2E32A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
240
Chain Sequence
EYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords F-box only protein 2
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
total genus 57
structure length 240
sequence length 249
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00646 F-box F-box domain
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2e32A01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e32A02
3DYMA 3V7DB 2WZ8A 3OGRA 2Y6KA 4UI9L 1O8PA 1OF4A 1OF3A 1T2XA 3L2OB 3MKSB 1W8NA 1EUUA 3T0AA 2HYXA 4ARXA 2VZRA 2QQLA 3THCA 3E1F1 1UY0A 5CZKA 3DECA 2VJXA 2VCCA 2VZ1A 2Y6HA 4QB2A 2JDAA 1L7RA 4DEQA 2LW8A 3IB3A 1W9SA 3I2HA 2J1RA 1XNAA 4MADA 4GWJA 1GNYA 4A41A 2VO5A 4CUCA 3OG2A 2EIEA 3LPGA 3WSOA 4L0PA 2QQIA 1ULPA 2E26A 3T0DA 5HXMA 4A42A 3IDAA 4XUPA 2LS6A 3J7HA 1XC6A 2EICA 3DYPA 5EJZB 1KEXA 4QB1A 3OB8A 1K45A 3IIIA 2WQ8A 2YB7A 4Z2AA 2WABA 3A22A 2JE8A 2VZTA 3I3BA 4A6OA 2P1MB 2BGPA 2P1NB 3PUHA 1XNTA 1UY4A 3A7QA 4LHSA 1JYXA 1CZVA 3WNOA 4XUQA 1XPWA 4KI5M 2W47A 3VD5A 4GWIA 3SEEA 2Y6GA 4P00B 4CU7A 2B4KA 4LPLA 4XUOA 2PQSA 2J1UA 2WYSA 2JKXA 5JMOA 1GOHA 4PQQA 3FHQA 4QX0A 1KGYA 2R7EB 1SHWB 2WZEA 1K12A 5EIYB 2OVQB 3CZUA 3K75B 3WF2A 2J1EA 4PT6A 3T2PA 3W5MA 3OGKB 1WCQA 3CKHA 3HEIA 3LEIA 1O8SA 3ZM8A 2OKXA 4JKLA 1NKGA 5IFTA 5DPNA 2VCBA 1GQPA 2VC9A 2ZEXA 4DXTA 3OEAA 3I2KA 3WNNA 1PX3A 1W0NA 1H6XA 3U37A 2VZSA 4W50A 3LE0A 1OT5A 3VD3A 4MO3M 2P1OB 1UY1A 4QX1A 3MO4A 4ZZ8A 3SKJE 3BN6A 3WNPA 4IUGA 2J1SA 4KMQA 5LA0A 1JYVA 4RYDA 3I3DA 2OVPB 2X10A 1CIYA 3HNMA 3WF1A 1F4AA 1H6YA 4BXSV 5C71A 2W91A 3ACFA 2VZQA 2ID4A 3ABZA 4AG4A 2ZXQA 2W5FA 5C70A 2YFZA 1UYZA 1GU3A 3IAQA 2W9XA 3VDCA 3NJVA 4W8JA 3HNYM 2VQTA 