1XVGE

Soluble methane monooxygenase hydroxylase: bromoethanol soaked structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvgE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvgE02
1FZIE 1XU5E 1FZ0E 1FYZE 1FZ7E 1FZ9E 1XVGE 1FZ5E 4GAMC 1FZ4E 1FZ3E 1MTYG 1XMFE 1XVEE 1XMHE 1XMGE 1FZHE 1FZ6E 1XVDE 1FZ1E 1XU3E 1XVCE 1MHYG 1XVBE 1FZ2E 1MHZG 1MMOG 1XVFE 1FZ8E
chains in the Genus database with same CATH superfamily
4DTSA 3NCIA 1FZIE 3V7DB 4DTXA 4FJMA 4FK4A 2MW2A 2OZMA 3QEVA 3HP9A 4HCCA 3C6OB 1FYZE 1FZ7E 3HGKE 2P1OB 4M3RA 3MKSB 2E31A 4EP9A 1FZ5E 3LDBA 4FJIA 3E4YA 3SJJA 3L0MA 3L2OB 3SNNA 4ADOA 1WAFA 4KHQA 4JRQA 3S9HA 2RKHA 1Q9YA 2E32A 3J27A 3K2OA 3SQ4A 3N1BA 4AKGA 3KD1E 3QEXA 3C94A 1XMHE 3CQ8A 1LDKE 1P22A 1XMGE 4JS4A 1FZHE 1XVDE 4E3SA 4J2AA 2B8IA 5IZ7A 2P5GA 3C95A 1NEXB 4M41A 3UO2A 4FJNA 3TJYA 3RMAA 4X5MA 1XL3C 4I6JB 1MMOG 4DTMA 2OYQA 3NAEA 1FZ8E 2K5SA 2PFTA 4DU3A 3KD5E 1XU5E 2RCUA 3C6PB 4DTUA 4J2BA 4M42A 3SUOA 2B7MA 4RG8A 2P5OA 3TAFA 4QNCA 4FJ9A 3RMDA 4AKHA 1FZ4E 3SPYA 4M3WA 3BVOA 4EPHA 4DTJA 3E4WA 4IT5A 4M3TA 2DEBA 4KHYA 2JH8A 2PFVA 4FVMA 4E4BA 5IBKB 3CFPA 4FJJA 1FZ6E 1Q9XA 4FJLA 4B08A 3OGMB 2P1PB 3QNNA 3SQ0A 1FZ1E 2H4TA 4JRPA 1FS1A 2OVPB 3QETA 1JW2A 4KI6A 2HD0A 4DTPA 4FJ5A 4M3YA 3SPZA 4FK0A 3HGLA 3UO3A 2JPNA 4DU4A 2VJ5A 3NGIA 4FJ7A 3SCXA 3UIQA 1FPOA 3QEPA 1FZ9E 1XVGE 1IG9A 4KI4A 2VIXA 5IREA 3SI6A 4KHUA 4FJ8A 3N1EA 3TAEA 2MZWB 3LDSA 2JH9A 1XVEE 2OZSA 4J2DA 3LZJA 2LF6A 3RWUA 2FW3A 3TAGA 4KHWA 4M3XA 2JHAA 4ICGC 4I9LA 3L1NA 4M3UA 4FJXA 2B1EA 2LF3A 2VJ4A 4M45A 3C6NB 4DTOA 4HCBA 3J2PA 4RL5A 4DTNA 2P1MB 3QERA 4FJGA 2JHPA 3QESA 3QEIA 2ATQA 3TL8B 4DU1A 4FJHA 3SQ2A 1IH7A 4RNGA 3NE6A 3LD8A 3TABA 4AI6A 4X5NA 3SUPA 4KHSA 2P1NB 1FZ0E 3OGKB 3RMBA 3L8BA 4EYWA 3CFOA 2DY4A 4GAMC 2JQTA 4ADNA 2DTUA 4FJKA 3QNOA 4DTRA 1FZ3E 1MTYG 1N1CA 1XMFE 1CLQA 4M3ZA 3CFRA 2MMBA 3QEWA 3LZIA 3WSOA 3SUQA 4J2EA 2JHCA 2QXFA 3SQ1A 2OVQB 2OVRB 4AKIA 4JS5A 3SUNA 4QNDA 3RMCA 4KHNA 1FXXA 3HL8A 1WAJA 1XU3E 4I9QA 1XVCE 3OGLB 2P1QB 1MHYG 1XVBE 1FZ2E 2YB5A 3SVIA 4FK2A 1MHZG 2FYOA 3NHGA 1XVFE 3NDKA 5H37A
chains in the Genus database with same CATH topology
