1XVGE

Soluble methane monooxygenase hydroxylase: bromoethanol soaked structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
total genus 61
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvgE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvgE02
1FZ6E 1MMOG 1XMGE 1FZ2E 1FZ9E 1XU5E 1XMFE 1XVFE 1XVCE 1MHYG 1XVGE 1MTYG 1XU3E 1XVEE 1FYZE 1FZ4E 1FZ1E 1FZ3E 1XVBE 1FZHE 4GAMC 1FZ7E 1FZ5E 1XVDE 1MHZG 1XMHE 1FZ0E 1FZIE 1FZ8E
chains in the Genus database with same CATH superfamily
2JHPA 4AKGA 2FW3A 2VIXA 2OVQB 4X5MA 3RMAA 4FJXA 3J27A 2JHCA 4FJKA 2PFTA 1FZ9E 3J2PA 2VJ5A 3LDSA 1XMFE 3N1EA 3NGIA 4DTNA 1XVFE 4J2AA 1FS1A 4KHNA 3SJJA 2H4TA 3NCIA 4JS4A 4M3XA 4FJ8A 3HL8A 2P1OB 1IG9A 4KHYA 4ADNA 1XVBE 2E32A 4HCBA 3L1NA 1WAFA 3HP9A 4DU4A 4JS5A 3NE6A 3S9HA 2LF6A 3N1BA 3SVIA 4KHUA 1MHZG 2P5OA 4KI6A 3CFPA 1FZ0E 2HD0A 2JQTA 1N1CA 1FZ8E 4DTJA 4RL5A 3UIQA 4FJIA 3RMCA 3RMBA 1MMOG 4ADOA 3SPYA 4I9QA 1FZ2E 1NEXB 2P1NB 4B08A 2B7MA 3K2OA 2P5GA 1XU5E 2DTUA 1JW2A 4M3RA 4JRPA 4FJGA 3V7DB 4FK4A 4X5NA 4AKIA 1XVCE 2OZSA 3SUPA 2K5SA 3LD8A 4AI6A 1XU3E 1WAJA 3E4WA 4AKHA 1FXXA 3QEXA 3KD5E 4DU1A 4M3ZA 3QNOA 3QETA 3MKSB 3TJYA 4J2EA 3SI6A 4IT5A 3L0MA 4E4BA 2DY4A 2JPNA 4FJMA 4EPHA 3QESA 1CLQA 4FJ7A 1FZIE 4GAMC 4I6JB 3UO3A 4RNGA 2RCUA 1FZ6E 3TAGA 3SUOA 3C95A 2LF3A 2MW2A 4FVMA 3SNNA 5IBKB 4FJHA 3HGKE 4DTSA 3LZJA 2OYQA 4KHSA 1LDKE 2JH9A 4FJJA 5IREA 4E3SA 2E31A 1Q9YA 3CQ8A 3E4YA 4KHQA 3CFRA 4J2DA 1MHYG 3QEVA 3SQ0A 4M3UA 2JHAA 2RKHA 2JH8A 1MTYG 5H37A 3UO2A 3RMDA 4HCCA 4QNCA 4JRQA 2MZWB 3KD1E 4QNDA 3CFOA 3L8BA 1FZ1E 1FZ4E 4KHWA 2OVRB 3NHGA 2OZMA 4EYWA 4DTUA 3OGLB 4DU3A 1FZ7E 2MMBA 3SUQA 1XVDE 3OGKB 1XMHE 3QEIA 3LZIA 4ICGC 3HGLA 4DTMA 2ATQA 2P1PB 2P1MB 4DTPA 3SQ2A 3SPZA 4FJ9A 4KI4A 4FJLA 3SQ4A 1XMGE 2OVPB 2QXFA 2B8IA 2PFVA 4FK2A 3LDBA 2YB5A 4EP9A 1FPOA 4J2BA 4I9LA 3SCXA 3TABA 1Q9XA 4FJNA 3NDKA 1P22A 2B1EA 3QERA 1XVGE 3RWUA 3C6NB 4M42A 1IH7A 2DEBA 3C94A 3TL8B 4RG8A 3QEPA 4DTXA 1FYZE 3SUNA 4FJ5A 1FZ3E 5IZ7A 4FK0A 4M3YA 1FZHE 2VJ4A 3QEWA 3L2OB 3QNNA 4M3WA 3C6PB 4M45A 3TAFA 1XL3C 4DTRA 3NAEA 3WSOA 3C6OB 3SQ1A 1FZ5E 3OGMB 4DTOA 4M3TA 3BVOA 3TAEA 2P1QB 4M41A 1XVEE 2FYOA
chains in the Genus database with same CATH topology