4XVHA 1K3IA 2RVAA 2E32A 4OMCA 1GOGA 3MBWA 1JHJA 2E31A 3HN3A 2W1QA 1EUTA 5JUVA 3C7OA 3IAPA 2BBAA 1W8OA 2JD9A 5JXIA 4UOJA 2HLEA 2YFUA 3A23A 3C6OB 5JR2A 4JKKA 4XURA 4OMDA 3K4DA 2DCJA 2YC4A 3ACIA 1DLCA 2WDBA 1W99A 4OUEA 2VCAA 4HG6B 1LNSA 4P5YA 5FUIA 2E33A 2Y6LA 1PMHX 3SKVA 3C6NB 5F7UA 1JZ6A 3K77A 3LQCA 3MV11 3DYOA 2W95A 4CUBA 4ZY9A 2Z4FA 4QPWA 3ACHA 1W9TA 2WN2A 4OYUA 3OGSA 3C7HA 4A3ZA 2OVRB 5DN2A 4BK4A 2V5DA 2P1QB 3HOBA 5JXGA 2VMCA 5IJRA 1MPXA 4BJ0A 2VZVA 3CDZB 1W9WA 3VD7A 3I2FA 4QDRA 2VQUA 5HPOA 1CX1A 1SG3A 4E8DA 2WAOA 1UY3A 2QQJA 3CIHA 4MGSA 1UYXA 2RV9A 4QX2A 5G04L 4JHZA 2DCKA 3HPNA 1OD3A 2J1TA 1JZ7A 3VDAA 4DXRA 4QB6A 5CYYA 2VTFA 3T0BA 1JU3A 3NJXA 5A1AA 4XZUG 3I3EA 2VMDA 4D0QA 3C6PB 1F4HA 2ORZA 3LEGA 4FI9A 2WBKA 1I5PA 2QQOA 2RJ2A 3UESA 2VZPA 3K4AA 2QQMA 3P1IA 5I0DA 1HN1A 5B4XA 2BGOA 4MGQA 2VMEA 4UAPA 3W5NA 1GUIA 2WN3A 2VZ3A 1J83A 4BK5A 2Y64A 5IHRA 1JU4A 1UMIA 5LA1A 1JI6A 2W1UA 3P6BA 2XHNA 1JZ4A 3GDBA 2J7MA 4P08A 1UZ0A 2J22A 3ACGA 1GOFA 4TXWA 1JZ8A 2KD7A 2Y6JA 3I2IA 2EIDA 5DMYA 2CDPA 2V4VA 2C4XA 4CUAA 4CU6A 2QBXA 3WNMA 1JZ3A 3FN9A 2BERA 3D3AA 2L9LA 1IQDC 5G05L 3WNKA 2WO2A 2W1WA 2ZEZA 3LPFA 3ECQA 1UXZA 3HNBM 3WF4A 1WKYA 3A21A 4M4RA 3PUIA 1O59A 4DUWA 3VD9A 2W1SA 3MUZ1 4DEVA 2VOTA 4DXSA 3VDBA 3CMGA 3OBAA 3F2ZA 1ULOA 3T2QA 3C7FA 1TVGA 2C9KA 1NX9A 3ETPA 3T09A 4RN5A 2ZEWA 4LKSA 2W46A 3NNGA 3OGLB 1UMHA 1OH4A 4GZ9A 4QDSA 1PMJX 1US2A 5DQ0A 4DUXA 4CVUA 2BZDA 3MUY1 1NAEA 3K46A 2Y8KA 2ZEYA 4QAWA 1R64A 3MV01 1JZ2A 2B9VA 4JX0A 3K4ZA 4DUVA 4M4PA 4CU9A 1UX7A 4D8MA 4LQRA 5IFPA 2C26A 1JZ5A 3SEPA 4ZZ5A 1K42A 2ORXA 2EIBA 2WO3A 4CU8A 2XOMA 4P02B 2VM9A 3GXUA 2W3JA 4XUTA 5J1XA 2WO1A 2J1VA 2J1AA 3EYPA 4YPJA 2VZOA 4MOAA 4OZOA 3UNPA 3C7GA 1L7QA 1NUKA 3FL7A 