1XVGE

Soluble methane monooxygenase hydroxylase: bromoethanol soaked structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
total genus 61
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvgE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvgE02
1FZ7E 1FZ3E 1FZIE 1XMFE 1FZ4E 1XVDE 1FZ2E 1XVCE 1FZHE 1FZ1E 1XVFE 1XU5E 1XMGE 1FZ9E 1FYZE 1FZ8E 1MHZG 4GAMC 1XU3E 1FZ5E 1MMOG 1XVEE 1FZ0E 1FZ6E 1MHYG 1XMHE 1MTYG 1XVGE 1XVBE
chains in the Genus database with same CATH superfamily
2DTUA 4FJLA 2JQTA 3RMCA 1FZ3E 4AKIA 4QNDA 4M41A 1XL3C 3SJJA 1FZ4E 1XMFE 2JHAA 4FVMA 4EPHA 1FS1A 2MW2A 2LF3A 4EP9A 3L8BA 3OGMB 4KI6A 2B1EA 2K5SA 3NDKA 3C6NB 4I6JB 3QNNA 4FJ9A 4DTXA 3QEPA 1FZHE 4J2DA 4M3YA 3UO2A 2E31A 3WSOA 3KD5E 3RWUA 3LDSA 4FJGA 1XVFE 1XU5E 3LD8A 2OVQB 1FZ9E 4FK4A 3QERA 1FYZE 1FZ8E 1MHZG 1N1CA 5IREA 2PFVA 4GAMC 4M45A 4I9QA 3SVIA 4M3ZA 3SUOA 5IBKB 3J2PA 1MHYG 4JS4A 3QETA 4HCBA 1P22A 4DTRA 3QEXA 3RMBA 3TAEA 3TABA 2B8IA 4RG8A 2OYQA 2P5OA 1WAJA 4J2BA 3N1BA 3TL8B 2FW3A 3QEWA 3SUQA 4JS5A 3SQ1A 3UIQA 4E3SA 3C6OB 2QXFA 3NGIA 4M3UA 1WAFA 3MKSB 4ADNA 5IZ7A 1XVDE 3SQ4A 1FZ2E 4QNCA 4E4BA 4KHUA 4J2AA 4KHSA 1LDKE 3SQ0A 3SUNA 1FZ1E 3HP9A 4KHNA 1NEXB 4M3WA 3K2OA 2OVPB 3LDBA 3UO3A 3CFPA 4FJIA 3LZJA 4IT5A 1FZ5E 4HCCA 3QEIA 2OVRB 3CFRA 3SCXA 1MTYG 3HGKE 5H37A 2VJ5A 4DTMA 3TAFA 4JRPA 3S9HA 3SQ2A 4FJ8A 3L2OB 3E4WA 2P1QB 4B08A 3SUPA 3NCIA 4EYWA 2JH8A 3QESA 1FZ7E 1IH7A 3CQ8A 2E32A 2ATQA 1IG9A 4DTPA 4X5NA 1FZIE 4M3RA 3NHGA 3NAEA 4FJJA 4J2EA 4KHQA 2DY4A 3SI6A 2YB5A 3SPZA 3KD1E 1XVCE 4FK2A 3QEVA 4M3XA 2VIXA 3CFOA 3V7DB 1XMGE 2RKHA 1Q9YA 2P1OB 3OGLB 2DEBA 2RCUA 3OGKB 4DTOA 4ADOA 3HGLA 4DTJA 3N1EA 1MMOG 1XVEE 3L0MA 4DTUA 1FZ6E 3RMAA 4FK0A 1XMHE 4DU3A 3NE6A 3SPYA 2HD0A 4FJHA 1XVBE 2MZWB 2PFTA 4AKGA 2JH9A 4ICGC 4RL5A 4AKHA 3LZIA 1JW2A 3C95A 4DU1A 4FJ7A 4KHYA 4M42A 3HL8A 3L1NA 2H4TA 2LF6A 2P5GA 2JHCA 4FJ5A 4DTNA 4DTSA 3QNOA 4I9LA 4AI6A 2VJ4A 3SNNA 1FPOA 3C6PB 3BVOA 3RMDA 3J27A 4DU4A 1FXXA 4M3TA 2B7MA 4FJNA 1CLQA 3TJYA 4FJKA 4RNGA 1XU3E 2FYOA 1Q9XA 2OZMA 2JHPA 3E4YA 3TAGA 1FZ0E 4X5MA 2JPNA 1XVGE 2OZSA 4FJMA 4KHWA 2P1MB 4JRQA 2P1NB 4KI4A 2P1PB 4FJXA 2MMBA 3C94A
chains in the Genus database with same CATH topology
