1MTYG

Methane monooxygenase hydroxylase from methylococcus capsulatus (bath)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
162
structure length
162
Chain Sequence
LGIHSNDTRDAWVNKIAHVNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE HYDROXYLASE
publication title Crystal structures of the methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath): implications for substrate gating and component interactions.
pubmed doi rcsb
molecule tags Monooxygenase
total genus 59
structure length 162
sequence length 162
chains with identical sequence H
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1996-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mtyG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mtyG02
1XU3E 1FZ2E 1FZ8E 1FZ0E 1FZ5E 1FZ6E 1FZ4E 1XVDE 1XVEE 4GAMC 1MHZG 1XVCE 1FZ9E 1FZ7E 1MTYG 1FZIE 1FYZE 1MHYG 1XMFE 1FZ1E 1XU5E 1XVBE 1XVFE 1XMHE 1XVGE 1XMGE 1FZHE 1FZ3E 1MMOG
chains in the Genus database with same CATH superfamily
2PFTA 2DTUA 3OGKB 1XU3E 4AKHA 3SQ1A 3SUNA 4M3YA 2OZMA 4KHWA 2HD0A 1LDKE 2MW2A 4KHSA 4JS4A 1XVCE 1FXXA 3HGKE 2ATQA 4X5MA 4JS5A 4FVMA 4KHQA 1WAJA 4DTSA 2DY4A 3QEIA 3UIQA 4EPHA 3KD1E 1FZIE 1FYZE 4E4BA 4AKGA 2VJ4A 2OVRB 1XMFE 3WSOA 2MZWB 4DTPA 2JHPA 3TL8B 2B1EA 3SQ0A 1XVGE 2FYOA 2P1OB 4HCCA 4FK0A 4AKIA 4RNGA 4FJXA 2B8IA 2H4TA 3L2OB 4KHNA 2VJ5A 1FZ3E 4M45A 4KHUA 4FJHA 3QETA 1FZ8E 3QNNA 3KD5E 4DU1A 3QESA 3QEPA 3RWUA 1N1CA 1FZ0E 1FPOA 1FZ6E 1XVDE 2E31A 3OGMB 3CFOA 3TJYA 4ADNA 2P5OA 3TABA 4J2DA 1FZ9E 2FW3A 3L1NA 5IBKB 4KHYA 4FK4A 3V7DB 4M42A 4M3UA 3NHGA 4M3WA 3RMDA 4DTNA 4JRQA 3QEWA 4B08A 1FZ1E 4I9LA 1XVBE 3NGIA 3MKSB 2P1NB 3CFPA 3OGLB 3SJJA 2P5GA 4FJGA 2RCUA 4DTMA 1FS1A 4HCBA 3C6NB 3RMCA 2QXFA 4QNCA 3CFRA 3NAEA 3C6OB 4DTXA 4FJKA 3SPYA 4FJJA 2OVQB 3NCIA 3J2PA 3SPZA 2MMBA 2JHCA 2P1PB 3C95A 4DTJA 4J2BA 4M3RA 3N1BA 4DU4A 4M41A 4FJ5A 3RMBA 4J2AA 4QNDA 1FZ5E 1FZ4E 5IREA 3TAEA 3LDBA 1MHZG 1IG9A 4M3TA 2P1QB 3J27A 2P1MB 4FJ7A 4I9QA 3QEXA 1XL3C 3NE6A 1MTYG 4FK2A 3SUOA 1MHYG 4DTUA 4EYWA 1XU5E 3HL8A 1CLQA 3RMAA 3K2OA 2K5SA 1XMHE 3SVIA 3E4YA 3SQ2A 3NDKA 5IZ7A 4FJ9A 3TAGA 4EP9A 3LD8A 3HGLA 1FZHE 4M3ZA 3S9HA 1P22A 4ICGC 3SUQA 4AI6A 2LF6A 1MMOG 4X5NA 3LDSA 2JH9A 4RG8A 4E3SA 3SCXA 3L0MA 1FZ2E 4FJ8A 3BVOA 2LF3A 3QNOA 3HP9A 2JH8A 2JPNA 1XVEE 2VIXA 3C6PB 2YB5A 3C94A 4GAMC 4FJMA 2DEBA 1Q9YA 2E32A 3LZIA 2JHAA 3QEVA 4FJNA 3N1EA 4M3XA 1FZ7E 4KI6A 3SNNA 2RKHA 4DU3A 1WAFA 2OYQA 2OZSA 4RL5A 3LZJA 2B7MA 3TAFA 3SUPA 1XVFE 1IH7A 3CQ8A 2OVPB 4ADOA 4DTOA 3UO3A 4FJIA 3QERA 2JQTA 3SI6A 3UO2A 1XMGE 5H37A 2PFVA 4FJLA 4DTRA 1JW2A 3SQ4A 4KI4A 1Q9XA 4J2EA 1NEXB 3L8BA 4JRPA 4I6JB 4IT5A 3E4WA
