4RL5A

Crystal structure of the arabidopsis exocyst subunit exo70 family protein a1
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
556
structure length
448
Chain Sequence
SVILSQFDLLRQAETKVLLDAIAQLRKIIRYFMSSLLAKAQSKLEEEFKQLLASYSKAVEPDRLPILIPSRVLPLLHDLAQQMVQQLLQIYRDTRSFVLEESLKKLGVEKDVQRMQWEVLEAKIGNWIHFMRIAVKLLFAGERQVCDQIFSDQCFAEVTVSSVSMLLSFGDAIRSPEKLFVLLDMYEIMRELHTEIETIFKGKACLEIRDSATGLTKRLAQTAQETFGDFEEAVEKDATKTAVLDGTVHPLTSYVINYVKFLFDYQTTLKQLFDSNSQLASVTMRIMQALQNNLDGKSKQYKDPALTHLFLMNNIHYMVRSVRRSEAKDLLGDDWVQRHRRIVQQHANQYKRVAWTKILQSSSAQGLTVSRGLLKERFKMFNMQFDELHQRQSQWTVPDTELRESLRLAVAEVLLPAYRSFLKRFGPLQKYIKYTAEDLERLLGELFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Endosidin2 targets conserved exocyst complex subunit EXO70 to inhibit exocytosis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
molecule keywords Exocyst complex component EXO70A1
total genus 138
structure length 448
sequence length 556
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03081 Exo70 Exo70 exocyst complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.170 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4rl5A00
2PFTA 2PFVA 2B7MA 4RL5A 2B1EA
chains in the Genus database with same CATH superfamily
3E4YA 5H37A 3UO2A 1NEXB 4RG8A 2OYQA 3NE6A 4DTNA 3HGKE 4RL5A 4M42A 4DU3A 1XMFE 2H4TA 3N1EA 2MW2A 1WAJA 4FK2A 3SQ4A 3LZJA 2PFVA 2FW3A 4FJKA 4ADOA 3LZIA 2E31A 3C94A 2P5OA 2JPNA 2MZWB 4JS4A 1FS1A 4J2EA 2YB5A 1FZ0E 2JHPA 4J2AA 4FK0A 3TAFA 4DU1A 3RWUA 4FJ8A 4FJHA 3MKSB 3QEXA 3SUQA 1XVDE 3L0MA 3E4WA 4QNCA 3TABA 4FJJA 3CQ8A 4KHWA 1FZHE 4RNGA 3QEIA 1FZ2E 1FZIE 3KD5E 4FJLA 3QNNA 3SUPA 4HCBA 1IH7A 4JS5A 3QETA 2P1MB 4KHYA 2P1OB 1XMGE 4GAMC 2MMBA 4FVMA 4JRPA 4EYWA 3S9HA 2OVRB 1WAFA 4M41A 1LDKE 3UIQA 2FYOA 3TAEA 1MTYG 2E32A 3NAEA 3SQ2A 3C95A 3RMBA 4M3UA 3QEPA 1XMHE 1XU3E 2RKHA 3C6OB 4DTMA 3RMCA 1Q9YA 4M3TA 4FJMA 4AKGA 4ICGC 4DTOA 4B08A 5IREA 3C6PB 3SPYA 2LF6A 3K2OA 3C6NB 3QEWA 3V7DB 3LDSA 3L1NA 3BVOA 4FJXA 4AKIA 4KI4A 2ATQA 2JH9A 4M3WA 5IBKB 1P22A 3WSOA 1Q9XA 1MHZG 1MHYG 2B7MA 4HCCA 4M3ZA 1XVFE 1FZ5E 3LD8A 3SCXA 2K5SA 3TL8B 4KHNA 3L8BA 3SVIA 3TAGA 1FXXA 1XVGE 3HGLA 3J27A 3SQ1A 4E3SA 3RMAA 1FPOA 3OGLB 1FZ8E 3QNOA 2B8IA 5IZ7A 3QEVA 2P5GA 1FZ3E 4I9QA 3SPZA 3NGIA 4DTUA 2HD0A 4ADNA 3L2OB 4J2BA 4M3XA 1XVEE 1MMOG 1FZ1E 4IT5A 1IG9A 4AKHA 4E4BA 4FJIA 4I9LA 2JH8A 2JHCA 1CLQA 4FJGA 2JQTA 1FYZE 