2DTUA 4FJLA 3RMCA 1FZ3E 4AKIA 4QNDA 4M41A 1XL3C 3SJJA 1FZ4E 1XMFE 2JHAA 4FVMA 4EPHA 1FS1A 4EP9A 2LF3A 3L8BA 4KI6A 3OGMB 2B1EA 3NDKA 3C6NB 4I6JB 3QNNA 4FJ9A 4DTXA 3QEPA 1FZHE 4J2DA 4M3YA 3WSOA 2E31A 3KD5E 3RWUA 3LDSA 4FJGA 1XVFE 1XU5E 3LD8A 2OVQB 1FZ9E 4FK4A 3QERA 1FYZE 1FZ8E 1MHZG 5IREA 4AKGA 2PFVA 4GAMC 4M45A 4I9QA 3SVIA 4M3ZA 3SUOA 5IBKB 3J2PA 1MHYG 4JS4A 3QETA 4HCBA 1P22A 4DTRA 3QEXA 3RMBA 3TAEA 3TABA 2B8IA 4RG8A 2OYQA 2P5OA 1WAJA 4J2BA 3N1BA 3TL8B 2FW3A 3QEWA 3SUQA 4JS5A 3SQ1A 3UIQA 4E3SA 3C6OB 2QXFA 3NGIA 4M3UA 1WAFA 3MKSB 4ADNA 5IZ7A 1XVDE 3SQ4A 1FZ2E 4QNCA 4E4BA 4KHUA 4J2AA 4KHSA 1LDKE 3SQ0A 3SUNA 1FZ1E 3HP9A 4KHNA 1NEXB 4M3WA 3K2OA 2OVPB 3LDBA 4FJIA 3CFPA 3LZJA 1FZ5E 4HCCA 3QEIA 2OVRB 3CFRA 3SCXA 1MTYG 3HGKE 5H37A 2VJ5A 4DTMA 3TAFA 4JRPA 3S9HA 3SQ2A 4FJ8A 3L2OB 3E4WA 2P1QB 4B08A 3SUPA 3NCIA 4EYWA 2JH8A 3QESA 1FZ7E 1IH7A 3CQ8A 2E32A 2ATQA 1IG9A 4DTPA 4X5NA 1FZIE 4M3RA 3NHGA 3NAEA 4FJJA 4J2EA 4KHQA 2DY4A 3SI6A 2YB5A 3SPZA 3KD1E 1XVCE 4FK2A 3QEVA 4M3XA 2VIXA 3CFOA 3V7DB 1XMGE 1Q9YA 2P1OB 3OGLB 2DEBA 2RCUA 3OGKB 4DTOA 4ADOA 3HGLA 4DTJA 3N1EA 1MMOG 1XVEE 3L0MA 4DTUA 1FZ6E 3RMAA 4FK0A 1XMHE 4DU3A 3NE6A 3SPYA 2HD0A 4FJHA 1XVBE 2MZWB 2PFTA 2JH9A 4RL5A 4AKHA 3LZIA 3C95A 4DU1A 4FJ7A 4KHYA 4M42A 3HL8A 3L1NA 2H4TA 2LF6A 2P5GA 2JHCA 4FJ5A 4DTNA 4DTSA 3QNOA 4I9LA 4AI6A 2VJ4A 3SNNA 3C6PB 3RMDA 3J27A 4DU4A 1FXXA 4M3TA 2B7MA 4FJNA 1CLQA 3TJYA 4FJKA 4RNGA 1XU3E 2FYOA 1Q9XA 2OZMA 2JHPA 3E4YA 3TAGA 1FZ0E 4X5MA 2JPNA 1XVGE 2OZSA 4FJMA 4KHWA 2P1MB 4JRQA 2P1NB 4KI4A 2P1PB 4FJXA 2MMBA 3C94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ7 E;  1FZ3 E;  1FZI E;  1XMF E;  1FZ4 E;  1XVD E;  1FZ2 E;  1XVC E;  1FZH E;  1FZ1 E;  1XVF E;  1XU5 E;  1XMG E;  1FZ9 E;  1FYZ E;  1FZ8 E;  1MHZ G;  4GAM C;  1XU3 E;  1FZ5 E;  1MMO G;  1XVE E;  1FZ0 E;  1FZ6 E;  1MHY G;  1XMH E;  1MTY G;  1XVG E;  1XVB E; 
#chains in the Genus database with same CATH topology
 2DTU A;  4FJL A;  2JQT A;  3RMC A;  1FZ3 E;  4AKI A;  4QND A;  4M41 A;  1XL3 C;  3SJJ A;  1FZ4 E;  1XMF E;  2JHA A;  4FVM A;  4EPH A;  1FS1 A;  2MW2 A;  2LF3 A;  4EP9 A;  3L8B A;  3OGM B;  4KI6 A;  2B1E A;  2K5S A;  3NDK A;  3C6N B;  4I6J B;  3QNN A;  4FJ9 A;  4DTX A;  3QEP A;  1FZH E;  4J2D A;  4M3Y A;  3UO2 A;  2E31 A;  3WSO A;  3KD5 E;  3RWU A;  3LDS A;  4FJG A;  