4RL5A

Crystal structure of the arabidopsis exocyst subunit exo70 family protein a1
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
556
structure length
448
Chain Sequence
SVILSQFDLLRQAETKVLLDAIAQLRKIIRYFMSSLLAKAQSKLEEEFKQLLASYSKAVEPDRLPILIPSRVLPLLHDLAQQMVQQLLQIYRDTRSFVLEESLKKLGVEKDVQRMQWEVLEAKIGNWIHFMRIAVKLLFAGERQVCDQIFSDQCFAEVTVSSVSMLLSFGDAIRSPEKLFVLLDMYEIMRELHTEIETIFKGKACLEIRDSATGLTKRLAQTAQETFGDFEEAVEKDATKTAVLDGTVHPLTSYVINYVKFLFDYQTTLKQLFDSNSQLASVTMRIMQALQNNLDGKSKQYKDPALTHLFLMNNIHYMVRSVRRSEAKDLLGDDWVQRHRRIVQQHANQYKRVAWTKILQSSSAQGLTVSRGLLKERFKMFNMQFDELHQRQSQWTVPDTELRESLRLAVAEVLLPAYRSFLKRFGPLQKYIKYTAEDLERLLGELFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Exocyst complex component EXO70A1
publication title Endosidin2 targets conserved exocyst complex subunit EXO70 to inhibit exocytosis.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 138
structure length 448
sequence length 556
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03081 Exo70 Exo70 exocyst complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.170 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4rl5A00
2B7MA 4RL5A 2PFTA 2PFVA 2B1EA
chains in the Genus database with same CATH superfamily
4FJIA 4J2EA 3C6NB 4KHWA 2RKHA 4GAMC 5IBKB 3CFRA 4JS4A 3QEXA 3SQ4A 4DTMA 3SUPA 2P1PB 4I9LA 3NAEA 2LF3A 3K2OA 1IG9A 3RMBA 1WAJA 3OGMB 4E4BA 2JHCA 3SCXA 4KI6A 4I6JB 4M3XA 4AKIA 2P1NB 2JH9A 4E3SA 3SUOA 4FJMA 2MW2A 3HL8A 3J2PA 3LDBA 3QNOA 3C94A 3QEWA 1FS1A 1FZ4E 1FZ9E 2P1MB 2B1EA 1FXXA 1XVCE 4QNCA 2RCUA 4RG8A 3C95A 3CFOA 1XVEE 3SJJA 4KHUA 4KHNA 3NCIA 3QEIA 2QXFA 4DTUA 3S9HA 1Q9YA 4FJHA 2JQTA 4M3UA 2B7MA 1FZ1E 4AI6A 2MMBA 4KHQA 1FZ2E 3J27A 4DTRA 4FJ5A 1XVDE 2FYOA 3KD5E 3QEVA 3SUQA 4KHSA 3TL8B 1N1CA 3C6OB 2JPNA 2VJ4A 1XL3C 4FJ9A 4FK4A 4X5MA 1FZ6E 3UO2A 5IREA 3SPYA 4X5NA 2H4TA 2P1OB 3MKSB 4FJKA 1FZ8E 5H37A 1CLQA 4IT5A 1FZ0E 2JHAA 1FZIE 2DEBA 3SQ2A 2OVPB 1Q9XA 4HCBA 2K5SA 3LZJA 3NHGA 1XVBE 1MMOG 1XVGE 1FZ7E 2HD0A 3E4YA 3N1BA 3RMAA 3SPZA 3L1NA 3KD1E 4FJ8A 2OZSA 4M3YA 4QNDA 4JRQA 3NGIA 3TJYA 4M3RA 4EYWA 4DU1A 3UIQA 2E31A 2OZMA 4M42A 4EPHA 1NEXB 4M3ZA 4I9QA 3BVOA 3N1EA 1WAFA 2OVRB 3CFPA 3OGKB 2FW3A 2YB5A 4EP9A 2P5OA 1FZ5E 1XU5E 1XMHE 3CQ8A 4DTOA 4FJLA 4J2BA 4AKHA 3SUNA 3RMDA 4FK2A 1IH7A 1XMGE 1JW2A 4FK0A 3QEPA 4J2AA 4M3WA 2DTUA 4M41A 4FJ7A 1MTYG 3NE6A 3TAEA 1XU3E 3HP9A 4DTPA 4FJJA 4DTNA 4DTJA 