3JXSA 3GM8A 4TTGA 5C7GA 4E8CA 3WF3A 1DP0A 3C7EA 2W94A 3CQOA 4QX3A 4W4ZA 2VMFA 2X05A 3OGVA 3WF0A 5JXHA 5IYYA 3GGLA 3LEKA 2V72A 2WUHA 1LDKE 3VD4A 1NEXB 4KWUA 1CZTA 2DDUA 4BDVB 2P1PB 2YC2A 3NRUA 2XONA 1UWWA 1FS1A 3I2JA 3OEBA 1D7PM 1JYNA 1CZSA 2YG0A 4ARYA 3I97A 3C8XA 3NQHA 3WNLA 3I2GA 1UXXX 3EB7A 5IBKB 1P8JA 3WQBA 1J84A 4A44A 2XQXA 2VZUA 4ZXEA 3CZJA 2QQKA 2QQNA 3THDA 5LA2A 5EJ1B 3BGAA 4PF1A 1JYWA 4JKMA 4QDQA 3WEZA 5JXJA 1SDDB 2VL4A 5LCWL 5B4NA 2WAAA 1P22A 4AAXA 1US3A 4ET7A 4XUNA 3T08A 4I6JB 3AC0A 1DYOA 1PX4A 2W87A 1UYYA 1TG7A 3T2OA 4A45A 2VR4A 1BHGA 3HJRA 2X09A 3UETA 4A4AA 1GMMA 2W92A 1YQ2A 3OGMB 3FHAA 1UY2A 1RYYA 2CDOA
chains in the Genus database with same CATH superfamily
4HK8A 1W28A 2YROA 2JKBA 5IVYA 4UI9L 1F15A 1Q5OA 2ZZJA 3B01A 4FPLA 1RVF1 2BW8A 2CSGA 4NHMA 3U14A 1EUUA 2EAAA 2VU9A 3PUAA 3T0AA 3RMAA 2VZRA 1CWPA 3THCA 3ZFGA 3GBGA 1PIV2 1JOBA 2WKKA 2BUKA 3M3CA 2VCCA 5FYYA 3RGBA 2CHHA 3THTA 2WFF3 3PVBB 1I9RA 1H1MA 2Y6HA 4CEWC 2JDAA 4ZHNA 2D5FA 5K8SA 3IB3A 4GA9A 1W9SA 5ACA2 1QHDA 2EXHA 1W6OA 2CAUA 2Q8DA 4J1XA 4MADA 1DGRN 4CUGA 4GWJA 4NROA 4RHV3 1VMFA 4AVSA 1GNYA 3WY6A 2VO5A 4CRQA 2BOIA 2WLPA 4HSJA 4GKXA 4P9WA 1NYWA 4LBNA 5LATA 5LBFA 2CGPA 3N9MA 2UWAA 1AL22 3HQUA 3HP9A 4OFGA 4CXXA 5HXVA 4DTMA 1QJY3 3AKTA 1XC6A 2DTYA 2EICA 2ZGQA 4WVWA 5FLHA 3UO3A 3DYPA 4QB1A 2R042 4RS5C 2BNOA 3P3PA 3OB8A 4LMFA 4BISA 3WP6A 1FZ0E 1OXCA 1URXA 2YDEA 5CNAA 1RUG3 1K45A 1VB2A 2ES3A 2FYOA 4NE9A 1W8HA 1YFWA 3J27A 2HWF1 2WABA 4IXLA 3VBFB 4EN0A 2JE8A 5FXVA 1WLCA 1TMF2 2WS91 3I3BA 3NL1A 4XFIA 1R1A2 4M3UA 1QXPA 2DFBA 2XL9A 1RUI1 1N3QA 1XNTA 1UY4A 1AR93 1COV3 4P14A 2DU1A 1LAJA 4YVSC 5JOZA 3WNOA 2CL2A 4LA2A 1YQ8A 2K46A 4ONUA 3SXWA 3TB0A 3AZXA 5C33A 3PTRB 5FP7A 