1XVGE

Soluble methane monooxygenase hydroxylase: bromoethanol soaked structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
total genus 61
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvgE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvgE02
1FZ3E 1FZ4E 1XVDE 1FZ9E 1FZ6E 1MHZG 1FZ5E 1XMGE 1XVGE 1XVEE 1XVCE 1XU5E 1XVBE 1FYZE 1FZ1E 1XMHE 4GAMC 1FZ8E 1MTYG 1FZIE 1MMOG 1FZ0E 1FZ7E 1FZ2E 1FZHE 1MHYG 1XU3E 1XMFE 1XVFE
chains in the Genus database with same CATH superfamily
4EP9A 3NHGA 4DTPA 4FK0A 3HP9A 1WAFA 2QXFA 3E4WA 4RL5A 4FJJA 4FK4A 3QETA 3UIQA 3RMBA 1FZ6E 1MHZG 4I9LA 1WAJA 1Q9YA 1FPOA 2OZSA 2RCUA 3HL8A 3CFPA 4HCCA 1Q9XA 3SUNA 4J2DA 4FVMA 4X5MA 3C6NB 2OZMA 3L8BA 4I9QA 2LF6A 2RKHA 2DY4A 4FJNA 4EYWA 3QESA 3BVOA 3J2PA 3TJYA 3SUQA 4FK2A 3J27A 4M3RA 4DTXA 4FJKA 3TABA 3SPYA 1FZIE 3N1BA 3NAEA 3SPZA 5IREA 3RWUA 4RG8A 4B08A 3SI6A 4QNDA 4M3ZA 2P5OA 1FZ7E 3TAGA 2MW2A 4M41A 4ADNA 1JW2A 1FZ2E 4M42A 3L0MA 1XMFE 1XVFE 3CFRA 2OYQA 1FS1A 3SUOA 4DTOA 4KHQA 1FZ4E 2VJ5A 4FJIA 2HD0A 4FJMA 2OVRB 4M45A 3LDSA 1XVEE 1XVCE 4KHUA 4AKHA 1XU5E 2JQTA 2K5SA 4DU3A 3K2OA 3QNNA 4KHYA 1CLQA 2P1QB 5IBKB 3SVIA 3NGIA 1FZ1E 3KD1E 2P1NB 3SUPA 2MZWB 1N1CA 3CFOA 3QEXA 4AKIA 1FZ8E 3SQ4A 1IG9A 4E4BA 2YB5A 3QEPA 3CQ8A 3QNOA 2PFTA 3HGKE 3V7DB 2MMBA 3WSOA 4DTMA 3L2OB 4FJLA 3C6PB 4X5NA 2P1OB 4FJGA 4FJ7A 2DTUA 4IT5A 3RMAA 3NCIA 4FJ5A 4FJ8A 4E3SA 4QNCA 3KD5E 4FJ9A 3LD8A 4M3UA 1FZ3E 2FW3A 4JS4A 4RNGA 4DTUA 2JPNA 2OVPB 3LZIA 4J2BA 2B7MA 1XMGE 3C94A 4FJHA 3L1NA 1LDKE 1P22A 3RMDA 1FXXA 1XVBE 2ATQA 3C6OB 4KI4A 2FYOA 5H37A 4DU4A 4FJXA 3TL8B 4JRPA 4ICGC 2JH8A 4GAMC 4AKGA 3NDKA 4J2AA 1NEXB 2JHAA 2JHCA 4JS5A 2P5GA 3UO3A 3SQ1A 1MTYG 2LF3A 4J2EA 4DU1A 1MMOG 2B1EA 2E32A 3HGLA 3NE6A 3SJJA 4KHSA 3S9HA 3SNNA 2B8IA 3LDBA 3SCXA 1FZ0E 3UO2A 1FZHE 3N1EA 1XU3E 4I6JB 4KHNA 3OGLB 2P1MB 3OGKB 3RMCA 3QEVA 3TAEA 4ADOA 1XVDE 1FZ9E 3OGMB 4M3WA 1FZ5E 4M3YA 4HCBA 1XL3C 1XVGE 2PFVA 4M3TA 4DTSA 1IH7A 2JH9A 2OVQB 4EPHA 2H4TA 1FYZE 4DTNA 1XMHE 2JHPA 2DEBA 3TAFA 4DTRA 2E31A 2VIXA 3C95A 3MKSB 3SQ2A 3QEWA 3SQ0A 4KI6A 4JRQA 2P1PB 3QERA 3QEIA 3E4YA 4M3XA 4DTJA 1MHYG 4KHWA 4AI6A 2VJ4A 3LZJA 5IZ7A
chains in the Genus database with same CATH topology