1XVF E;  1XU5 E;  3LD8 A;  2OVQ B;  1FZ9 E;  4FK4 A;  3QER A;  1FYZ E;  1FZ8 E;  1MHZ G;  1N1C A;  5IRE A;  2PFV A;  4GAM C;  4M45 A;  4I9Q A;  3SVI A;  4M3Z A;  3SUO A;  5IBK B;  3J2P A;  1MHY G;  4JS4 A;  3QET A;  4HCB A;  1P22 A;  4DTR A;  3QEX A;  3RMB A;  3TAE A;  3TAB A;  2B8I A;  4RG8 A;  2OYQ A;  2P5O A;  1WAJ A;  4J2B A;  3N1B A;  3TL8 B;  2FW3 A;  3QEW A;  3SUQ A;  4JS5 A;  3SQ1 A;  3UIQ A;  4E3S A;  3C6O B;  2QXF A;  3NGI A;  4M3U A;  1WAF A;  3MKS B;  4ADN A;  5IZ7 A;  1XVD E;  3SQ4 A;  1FZ2 E;  4QNC A;  4E4B A;  4KHU A;  4J2A A;  4KHS A;  1LDK E;  3SQ0 A;  3SUN A;  1FZ1 E;  3HP9 A;  4KHN A;  1NEX B;  4M3W A;  3K2O A;  2OVP B;  3LDB A;  3UO3 A;  3CFP A;  4FJI A;  3LZJ A;  4IT5 A;  1FZ5 E;  4HCC A;  3QEI A;  2OVR B;  3CFR A;  3SCX A;  1MTY G;  3HGK E;  5H37 A;  2VJ5 A;  4DTM A;  3TAF A;  4JRP A;  3S9H A;  3SQ2 A;  4FJ8 A;  3L2O B;  3E4W A;  2P1Q B;  4B08 A;  3SUP A;  3NCI A;  4EYW A;  2JH8 A;  3QES A;  1FZ7 E;  1IH7 A;  3CQ8 A;  2E32 A;  2ATQ A;  1IG9 A;  4DTP A;  4X5N A;  1FZI E;  4M3R A;  3NHG A;  3NAE A;  4FJJ A;  4J2E A;  4KHQ A;  2DY4 A;  3SI6 A;  2YB5 A;  3SPZ A;  3KD1 E;  1XVC E;  4FK2 A;  3QEV A;  4M3X A;  2VIX A;  3CFO A;  3V7D B;  1XMG E;  2RKH A;  1Q9Y A;  2P1O B;  3OGL B;  2DEB A;  2RCU A;  3OGK B;  4DTO A;  4ADO A;  3HGL A;  4DTJ A;  3N1E A;  1MMO G;  1XVE E;  3L0M A;  4DTU A;  1FZ6 E;  3RMA A;  4FK0 A;  1XMH E;  4DU3 A;  3NE6 A;  3SPY A;  2HD0 A;  4FJH A;  1XVB E;  2MZW B;  2PFT A;  4AKG A;  2JH9 A;  4ICG C;  4RL5 A;  4AKH A;  3LZI A;  1JW2 A;  3C95 A;  4DU1 A;  4FJ7 A;  4KHY A;  4M42 A;  3HL8 A;  3L1N A;  2H4T A;  2LF6 A;  2P5G A;  2JHC A;  4FJ5 A;  4DTN A;  4DTS A;  3QNO A;  4I9L A;  4AI6 A;  2VJ4 A;  3SNN A;  1FPO A;  3C6P B;  3BVO A;  3RMD A;  3J27 A;  4DU4 A;  1FXX A;  4M3T A;  2B7M A;  4FJN A;  1CLQ A;  3TJY A;  4FJK A;  4RNG A;  1XU3 E;  2FYO A;  1Q9X A;  2OZM A;  2JHP A;  3E4Y A;  3TAG A;  1FZ0 E;  4X5M A;  2JPN A;  1XVG E;  2OZS A;  4FJM A;  4KHW A;  2P1M B;  4JRQ A;  2P1N B;  4KI4 A;  2P1P B;  4FJX A;  2MMB A;  3C94 A; 
#chains in the Genus database with same CATH homology
