1XVGE

Soluble methane monooxygenase hydroxylase: bromoethanol soaked structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvgE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvgE02
1XMFE 1XVEE 1FZ7E 1MTYG 1FZ8E 1FZ0E 1FZIE 1XMGE 1XVBE 1MHYG 1XVCE 1FZ4E 1XVDE 1FZ2E 1FZ9E 1FZHE 1XVFE 4GAMC 1MHZG 1XU3E 1XU5E 1FZ3E 1FYZE 1XMHE 1XVGE 1FZ5E 1FZ6E 1MMOG 1FZ1E
chains in the Genus database with same CATH superfamily
3SUQA 3LZIA 2FW3A 2ATQA 2JPNA 2RKHA 4JRPA 4ADNA 3CFRA 5IBKB 3WSOA 4DTMA 4ADOA 3S9HA 4RL5A 4AKGA 2P1OB 1WAFA 1XVDE 4FJKA 3SUOA 3UO3A 1LDKE 2LF6A 2DEBA 3QEXA 4M3ZA 3J2PA 2P5OA 2JHAA 2VJ4A 3SQ1A 4J2DA 4KHWA 1CLQA 2K5SA 4EP9A 3RMCA 4KI4A 4M3TA 3QEVA 1Q9XA 4DTOA 3SUNA 4M41A 3C95A 1FZ6E 3KD1E 4FK2A 3CFOA 4ICGC 1MMOG 2JH8A 3TABA 3NGIA 4J2AA 3J27A 3TAEA 2MMBA 1XMFE 3C6NB 3OGLB 4M3RA 3SJJA 2P1MB 3C6PB 1XVEE 4I9LA 1FZ7E 1MTYG 3SQ0A 1FZ8E 5H37A 1FPOA 2MZWB 3C94A 3SNNA 3MKSB 1XMGE 2VIXA 4X5NA 4DTSA 3E4YA 2HD0A 3QEWA 4I9QA 3NCIA 2P5GA 3NDKA 3QEPA 4FJ8A 4KHQA 4I6JB 4E3SA 1FZHE 4FJ9A 4M3YA 2E32A 4FJNA 1XVFE 2E31A 3SVIA 2OZMA 3QEIA 3L8BA 3QETA 3SQ2A 3L0MA 4J2EA 2H4TA 4FVMA 2JHPA 4DTUA 4FJLA 4QNDA 4QNCA 3NHGA 3NAEA 2OVQB 4KHSA 4KHYA 3LDBA 3QESA 4FK4A 3RWUA 4KHUA 4M42A 2B7MA 2JQTA 4AI6A 2JHCA 3CQ8A 2JH9A 2OVRB 4B08A 4HCCA 4DU3A 4KHNA 3HP9A 1WAJA 3HL8A 2PFVA 4JS4A 1XVCE 3SI6A 3TAFA 1FZ2E 1FZ9E 3SUPA 4FJJA 4FJMA 4FJ7A 4DTRA 4M3UA 4DU1A 4M45A 3N1EA 2OZSA 4FJXA 3K2OA 3TL8B 4JS5A 4RG8A 1FS1A 3C6OB 3SCXA 2B1EA 2LF3A 3RMAA 2OYQA 4GAMC 1MHZG 1XU3E 1XU5E 3OGMB 1FZ3E 4FJGA 3OGKB 4DTNA 2P1PB 2QXFA 3BVOA 3SPZA 3L1NA 3UO2A 3SQ4A 3UIQA 1XMHE 3TJYA 1XVGE 1FZ5E 5IZ7A 1NEXB 2P1NB 1IH7A 1P22A 2VJ5A 4RNGA 1FXXA 4EYWA 4JRQA 4DTJA 3LD8A 3RMBA 3SPYA 1XL3C 2B8IA 1Q9YA 3KD5E 4FJHA 3NE6A 2DTUA 4FJ5A 1FZ0E 1FZIE 4AKHA 1XVBE 1MHYG 1FZ4E 4X5MA 2OVPB 2DY4A 3N1BA 4IT5A 3QERA 3QNOA 4HCBA 3HGKE 4M3WA 3RMDA 2FYOA 5IREA 3QNNA 3TAGA 4E4BA 4J2BA 2MW2A 4FJIA 3L2OB 3E4WA 4DU4A 4EPHA 4FK0A 3CFPA 4KI6A 1JW2A 2YB5A 2RCUA 3LDSA 3LZJA 4DTXA 4DTPA 4AKIA 1FYZE 3V7DB 4M3XA 2PFTA 2P1QB 1IG9A 3HGLA 1N1CA 1FZ1E
chains in the Genus database with same CATH topology