2JHPA 4AKGA 2FW3A 2VIXA 2OVQB 4X5MA 3RMAA 4FJXA 3J27A 2JHCA 4FJKA 2PFTA 1FZ9E 3J2PA 2VJ5A 3LDSA 1XMFE 3N1EA 3NGIA 4DTNA 1XVFE 4J2AA 1FS1A 4KHNA 3SJJA 2H4TA 3NCIA 4JS4A 4M3XA 4FJ8A 3HL8A 2P1OB 1IG9A 4KHYA 4ADNA 1XVBE 2E32A 4HCBA 3L1NA 1WAFA 3HP9A 4DU4A 4JS5A 3NE6A 3S9HA 2LF6A 3N1BA 3SVIA 4KHUA 1MHZG 2P5OA 4KI6A 3CFPA 1FZ0E 2HD0A 1FZ8E 4DTJA 4RL5A 3UIQA 4FJIA 3RMCA 3RMBA 1MMOG 4ADOA 3SPYA 4I9QA 1FZ2E 1NEXB 2P1NB 4B08A 2B7MA 3K2OA 2P5GA 1XU5E 2DTUA 4M3RA 4JRPA 4FJGA 3V7DB 4FK4A 4X5NA 4AKIA 1XVCE 2OZSA 3SUPA 3LD8A 4AI6A 1XU3E 1WAJA 3E4WA 4AKHA 1FXXA 3QEXA 3KD5E 4DU1A 4M3ZA 3QNOA 3QETA 3MKSB 3TJYA 4J2EA 3SI6A 3L0MA 4E4BA 2DY4A 2JPNA 4FJMA 4EPHA 3QESA 1CLQA 4FJ7A 1FZIE 4GAMC 4I6JB 4RNGA 2RCUA 1FZ6E 3TAGA 3SUOA 3C95A 2LF3A 4FVMA 4FJHA 3SNNA 5IBKB 3HGKE 4DTSA 3LZJA 2OYQA 4KHSA 1LDKE 2JH9A 4FJJA 5IREA 4E3SA 2E31A 1Q9YA 3CQ8A 3E4YA 4KHQA 3CFRA 4J2DA 1MHYG 3QEVA 3SQ0A 4M3UA 2JHAA 5H37A 2JH8A 1MTYG 3RMDA 4HCCA 4QNCA 4JRQA 2MZWB 3KD1E 4QNDA 3CFOA 3L8BA 1FZ1E 1FZ4E 4KHWA 2OVRB 3NHGA 2OZMA 4EYWA 4DTUA 3OGLB 4DU3A 1FZ7E 2MMBA 3SUQA 1XVDE 3OGKB 1XMHE 3QEIA 3LZIA 3HGLA 4DTMA 2ATQA 2P1PB 2P1MB 4DTPA 3SQ2A 3SPZA 4FJ9A 4KI4A 4FJLA 3SQ4A 1XMGE 2OVPB 2QXFA 2B8IA 2PFVA 4FK2A 3LDBA 2YB5A 4EP9A 4J2BA 4I9LA 3SCXA 3TABA 1Q9XA 4FJNA 3NDKA 1P22A 2B1EA 3QERA 1XVGE 3RWUA 3C6NB 4M42A 1IH7A 2DEBA 3C94A 3TL8B 4RG8A 3QEPA 4DTXA 1FYZE 3SUNA 4FJ5A 1FZ3E 5IZ7A 4FK0A 4M3YA 1FZHE 2VJ4A 3QEWA 3L2OB 3QNNA 4M3WA 3C6PB 4M45A 3TAFA 1XL3C 4DTRA 3NAEA 3WSOA 3C6OB 3SQ1A 1FZ5E 3OGMB 4DTOA 4M3TA 3TAEA 2P1QB 4M41A 1XVEE 2FYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ6 E;  1MMO G;  1XMG E;  1FZ2 E;  1FZ9 E;  1XU5 E;  1XMF E;  1XVF E;  1XVC E;  1MHY G;  1XVG E;  1MTY G;  1XU3 E;  1XVE E;  1FYZ E;  1FZ4 E;  1FZ1 E;  1FZ3 E;  1XVB E;  1FZH E;  4GAM C;  1FZ7 E;  1FZ5 E;  1XVD E;  1MHZ G;  1XMH E;  1FZ0 E;  1FZI E;  1FZ8 E; 
#chains in the Genus database with same CATH topology
 2JHP A;  4AKG A;  2FW3 A;  2VIX A;  2OVQ B;  4X5M A;  3RMA A;  4FJX A;  3J27 A;  2JHC A;  4FJK A;  2PFT A;  1FZ9 E;  3J2P A;  2VJ5 A;  3LDS A;  1XMF E;  3N1E A;  3NGI A;  4DTN A;  1XVF E;  4J2A A;  1FS1 A;  4KHN A;  3SJJ A;  2H4T A;  3NCI A;  4JS4 A;  4M3X A;  4FJ8 A;  3HL8 A;  2P1O B;  1IG9 A;  4KHY A;  4ADN A;  1XVB E;  2E32 A;  4HCB A;  3L1N A;  1WAF A;  3HP9 A;  