chains in the Genus database with same CATH topology
2PFTA 2DTUA 3OGKB 1XU3E 4AKHA 3SQ1A 3SUNA 4M3YA 2OZMA 4KHWA 2HD0A 1LDKE 4KHSA 4JS4A 1XVCE 1FXXA 3HGKE 2ATQA 4X5MA 4JS5A 4FVMA 4KHQA 1WAJA 4DTSA 2DY4A 3QEIA 3UIQA 4EPHA 3KD1E 1FZIE 1FYZE 4E4BA 4AKGA 2VJ4A 2OVRB 1XMFE 3WSOA 2MZWB 4DTPA 2JHPA 3TL8B 2B1EA 3SQ0A 1XVGE 2FYOA 2P1OB 4HCCA 4FK0A 4AKIA 4RNGA 4FJXA 2B8IA 2H4TA 3L2OB 4KHNA 2VJ5A 1FZ3E 4M45A 4KHUA 4FJHA 3QETA 1FZ8E 3QNNA 3KD5E 4DU1A 3QESA 3QEPA 3RWUA 1FZ0E 1FZ6E 2E31A 1XVDE 3OGMB 4ADNA 3CFOA 3TJYA 2P5OA 4J2DA 3TABA 1FZ9E 2FW3A 3L1NA 5IBKB 4KHYA 4FK4A 3V7DB 4M42A 4M3UA 3NHGA 4M3WA 3RMDA 4DTNA 4JRQA 3QEWA 4B08A 1FZ1E 4I9LA 1XVBE 3NGIA 3MKSB 2P1NB 3CFPA 3OGLB 3SJJA 2P5GA 4FJGA 2RCUA 4DTMA 1FS1A 4HCBA 3C6NB 3RMCA 2QXFA 4QNCA 3CFRA 3NAEA 3C6OB 4DTXA 4FJKA 3SPYA 4FJJA 2OVQB 3NCIA 3J2PA 3SPZA 2MMBA 2JHCA 2P1PB 3C95A 4DTJA 4J2BA 4M3RA 3N1BA 4DU4A 4M41A 4FJ5A 3RMBA 4J2AA 4QNDA 1FZ5E 1FZ4E 5IREA 3TAEA 3LDBA 1MHZG 1IG9A 4M3TA 2P1QB 3J27A 2P1MB 4FJ7A 4I9QA 3QEXA 1XL3C 3NE6A 1MTYG 4FK2A 3SUOA 1MHYG 4DTUA 4EYWA 1XU5E 3HL8A 1CLQA 3RMAA 3K2OA 1XMHE 3SVIA 3E4YA 3SQ2A 3NDKA 5IZ7A 4FJ9A 3TAGA 4EP9A 3LD8A 3HGLA 1FZHE 4M3ZA 3S9HA 1P22A 3SUQA 4AI6A 2LF6A 1MMOG 4X5NA 3LDSA 2JH9A 4RG8A 4E3SA 3SCXA 3L0MA 1FZ2E 4FJ8A 2LF3A 3QNOA 3HP9A 2JH8A 2JPNA 1XVEE 3C94A 3C6PB 2VIXA 2YB5A 4GAMC 4FJMA 2DEBA 1Q9YA 2E32A 3LZIA 2JHAA 3QEVA 4FJNA 3N1EA 4M3XA 1FZ7E 4KI6A 3SNNA 4DU3A 1WAFA 2OYQA 2OZSA 4RL5A 3LZJA 2B7MA 3TAFA 3SUPA 1XVFE 1IH7A 3CQ8A 2OVPB 4ADOA 4DTOA 4FJIA 3QERA 3SI6A 1XMGE 5H37A 2PFVA 4FJLA 4DTRA 3SQ4A 4KI4A 1Q9XA 4J2EA 1NEXB 3L8BA 4JRPA 4I6JB 3E4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XU3 E;  1FZ2 E;  1FZ8 E;  1FZ0 E;  1FZ5 E;  1FZ6 E;  1FZ4 E;  1XVD E;  1XVE E;  4GAM C;  1MHZ G;  1XVC E;  1FZ9 E;  1FZ7 E;  1MTY G;  1FZI E;  1FYZ E;  1MHY G;  1XMF E;  1FZ1 E;  1XU5 E;  1XVB E;  1XVF E;  1XMH E;  1XVG E;  1XMG E;  1FZH E;  1FZ3 E;  1MMO G; 
#chains in the Genus database with same CATH topology