4M3RA 4M45A 3NCIA 3QERA 2PFTA 3SQ0A 3UO3A 3RMDA 3HP9A 4KI6A 1FZ7E 1XU5E 4FK4A 3CFRA 1JW2A 2RCUA 3HL8A 4QNDA 1XVCE 4DU4A 3NHGA 1FZ6E 3OGKB 2OZMA 2OVQB 3SNNA 4DTSA 2JHAA 4DTXA 2OVPB 4I6JB 2VIXA 4FJ5A 2QXFA 3LDBA 3QESA 3CFOA 2P1PB 4DTJA 1FZ9E 2DEBA 4EPHA 1XVBE 2VJ5A 2B1EA 4DTRA 4J2DA 3KD1E 4AI6A 4KHUA 4X5MA 4JRQA 1XL3C 2P1QB 2OZSA 1FZ4E 4KHSA 3OGMB 3SJJA 2LF3A 4DTPA 2P1NB 3SI6A 4FJ7A 4EP9A 2DY4A 4FJ9A 3SUOA 3J2PA 3N1BA 4KHQA 4M3YA 1N1CA 2VJ4A 4X5NA 3CFPA 3TJYA 3SUNA 2DTUA 3NDKA 4FJNA
chains in the Genus database with same CATH topology
3E4YA 5H37A 2OYQA 1NEXB 4RG8A 3NE6A 4DTNA 3HGKE 4RL5A 4M42A 4DU3A 1XMFE 2H4TA 3N1EA 1WAJA 4FK2A 3SQ4A 3LZJA 2PFVA 2FW3A 4FJKA 4ADOA 3LZIA 2E31A 3C94A 2P5OA 2JPNA 2MZWB 4JS4A 1FS1A 4J2EA 2YB5A 1FZ0E 2JHPA 4J2AA 4FK0A 3TAFA 4DU1A 3RWUA 4FJ8A 4FJHA 3MKSB 3QEXA 3SUQA 1XVDE 3L0MA 3E4WA 4QNCA 3TABA 4FJJA 3CQ8A 4KHWA 1FZHE 4RNGA 3QEIA 1FZ2E 1FZIE 3KD5E 4FJLA 3QNNA 3SUPA 4HCBA 1IH7A 4JS5A 3QETA 2P1MB 4KHYA 2P1OB 1XMGE 4GAMC 2MMBA 4FVMA 4JRPA 4EYWA 3S9HA 2OVRB 1WAFA 4M41A 1LDKE 3UIQA 2FYOA 3TAEA 1MTYG 2E32A 3NAEA 3SQ2A 3C95A 3RMBA 4M3UA 3QEPA 1XMHE 1XU3E 3C6OB 4DTMA 3RMCA 1Q9YA 4M3TA 4FJMA 4AKGA 4DTOA 4B08A 5IREA 3C6PB 3SPYA 2LF6A 3K2OA 3C6NB 3QEWA 3V7DB 3LDSA 3L1NA 4AKIA 4FJXA 4KI4A 2ATQA 2JH9A 4M3WA 5IBKB 1P22A 3WSOA 1Q9XA 1MHZG 1MHYG 2B7MA 4HCCA 4M3ZA 1XVFE 1FZ5E 3LD8A 3SCXA 3TL8B 4KHNA 3L8BA 3SVIA 3TAGA 1FXXA 1XVGE 3HGLA 3J27A 3SQ1A 4E3SA 3RMAA 3OGLB 1FZ8E 3QNOA 2B8IA 5IZ7A 3QEVA 2P5GA 1FZ3E 4I9QA 3SPZA 3NGIA 4DTUA 2HD0A 4ADNA 3L2OB 4J2BA 4M3XA 1XVEE 1MMOG 1FZ1E 1IG9A 4AKHA 4E4BA 4FJIA 4I9LA 2JH8A 2JHCA 1CLQA 4FJGA 1FYZE 4M3RA 4M45A 3NCIA 3QERA 2PFTA 3SQ0A 3RMDA 3HP9A 4KI6A 1FZ7E 1XU5E 4FK4A 3CFRA 2RCUA 3HL8A 4QNDA 1XVCE 4DU4A 3NHGA 1FZ6E 3OGKB 2OZMA 2OVQB 3SNNA 4DTSA 2JHAA 4DTXA 2OVPB 4I6JB 2VIXA 4FJ5A 2QXFA 3LDBA 3QESA 3CFOA 2P1PB 4DTJA 1FZ9E 2DEBA 4EPHA 1XVBE 2VJ5A 2B1EA 4DTRA 4J2DA 3KD1E 4AI6A 4KHUA 4X5MA 4JRQA 1XL3C 2P1QB 2OZSA 1FZ4E 4KHSA 3OGMB 3SJJA 2LF3A 4DTPA 2P1NB 3SI6A 4FJ7A 4EP9A 2DY4A 4FJ9A 3SUOA 3J2PA 3N1BA 4KHQA 4M3YA 3CFPA 2VJ4A 4X5NA 3SUNA 3TJYA 2DTUA 3NDKA 4FJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFT A;  2PFV A;  2B7M A;  4RL5 A;  2B1E A; 
#chains in the Genus database with same CATH topology