3LD8A 3TABA 4FJGA 4DU4A 4FJNA 3QESA 3TAFA 2E32A 3QNNA 2P1QB 3SQ0A 1MHYG 3UO3A 1FPOA 3WSOA 2VIXA 3L2OB 3V7DB 4M45A 2OVQB 2OYQA 2ATQA 2DY4A 4AKGA 4RNGA 3OGLB 4M3TA 5IZ7A 2B8IA 4RL5A 4JS5A 4DU3A 3SVIA 4KHYA 3SNNA 3SQ1A 3L8BA 1LDKE 4DTXA 4B08A 3TAGA 3L0MA 4KI4A 3C6PB 3LZIA 1FZ3E 2JHPA 3LDSA 2PFTA 2LF6A 3RWUA 3QERA 1XMFE 3RMCA 2JH8A 4HCCA 3HGKE 1XVFE 4ICGC 1FYZE 3E4WA 4ADNA 3QETA 4ADOA 2VJ5A 4JRPA 1MHZG 4DTSA 4J2DA 2MZWB 1FZHE 3HGLA 2PFVA 1P22A 4FJXA 3SI6A 4FVMA 3NDKA 2P5GA
chains in the Genus database with same CATH topology
4FJIA 4J2EA 3C6NB 4KHWA 4GAMC 5IBKB 3CFRA 3QEXA 4JS4A 3SQ4A 4DTMA 3SUPA 2P1PB 4I9LA 3NAEA 2LF3A 3K2OA 1IG9A 3RMBA 1WAJA 3OGMB 4E4BA 2JHCA 3SCXA 4KI6A 4I6JB 4M3XA 4AKIA 2P1NB 2JH9A 4E3SA 3SUOA 4FJMA 3HL8A 3J2PA 3LDBA 3QNOA 3C94A 3QEWA 1FS1A 1FZ4E 1FZ9E 2P1MB 2B1EA 1FXXA 1XVCE 4QNCA 2RCUA 4RG8A 3C95A 3CFOA 1XVEE 3SJJA 4KHUA 4KHNA 3NCIA 3QEIA 2QXFA 4DTUA 3S9HA 1Q9YA 4FJHA 4M3UA 2B7MA 1FZ1E 4AI6A 2MMBA 4KHQA 1FZ2E 3J27A 4DTRA 4FJ5A 1XVDE 2FYOA 3KD5E 3QEVA 3SUQA 4KHSA 3TL8B 3C6OB 2JPNA 2VJ4A 1XL3C 4FJ9A 4FK4A 4X5MA 1FZ6E 5IREA 3SPYA 4X5NA 2H4TA 2P1OB 3MKSB 4FJKA 1FZ8E 5H37A 1CLQA 1FZ0E 2JHAA 1FZIE 2DEBA 3SQ2A 2OVPB 1Q9XA 4HCBA 3LZJA 3NHGA 1XVBE 1MMOG 1XVGE 1FZ7E 2HD0A 3E4YA 3N1BA 3RMAA 3SPZA 3L1NA 3KD1E 4FJ8A 2OZSA 4M3YA 4QNDA 4JRQA 3NGIA 3TJYA 4M3RA 4EYWA 4DU1A 3UIQA 2E31A 2OZMA 4M42A 4EPHA 1NEXB 4M3ZA 4I9QA 3N1EA 1WAFA 2OVRB 3CFPA 3OGKB 2FW3A 2YB5A 4EP9A 2P5OA 1FZ5E 1XU5E 1XMHE 3CQ8A 4DTOA 4FJLA 4J2BA 4AKHA 3SUNA 3RMDA 4FK2A 1IH7A 1XMGE 4FK0A 3QEPA 4J2AA 4M3WA 2DTUA 4M41A 4FJ7A 1MTYG 3NE6A 3TAEA 1XU3E 3HP9A 4DTPA 4FJJA 4DTNA 4DTJA 3LD8A 3TABA 4FJGA 4DU4A 4FJNA 3QESA 3TAFA 2E32A 3QNNA 2P1QB 3SQ0A 1MHYG 3WSOA 2VIXA 3L2OB 3V7DB 4M45A 2OVQB 2OYQA 2ATQA 2DY4A 4AKGA 4RNGA 3OGLB 4M3TA 5IZ7A 2B8IA 4RL5A 4JS5A 4DU3A 3SVIA 4KHYA 3SNNA 3SQ1A 3L8BA 1LDKE 4DTXA 4B08A 3TAGA 3L0MA 4KI4A 3C6PB 3LZIA 1FZ3E 2JHPA 3LDSA 2PFTA 2LF6A 3RWUA 3QERA 1XMFE 3RMCA 2JH8A 4HCCA 3HGKE 1XVFE 1FYZE 3E4WA 4ADNA 3QETA 4ADOA 2VJ5A 4JRPA 1MHZG 4DTSA 4J2DA 2MZWB 1FZHE 3HGLA 2PFVA 1P22A 4FJXA 3SI6A 4FVMA 3NDKA 2P5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7M A;  4RL5 A;  2PFT A;  2PFV A;  2B1E A; 
#chains in the Genus database with same CATH topology