3SUQA 3LZIA 2FW3A 2ATQA 2JPNA 4JRPA 4ADNA 3CFRA 5IBKB 3WSOA 4DTMA 4ADOA 3S9HA 4RL5A 4AKGA 2P1OB 1WAFA 1XVDE 4FJKA 3SUOA 1LDKE 2LF6A 2DEBA 3QEXA 4M3ZA 3J2PA 2P5OA 2JHAA 2VJ4A 3SQ1A 4J2DA 4KHWA 1CLQA 4EP9A 3RMCA 4KI4A 4M3TA 3QEVA 1Q9XA 4DTOA 3SUNA 4M41A 3C95A 1FZ6E 3KD1E 4FK2A 3CFOA 4J2AA 1MMOG 2JH8A 3TABA 3NGIA 3J27A 3TAEA 2MMBA 1XMFE 3C6NB 3OGLB 4M3RA 3SJJA 2P1MB 3C6PB 1XVEE 4I9LA 1FZ7E 1MTYG 3SQ0A 1FZ8E 5H37A 2MZWB 3C94A 3SNNA 3MKSB 1XMGE 2VIXA 4X5NA 4DTSA 3E4YA 2HD0A 3QEWA 4I9QA 3NCIA 2P5GA 3NDKA 3QEPA 4FJ8A 4KHQA 4I6JB 4E3SA 1FZHE 4FJ9A 4M3YA 2E32A 4FJNA 1XVFE 2E31A 3SVIA 2OZMA 3QEIA 3L8BA 3QETA 3SQ2A 3L0MA 4J2EA 2H4TA 4FVMA 2JHPA 4DTUA 4FJLA 4QNDA 4QNCA 3NHGA 3NAEA 2OVQB 4KHSA 4KHYA 3LDBA 3QESA 4FK4A 3RWUA 4KHUA 4M42A 2B7MA 4AI6A 2JHCA 3CQ8A 2JH9A 2OVRB 4B08A 4HCCA 4DU3A 4KHNA 3HP9A 1WAJA 3HL8A 2PFVA 4JS4A 1XVCE 3SI6A 3TAFA 1FZ2E 1FZ9E 3SUPA 4FJJA 4FJMA 4FJ7A 4DTRA 4M3UA 4DU1A 4M45A 3N1EA 2OZSA 4FJXA 3K2OA 3TL8B 4JS5A 4RG8A 1FS1A 3C6OB 3SCXA 2B1EA 2LF3A 3RMAA 2OYQA 4GAMC 1MHZG 1XU3E 1XU5E 3OGMB 1FZ3E 4FJGA 3OGKB 4DTNA 2P1PB 2QXFA 3SPZA 3UIQA 3L1NA 3SQ4A 1XMHE 3TJYA 1XVGE 1FZ5E 5IZ7A 1NEXB 2P1NB 1IH7A 1P22A 2VJ5A 4RNGA 1FXXA 4EYWA 4JRQA 4DTJA 3LD8A 3RMBA 3SPYA 1XL3C 2B8IA 1Q9YA 3KD5E 4FJHA 3NE6A 2DTUA 4FJ5A 1FZ0E 1FZIE 4AKHA 1XVBE 1MHYG 1FZ4E 4X5MA 2OVPB 2DY4A 3N1BA 3QERA 3QNOA 4HCBA 3HGKE 4M3WA 3RMDA 2FYOA 5IREA 3QNNA 3TAGA 4E4BA 4J2BA 4FJIA 3L2OB 3E4WA 4DU4A 4EPHA 4FK0A 3CFPA 4KI6A 2YB5A 2RCUA 3LDSA 3LZJA 4DTXA 4DTPA 4AKIA 1FYZE 3V7DB 4M3XA 2PFTA 2P1QB 1IG9A 3HGLA 1FZ1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMF E;  1XVE E;  1FZ7 E;  1MTY G;  1FZ8 E;  1FZ0 E;  1FZI E;  1XMG E;  1XVB E;  1MHY G;  1XVC E;  1FZ4 E;  1XVD E;  1FZ2 E;  1FZ9 E;  1FZH E;  1XVF E;  4GAM C;  1MHZ G;  1XU3 E;  1XU5 E;  1FZ3 E;  1FYZ E;  1XMH E;  1XVG E;  1FZ5 E;  1FZ6 E;  1MMO G;  1FZ1 E; 
#chains in the Genus database with same CATH topology
 3SUQ A;  3LZI A;  2FW3 A;  2ATQ A;  2JPN A;  2RKH A;  4JRP A;  4ADN A;  3CFR A;  5IBK B;  3WSO A;  4DTM A;  4ADO A;  3S9H A;  4RL5 A;  4AKG A;  2P1O B;  1WAF A;  1XVD E;  4FJK A;  3SUO A;  3UO3 A;  1LDK E;  2LF6 A;  2DEB A;  3QEX A;  4M3Z A;  3J2P A;  2P5O A;  2JHA A;  2VJ4 A;  3SQ1 A;  4J2D A;  4KHW A;  1CLQ A;  2K5S A;  4EP9 A;  3RMC A;  4KI4 A;  4M3T A;  3QEV A;  1Q9X A;  4DTO A;  3SUN A;  4M41 