4EP9A 3NHGA 4DTPA 4FK0A 3HP9A 1WAFA 2QXFA 3E4WA 4RL5A 4FJJA 4FK4A 3QETA 3UIQA 3RMBA 1FZ6E 1MHZG 4I9LA 1WAJA 1Q9YA 2OZSA 2RCUA 3HL8A 3CFPA 4HCCA 1Q9XA 3SUNA 4J2DA 4FVMA 4X5MA 3C6NB 2OZMA 3L8BA 4I9QA 2LF6A 2DY4A 4FJNA 4EYWA 3QESA 3J2PA 3TJYA 3SUQA 4FK2A 3J27A 4M3RA 4DTXA 4FJKA 3TABA 3SPYA 1FZIE 3N1BA 3NAEA 3SPZA 5IREA 3RWUA 4RG8A 4B08A 3SI6A 4QNDA 4M3ZA 2P5OA 1FZ7E 3TAGA 4M41A 4ADNA 1FZ2E 4M42A 3L0MA 1XMFE 1XVFE 3CFRA 2OYQA 1FS1A 3SUOA 4DTOA 4KHQA 1FZ4E 2VJ5A 4FJIA 2HD0A 4FJMA 2OVRB 4M45A 3LDSA 1XVEE 1XVCE 4KHUA 4AKHA 1XU5E 4DU3A 1CLQA 3K2OA 3QNNA 4KHYA 2P1QB 5IBKB 3SVIA 3NGIA 1FZ1E 3KD1E 2P1NB 3SUPA 2MZWB 3CFOA 3QEXA 4AKIA 1FZ8E 3SQ4A 1IG9A 4E4BA 2YB5A 3QEPA 3CQ8A 3QNOA 2PFTA 3HGKE 3V7DB 2MMBA 3WSOA 4DTMA 3L2OB 4FJLA 3C6PB 4X5NA 2P1OB 4FJGA 4FJ7A 2DTUA 3RMAA 3NCIA 4FJ5A 4FJ8A 4E3SA 4QNCA 3KD5E 4FJ9A 3LD8A 4M3UA 1FZ3E 2FW3A 4JS4A 4RNGA 4DTUA 2JPNA 2OVPB 3LZIA 4J2BA 2B7MA 1XMGE 3C94A 4FJHA 3L1NA 1LDKE 1P22A 3RMDA 1FXXA 1XVBE 2ATQA 3C6OB 4KI4A 2FYOA 5H37A 4DU4A 4FJXA 3TL8B 4JRPA 2JH8A 4GAMC 4AKGA 3NDKA 4J2AA 1NEXB 2JHAA 2JHCA 4JS5A 2P5GA 3SQ1A 1MTYG 2LF3A 4J2EA 4DU1A 1MMOG 2B1EA 2E32A 3HGLA 3NE6A 3SJJA 4KHSA 3S9HA 3SNNA 2B8IA 3LDBA 3SCXA 1FZ0E 1FZHE 3N1EA 1XU3E 4I6JB 4KHNA 3OGLB 2P1MB 3OGKB 3RMCA 3QEVA 3TAEA 4ADOA 1XVDE 1FZ9E 3OGMB 4M3WA 1FZ5E 4M3YA 4HCBA 1XL3C 1XVGE 2PFVA 4M3TA 4DTSA 1IH7A 2JH9A 2OVQB 4EPHA 2H4TA 1FYZE 4DTNA 1XMHE 2JHPA 2DEBA 3TAFA 4DTRA 2E31A 2VIXA 3C95A 3MKSB 3SQ2A 3QEWA 3SQ0A 4KI6A 4JRQA 2P1PB 3QERA 3QEIA 3E4YA 4M3XA 4DTJA 1MHYG 4KHWA 4AI6A 2VJ4A 3LZJA 5IZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ3 E;  1FZ4 E;  1XVD E;  1FZ9 E;  1FZ6 E;  1MHZ G;  1FZ5 E;  1XMG E;  1XVG E;  1XVE E;  1XVC E;  1XU5 E;  1XVB E;  1FYZ E;  1FZ1 E;  1XMH E;  4GAM C;  1FZ8 E;  1MTY G;  1FZI E;  1MMO G;  1FZ0 E;  1FZ7 E;  1FZ2 E;  1FZH E;  1MHY G;  1XU3 E;  1XMF E;  1XVF E; 
#chains in the Genus database with same CATH topology
 4EP9 A;  3NHG A;  4DTP A;  4FK0 A;  3HP9 A;  1WAF A;  2QXF A;  3E4W A;  4RL5 A;  4FJJ A;  4FK4 A;  3QET A;  3UIQ A;  3RMB A;  1FZ6 E;  1MHZ G;  4I9L A;  1WAJ A;  1Q9Y A;  1FPO A;  2OZS A;  2RCU A;  3HL8 A;  3CFP A;  4HCC A;  1Q9X A;  3SUN A;  4J2D A;  4FVM A;  4X5M A;  3C6N B;  2OZM A;  3L8B A;  4I9Q A;  2LF6 A;  2RKH A;  2DY4 A;  4FJN A;  4EYW A;  3QES A;  3BVO A;  