4DTSA 3NCIA 1FZIE 3V7DB 4DTXA 4FJMA 4FK4A 2OZMA 3QEVA 3HP9A 4HCCA 3C6OB 1FYZE 1FZ7E 3HGKE 2P1OB 4M3RA 3MKSB 2E31A 4EP9A 1FZ5E 3LDBA 4FJIA 3E4YA 3SJJA 3L0MA 3L2OB 3SNNA 4ADOA 1WAFA 4KHQA 4JRQA 3S9HA 1Q9YA 2E32A 3J27A 3K2OA 3SQ4A 3N1BA 4AKGA 3KD1E 3QEXA 3C94A 1XMHE 3CQ8A 1LDKE 1P22A 1XMGE 4JS4A 1FZHE 1XVDE 4E3SA 4J2AA 2B8IA 5IZ7A 2P5GA 3C95A 1NEXB 4M41A 4FJNA 3TJYA 3RMAA 4X5MA 1XL3C 4I6JB 1MMOG 4DTMA 2OYQA 3NAEA 1FZ8E 2PFTA 4DU3A 3KD5E 1XU5E 2RCUA 3C6PB 4DTUA 4J2BA 4M42A 3SUOA 2B7MA 4RG8A 2P5OA 3TAFA 4QNCA 4FJ9A 3RMDA 4AKHA 1FZ4E 3SPYA 4M3WA 4EPHA 4DTJA 3E4WA 4M3TA 2DEBA 4KHYA 2JH8A 2PFVA 4FVMA 4E4BA 5IBKB 3CFPA 4FJJA 1FZ6E 1Q9XA 4FJLA 4B08A 3OGMB 2P1PB 3QNNA 3SQ0A 1FZ1E 2H4TA 4JRPA 1FS1A 2OVPB 3QETA 4KI6A 2HD0A 4DTPA 4FJ5A 4M3YA 3SPZA 4FK0A 3HGLA 2JPNA 4DU4A 2VJ5A 3NGIA 4FJ7A 3SCXA 3UIQA 3QEPA 1FZ9E 1XVGE 1IG9A 4KI4A 2VIXA 5IREA 3SI6A 4KHUA 4FJ8A 3N1EA 3TAEA 2MZWB 3LDSA 2JH9A 1XVEE 2OZSA 4J2DA 3LZJA 2LF6A 3RWUA 2FW3A 3TAGA 4KHWA 4M3XA 2JHAA 4I9LA 4M3UA 3L1NA 4FJXA 2B1EA 2LF3A 2VJ4A 4M45A 3C6NB 4DTOA 4HCBA 3J2PA 4RL5A 4DTNA 2P1MB 3QERA 4FJGA 2JHPA 3QESA 3QEIA 2ATQA 3TL8B 4DU1A 4FJHA 3SQ2A 1IH7A 4RNGA 3NE6A 3LD8A 3TABA 4AI6A 4X5NA 3SUPA 4KHSA 2P1NB 1FZ0E 3OGKB 3RMBA 3L8BA 4EYWA 3CFOA 2DY4A 4GAMC 4ADNA 2DTUA 4FJKA 3QNOA 4DTRA 1FZ3E 1MTYG 1XMFE 1CLQA 4M3ZA 3CFRA 2MMBA 3QEWA 3LZIA 3WSOA 3SUQA 4J2EA 2JHCA 2QXFA 3SQ1A 2OVQB 2OVRB 4AKIA 4JS5A 3SUNA 4QNDA 3RMCA 4KHNA 1FXXA 3HL8A 1WAJA 1XU3E 4I9QA 1XVCE 3OGLB 2P1QB 1MHYG 1XVBE 1FZ2E 2YB5A 3SVIA 4FK2A 1MHZG 2FYOA 3NHGA 1XVFE 3NDKA 5H37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZI E;  1XU5 E;  1FZ0 E;  1FYZ E;  1FZ7 E;  1FZ9 E;  1XVG E;  1FZ5 E;  4GAM C;  1FZ4 E;  1FZ3 E;  1MTY G;  1XMF E;  1XVE E;  1XMH E;  1XMG E;  1FZH E;  1FZ6 E;  1XVD E;  1FZ1 E;  1XU3 E;  1XVC E;  1MHY G;  1XVB E;  1FZ2 E;  1MHZ G;  1MMO G;  1XVF E;  1FZ8 E; 
#chains in the Genus database with same CATH topology
 4DTS A;  3NCI A;  1FZI E;  3V7D B;  4DTX A;  4FJM A;  4FK4 A;  2MW2 A;  2OZM A;  3QEV A;  3HP9 A;  4HCC A;  3C6O B;  1FYZ E;  1FZ7 E;  3HGK E;  2P1O B;  4M3R A;  3MKS B;  2E31 A;  4EP9 A;  1FZ5 E;  3LDB A;  4FJI A;  3E4Y A;  3SJJ A;  3L0M A;  3L2O B;  3SNN A;  4ADO A;  1WAF A;  4KHQ A;  4JRQ A;  3S9H A;  2RKH A;  1Q9Y A;  2E32 A;  3J27 A;  3K2O A;  3SQ4 A;  3N1B A;  4AKG A;  3KD1 E;  3QEX A;  3C94 