a1
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
556
structure length
448
Chain Sequence
SVILSQFDLLRQAETKVLLDAIAQLRKIIRYFMSSLLAKAQSKLEEEFKQLLASYSKAVEPDRLPILIPSRVLPLLHDLAQQMVQQLLQIYRDTRSFVLEESLKKLGVEKDVQRMQWEVLEAKIGNWIHFMRIAVKLLFAGERQVCDQIFSDQCFAEVTVSSVSMLLSFGDAIRSPEKLFVLLDMYEIMRELHTEIETIFKGKACLEIRDSATGLTKRLAQTAQETFGDFEEAVEKDATKTAVLDGTVHPLTSYVINYVKFLFDYQTTLKQLFDSNSQLASVTMRIMQALQNNLDGKSKQYKDPALTHLFLMNNIHYMVRSVRRSEAKDLLGDDWVQRHRRIVQQHANQYKRVAWTKILQSSSAQGLTVSRGLLKERFKMFNMQFDELHQRQSQWTVPDTELRESLRLAVAEVLLPAYRSFLKRFGPLQKYIKYTAEDLERLLGELFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exocyst complex component EXO70A1
publication title Endosidin2 targets conserved exocyst complex subunit EXO70 to inhibit exocytosis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 138
structure length 448
sequence length 556
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03081 Exo70 Exo70 exocyst complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.170 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4rl5A00
2B1EA 4RL5A 2PFTA 2B7MA 2PFVA
chains in the Genus database with same CATH superfamily
3SUOA 2H4TA 3RMAA 3OGLB 3LDBA 2OZSA 4FJMA 4DU4A 4J2BA 4KHWA 3C94A 4AKGA 2E31A 4FJKA 1XVGE 3SNNA 4JS5A 4B08A 1IH7A 4KI4A 2LF3A 3C6NB 1MTYG 1JW2A 3SQ1A 3CQ8A 4DTXA 4FK0A 3TJYA 4EPHA 3HGLA 4M42A 1Q9YA 3OGKB 3E4WA 3SCXA 2JHCA 3NDKA 1FZ6E 1FZ5E 1FZ7E 3CFPA 4RG8A 2B1EA 3QEPA 2JPNA 1FXXA 3K2OA 3TL8B 2OYQA 2VIXA 2JHPA 2OZMA 4M3ZA 4FJ5A 2JHAA 3HGKE 3N1EA 4X5MA 3SVIA 3QEIA 1FZ9E 3SQ2A 3SPYA 4ICGC 3RMCA 4M3UA 1FZ8E 3WSOA 2P1OB 4EYWA 3QNOA 2HD0A 4FJGA 3OGMB 4HCCA 4J2AA 1WAJA 2VJ5A 1FZ3E 4DTUA 2B7MA 3NCIA 2DY4A 2YB5A 2OVQB 4RNGA 4DTPA 3SQ0A 4FJLA 4FVMA 4ADOA 4DTJA 1FYZE 1FZ0E 4AI6A 3L8BA 4KHUA 4M3TA 4J2DA 1LDKE 4KI6A 3QEXA 4EP9A 3SPZA 1CLQA 1P22A 3UIQA 3J2PA 4DTSA 4E3SA 4KHQA 4KHNA 4M41A 3CFOA 4IT5A 4FK4A 4DU3A 3HL8A 5IZ7A 4I9QA 3MKSB 2JH9A 1WAFA 4FJJA 4QNDA 2QXFA 2VJ4A 3KD5E 1XVFE 1MMOG 3LZJA 2JQTA 4I6JB 4M45A 3TAEA 3C6OB 3J27A 2DEBA 3TABA 3SJJA 4KHSA 3TAGA 4FJIA 3L2OB 4FJ8A 3RWUA 3SUNA 4KHYA 2FW3A 4DTNA 1IG9A 3N1BA 4DTOA 3NGIA 3UO3A 2LF6A 3QESA 3E4YA 4DTRA 1FZ2E 1FS1A 3KD1E 4DTMA 2MW2A 4HCBA 4DU1A 3QEWA 3SQ4A 2DTUA 2P1MB 3TAFA 4J2EA 4M3WA 3S9HA 3SUQA 3C95A 1XMFE 1FPOA 2P1NB 3L0MA 2ATQA 3V7DB 2P1PB 1MHYG 1XL3C 3NE6A 3QEVA 2P5OA 2OVRB 1MHZG 2JH8A 4ADNA 