 2PFT A;  2DTU A;  3OGK B;  1XU3 E;  4AKH A;  3SQ1 A;  3SUN A;  4M3Y A;  2OZM A;  4KHW A;  2HD0 A;  1LDK E;  2MW2 A;  4KHS A;  4JS4 A;  1XVC E;  1FXX A;  3HGK E;  2ATQ A;  4X5M A;  4JS5 A;  4FVM A;  4KHQ A;  1WAJ A;  4DTS A;  2DY4 A;  3QEI A;  3UIQ A;  4EPH A;  3KD1 E;  1FZI E;  1FYZ E;  4E4B A;  4AKG A;  2VJ4 A;  2OVR B;  1XMF E;  3WSO A;  2MZW B;  4DTP A;  2JHP A;  3TL8 B;  2B1E A;  3SQ0 A;  1XVG E;  2FYO A;  2P1O B;  4HCC A;  4FK0 A;  4AKI A;  4RNG A;  4FJX A;  2B8I A;  2H4T A;  3L2O B;  4KHN A;  2VJ5 A;  1FZ3 E;  4M45 A;  4KHU A;  4FJH A;  3QET A;  1FZ8 E;  3QNN A;  3KD5 E;  4DU1 A;  3QES A;  3QEP A;  3RWU A;  1N1C A;  1FZ0 E;  1FPO A;  1FZ6 E;  1XVD E;  2E31 A;  3OGM B;  3CFO A;  3TJY A;  4ADN A;  2P5O A;  3TAB A;  4J2D A;  1FZ9 E;  2FW3 A;  3L1N A;  5IBK B;  4KHY A;  4FK4 A;  3V7D B;  4M42 A;  4M3U A;  3NHG A;  4M3W A;  3RMD A;  4DTN A;  4JRQ A;  3QEW A;  4B08 A;  1FZ1 E;  4I9L A;  1XVB E;  3NGI A;  3MKS B;  2P1N B;  3CFP A;  3OGL B;  3SJJ A;  2P5G A;  4FJG A;  2RCU A;  4DTM A;  1FS1 A;  4HCB A;  3C6N B;  3RMC A;  2QXF A;  4QNC A;  3CFR A;  3NAE A;  3C6O B;  4DTX A;  4FJK A;  3SPY A;  4FJJ A;  2OVQ B;  3NCI A;  3J2P A;  3SPZ A;  2MMB A;  2JHC A;  2P1P B;  3C95 A;  4DTJ A;  4J2B A;  4M3R A;  3N1B A;  4DU4 A;  4M41 A;  4FJ5 A;  3RMB A;  4J2A A;  4QND A;  1FZ5 E;  1FZ4 E;  5IRE A;  3TAE A;  3LDB A;  1MHZ G;  1IG9 A;  4M3T A;  2P1Q B;  3J27 A;  2P1M B;  4FJ7 A;  4I9Q A;  3QEX A;  1XL3 C;  3NE6 A;  1MTY G;  4FK2 A;  3SUO A;  1MHY G;  4DTU A;  4EYW A;  1XU5 E;  3HL8 A;  1CLQ A;  3RMA A;  3K2O A;  2K5S A;  1XMH E;  3SVI A;  3E4Y A;  3SQ2 A;  3NDK A;  5IZ7 A;  4FJ9 A;  3TAG A;  4EP9 A;  3LD8 A;  3HGL A;  1FZH E;  4M3Z A;  3S9H A;  1P22 A;  4ICG C;  3SUQ A;  4AI6 A;  2LF6 A;  1MMO G;  4X5N A;  3LDS A;  2JH9 A;  4RG8 A;  4E3S A;  3SCX A;  3L0M A;  1FZ2 E;  4FJ8 A;  3BVO A;  2LF3 A;  3QNO A;  3HP9 A;  2JH8 A;  2JPN A;  1XVE E;  2VIX A;  3C6P B;  2YB5 A;  3C94 A;  4GAM C;  4FJM A;  2DEB A;  1Q9Y A;  2E32 A;  3LZI A;  2JHA A;  3QEV A;  4FJN A;  3N1E A;  4M3X A;  1FZ7 E;  4KI6 A;  3SNN A;  2RKH A;  4DU3 A;  1WAF A;  2OYQ A;  2OZS A;  4RL5 A;  3LZJ A;  2B7M A;  3TAF A;  3SUP A;  1XVF E;  1IH7 A;  3CQ8 A;  2OVP B;  4ADO A;  4DTO A;  3UO3 A;  4FJI A;  3QER A;  2JQT A;  3SI6 A;  3UO2 A;  1XMG E;  5H37 A;  2PFV A;  4FJL A;  4DTR A;  1JW2 A;  3SQ4 A;  4KI4 A;  1Q9X A;  4J2E A;  1NEX B;  3L8B A;  4JRP A;  4I6J B;  4IT5 A;  3E4W A; 
#chains in the Genus database with same CATH homology