A;  1XMH E;  3CQ8 A;  1LDK E;  1P22 A;  1XMG E;  4JS4 A;  1FZH E;  1XVD E;  4E3S A;  4J2A A;  2B8I A;  5IZ7 A;  2P5G A;  3C95 A;  1NEX B;  4M41 A;  3UO2 A;  4FJN A;  3TJY A;  3RMA A;  4X5M A;  1XL3 C;  4I6J B;  1MMO G;  4DTM A;  2OYQ A;  3NAE A;  1FZ8 E;  2K5S A;  2PFT A;  4DU3 A;  3KD5 E;  1XU5 E;  2RCU A;  3C6P B;  4DTU A;  4J2B A;  4M42 A;  3SUO A;  2B7M A;  4RG8 A;  2P5O A;  3TAF A;  4QNC A;  4FJ9 A;  3RMD A;  4AKH A;  1FZ4 E;  3SPY A;  4M3W A;  3BVO A;  4EPH A;  4DTJ A;  3E4W A;  4IT5 A;  4M3T A;  2DEB A;  4KHY A;  2JH8 A;  2PFV A;  4FVM A;  4E4B A;  5IBK B;  3CFP A;  4FJJ A;  1FZ6 E;  1Q9X A;  4FJL A;  4B08 A;  3OGM B;  2P1P B;  3QNN A;  3SQ0 A;  1FZ1 E;  2H4T A;  4JRP A;  1FS1 A;  2OVP B;  3QET A;  1JW2 A;  4KI6 A;  2HD0 A;  4DTP A;  4FJ5 A;  4M3Y A;  3SPZ A;  4FK0 A;  3HGL A;  3UO3 A;  2JPN A;  4DU4 A;  2VJ5 A;  3NGI A;  4FJ7 A;  3SCX A;  3UIQ A;  1FPO A;  3QEP A;  1FZ9 E;  1XVG E;  1IG9 A;  4KI4 A;  2VIX A;  5IRE A;  3SI6 A;  4KHU A;  4FJ8 A;  3N1E A;  3TAE A;  2MZW B;  3LDS A;  2JH9 A;  1XVE E;  2OZS A;  4J2D A;  3LZJ A;  2LF6 A;  3RWU A;  2FW3 A;  3TAG A;  4KHW A;  4M3X A;  2JHA A;  4ICG C;  4I9L A;  3L1N A;  4M3U A;  4FJX A;  2B1E A;  2LF3 A;  2VJ4 A;  4M45 A;  3C6N B;  4DTO A;  4HCB A;  3J2P A;  4RL5 A;  4DTN A;  2P1M B;  3QER A;  4FJG A;  2JHP A;  3QES A;  3QEI A;  2ATQ A;  3TL8 B;  4DU1 A;  4FJH A;  3SQ2 A;  1IH7 A;  4RNG A;  3NE6 A;  3LD8 A;  3TAB A;  4AI6 A;  4X5N A;  3SUP A;  4KHS A;  2P1N B;  1FZ0 E;  3OGK B;  3RMB A;  3L8B A;  4EYW A;  3CFO A;  2DY4 A;  4GAM C;  2JQT A;  4ADN A;  2DTU A;  4FJK A;  3QNO A;  4DTR A;  1FZ3 E;  1MTY G;  1N1C A;  1XMF E;  1CLQ A;  4M3Z A;  3CFR A;  2MMB A;  3QEW A;  3LZI A;  3WSO A;  3SUQ A;  4J2E A;  2JHC A;  2QXF A;  3SQ1 A;  2OVQ B;  2OVR B;  4AKI A;  4JS5 A;  3SUN A;  4QND A;  3RMC A;  4KHN A;  1FXX A;  3HL8 A;  1WAJ A;  1XU3 E;  4I9Q A;  1XVC E;  3OGL B;  2P1Q B;  1MHY G;  1XVB E;  1FZ2 E;  2YB5 A;  3SVI A;  4FK2 A;  1MHZ G;  2FYO A;  3NHG A;  1XVF E;  3NDK A;  5H37 A; 
#chains in the Genus database with same CATH homology