3NAEA 2PFTA 1FZ1E 1NEXB 2MMBA 4I9LA 5H37A 3CFRA 4M3XA 4AKIA 4FJ7A 4FJ9A 1XVBE 3SUPA 4JS4A 4FJXA 1FZIE 3QETA 1XVEE 4FJHA 1XVDE 2MZWB 1XU5E 2B8IA 1FZ4E 1XMGE 4M3RA 3C6PB 3UO2A 4AKHA 3QERA 4FJNA 4RL5A 4X5NA 3LZIA 4JRQA 2P5GA 2OVPB 3RMBA 3QNNA 2PFVA 3LDSA 3NHGA 2P1QB 3LD8A 4M3YA 1FZHE 5IREA 2E32A 1N1CA 4GAMC 5IBKB 1Q9XA 1XVCE 1XMHE 4JRPA 2K5SA 3SI6A 3HP9A 4FK2A 1XU3E 3RMDA 4E4BA 2RCUA 4QNCA 3L1NA 3BVOA 2FYOA 2RKHA
chains in the Genus database with same CATH topology
3SUOA 2H4TA 3RMAA 3OGLB 3LDBA 2OZSA 4FJMA 4DU4A 4J2BA 4KHWA 3C94A 4AKGA 2E31A 4FJKA 1XVGE 3SNNA 4JS5A 4B08A 1IH7A 4KI4A 2LF3A 3C6NB 1MTYG 3SQ1A 3CQ8A 4DTXA 4FK0A 3TJYA 4EPHA 3HGLA 4M42A 1Q9YA 3OGKB 3E4WA 3SCXA 2JHCA 3NDKA 1FZ6E 1FZ5E 1FZ7E 3CFPA 4RG8A 2B1EA 3QEPA 2JPNA 1FXXA 3K2OA 3TL8B 2OYQA 2VIXA 2JHPA 2OZMA 4M3ZA 4FJ5A 2JHAA 3HGKE 3N1EA 4X5MA 3SVIA 3QEIA 1FZ9E 3SQ2A 3SPYA 4M3UA 3RMCA 1FZ8E 3WSOA 2P1OB 4EYWA 3QNOA 2HD0A 4FJGA 3OGMB 4HCCA 4J2AA 1WAJA 2VJ5A 1FZ3E 4DTUA 2B7MA 3NCIA 2DY4A 2YB5A 2OVQB 4RNGA 4DTPA 3SQ0A 4FJLA 4FVMA 4ADOA 4DTJA 1FYZE 1FZ0E 4AI6A 3L8BA 4KHUA 4M3TA 4J2DA 1LDKE 4KI6A 3QEXA 4EP9A 3SPZA 1CLQA 1P22A 3UIQA 3J2PA 4DTSA 4E3SA 4KHQA 4KHNA 4M41A 3CFOA 4FK4A 4DU3A 3HL8A 5IZ7A 4I9QA 3MKSB 2JH9A 1WAFA 4FJJA 4QNDA 2QXFA 2VJ4A 3KD5E 1XVFE 1MMOG 3LZJA 4I6JB 4M45A 3TAEA 3C6OB 3J27A 2DEBA 3TABA 3SJJA 4KHSA 3TAGA 4FJIA 3L2OB 4FJ8A 3RWUA 3SUNA 4KHYA 2FW3A 4DTNA 1IG9A 3N1BA 4DTOA 3NGIA 2LF6A 3QESA 3E4YA 4DTRA 1FZ2E 1FS1A 3KD1E 4DTMA 4HCBA 4DU1A 3QEWA 3SQ4A 2DTUA 2P1MB 3TAFA 4J2EA 4M3WA 3S9HA 3SUQA 3C95A 1XMFE 3L0MA 2P1NB 2ATQA 3V7DB 2P1PB 1MHYG 1XL3C 3NE6A 3QEVA 2P5OA 2OVRB 1MHZG 2JH8A 4ADNA 3NAEA 2PFTA 1FZ1E 1NEXB 2MMBA 4I9LA 5H37A 3CFRA 4M3XA 4AKIA 4FJ7A 4FJ9A 1XVBE 3SUPA 4JS4A 4FJXA 1FZIE 3QETA 1XVEE 4FJHA 1XVDE 2MZWB 1XU5E 2B8IA 1FZ4E 1XMGE 4M3RA 3C6PB 4AKHA 3QERA 4FJNA 4RL5A 4X5NA 3LZIA 4JRQA 2P5GA 2OVPB 3RMBA 3QNNA 2PFVA 3LDSA 3NHGA 2P1QB 3LD8A 4M3YA 1FZHE 5IREA 2E32A 4GAMC 5IBKB 1Q9XA 1XVCE 1XMHE 4JRPA 3SI6A 3HP9A 4FK2A 1XU3E 3RMDA 4E4BA 2RCUA 4QNCA 3L1NA 2FYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1E A;  4RL5 A;  2PFT A;  2B7M A;  2PFV A; 
#chains in the Genus database with same CATH topology