5FO7B 4SLIA 4GAZA 1ND3A 5JPNB 4COUA 4DNYA 1RGSA 4LK6A 4XUOA 4HVRA 1GV9A 1F35A 1QU0A 4TYSA 2JKXA 4AYUA 4ES9A 5C9AB 5J98B 1YQ5A 3AZYA 1TNFA 3U1XA 3WP4A 3PIGA 1VAMA 3NE6A 2DBIA 2R32A 2WZEA 3O12A 1K12A 1W9FA 3E4YA 4ZONA 4JS4A 4FTBA 3K75B 1MZ5A 1GNHA 4XAAA 1PNFA 2BEOA 3T2PA 3HEIA 3W9AA 1GZ9A 1O8SA 3RMDA 1JXNA 1JOPA 3QCWA 5JZGC 1SLAA 3IM0A 4Y1YA 4E4DX 3VBRC 4MGIE 3OBRA 3M4FA 5LK7B 2GC3A 1H9WA 3QH6A 2FBEA 2JJ6A 1W2UA 2OUJA 1VBD1 4NIAA 1REFA 5DPNA 5JLVA 3LDSA 2RS53 4DXTA 1UZWA 4OHZA 2JB4A 3P3NA 4QGLA 3WNNA 1J59A 2P37A 2QZ2A 3U37A 3LE0A 5IAXA 3KZ4C 1OT5A 3VD3A 1KFXL 5FY9A 4AFAA 4ICGC 4QX8A 3ZYGA 1GANA 2HWC1 1B35A 1S2KA 2XDVA 3NV2A 3ZOIA 4CP2A 3CHXA 1RUF2 5A6XA 2VOXA 3RDIA 3NCIA 5DAPA 1HQLA 3POBA 1OI6A 1OUXA 4WVMB 1ND2C 2P6CA 4M0HA 2X10A 5HV0A 3WDYA 2VXJA 1PHMA 2RM23 3BIEA 1DDLA 1H6YA 4JRAA 4Q27A 4MGTA 5A70A 4CCKA 3ACFA 3OY8A 3QBQA 4NR1A 3ZXGA 1RUNA 3ZR6A 4AG4A 3AKQA 1QJX1 2ZXQA 2CV6A 4BQ1A 3IPVB 2BTVC 1UYZA 4HCBA 5AFEA 1UZVA 3HQXA 3NV4A 3H1MA 2ZGKA 2VD7A 4CDXA 2X5IC 3UJOA 5FZIA 4Y22A 4LEJA 1XB9A 1BEV2 1O3QA 4QWNA 1HJFA 3ZO0B 4OMCA 5J3UA 2JDZA 3OJBA 3AYDA 2P2KA 1EUTA 3ETQA 4PQ9A 3RMXA 1VALA 2BBAA 1NLRA 1GFF2 1XVDE 2EXIA 4JGZA 1C8M1 3U0ZA 2JHPA 1EAH1 2XWBB 1YEWA 2JD9A 5A7WA 4BLJA 2Q30A 3VBSC 5A1LA 1UNBA 2HLEA 2PMWB 3HIFA 3KGZA 3P5BA 5JR2A 3AM2A 3RZHA 2FMYA 1FV2A 3S5QA 3H50A 1AYM3 4FOVA 1XU2A 2MZWB 1YLLA 3ACIA 4Y4RA 1ZRFA 2JG9A 3PL0A 1W06A 4XXPA 4JTOA 4X8NA 4CEWB 1ZNPA 4DZGA 2D3RA 1PO21 1T6GC 1LNSA 4INDA 3ZFGC 2OQ6A 3ALQA 4Q0PA 1FNZA 4FPHA 2O8OA 1PMHX 5DAQA 5L9RA 4DRVA 1X8EA 2RJKA 5A7OA 3TEXA 2B42B 4ZS2A 3MIFA 4CXYA 4AKIA 3LZJA 3BOPA 3IDEA 3RYKA 4CUBA 3FWEA 1V6IA 3D5OA 4F3JA 3ZYPA 1DGLA 1CR7A 5GZFA 3M3QA 2Z4FA 4Y5Z0 2BOJA 3PVEA 2PAKA 