 4DTS A;  3NCI A;  1FZI E;  3V7D B;  4DTX A;  4FJM A;  4FK4 A;  2OZM A;  3QEV A;  3HP9 A;  4HCC A;  3C6O B;  1FYZ E;  1FZ7 E;  3HGK E;  2P1O B;  4M3R A;  3MKS B;  2E31 A;  4EP9 A;  1FZ5 E;  3LDB A;  4FJI A;  3E4Y A;  3SJJ A;  3L0M A;  3L2O B;  3SNN A;  4ADO A;  1WAF A;  4KHQ A;  4JRQ A;  3S9H A;  1Q9Y A;  2E32 A;  3J27 A;  3K2O A;  3SQ4 A;  3N1B A;  4AKG A;  3KD1 E;  3QEX A;  3C94 A;  1XMH E;  3CQ8 A;  1LDK E;  1P22 A;  1XMG E;  4JS4 A;  1FZH E;  1XVD E;  4E3S A;  4J2A A;  2B8I A;  5IZ7 A;  2P5G A;  3C95 A;  1NEX B;  4M41 A;  4FJN A;  3TJY A;  3RMA A;  4X5M A;  1XL3 C;  4I6J B;  1MMO G;  4DTM A;  2OYQ A;  3NAE A;  1FZ8 E;  2PFT A;  4DU3 A;  3KD5 E;  1XU5 E;  2RCU A;  3C6P B;  4DTU A;  4J2B A;  4M42 A;  3SUO A;  2B7M A;  4RG8 A;  2P5O A;  3TAF A;  4QNC A;  4FJ9 A;  3RMD A;  4AKH A;  1FZ4 E;  3SPY A;  4M3W A;  4EPH A;  4DTJ A;  3E4W A;  4M3T A;  2DEB A;  4KHY A;  2JH8 A;  2PFV A;  4FVM A;  4E4B A;  5IBK B;  3CFP A;  4FJJ A;  1FZ6 E;  1Q9X A;  4FJL A;  4B08 A;  3OGM B;  2P1P B;  3QNN A;  3SQ0 A;  1FZ1 E;  2H4T A;  4JRP A;  1FS1 A;  2OVP B;  3QET A;  4KI6 A;  2HD0 A;  4DTP A;  4FJ5 A;  4M3Y A;  3SPZ A;  4FK0 A;  3HGL A;  2JPN A;  4DU4 A;  2VJ5 A;  3NGI A;  4FJ7 A;  3SCX A;  3UIQ A;  3QEP A;  1FZ9 E;  1XVG E;  1IG9 A;  4KI4 A;  2VIX A;  5IRE A;  3SI6 A;  4KHU A;  4FJ8 A;  3N1E A;  3TAE A;  2MZW B;  3LDS A;  2JH9 A;  1XVE E;  2OZS A;  4J2D A;  3LZJ A;  2LF6 A;  3RWU A;  2FW3 A;  3TAG A;  4KHW A;  4M3X A;  2JHA A;  4I9L A;  4M3U A;  3L1N A;  4FJX A;  2B1E A;  2LF3 A;  2VJ4 A;  4M45 A;  3C6N B;  4DTO A;  4HCB A;  3J2P A;  4RL5 A;  4DTN A;  2P1M B;  3QER A;  4FJG A;  2JHP A;  3QES A;  3QEI A;  2ATQ A;  3TL8 B;  4DU1 A;  4FJH A;  3SQ2 A;  1IH7 A;  4RNG A;  3NE6 A;  3LD8 A;  3TAB A;  4AI6 A;  4X5N A;  3SUP A;  4KHS A;  2P1N B;  1FZ0 E;  3OGK B;  3RMB A;  3L8B A;  4EYW A;  3CFO A;  2DY4 A;  4GAM C;  4ADN A;  2DTU A;  4FJK A;  3QNO A;  4DTR A;  1FZ3 E;  1MTY G;  1XMF E;  1CLQ A;  4M3Z A;  3CFR A;  2MMB A;  3QEW A;  3LZI A;  3WSO A;  3SUQ A;  4J2E A;  2JHC A;  2QXF A;  3SQ1 A;  2OVQ B;  2OVR B;  4AKI A;  4JS5 A;  3SUN A;  4QND A;  3RMC A;  4KHN A;  1FXX A;  3HL8 A;  1WAJ A;  1XU3 E;  4I9Q A;  1XVC E;  3OGL B;  2P1Q B;  1MHY G;  1XVB E;  1FZ2 E;  2YB5 A;  3SVI A;  4FK2 A;  1MHZ G;  2FYO A;  3NHG A;  1XVF E;  3NDK A;  5H37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...