A;  3C95 A;  1FZ6 E;  3KD1 E;  4FK2 A;  3CFO A;  4ICG C;  1MMO G;  2JH8 A;  3TAB A;  3NGI A;  4J2A A;  3J27 A;  3TAE A;  2MMB A;  1XMF E;  3C6N B;  3OGL B;  4M3R A;  3SJJ A;  2P1M B;  3C6P B;  1XVE E;  4I9L A;  1FZ7 E;  1MTY G;  3SQ0 A;  1FZ8 E;  5H37 A;  1FPO A;  2MZW B;  3C94 A;  3SNN A;  3MKS B;  1XMG E;  2VIX A;  4X5N A;  4DTS A;  3E4Y A;  2HD0 A;  3QEW A;  4I9Q A;  3NCI A;  2P5G A;  3NDK A;  3QEP A;  4FJ8 A;  4KHQ A;  4I6J B;  4E3S A;  1FZH E;  4FJ9 A;  4M3Y A;  2E32 A;  4FJN A;  1XVF E;  2E31 A;  3SVI A;  2OZM A;  3QEI A;  3L8B A;  3QET A;  3SQ2 A;  3L0M A;  4J2E A;  2H4T A;  4FVM A;  2JHP A;  4DTU A;  4FJL A;  4QND A;  4QNC A;  3NHG A;  3NAE A;  2OVQ B;  4KHS A;  4KHY A;  3LDB A;  3QES A;  4FK4 A;  3RWU A;  4KHU A;  4M42 A;  2B7M A;  2JQT A;  4AI6 A;  2JHC A;  3CQ8 A;  2JH9 A;  2OVR B;  4B08 A;  4HCC A;  4DU3 A;  4KHN A;  3HP9 A;  1WAJ A;  3HL8 A;  2PFV A;  4JS4 A;  1XVC E;  3SI6 A;  3TAF A;  1FZ2 E;  1FZ9 E;  3SUP A;  4FJJ A;  4FJM A;  4FJ7 A;  4DTR A;  4M3U A;  4DU1 A;  4M45 A;  3N1E A;  2OZS A;  4FJX A;  3K2O A;  3TL8 B;  4JS5 A;  4RG8 A;  1FS1 A;  3C6O B;  3SCX A;  2B1E A;  2LF3 A;  3RMA A;  2OYQ A;  4GAM C;  1MHZ G;  1XU3 E;  1XU5 E;  3OGM B;  1FZ3 E;  4FJG A;  3OGK B;  4DTN A;  2P1P B;  2QXF A;  3BVO A;  3SPZ A;  3L1N A;  3UO2 A;  3SQ4 A;  3UIQ A;  1XMH E;  3TJY A;  1XVG E;  1FZ5 E;  5IZ7 A;  1NEX B;  2P1N B;  1IH7 A;  1P22 A;  2VJ5 A;  4RNG A;  1FXX A;  4EYW A;  4JRQ A;  4DTJ A;  3LD8 A;  3RMB A;  3SPY A;  1XL3 C;  2B8I A;  1Q9Y A;  3KD5 E;  4FJH A;  3NE6 A;  2DTU A;  4FJ5 A;  1FZ0 E;  1FZI E;  4AKH A;  1XVB E;  1MHY G;  1FZ4 E;  4X5M A;  2OVP B;  2DY4 A;  3N1B A;  4IT5 A;  3QER A;  3QNO A;  4HCB A;  3HGK E;  4M3W A;  3RMD A;  2FYO A;  5IRE A;  3QNN A;  3TAG A;  4E4B A;  4J2B A;  2MW2 A;  4FJI A;  3L2O B;  3E4W A;  4DU4 A;  4EPH A;  4FK0 A;  3CFP A;  4KI6 A;  1JW2 A;  2YB5 A;  2RCU A;  3LDS A;  3LZJ A;  4DTX A;  4DTP A;  4AKI A;  1FYZ E;  3V7D B;  4M3X A;  2PFT A;  2P1Q B;  1IG9 A;  3HGL A;  1N1C A;  1FZ1 E; 
#chains in the Genus database with same CATH homology