4FTSA 1W8ZA 2AREA 4OYUA 2OS2A 3C7HA 1POV1 1XU1A 2I2SA 3ZSJA 2VQAA 2OVRB 2XLGA 3C95A 3A4UA 3BOWA 2DVDA 3S7EA 4BK4A 2V5DA 5D8AA 3AP5A 4O9EA 5JIUA 1NXD1 2VMCA 2YU1A 5F32A 3S6PA 1CONA 3AZWA 4LUKA 5KHJA 4XC9A 5LBBA 4AI2A 3JD73 5APAA 1W2NA 4IQPA 1YQ6A 3I8TA 4YRDA 2GNBA 4PIYA 4QDRA 4BB3A 2GH8A 4DINB 1W0PA 3ZYRA 3BALA 5FJKA 1JHNA 2UYAA 1SG3A 4Y24A 3BI3A 3QEXA 1KD7A 3SCXA 1ONAA 3TAGA 4E8DA 4R4ZA 2W08A 3QEVA 2F17A 2GN7A 2YUEA 3WVJA 3VHRA 4LE4A 4LHKA 4XACA 4QX2A 5KBFA 1HRV3 1NCQA 2EVXA 3E6DA 5G04L 5C6CA 2DCKA 2OZ6A 1IPKA 3WHTA 2BQPA 1OD3A 4YGBA 2ADEA 2W39A 1JW2A 1ND3C 1WBFA 2VTFA 1AL23 4LXLA 2DYCA 3T0BA 4BQWA 1FV3A 4XZUG 3AYCA 3SCGA 4DIQA 1NQDA 3I3EA 4URTA 1KRIA 1HB2A 2FDKA 3C6PB 4QQLA 3U75A 2WBKA 3ZDVA 5KHGA 3LEMA 2RJ2A 4LKEA 4UT5A 3VKMA 1XRUA 5KWRA 1HN1A 5B4XA 5DG2A 4QPGA 1QMJA 4MSVA 3WUCA 2ZGOA 4UF0A 5JZGB 1TMF3 4RSUA 3S9HA 1SBFA 4YW1A 3U78A 3VBRB 1W3XA 1DU3D 4DMIA 1OURA 3ZYBA 5CFCA 1CAUA 2VZ3A 1AL0G 2LF6A 1JBCA 3C94A 1EYBA 4CDUA 5EP9A 3R4SA 4P9XA 4UW4A 4IE4A 5IHRA 1NCRC 3HL8A 1UMIA 1IG9A 4WVZA 3HMYA 4H14A 5ABJB 2FDFA 3P6BA 1CAWB 1SPPB 5FKBA 1Y4WA 2R071 1DYPA 2XHNA 5K0UA 5FY8A 5C4WB 1JZ4A 3PNAA 2O8QA 4RG8A 3GDBA 1PMIA 2JQTA 4CP0A 3AMPA 4P08A 3KVBA 1UZ0A 3NMBA 1G86A 1S0GA 3ZYFA 3ACGA 4FJMA 1NG0A 3DKWA 1HKDA 1RXFA 2P1BA 2ZKNA 1IS4A 3LDKA 3MF6A 2R1BA 1UPIA 1B35C 3I2IA 5CISA 3NNJA 2CDPA 1C1FA 2Q4SA 4CCEA 2HKXA 3DXTA 5DAXA 5FP8A 1RUE2 3FFQA 5LB6A 3I59B 5FQ0A 1LECA 2BERA 3X29B 4AI3A 2A6WA 3PUQA 3I2DA 1W90A 3Q8FA 3NKTA 4HVOA 1XNBA 1OA4A 2ZEZA 3S30A 4I2OA 4NIGA 4B4QA 5DZGA 2NN8A 3HNBM 4EWDA 4CTEA 3SQ1A 1WKYA 1LOBA 2XMLA 4IEZA 1H2NA 4YM3A 4HZFA 4QGMA 4RR3A 1RUH2 4NMIA 5IVJA 2BNMA 4CDXC 1O59A 4L92A 2W1SA 1U5XA 3VD9A 3LB9A 1SCSA 3MUZ1 4K8FA 