3J2P A;  3TJY A;  3SUQ A;  4FK2 A;  3J27 A;  4M3R A;  4DTX A;  4FJK A;  3TAB A;  3SPY A;  1FZI E;  3N1B A;  3NAE A;  3SPZ A;  5IRE A;  3RWU A;  4RG8 A;  4B08 A;  3SI6 A;  4QND A;  4M3Z A;  2P5O A;  1FZ7 E;  3TAG A;  2MW2 A;  4M41 A;  4ADN A;  1JW2 A;  1FZ2 E;  4M42 A;  3L0M A;  1XMF E;  1XVF E;  3CFR A;  2OYQ A;  1FS1 A;  3SUO A;  4DTO A;  4KHQ A;  1FZ4 E;  2VJ5 A;  4FJI A;  2HD0 A;  4FJM A;  2OVR B;  4M45 A;  3LDS A;  1XVE E;  1XVC E;  4KHU A;  4AKH A;  1XU5 E;  2JQT A;  2K5S A;  4DU3 A;  3K2O A;  3QNN A;  4KHY A;  1CLQ A;  2P1Q B;  5IBK B;  3SVI A;  3NGI A;  1FZ1 E;  3KD1 E;  2P1N B;  3SUP A;  2MZW B;  1N1C A;  3CFO A;  3QEX A;  4AKI A;  1FZ8 E;  3SQ4 A;  1IG9 A;  4E4B A;  2YB5 A;  3QEP A;  3CQ8 A;  3QNO A;  2PFT A;  3HGK E;  3V7D B;  2MMB A;  3WSO A;  4DTM A;  3L2O B;  4FJL A;  3C6P B;  4X5N A;  2P1O B;  4FJG A;  4FJ7 A;  2DTU A;  4IT5 A;  3RMA A;  3NCI A;  4FJ5 A;  4FJ8 A;  4E3S A;  4QNC A;  3KD5 E;  4FJ9 A;  3LD8 A;  4M3U A;  1FZ3 E;  2FW3 A;  4JS4 A;  4RNG A;  4DTU A;  2JPN A;  2OVP B;  3LZI A;  4J2B A;  2B7M A;  1XMG E;  3C94 A;  4FJH A;  3L1N A;  1LDK E;  1P22 A;  3RMD A;  1FXX A;  1XVB E;  2ATQ A;  3C6O B;  4KI4 A;  2FYO A;  5H37 A;  4DU4 A;  4FJX A;  3TL8 B;  4JRP A;  4ICG C;  2JH8 A;  4GAM C;  4AKG A;  3NDK A;  4J2A A;  1NEX B;  2JHA A;  2JHC A;  4JS5 A;  2P5G A;  3UO3 A;  3SQ1 A;  1MTY G;  2LF3 A;  4J2E A;  4DU1 A;  1MMO G;  2B1E A;  2E32 A;  3HGL A;  3NE6 A;  3SJJ A;  4KHS A;  3S9H A;  3SNN A;  2B8I A;  3LDB A;  3SCX A;  1FZ0 E;  3UO2 A;  1FZH E;  3N1E A;  1XU3 E;  4I6J B;  4KHN A;  3OGL B;  2P1M B;  3OGK B;  3RMC A;  3QEV A;  3TAE A;  4ADO A;  1XVD E;  1FZ9 E;  3OGM B;  4M3W A;  1FZ5 E;  4M3Y A;  4HCB A;  1XL3 C;  1XVG E;  2PFV A;  4M3T A;  4DTS A;  1IH7 A;  2JH9 A;  2OVQ B;  4EPH A;  2H4T A;  1FYZ E;  4DTN A;  1XMH E;  2JHP A;  2DEB A;  3TAF A;  4DTR A;  2E31 A;  2VIX A;  3C95 A;  3MKS B;  3SQ2 A;  3QEW A;  3SQ0 A;  4KI6 A;  4JRQ A;  2P1P B;  3QER A;  3QEI A;  3E4Y A;  4M3X A;  4DTJ A;  1MHY G;  4KHW A;  4AI6 A;  2VJ4 A;  3LZJ A;  5IZ7 A; 
#chains in the Genus database with same CATH homology