 3SUO A;  2H4T A;  3RMA A;  3OGL B;  3LDB A;  2OZS A;  4FJM A;  4DU4 A;  4J2B A;  4KHW A;  3C94 A;  4AKG A;  2E31 A;  4FJK A;  1XVG E;  3SNN A;  4JS5 A;  4B08 A;  1IH7 A;  4KI4 A;  2LF3 A;  3C6N B;  1MTY G;  1JW2 A;  3SQ1 A;  3CQ8 A;  4DTX A;  4FK0 A;  3TJY A;  4EPH A;  3HGL A;  4M42 A;  1Q9Y A;  3OGK B;  3E4W A;  3SCX A;  2JHC A;  3NDK A;  1FZ6 E;  1FZ5 E;  1FZ7 E;  3CFP A;  4RG8 A;  2B1E A;  3QEP A;  2JPN A;  1FXX A;  3K2O A;  3TL8 B;  2OYQ A;  2VIX A;  2JHP A;  2OZM A;  4M3Z A;  4FJ5 A;  2JHA A;  3HGK E;  3N1E A;  4X5M A;  3SVI A;  3QEI A;  1FZ9 E;  3SQ2 A;  3SPY A;  4ICG C;  3RMC A;  4M3U A;  1FZ8 E;  3WSO A;  2P1O B;  4EYW A;  3QNO A;  2HD0 A;  4FJG A;  3OGM B;  4HCC A;  4J2A A;  1WAJ A;  2VJ5 A;  1FZ3 E;  4DTU A;  2B7M A;  3NCI A;  2DY4 A;  2YB5 A;  2OVQ B;  4RNG A;  4DTP A;  3SQ0 A;  4FJL A;  4FVM A;  4ADO A;  4DTJ A;  1FYZ E;  1FZ0 E;  4AI6 A;  3L8B A;  4KHU A;  4M3T A;  4J2D A;  1LDK E;  4KI6 A;  3QEX A;  4EP9 A;  3SPZ A;  1CLQ A;  1P22 A;  3UIQ A;  3J2P A;  4DTS A;  4E3S A;  4KHQ A;  4KHN A;  4M41 A;  3CFO A;  4IT5 A;  4FK4 A;  4DU3 A;  3HL8 A;  5IZ7 A;  4I9Q A;  3MKS B;  2JH9 A;  1WAF A;  4FJJ A;  4QND A;  2QXF A;  2VJ4 A;  3KD5 E;  1XVF E;  1MMO G;  3LZJ A;  2JQT A;  4I6J B;  4M45 A;  3TAE A;  3C6O B;  3J27 A;  2DEB A;  3TAB A;  3SJJ A;  4KHS A;  3TAG A;  4FJI A;  3L2O B;  4FJ8 A;  3RWU A;  3SUN A;  4KHY A;  2FW3 A;  4DTN A;  1IG9 A;  3N1B A;  4DTO A;  3NGI A;  3UO3 A;  2LF6 A;  3QES A;  3E4Y A;  4DTR A;  1FZ2 E;  1FS1 A;  3KD1 E;  4DTM A;  2MW2 A;  4HCB A;  4DU1 A;  3QEW A;  3SQ4 A;  2DTU A;  2P1M B;  3TAF A;  4J2E A;  4M3W A;  3S9H A;  3SUQ A;  3C95 A;  1XMF E;  1FPO A;  2P1N B;  3L0M A;  2ATQ A;  3V7D B;  2P1P B;  1MHY G;  1XL3 C;  3NE6 A;  3QEV A;  2P5O A;  2OVR B;  1MHZ G;  2JH8 A;  4ADN A;  3NAE A;  2PFT A;  1FZ1 E;  1NEX B;  2MMB A;  4I9L A;  5H37 A;  3CFR A;  4M3X A;  4AKI A;  4FJ7 A;  4FJ9 A;  1XVB E;  3SUP A;  4JS4 A;  4FJX A;  1FZI E;  3QET A;  1XVE E;  4FJH A;  1XVD E;  2MZW B;  1XU5 E;  2B8I A;  1FZ4 E;  1XMG E;  4M3R A;  3C6P B;  3UO2 A;  4AKH A;  3QER A;  4FJN A;  4RL5 A;  4X5N A;  3LZI A;  4JRQ A;  2P5G A;  2OVP B;  3RMB A;  3QNN A;  2PFV A;  3LDS A;  3NHG A;  2P1Q B;  3LD8 A;  4M3Y A;  1FZH E;  5IRE A;  2E32 A;  1N1C A;  4GAM C;  5IBK B;  1Q9X A;  1XVC E;  1XMH E;  4JRP A;  2K5S A;  3SI6 A;  3HP9 A;  4FK2 A;  1XU3 E;  3RMD A;  4E4B A;  2RCU A;  4QNC A;  3L1N A;  3BVO A;  2FYO A;  2RKH A; 
#chains in the Genus database with same CATH homology