4A7YA 2VOTA 4JHTA 2BV4A 4MHUA 3ACLA 3VDBA 1ZZ7A 5FTTC 3ZN6B 4CDQA 3VBSB 2ZGUA 1QJFA 3T2QA 1RUF3 4YFWA 3N3HA 1DHKB 1F5FA 1TVGA 2VW2A 3T09A 4UFLA 5IVBA 4C1WA 4AOCA 1FZ6E 2ZEWA 4JGZC 2W46A 1LHUA 4JCKA 1RJ7A 1UIKA 4ZXKA 3N9PA 3EJKA 3VBUA 4QDSA 4E3SA 1QEXA 3JQXA 2HEWF 2ATQA 2XBO3 1OPOA 3OBZA 4D6SA 1Q8SA 2RDQA 1RXGA 3J2PA 3KMHA 3BTYA 5GKAC 2DY4A 3SUOA 1R092 1LU2A 2RS12 4GB33 1PVC1 2ARXA 2JG9C 3USSA 4OLLA 5HCBA 3TL8B 4F8AA 2UU8A 3Q9OA 4D8MA 1PZ7A 1BEV3 2C26A 2IXCA 5DUXA 3J4UH 4F83A 1G6NA 4M41A 1XYNA 1W6OB 1ZBE2 1JTZX 4XFFA 5LRRA 3AMQA 2NPIA 4UFJA 1WGPA 1OPMA 4P02B 3ZVXA 3TAEA 3NVCA 3ZYIB 4BQ2A 4FFIA 2D3PA 2J1VA 3MLJA 1LENA 3UGGA 1R081 1IPJA 3ES1A 2W52A 1WW4A 2NM1A 4IEYA 3ASIA 3PTYA 4YYOA 2CGOA 1ASJ2 1HRI1 2JHAA 1DZTA 2WNVA 3SLIA 4Z92B 1LEDA 4COWA 4AI6A 4CSWA 3N7LA 4TTGA 2BWAA 3ZXEA 3WF3A 4D6QA 5F9TA 1N3PA 5BNOA 3C7EA 5D8AC 4QX3A 5F5AA 2ETEA 2VMFA 1TME2 4FJNA 3OUHA 4EWEA 2YBPA 3BB6A 4KGQA 4COZA 1OD5A 2ZHMA 4KI6A 4NUBA 1FT9A 2JDHA 3OGVA 1GP4A 5CB7A 4AEJA 4L8QA 3DEMA 5JXHA 3WCSA 1K5MB 1FOD1 4YM0A 3VHOA 5A7NA 3WUDA 3HAGA 4X6QB 1LDKE 4BCUA 3ZXKA 3HGKE 4IEQA 3OD4A 4ASMB 5CADA 3QESA 1VRH1 1CZTA 3WDVA 2DDUA 3JZVA 4AWDA 5J09A 4LULA 1ND3B 5FP9A 1NCQC 1J3PA 1QJU2 2OVUA 2DFCA 3BU7A 3EQEA 1IG3A 1FYZE 2PHXA 4J25A 5FUNA 1D7PM 5F39A 1LJ7A 2ZOEB 1K5JA 3DPRB 1XVCE 4NO4A 4TZDA 2VH9A 1XMHE 4GD4A 2UYBA 5BNPA 5H9RA 1MS5A 2XHKA 4DTUA 3RMCA 4AI0A 1G9FA 1BVP1 1PO11 3QH7A 1XBFA 4TN7A 5FZ8A 3SITA 5IVVA 2SBAA 2JX9A 4LBLA 3CJXA 1A34A 1ENXA 4QPGC 3TABA 2WFF2 1XJAA 1QKQA 4Z1VA 3CZJA 1L3JA 2QQKA 4HKOA 1WCKA 2WLQA 5LA2A 5CFCC 1WCUA 1ZZ9A 4PF1A 4H55A 4S2GA 2H6CA 2IZWA 2WNUA 4QDQA 1TE1B 2PLV1 1SDDB 4Q4W1 1HW5A 4KG8A 2HBTA 2HWB2 3T4HB 1BMV1 1Q3EA 2WS93 5IVCA 5FP3A 3UKVA 