 2DTU A;  4FJL A;  3RMC A;  1FZ3 E;  4AKI A;  4QND A;  4M41 A;  1XL3 C;  3SJJ A;  1FZ4 E;  1XMF E;  2JHA A;  4FVM A;  4EPH A;  1FS1 A;  4EP9 A;  2LF3 A;  3L8B A;  4KI6 A;  3OGM B;  2B1E A;  3NDK A;  3C6N B;  4I6J B;  3QNN A;  4FJ9 A;  4DTX A;  3QEP A;  1FZH E;  4J2D A;  4M3Y A;  3WSO A;  2E31 A;  3KD5 E;  3RWU A;  3LDS A;  4FJG A;  1XVF E;  1XU5 E;  3LD8 A;  2OVQ B;  1FZ9 E;  4FK4 A;  3QER A;  1FYZ E;  1FZ8 E;  1MHZ G;  5IRE A;  4AKG A;  2PFV A;  4GAM C;  4M45 A;  4I9Q A;  3SVI A;  4M3Z A;  3SUO A;  5IBK B;  3J2P A;  1MHY G;  4JS4 A;  3QET A;  4HCB A;  1P22 A;  4DTR A;  3QEX A;  3RMB A;  3TAE A;  3TAB A;  2B8I A;  4RG8 A;  2OYQ A;  2P5O A;  1WAJ A;  4J2B A;  3N1B A;  3TL8 B;  2FW3 A;  3QEW A;  3SUQ A;  4JS5 A;  3SQ1 A;  3UIQ A;  4E3S A;  3C6O B;  2QXF A;  3NGI A;  4M3U A;  1WAF A;  3MKS B;  4ADN A;  5IZ7 A;  1XVD E;  3SQ4 A;  1FZ2 E;  4QNC A;  4E4B A;  4KHU A;  4J2A A;  4KHS A;  1LDK E;  3SQ0 A;  3SUN A;  1FZ1 E;  3HP9 A;  4KHN A;  1NEX B;  4M3W A;  3K2O A;  2OVP B;  3LDB A;  4FJI A;  3CFP A;  3LZJ A;  1FZ5 E;  4HCC A;  3QEI A;  2OVR B;  3CFR A;  3SCX A;  1MTY G;  3HGK E;  5H37 A;  2VJ5 A;  4DTM A;  3TAF A;  4JRP A;  3S9H A;  3SQ2 A;  4FJ8 A;  3L2O B;  3E4W A;  2P1Q B;  4B08 A;  3SUP A;  3NCI A;  4EYW A;  2JH8 A;  3QES A;  1FZ7 E;  1IH7 A;  3CQ8 A;  2E32 A;  2ATQ A;  1IG9 A;  4DTP A;  4X5N A;  1FZI E;  4M3R A;  3NHG A;  3NAE A;  4FJJ A;  4J2E A;  4KHQ A;  2DY4 A;  3SI6 A;  2YB5 A;  3SPZ A;  3KD1 E;  1XVC E;  4FK2 A;  3QEV A;  4M3X A;  2VIX A;  3CFO A;  3V7D B;  1XMG E;  1Q9Y A;  2P1O B;  3OGL B;  2DEB A;  2RCU A;  3OGK B;  4DTO A;  4ADO A;  3HGL A;  4DTJ A;  3N1E A;  1MMO G;  1XVE E;  3L0M A;  4DTU A;  1FZ6 E;  3RMA A;  4FK0 A;  1XMH E;  4DU3 A;  3NE6 A;  3SPY A;  2HD0 A;  4FJH A;  1XVB E;  2MZW B;  2PFT A;  2JH9 A;  4RL5 A;  4AKH A;  3LZI A;  3C95 A;  4DU1 A;  4FJ7 A;  4KHY A;  4M42 A;  3HL8 A;  3L1N A;  2H4T A;  2LF6 A;  2P5G A;  2JHC A;  4FJ5 A;  4DTN A;  4DTS A;  3QNO A;  4I9L A;  4AI6 A;  2VJ4 A;  3SNN A;  3C6P B;  3RMD A;  3J27 A;  4DU4 A;  1FXX A;  4M3T A;  2B7M A;  4FJN A;  1CLQ A;  3TJY A;  4FJK A;  4RNG A;  1XU3 E;  2FYO A;  1Q9X A;  2OZM A;  2JHP A;  3E4Y A;  3TAG A;  1FZ0 E;  4X5M A;  2JPN A;  1XVG E;  2OZS A;  4FJM A;  4KHW A;  2P1M B;  4JRQ A;  2P1N B;  4KI4 A;  2P1P B;  4FJX A;  2MMB A;  3C94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...