 3SUO A;  2H4T A;  3RMA A;  3OGL B;  3LDB A;  2OZS A;  4FJM A;  4DU4 A;  4J2B A;  4KHW A;  3C94 A;  4AKG A;  2E31 A;  4FJK A;  1XVG E;  3SNN A;  4JS5 A;  4B08 A;  1IH7 A;  4KI4 A;  2LF3 A;  3C6N B;  1MTY G;  3SQ1 A;  3CQ8 A;  4DTX A;  4FK0 A;  3TJY A;  4EPH A;  3HGL A;  4M42 A;  1Q9Y A;  3OGK B;  3E4W A;  3SCX A;  2JHC A;  3NDK A;  1FZ6 E;  1FZ5 E;  1FZ7 E;  3CFP A;  4RG8 A;  2B1E A;  3QEP A;  2JPN A;  1FXX A;  3K2O A;  3TL8 B;  2OYQ A;  2VIX A;  2JHP A;  2OZM A;  4M3Z A;  4FJ5 A;  2JHA A;  3HGK E;  3N1E A;  4X5M A;  3SVI A;  3QEI A;  1FZ9 E;  3SQ2 A;  3SPY A;  4M3U A;  3RMC A;  1FZ8 E;  3WSO A;  2P1O B;  4EYW A;  3QNO A;  2HD0 A;  4FJG A;  3OGM B;  4HCC A;  4J2A A;  1WAJ A;  2VJ5 A;  1FZ3 E;  4DTU A;  2B7M A;  3NCI A;  2DY4 A;  2YB5 A;  2OVQ B;  4RNG A;  4DTP A;  3SQ0 A;  4FJL A;  4FVM A;  4ADO A;  4DTJ A;  1FYZ E;  1FZ0 E;  4AI6 A;  3L8B A;  4KHU A;  4M3T A;  4J2D A;  1LDK E;  4KI6 A;  3QEX A;  4EP9 A;  3SPZ A;  1CLQ A;  1P22 A;  3UIQ A;  3J2P A;  4DTS A;  4E3S A;  4KHQ A;  4KHN A;  4M41 A;  3CFO A;  4FK4 A;  4DU3 A;  3HL8 A;  5IZ7 A;  4I9Q A;  3MKS B;  2JH9 A;  1WAF A;  4FJJ A;  4QND A;  2QXF A;  2VJ4 A;  3KD5 E;  1XVF E;  1MMO G;  3LZJ A;  4I6J B;  4M45 A;  3TAE A;  3C6O B;  3J27 A;  2DEB A;  3TAB A;  3SJJ A;  4KHS A;  3TAG A;  4FJI A;  3L2O B;  4FJ8 A;  3RWU A;  3SUN A;  4KHY A;  2FW3 A;  4DTN A;  1IG9 A;  3N1B A;  4DTO A;  3NGI A;  2LF6 A;  3QES A;  3E4Y A;  4DTR A;  1FZ2 E;  1FS1 A;  3KD1 E;  4DTM A;  4HCB A;  4DU1 A;  3QEW A;  3SQ4 A;  2DTU A;  2P1M B;  3TAF A;  4J2E A;  4M3W A;  3S9H A;  3SUQ A;  3C95 A;  1XMF E;  3L0M A;  2P1N B;  2ATQ A;  3V7D B;  2P1P B;  1MHY G;  1XL3 C;  3NE6 A;  3QEV A;  2P5O A;  2OVR B;  1MHZ G;  2JH8 A;  4ADN A;  3NAE A;  2PFT A;  1FZ1 E;  1NEX B;  2MMB A;  4I9L A;  5H37 A;  3CFR A;  4M3X A;  4AKI A;  4FJ7 A;  4FJ9 A;  1XVB E;  3SUP A;  4JS4 A;  4FJX A;  1FZI E;  3QET A;  1XVE E;  4FJH A;  1XVD E;  2MZW B;  1XU5 E;  2B8I A;  1FZ4 E;  1XMG E;  4M3R A;  3C6P B;  4AKH A;  3QER A;  4FJN A;  4RL5 A;  4X5N A;  3LZI A;  4JRQ A;  2P5G A;  2OVP B;  3RMB A;  3QNN A;  2PFV A;  3LDS A;  3NHG A;  2P1Q B;  3LD8 A;  4M3Y A;  1FZH E;  5IRE A;  2E32 A;  4GAM C;  5IBK B;  1Q9X A;  1XVC E;  1XMH E;  4JRP A;  3SI6 A;  3HP9 A;  4FK2 A;  1XU3 E;  3RMD A;  4E4B A;  2RCU A;  4QNC A;  3L1N A;  2FYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...