4DU4 A;  4JS5 A;  3NE6 A;  3S9H A;  2LF6 A;  3N1B A;  3SVI A;  4KHU A;  1MHZ G;  2P5O A;  4KI6 A;  3CFP A;  1FZ0 E;  2HD0 A;  2JQT A;  1N1C A;  1FZ8 E;  4DTJ A;  4RL5 A;  3UIQ A;  4FJI A;  3RMC A;  3RMB A;  1MMO G;  4ADO A;  3SPY A;  4I9Q A;  1FZ2 E;  1NEX B;  2P1N B;  4B08 A;  2B7M A;  3K2O A;  2P5G A;  1XU5 E;  2DTU A;  1JW2 A;  4M3R A;  4JRP A;  4FJG A;  3V7D B;  4FK4 A;  4X5N A;  4AKI A;  1XVC E;  2OZS A;  3SUP A;  2K5S A;  3LD8 A;  4AI6 A;  1XU3 E;  1WAJ A;  3E4W A;  4AKH A;  1FXX A;  3QEX A;  3KD5 E;  4DU1 A;  4M3Z A;  3QNO A;  3QET A;  3MKS B;  3TJY A;  4J2E A;  3SI6 A;  4IT5 A;  3L0M A;  4E4B A;  2DY4 A;  2JPN A;  4FJM A;  4EPH A;  3QES A;  1CLQ A;  4FJ7 A;  1FZI E;  4GAM C;  4I6J B;  3UO3 A;  4RNG A;  2RCU A;  1FZ6 E;  3TAG A;  3SUO A;  3C95 A;  2LF3 A;  2MW2 A;  4FVM A;  3SNN A;  5IBK B;  4FJH A;  3HGK E;  4DTS A;  3LZJ A;  2OYQ A;  4KHS A;  1LDK E;  2JH9 A;  4FJJ A;  5IRE A;  4E3S A;  2E31 A;  1Q9Y A;  3CQ8 A;  3E4Y A;  4KHQ A;  3CFR A;  4J2D A;  1MHY G;  3QEV A;  3SQ0 A;  4M3U A;  2JHA A;  2RKH A;  2JH8 A;  1MTY G;  5H37 A;  3UO2 A;  3RMD A;  4HCC A;  4QNC A;  4JRQ A;  2MZW B;  3KD1 E;  4QND A;  3CFO A;  3L8B A;  1FZ1 E;  1FZ4 E;  4KHW A;  2OVR B;  3NHG A;  2OZM A;  4EYW A;  4DTU A;  3OGL B;  4DU3 A;  1FZ7 E;  2MMB A;  3SUQ A;  1XVD E;  3OGK B;  1XMH E;  3QEI A;  3LZI A;  4ICG C;  3HGL A;  4DTM A;  2ATQ A;  2P1P B;  2P1M B;  4DTP A;  3SQ2 A;  3SPZ A;  4FJ9 A;  4KI4 A;  4FJL A;  3SQ4 A;  1XMG E;  2OVP B;  2QXF A;  2B8I A;  2PFV A;  4FK2 A;  3LDB A;  2YB5 A;  4EP9 A;  1FPO A;  4J2B A;  4I9L A;  3SCX A;  3TAB A;  1Q9X A;  4FJN A;  3NDK A;  1P22 A;  2B1E A;  3QER A;  1XVG E;  3RWU A;  3C6N B;  4M42 A;  1IH7 A;  2DEB A;  3C94 A;  3TL8 B;  4RG8 A;  3QEP A;  4DTX A;  1FYZ E;  3SUN A;  4FJ5 A;  1FZ3 E;  5IZ7 A;  4FK0 A;  4M3Y A;  1FZH E;  2VJ4 A;  3QEW A;  3L2O B;  3QNN A;  4M3W A;  3C6P B;  4M45 A;  3TAF A;  1XL3 C;  4DTR A;  3NAE A;  3WSO A;  3C6O B;  3SQ1 A;  1FZ5 E;  3OGM B;  4DTO A;  4M3T A;  3BVO A;  3TAE A;  2P1Q B;  4M41 A;  1XVE E;  2FYO A; 
#chains in the Genus database with same CATH homology