 3SUQ A;  3LZI A;  2FW3 A;  2ATQ A;  2JPN A;  4JRP A;  4ADN A;  3CFR A;  5IBK B;  3WSO A;  4DTM A;  4ADO A;  3S9H A;  4RL5 A;  4AKG A;  2P1O B;  1WAF A;  1XVD E;  4FJK A;  3SUO A;  1LDK E;  2LF6 A;  2DEB A;  3QEX A;  4M3Z A;  3J2P A;  2P5O A;  2JHA A;  2VJ4 A;  3SQ1 A;  4J2D A;  4KHW A;  1CLQ A;  4EP9 A;  3RMC A;  4KI4 A;  4M3T A;  3QEV A;  1Q9X A;  4DTO A;  3SUN A;  4M41 A;  3C95 A;  1FZ6 E;  3KD1 E;  4FK2 A;  3CFO A;  4J2A A;  1MMO G;  2JH8 A;  3TAB A;  3NGI A;  3J27 A;  3TAE A;  2MMB A;  1XMF E;  3C6N B;  3OGL B;  4M3R A;  3SJJ A;  2P1M B;  3C6P B;  1XVE E;  4I9L A;  1FZ7 E;  1MTY G;  3SQ0 A;  1FZ8 E;  5H37 A;  2MZW B;  3C94 A;  3SNN A;  3MKS B;  1XMG E;  2VIX A;  4X5N A;  4DTS A;  3E4Y A;  2HD0 A;  3QEW A;  4I9Q A;  3NCI A;  2P5G A;  3NDK A;  3QEP A;  4FJ8 A;  4KHQ A;  4I6J B;  4E3S A;  1FZH E;  4FJ9 A;  4M3Y A;  2E32 A;  4FJN A;  1XVF E;  2E31 A;  3SVI A;  2OZM A;  3QEI A;  3L8B A;  3QET A;  3SQ2 A;  3L0M A;  4J2E A;  2H4T A;  4FVM A;  2JHP A;  4DTU A;  4FJL A;  4QND A;  4QNC A;  3NHG A;  3NAE A;  2OVQ B;  4KHS A;  4KHY A;  3LDB A;  3QES A;  4FK4 A;  3RWU A;  4KHU A;  4M42 A;  2B7M A;  4AI6 A;  2JHC A;  3CQ8 A;  2JH9 A;  2OVR B;  4B08 A;  4HCC A;  4DU3 A;  4KHN A;  3HP9 A;  1WAJ A;  3HL8 A;  2PFV A;  4JS4 A;  1XVC E;  3SI6 A;  3TAF A;  1FZ2 E;  1FZ9 E;  3SUP A;  4FJJ A;  4FJM A;  4FJ7 A;  4DTR A;  4M3U A;  4DU1 A;  4M45 A;  3N1E A;  2OZS A;  4FJX A;  3K2O A;  3TL8 B;  4JS5 A;  4RG8 A;  1FS1 A;  3C6O B;  3SCX A;  2B1E A;  2LF3 A;  3RMA A;  2OYQ A;  4GAM C;  1MHZ G;  1XU3 E;  1XU5 E;  3OGM B;  1FZ3 E;  4FJG A;  3OGK B;  4DTN A;  2P1P B;  2QXF A;  3SPZ A;  3UIQ A;  3L1N A;  3SQ4 A;  1XMH E;  3TJY A;  1XVG E;  1FZ5 E;  5IZ7 A;  1NEX B;  2P1N B;  1IH7 A;  1P22 A;  2VJ5 A;  4RNG A;  1FXX A;  4EYW A;  4JRQ A;  4DTJ A;  3LD8 A;  3RMB A;  3SPY A;  1XL3 C;  2B8I A;  1Q9Y A;  3KD5 E;  4FJH A;  3NE6 A;  2DTU A;  4FJ5 A;  1FZ0 E;  1FZI E;  4AKH A;  1XVB E;  1MHY G;  1FZ4 E;  4X5M A;  2OVP B;  2DY4 A;  3N1B A;  3QER A;  3QNO A;  4HCB A;  3HGK E;  4M3W A;  3RMD A;  2FYO A;  5IRE A;  3QNN A;  3TAG A;  4E4B A;  4J2B A;  4FJI A;  3L2O B;  3E4W A;  4DU4 A;  4EPH A;  4FK0 A;  3CFP A;  4KI6 A;  2YB5 A;  2RCU A;  3LDS A;  3LZJ A;  4DTX A;  4DTP A;  4AKI A;  1FYZ E;  3V7D B;  4M3X A;  2PFT A;  2P1Q B;  1IG9 A;  3HGL A;  1FZ1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...