 4FJI A;  4J2E A;  3C6N B;  4KHW A;  2RKH A;  4GAM C;  5IBK B;  3CFR A;  4JS4 A;  3QEX A;  3SQ4 A;  4DTM A;  3SUP A;  2P1P B;  4I9L A;  3NAE A;  2LF3 A;  3K2O A;  1IG9 A;  3RMB A;  1WAJ A;  3OGM B;  4E4B A;  2JHC A;  3SCX A;  4KI6 A;  4I6J B;  4M3X A;  4AKI A;  2P1N B;  2JH9 A;  4E3S A;  3SUO A;  4FJM A;  2MW2 A;  3HL8 A;  3J2P A;  3LDB A;  3QNO A;  3C94 A;  3QEW A;  1FS1 A;  1FZ4 E;  1FZ9 E;  2P1M B;  2B1E A;  1FXX A;  1XVC E;  4QNC A;  2RCU A;  4RG8 A;  3C95 A;  3CFO A;  1XVE E;  3SJJ A;  4KHU A;  4KHN A;  3NCI A;  3QEI A;  2QXF A;  4DTU A;  3S9H A;  1Q9Y A;  4FJH A;  2JQT A;  4M3U A;  2B7M A;  1FZ1 E;  4AI6 A;  2MMB A;  4KHQ A;  1FZ2 E;  3J27 A;  4DTR A;  4FJ5 A;  1XVD E;  2FYO A;  3KD5 E;  3QEV A;  3SUQ A;  4KHS A;  3TL8 B;  1N1C A;  3C6O B;  2JPN A;  2VJ4 A;  1XL3 C;  4FJ9 A;  4FK4 A;  4X5M A;  1FZ6 E;  3UO2 A;  5IRE A;  3SPY A;  4X5N A;  2H4T A;  2P1O B;  3MKS B;  4FJK A;  1FZ8 E;  5H37 A;  1CLQ A;  4IT5 A;  1FZ0 E;  2JHA A;  1FZI E;  2DEB A;  3SQ2 A;  2OVP B;  1Q9X A;  4HCB A;  2K5S A;  3LZJ A;  3NHG A;  1XVB E;  1MMO G;  1XVG E;  1FZ7 E;  2HD0 A;  3E4Y A;  3N1B A;  3RMA A;  3SPZ A;  3L1N A;  3KD1 E;  4FJ8 A;  2OZS A;  4M3Y A;  4QND A;  4JRQ A;  3NGI A;  3TJY A;  4M3R A;  4EYW A;  4DU1 A;  3UIQ A;  2E31 A;  2OZM A;  4M42 A;  4EPH A;  1NEX B;  4M3Z A;  4I9Q A;  3BVO A;  3N1E A;  1WAF A;  2OVR B;  3CFP A;  3OGK B;  2FW3 A;  2YB5 A;  4EP9 A;  2P5O A;  1FZ5 E;  1XU5 E;  1XMH E;  3CQ8 A;  4DTO A;  4FJL A;  4J2B A;  4AKH A;  3SUN A;  3RMD A;  4FK2 A;  1IH7 A;  1XMG E;  1JW2 A;  4FK0 A;  3QEP A;  4J2A A;  4M3W A;  2DTU A;  4M41 A;  4FJ7 A;  1MTY G;  3NE6 A;  3TAE A;  1XU3 E;  3HP9 A;  4DTP A;  4FJJ A;  4DTN A;  4DTJ A;  3LD8 A;  3TAB A;  4FJG A;  4DU4 A;  4FJN A;  3QES A;  3TAF A;  2E32 A;  3QNN A;  2P1Q B;  3SQ0 A;  1MHY G;  3UO3 A;  1FPO A;  3WSO A;  2VIX A;  3L2O B;  3V7D B;  4M45 A;  2OVQ B;  2OYQ A;  2ATQ A;  2DY4 A;  4AKG A;  4RNG A;  3OGL B;  4M3T A;  5IZ7 A;  2B8I A;  4RL5 A;  4JS5 A;  4DU3 A;  3SVI A;  4KHY A;  3SNN A;  3SQ1 A;  3L8B A;  1LDK E;  4DTX A;  4B08 A;  3TAG A;  3L0M A;  4KI4 A;  3C6P B;  3LZI A;  1FZ3 E;  2JHP A;  3LDS A;  2PFT A;  2LF6 A;  3RWU A;  3QER A;  1XMF E;  3RMC A;  2JH8 A;  4HCC A;  3HGK E;  1XVF E;  4ICG C;  1FYZ E;  3E4W A;  4ADN A;  3QET A;  4ADO A;  2VJ5 A;  4JRP A;  1MHZ G;  4DTS A;  4J2D A;  2MZW B;  1FZH E;  3HGL A;  2PFV A;  1P22 A;  4FJX A;  3SI6 A;  4FVM A;  3NDK A;  2P5G A; 
#chains in the Genus database with same CATH homology