2VXRA 3LA3A 5FYZA 1US3A 1RUI3 4UW3A 4QXHA 3TEZA 2D97A 4Q1PA 3TRSB 4CDWA 3QEPA 1QJY2 1Y3TA 2Z42A 1PX4A 4A45A 2PELA 5F3IA 1DFQA 4AQSA 1B35B 1CJDA 1EY2A 5A3WA 2ZAAA 1BHGA 4R8HA 1LEMA 2ZMLA 1RUG2 3AVSA 2UY9A 4O9GA 4XCBA 4A4AA 2OZJA 1YFYA 3FBYA 4KL1A 3VLBB 1H8VA 4EPHA 1ZYBA 3AMNA 2YPJA 3FHAA 1FZ3E 1YNAA 4AI8A 2TBVA 3WQ7A 4IL7A 3OY8B 4NHYA 5L36A 1QJZA 5BPXA 2WZ8A 1X82A 4XEZA 1O8PA 1AR92 2K0GA 1COV2 3LAGA 1T2XA 2IXJA 3L2OB 3MKSB 3VN4A 3PLQA 3AYAA 3PDQA 4CXWA 2HYXA 3I4IA 2DVAA 2FDIA 3E1F1 4Y22B 5F6KA 2VJXA 2XVGA 1AUYA 4EROA 4RR3C 1UOGA 2VTXJ 1L7RA 4AQ6A 5FPVA 4FO9A 5I93A 5IK8A 4N43A 3FHIB 1XNKA 1VBD3 3WDUA 4JGZB 4KHNA 4DU3A 5A33A 3GBFA 1H1IA 1HXS2 5A7WB 3VZOA 3WW1A 4BOWA 3SPYA 4R9AA 2OW4A 1LGCA 4A41A 3B9IA 2JDNA 1FPOA 3OG2A 1FZIE 1FAYA 2EIEA 1RUE3 1XMFE 4UYBA 4AZZA 3WSOA 4L0PA 4JS5A 3TNQA 4URAA 2MPFA 4Q4Y1 4RNGA 4JVAA 1LHNA 3VBUC 3T0DA 4W6XA 5HXMA 1O3SA 3SQ0A 1V70A 4N9IA 2HWC3 4XDPA 5FUPA 2JG9B 4CPBA 3GHNA 4LHNA 3VHPA 1V6KA 5I0SA 2XJRA 3O1PA 2P5OA 2XJUA 2MNGA 3AVRA 3AXDA 3J26N 4ITCA 4FAHA 5HCAA 2VGDA 4LBMA 3RZMA 2A3XA 2YB7A 4KQ7A 2RS52 1PZ9A 4FJ8A 1JOJA 1W03A 5A80A 3J8F1 5M0TA 2OT7A 4AFMA 5JI9A 1XE0A 4KWLA 4YG0A 5L19A 4M3YA 4BQ3A 3VL8A 1V9U1 4GIQA 4RGGA 1QJX3 2BGPA 1OH3A 3K3OA 4WM7A 3SMHA 4UBGA 1RUJ1 1OVPA 2ZX0A 3TEWA 1LB2A 1J1LA 3RNSA 1RUC1 2FQPA 2XXZA 3E5UA 3M7AA 2AC1A 4LHSA 1QNYA 4BU2A 4DRRA 4XUQA 3SQ2A 1XPWA 1SZBA 4KWKA 1DQ5A 5FYBA 3UKNA 5J7MA 4KBZA 4AEDA 4GWIA 1A6CA 1H0BA 3SEEA 1WD4A 4CU7A 2B4KA 3QETA 1O5UA 2MHFA 2WNVC 2RM22 5FOBB 2E6VA 3R6SA 3QEWA 4LNVA 1HDKA 3VZJA 4XPVA 2GMEA 2WYSA 4KBBA 5FZEA 1DYKA 4A3XA 4ADNA 3ZFFA 1YC61 1SLIA 1QDOA 4QKFA 3FHQA 4IV3A 1AX2A 5BNOC 4G3YC 4XBLA 2C24A 1DZRA 1EV11 1RMU3 5C3RA 1RHI1 4FPYA 4H7MA 