 4EP9 A;  3NHG A;  4DTP A;  4FK0 A;  3HP9 A;  1WAF A;  2QXF A;  3E4W A;  4RL5 A;  4FJJ A;  4FK4 A;  3QET A;  3UIQ A;  3RMB A;  1FZ6 E;  1MHZ G;  4I9L A;  1WAJ A;  1Q9Y A;  2OZS A;  2RCU A;  3HL8 A;  3CFP A;  4HCC A;  1Q9X A;  3SUN A;  4J2D A;  4FVM A;  4X5M A;  3C6N B;  2OZM A;  3L8B A;  4I9Q A;  2LF6 A;  2DY4 A;  4FJN A;  4EYW A;  3QES A;  3J2P A;  3TJY A;  3SUQ A;  4FK2 A;  3J27 A;  4M3R A;  4DTX A;  4FJK A;  3TAB A;  3SPY A;  1FZI E;  3N1B A;  3NAE A;  3SPZ A;  5IRE A;  3RWU A;  4RG8 A;  4B08 A;  3SI6 A;  4QND A;  4M3Z A;  2P5O A;  1FZ7 E;  3TAG A;  4M41 A;  4ADN A;  1FZ2 E;  4M42 A;  3L0M A;  1XMF E;  1XVF E;  3CFR A;  2OYQ A;  1FS1 A;  3SUO A;  4DTO A;  4KHQ A;  1FZ4 E;  2VJ5 A;  4FJI A;  2HD0 A;  4FJM A;  2OVR B;  4M45 A;  3LDS A;  1XVE E;  1XVC E;  4KHU A;  4AKH A;  1XU5 E;  4DU3 A;  1CLQ A;  3K2O A;  3QNN A;  4KHY A;  2P1Q B;  5IBK B;  3SVI A;  3NGI A;  1FZ1 E;  3KD1 E;  2P1N B;  3SUP A;  2MZW B;  3CFO A;  3QEX A;  4AKI A;  1FZ8 E;  3SQ4 A;  1IG9 A;  4E4B A;  2YB5 A;  3QEP A;  3CQ8 A;  3QNO A;  2PFT A;  3HGK E;  3V7D B;  2MMB A;  3WSO A;  4DTM A;  3L2O B;  4FJL A;  3C6P B;  4X5N A;  2P1O B;  4FJG A;  4FJ7 A;  2DTU A;  3RMA A;  3NCI A;  4FJ5 A;  4FJ8 A;  4E3S A;  4QNC A;  3KD5 E;  4FJ9 A;  3LD8 A;  4M3U A;  1FZ3 E;  2FW3 A;  4JS4 A;  4RNG A;  4DTU A;  2JPN A;  2OVP B;  3LZI A;  4J2B A;  2B7M A;  1XMG E;  3C94 A;  4FJH A;  3L1N A;  1LDK E;  1P22 A;  3RMD A;  1FXX A;  1XVB E;  2ATQ A;  3C6O B;  4KI4 A;  2FYO A;  5H37 A;  4DU4 A;  4FJX A;  3TL8 B;  4JRP A;  2JH8 A;  4GAM C;  4AKG A;  3NDK A;  4J2A A;  1NEX B;  2JHA A;  2JHC A;  4JS5 A;  2P5G A;  3SQ1 A;  1MTY G;  2LF3 A;  4J2E A;  4DU1 A;  1MMO G;  2B1E A;  2E32 A;  3HGL A;  3NE6 A;  3SJJ A;  4KHS A;  3S9H A;  3SNN A;  2B8I A;  3LDB A;  3SCX A;  1FZ0 E;  1FZH E;  3N1E A;  1XU3 E;  4I6J B;  4KHN A;  3OGL B;  2P1M B;  3OGK B;  3RMC A;  3QEV A;  3TAE A;  4ADO A;  1XVD E;  1FZ9 E;  3OGM B;  4M3W A;  1FZ5 E;  4M3Y A;  4HCB A;  1XL3 C;  1XVG E;  2PFV A;  4M3T A;  4DTS A;  1IH7 A;  2JH9 A;  2OVQ B;  4EPH A;  2H4T A;  1FYZ E;  4DTN A;  1XMH E;  2JHP A;  2DEB A;  3TAF A;  4DTR A;  2E31 A;  2VIX A;  3C95 A;  3MKS B;  3SQ2 A;  3QEW A;  3SQ0 A;  4KI6 A;  4JRQ A;  2P1P B;  3QER A;  3QEI A;  3E4Y A;  4M3X A;  4DTJ A;  1MHY G;  4KHW A;  4AI6 A;  2VJ4 A;  3LZJ A;  5IZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...