 3E4Y A;  5H37 A;  3UO2 A;  1NEX B;  4RG8 A;  2OYQ A;  3NE6 A;  4DTN A;  3HGK E;  4RL5 A;  4M42 A;  4DU3 A;  1XMF E;  2H4T A;  3N1E A;  2MW2 A;  1WAJ A;  4FK2 A;  3SQ4 A;  3LZJ A;  2PFV A;  2FW3 A;  4FJK A;  4ADO A;  3LZI A;  2E31 A;  3C94 A;  2P5O A;  2JPN A;  2MZW B;  4JS4 A;  1FS1 A;  4J2E A;  2YB5 A;  1FZ0 E;  2JHP A;  4J2A A;  4FK0 A;  3TAF A;  4DU1 A;  3RWU A;  4FJ8 A;  4FJH A;  3MKS B;  3QEX A;  3SUQ A;  1XVD E;  3L0M A;  3E4W A;  4QNC A;  3TAB A;  4FJJ A;  3CQ8 A;  4KHW A;  1FZH E;  4RNG A;  3QEI A;  1FZ2 E;  1FZI E;  3KD5 E;  4FJL A;  3QNN A;  3SUP A;  4HCB A;  1IH7 A;  4JS5 A;  3QET A;  2P1M B;  4KHY A;  2P1O B;  1XMG E;  4GAM C;  2MMB A;  4FVM A;  4JRP A;  4EYW A;  3S9H A;  2OVR B;  1WAF A;  4M41 A;  1LDK E;  3UIQ A;  2FYO A;  3TAE A;  1MTY G;  2E32 A;  3NAE A;  3SQ2 A;  3C95 A;  3RMB A;  4M3U A;  3QEP A;  1XMH E;  1XU3 E;  2RKH A;  3C6O B;  4DTM A;  3RMC A;  1Q9Y A;  4M3T A;  4FJM A;  4AKG A;  4ICG C;  4DTO A;  4B08 A;  5IRE A;  3C6P B;  3SPY A;  2LF6 A;  3K2O A;  3C6N B;  3QEW A;  3V7D B;  3LDS A;  3L1N A;  3BVO A;  4FJX A;  4AKI A;  4KI4 A;  2ATQ A;  2JH9 A;  4M3W A;  5IBK B;  1P22 A;  3WSO A;  1Q9X A;  1MHZ G;  1MHY G;  2B7M A;  4HCC A;  4M3Z A;  1XVF E;  1FZ5 E;  3LD8 A;  3SCX A;  2K5S A;  3TL8 B;  4KHN A;  3L8B A;  3SVI A;  3TAG A;  1FXX A;  1XVG E;  3HGL A;  3J27 A;  3SQ1 A;  4E3S A;  3RMA A;  1FPO A;  3OGL B;  1FZ8 E;  3QNO A;  2B8I A;  5IZ7 A;  3QEV A;  2P5G A;  1FZ3 E;  4I9Q A;  3SPZ A;  3NGI A;  4DTU A;  2HD0 A;  4ADN A;  3L2O B;  4J2B A;  4M3X A;  1XVE E;  1MMO G;  1FZ1 E;  4IT5 A;  1IG9 A;  4AKH A;  4E4B A;  4FJI A;  4I9L A;  2JH8 A;  2JHC A;  1CLQ A;  4FJG A;  2JQT A;  1FYZ E;  4M3R A;  4M45 A;  3NCI A;  3QER A;  2PFT A;  3SQ0 A;  3UO3 A;  3RMD A;  3HP9 A;  4KI6 A;  1FZ7 E;  1XU5 E;  4FK4 A;  3CFR A;  1JW2 A;  2RCU A;  3HL8 A;  4QND A;  1XVC E;  4DU4 A;  3NHG A;  1FZ6 E;  3OGK B;  2OZM A;  2OVQ B;  3SNN A;  4DTS A;  2JHA A;  4DTX A;  2OVP B;  4I6J B;  2VIX A;  4FJ5 A;  2QXF A;  3LDB A;  3QES A;  3CFO A;  2P1P B;  4DTJ A;  1FZ9 E;  2DEB A;  4EPH A;  1XVB E;  2VJ5 A;  2B1E A;  4DTR A;  4J2D A;  3KD1 E;  4AI6 A;  4KHU A;  4X5M A;  4JRQ A;  1XL3 C;  2P1Q B;  2OZS A;  1FZ4 E;  4KHS A;  3OGM B;  3SJJ A;  2LF3 A;  4DTP A;  2P1N B;  3SI6 A;  4FJ7 A;  4EP9 A;  2DY4 A;  4FJ9 A;  3SUO A;  3J2P A;  3N1B A;  4KHQ A;  4M3Y A;  1N1C A;  2VJ4 A;  4X5N A;  3CFP A;  3TJY A;  3SUN A;  2DTU A;  3NDK A;  4FJN A; 
#chains in the Genus database with same CATH homology