 4FJI A;  4J2E A;  3C6N B;  4KHW A;  4GAM C;  5IBK B;  3CFR A;  3QEX A;  4JS4 A;  3SQ4 A;  4DTM A;  3SUP A;  2P1P B;  4I9L A;  3NAE A;  2LF3 A;  3K2O A;  1IG9 A;  3RMB A;  1WAJ A;  3OGM B;  4E4B A;  2JHC A;  3SCX A;  4KI6 A;  4I6J B;  4M3X A;  4AKI A;  2P1N B;  2JH9 A;  4E3S A;  3SUO A;  4FJM A;  3HL8 A;  3J2P A;  3LDB A;  3QNO A;  3C94 A;  3QEW A;  1FS1 A;  1FZ4 E;  1FZ9 E;  2P1M B;  2B1E A;  1FXX A;  1XVC E;  4QNC A;  2RCU A;  4RG8 A;  3C95 A;  3CFO A;  1XVE E;  3SJJ A;  4KHU A;  4KHN A;  3NCI A;  3QEI A;  2QXF A;  4DTU A;  3S9H A;  1Q9Y A;  4FJH A;  4M3U A;  2B7M A;  1FZ1 E;  4AI6 A;  2MMB A;  4KHQ A;  1FZ2 E;  3J27 A;  4DTR A;  4FJ5 A;  1XVD E;  2FYO A;  3KD5 E;  3QEV A;  3SUQ A;  4KHS A;  3TL8 B;  3C6O B;  2JPN A;  2VJ4 A;  1XL3 C;  4FJ9 A;  4FK4 A;  4X5M A;  1FZ6 E;  5IRE A;  3SPY A;  4X5N A;  2H4T A;  2P1O B;  3MKS B;  4FJK A;  1FZ8 E;  5H37 A;  1CLQ A;  1FZ0 E;  2JHA A;  1FZI E;  2DEB A;  3SQ2 A;  2OVP B;  1Q9X A;  4HCB A;  3LZJ A;  3NHG A;  1XVB E;  1MMO G;  1XVG E;  1FZ7 E;  2HD0 A;  3E4Y A;  3N1B A;  3RMA A;  3SPZ A;  3L1N A;  3KD1 E;  4FJ8 A;  2OZS A;  4M3Y A;  4QND A;  4JRQ A;  3NGI A;  3TJY A;  4M3R A;  4EYW A;  4DU1 A;  3UIQ A;  2E31 A;  2OZM A;  4M42 A;  4EPH A;  1NEX B;  4M3Z A;  4I9Q A;  3N1E A;  1WAF A;  2OVR B;  3CFP A;  3OGK B;  2FW3 A;  2YB5 A;  4EP9 A;  2P5O A;  1FZ5 E;  1XU5 E;  1XMH E;  3CQ8 A;  4DTO A;  4FJL A;  4J2B A;  4AKH A;  3SUN A;  3RMD A;  4FK2 A;  1IH7 A;  1XMG E;  4FK0 A;  3QEP A;  4J2A A;  4M3W A;  2DTU A;  4M41 A;  4FJ7 A;  1MTY G;  3NE6 A;  3TAE A;  1XU3 E;  3HP9 A;  4DTP A;  4FJJ A;  4DTN A;  4DTJ A;  3LD8 A;  3TAB A;  4FJG A;  4DU4 A;  4FJN A;  3QES A;  3TAF A;  2E32 A;  3QNN A;  2P1Q B;  3SQ0 A;  1MHY G;  3WSO A;  2VIX A;  3L2O B;  3V7D B;  4M45 A;  2OVQ B;  2OYQ A;  2ATQ A;  2DY4 A;  4AKG A;  4RNG A;  3OGL B;  4M3T A;  5IZ7 A;  2B8I A;  4RL5 A;  4JS5 A;  4DU3 A;  3SVI A;  4KHY A;  3SNN A;  3SQ1 A;  3L8B A;  1LDK E;  4DTX A;  4B08 A;  3TAG A;  3L0M A;  4KI4 A;  3C6P B;  3LZI A;  1FZ3 E;  2JHP A;  3LDS A;  2PFT A;  2LF6 A;  3RWU A;  3QER A;  1XMF E;  3RMC A;  2JH8 A;  4HCC A;  3HGK E;  1XVF E;  1FYZ E;  3E4W A;  4ADN A;  3QET A;  4ADO A;  2VJ5 A;  4JRP A;  1MHZ G;  4DTS A;  4J2D A;  2MZW B;  1FZH E;  3HGL A;  2PFV A;  1P22 A;  4FJX A;  3SI6 A;  4FVM A;  3NDK A;  2P5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...