 2JHP A;  4AKG A;  2FW3 A;  2VIX A;  2OVQ B;  4X5M A;  3RMA A;  4FJX A;  3J27 A;  2JHC A;  4FJK A;  2PFT A;  1FZ9 E;  3J2P A;  2VJ5 A;  3LDS A;  1XMF E;  3N1E A;  3NGI A;  4DTN A;  1XVF E;  4J2A A;  1FS1 A;  4KHN A;  3SJJ A;  2H4T A;  3NCI A;  4JS4 A;  4M3X A;  4FJ8 A;  3HL8 A;  2P1O B;  1IG9 A;  4KHY A;  4ADN A;  1XVB E;  2E32 A;  4HCB A;  3L1N A;  1WAF A;  3HP9 A;  4DU4 A;  4JS5 A;  3NE6 A;  3S9H A;  2LF6 A;  3N1B A;  3SVI A;  4KHU A;  1MHZ G;  2P5O A;  4KI6 A;  3CFP A;  1FZ0 E;  2HD0 A;  1FZ8 E;  4DTJ A;  4RL5 A;  3UIQ A;  4FJI A;  3RMC A;  3RMB A;  1MMO G;  4ADO A;  3SPY A;  4I9Q A;  1FZ2 E;  1NEX B;  2P1N B;  4B08 A;  2B7M A;  3K2O A;  2P5G A;  1XU5 E;  2DTU A;  4M3R A;  4JRP A;  4FJG A;  3V7D B;  4FK4 A;  4X5N A;  4AKI A;  1XVC E;  2OZS A;  3SUP A;  3LD8 A;  4AI6 A;  1XU3 E;  1WAJ A;  3E4W A;  4AKH A;  1FXX A;  3QEX A;  3KD5 E;  4DU1 A;  4M3Z A;  3QNO A;  3QET A;  3MKS B;  3TJY A;  4J2E A;  3SI6 A;  3L0M A;  4E4B A;  2DY4 A;  2JPN A;  4FJM A;  4EPH A;  3QES A;  1CLQ A;  4FJ7 A;  1FZI E;  4GAM C;  4I6J B;  4RNG A;  2RCU A;  1FZ6 E;  3TAG A;  3SUO A;  3C95 A;  2LF3 A;  4FVM A;  4FJH A;  3SNN A;  5IBK B;  3HGK E;  4DTS A;  3LZJ A;  2OYQ A;  4KHS A;  1LDK E;  2JH9 A;  4FJJ A;  5IRE A;  4E3S A;  2E31 A;  1Q9Y A;  3CQ8 A;  3E4Y A;  4KHQ A;  3CFR A;  4J2D A;  1MHY G;  3QEV A;  3SQ0 A;  4M3U A;  2JHA A;  5H37 A;  2JH8 A;  1MTY G;  3RMD A;  4HCC A;  4QNC A;  4JRQ A;  2MZW B;  3KD1 E;  4QND A;  3CFO A;  3L8B A;  1FZ1 E;  1FZ4 E;  4KHW A;  2OVR B;  3NHG A;  2OZM A;  4EYW A;  4DTU A;  3OGL B;  4DU3 A;  1FZ7 E;  2MMB A;  3SUQ A;  1XVD E;  3OGK B;  1XMH E;  3QEI A;  3LZI A;  3HGL A;  4DTM A;  2ATQ A;  2P1P B;  2P1M B;  4DTP A;  3SQ2 A;  3SPZ A;  4FJ9 A;  4KI4 A;  4FJL A;  3SQ4 A;  1XMG E;  2OVP B;  2QXF A;  2B8I A;  2PFV A;  4FK2 A;  3LDB A;  2YB5 A;  4EP9 A;  4J2B A;  4I9L A;  3SCX A;  3TAB A;  1Q9X A;  4FJN A;  3NDK A;  1P22 A;  2B1E A;  3QER A;  1XVG E;  3RWU A;  3C6N B;  4M42 A;  1IH7 A;  2DEB A;  3C94 A;  3TL8 B;  4RG8 A;  3QEP A;  4DTX A;  1FYZ E;  3SUN A;  4FJ5 A;  1FZ3 E;  5IZ7 A;  4FK0 A;  4M3Y A;  1FZH E;  2VJ4 A;  3QEW A;  3L2O B;  3QNN A;  4M3W A;  3C6P B;  4M45 A;  3TAF A;  1XL3 C;  4DTR A;  3NAE A;  3WSO A;  3C6O B;  3SQ1 A;  1FZ5 E;  3OGM B;  4DTO A;  4M3T A;  3TAE A;  2P1Q B;  4M41 A;  1XVE E;  2FYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...