 2PFT A;  2DTU A;  3OGK B;  1XU3 E;  4AKH A;  3SQ1 A;  3SUN A;  4M3Y A;  2OZM A;  4KHW A;  2HD0 A;  1LDK E;  4KHS A;  4JS4 A;  1XVC E;  1FXX A;  3HGK E;  2ATQ A;  4X5M A;  4JS5 A;  4FVM A;  4KHQ A;  1WAJ A;  4DTS A;  2DY4 A;  3QEI A;  3UIQ A;  4EPH A;  3KD1 E;  1FZI E;  1FYZ E;  4E4B A;  4AKG A;  2VJ4 A;  2OVR B;  1XMF E;  3WSO A;  2MZW B;  4DTP A;  2JHP A;  3TL8 B;  2B1E A;  3SQ0 A;  1XVG E;  2FYO A;  2P1O B;  4HCC A;  4FK0 A;  4AKI A;  4RNG A;  4FJX A;  2B8I A;  2H4T A;  3L2O B;  4KHN A;  2VJ5 A;  1FZ3 E;  4M45 A;  4KHU A;  4FJH A;  3QET A;  1FZ8 E;  3QNN A;  3KD5 E;  4DU1 A;  3QES A;  3QEP A;  3RWU A;  1FZ0 E;  1FZ6 E;  2E31 A;  1XVD E;  3OGM B;  4ADN A;  3CFO A;  3TJY A;  2P5O A;  4J2D A;  3TAB A;  1FZ9 E;  2FW3 A;  3L1N A;  5IBK B;  4KHY A;  4FK4 A;  3V7D B;  4M42 A;  4M3U A;  3NHG A;  4M3W A;  3RMD A;  4DTN A;  4JRQ A;  3QEW A;  4B08 A;  1FZ1 E;  4I9L A;  1XVB E;  3NGI A;  3MKS B;  2P1N B;  3CFP A;  3OGL B;  3SJJ A;  2P5G A;  4FJG A;  2RCU A;  4DTM A;  1FS1 A;  4HCB A;  3C6N B;  3RMC A;  2QXF A;  4QNC A;  3CFR A;  3NAE A;  3C6O B;  4DTX A;  4FJK A;  3SPY A;  4FJJ A;  2OVQ B;  3NCI A;  3J2P A;  3SPZ A;  2MMB A;  2JHC A;  2P1P B;  3C95 A;  4DTJ A;  4J2B A;  4M3R A;  3N1B A;  4DU4 A;  4M41 A;  4FJ5 A;  3RMB A;  4J2A A;  4QND A;  1FZ5 E;  1FZ4 E;  5IRE A;  3TAE A;  3LDB A;  1MHZ G;  1IG9 A;  4M3T A;  2P1Q B;  3J27 A;  2P1M B;  4FJ7 A;  4I9Q A;  3QEX A;  1XL3 C;  3NE6 A;  1MTY G;  4FK2 A;  3SUO A;  1MHY G;  4DTU A;  4EYW A;  1XU5 E;  3HL8 A;  1CLQ A;  3RMA A;  3K2O A;  1XMH E;  3SVI A;  3E4Y A;  3SQ2 A;  3NDK A;  5IZ7 A;  4FJ9 A;  3TAG A;  4EP9 A;  3LD8 A;  3HGL A;  1FZH E;  4M3Z A;  3S9H A;  1P22 A;  3SUQ A;  4AI6 A;  2LF6 A;  1MMO G;  4X5N A;  3LDS A;  2JH9 A;  4RG8 A;  4E3S A;  3SCX A;  3L0M A;  1FZ2 E;  4FJ8 A;  2LF3 A;  3QNO A;  3HP9 A;  2JH8 A;  2JPN A;  1XVE E;  3C94 A;  3C6P B;  2VIX A;  2YB5 A;  4GAM C;  4FJM A;  2DEB A;  1Q9Y A;  2E32 A;  3LZI A;  2JHA A;  3QEV A;  4FJN A;  3N1E A;  4M3X A;  1FZ7 E;  4KI6 A;  3SNN A;  4DU3 A;  1WAF A;  2OYQ A;  2OZS A;  4RL5 A;  3LZJ A;  2B7M A;  3TAF A;  3SUP A;  1XVF E;  1IH7 A;  3CQ8 A;  2OVP B;  4ADO A;  4DTO A;  4FJI A;  3QER A;  3SI6 A;  1XMG E;  5H37 A;  2PFV A;  4FJL A;  4DTR A;  3SQ4 A;  4KI4 A;  1Q9X A;  4J2E A;  1NEX B;  3L8B A;  4JRP A;  4I6J B;  3E4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...