 3E4Y A;  5H37 A;  2OYQ A;  1NEX B;  4RG8 A;  3NE6 A;  4DTN A;  3HGK E;  4RL5 A;  4M42 A;  4DU3 A;  1XMF E;  2H4T A;  3N1E A;  1WAJ A;  4FK2 A;  3SQ4 A;  3LZJ A;  2PFV A;  2FW3 A;  4FJK A;  4ADO A;  3LZI A;  2E31 A;  3C94 A;  2P5O A;  2JPN A;  2MZW B;  4JS4 A;  1FS1 A;  4J2E A;  2YB5 A;  1FZ0 E;  2JHP A;  4J2A A;  4FK0 A;  3TAF A;  4DU1 A;  3RWU A;  4FJ8 A;  4FJH A;  3MKS B;  3QEX A;  3SUQ A;  1XVD E;  3L0M A;  3E4W A;  4QNC A;  3TAB A;  4FJJ A;  3CQ8 A;  4KHW A;  1FZH E;  4RNG A;  3QEI A;  1FZ2 E;  1FZI E;  3KD5 E;  4FJL A;  3QNN A;  3SUP A;  4HCB A;  1IH7 A;  4JS5 A;  3QET A;  2P1M B;  4KHY A;  2P1O B;  1XMG E;  4GAM C;  2MMB A;  4FVM A;  4JRP A;  4EYW A;  3S9H A;  2OVR B;  1WAF A;  4M41 A;  1LDK E;  3UIQ A;  2FYO A;  3TAE A;  1MTY G;  2E32 A;  3NAE A;  3SQ2 A;  3C95 A;  3RMB A;  4M3U A;  3QEP A;  1XMH E;  1XU3 E;  3C6O B;  4DTM A;  3RMC A;  1Q9Y A;  4M3T A;  4FJM A;  4AKG A;  4DTO A;  4B08 A;  5IRE A;  3C6P B;  3SPY A;  2LF6 A;  3K2O A;  3C6N B;  3QEW A;  3V7D B;  3LDS A;  3L1N A;  4AKI A;  4FJX A;  4KI4 A;  2ATQ A;  2JH9 A;  4M3W A;  5IBK B;  1P22 A;  3WSO A;  1Q9X A;  1MHZ G;  1MHY G;  2B7M A;  4HCC A;  4M3Z A;  1XVF E;  1FZ5 E;  3LD8 A;  3SCX A;  3TL8 B;  4KHN A;  3L8B A;  3SVI A;  3TAG A;  1FXX A;  1XVG E;  3HGL A;  3J27 A;  3SQ1 A;  4E3S A;  3RMA A;  3OGL B;  1FZ8 E;  3QNO A;  2B8I A;  5IZ7 A;  3QEV A;  2P5G A;  1FZ3 E;  4I9Q A;  3SPZ A;  3NGI A;  4DTU A;  2HD0 A;  4ADN A;  3L2O B;  4J2B A;  4M3X A;  1XVE E;  1MMO G;  1FZ1 E;  1IG9 A;  4AKH A;  4E4B A;  4FJI A;  4I9L A;  2JH8 A;  2JHC A;  1CLQ A;  4FJG A;  1FYZ E;  4M3R A;  4M45 A;  3NCI A;  3QER A;  2PFT A;  3SQ0 A;  3RMD A;  3HP9 A;  4KI6 A;  1FZ7 E;  1XU5 E;  4FK4 A;  3CFR A;  2RCU A;  3HL8 A;  4QND A;  1XVC E;  4DU4 A;  3NHG A;  1FZ6 E;  3OGK B;  2OZM A;  2OVQ B;  3SNN A;  4DTS A;  2JHA A;  4DTX A;  2OVP B;  4I6J B;  2VIX A;  4FJ5 A;  2QXF A;  3LDB A;  3QES A;  3CFO A;  2P1P B;  4DTJ A;  1FZ9 E;  2DEB A;  4EPH A;  1XVB E;  2VJ5 A;  2B1E A;  4DTR A;  4J2D A;  3KD1 E;  4AI6 A;  4KHU A;  4X5M A;  4JRQ A;  1XL3 C;  2P1Q B;  2OZS A;  1FZ4 E;  4KHS A;  3OGM B;  3SJJ A;  2LF3 A;  4DTP A;  2P1N B;  3SI6 A;  4FJ7 A;  4EP9 A;  2DY4 A;  4FJ9 A;  3SUO A;  3J2P A;  3N1B A;  4KHQ A;  4M3Y A;  3CFP A;  2VJ4 A;  4X5N A;  3SUN A;  3TJY A;  2DTU A;  3NDK A;  4FJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...