5EIYB 1FZHE 3KCYA 4HANA 1NLSA 3M1HA 2D43A 3ZDSA 1AR82 2J1EA 1UOFA 1CPNA 1WCQA 3LEIA 2HJIA 5A3NA 4OUMA 1HLCA 4Q0SA 1A8DA 3ZM8A 5JAXA 2AH2A 5FPAA 3H1YA 4JKLA 1NCQB 4R9CA 5HCFA 4DFSA 1CGPA 2LRPA 1AR61 4BHPA 1PO23 3H8UA 4HOOA 4MGYE 3TN91 3RYRA 1FXXA 4NVPA 2ADDA 1GQPA 1ASJ3 3DKQA 4R4XA 5E6HA 3NNMA 5DUVA 1N1YA 1PX3A 3MIHA 4QXCA 4FK2A 3RZGA 2LUWA 4XYXA 2VZSA 3KLSA 4MO3M 4LK7A 4GXLA 5F5IA 2ZPXA 1AYM2 2IXKA 2WNEA 2B39A 1UY1A 2ZGTA 4QU2A 3KQRA 5BNPC 4FP3A 4QPGB 4QHBA 4IUGA 1TME3 3R4UA 4L99A 4UF0B 3WNPA 3ZMNA 4D94A 5C3QA 3CU7A 3KSCA 1WAJA 1POV3 5JOYA 5CFCB 3M3EA 1Q56A 1CAUB 1GYKA 3I3DA 3ZLIA 4CP9B 5FYUA 1F4AA 1ZA4A 3NV1A 3Q8BA 4FFHA 4Q0VA 1ZA7A 4AR2A 4B3NA 4BQXA 4CDUB 5DZEA 3MPBA 5C71A 2FDGA 1KITA 4FJIA 2RHPA 5LRSA 2WNUC 3WINE 3WW4A 1O3TA 2FZ1A 1M06G 1BBT2 2YFZA 1KS4A 5K0UB 2RS31 4Q29A 1QOSA 5DDJ1 4XIOA 1X36A 3GZUC 2VTXA 4JGYA 5GZDA 3N1BA 4SBVA 2QFEA 5TSWA 2YPDA 2E32A 4CDWC 4K40A 1JHJA 4G4FA 4J6GA 5FZ9A 4BLIA 2ZX2A 3SHRA 4L9BA 5FPUA 1ACCA 1C8NA 3IAPA 5JVVA 1W8OA 3O5SA 4BA6A 5FZKA 3JD72 2QDNA 2OZMA 3V0BA 3HT2A 4OCTA 3IMMA 3EXUA 4Q4V1 5FBJA 5FQ0B 1R1ZA 1YFUA 4E2SA 5C5TA 2YFUA 1ZREA 2G9GA 4OHYA 5LY2A 1OFNA 2D6KA 1YHFA 3K51A 3W20A 4Q4X1 3W59A 2MEV1 2XL7A 2YBKA 4E4SA 3K4DA 2VJ5A 2DCJA 2E63A 5C3OA 5CEHA 3AXEA 3AKSA 5IUQA 1DLCA 3OPTA 2WDBA 1HRV2 1HB1A 4PHZA 4O61A 2HWB3 4BIOA 1AF9A 3NHGA 2EIGA 1ZVFA 1AR71 4XQDA 4YW4A 4XJAA 4WZFA 4AVBA 1V00A 2Q8EA 2HEYF 4AFDA 3LZIA 1LRHA 2IC1A 2EF6A 2OXBA 3CEWA 5C5UA 5C3PA 4XFBA 2RR12 2R0HA 5GLZA 4BIFA 4CDQB 1OVSA 3GJBA 2BDRA 5F7UA 1POQA 3RJRA 3GCWA 4FTEA 4N43C 4YW3A 4D6RA 1ULGA 3LQCA 3IDCB 3O1TA 3MV11 5FKCA 2A3YA 3DYOA 4NHKA 1QGLA 4M3CA 1YCIA 2P34A 4JTNA 4GMP3 4ZY9A 3VBUB 1NA1A 3N7KA 4DOUA 1WMDA 2PHFA 4QPWA 2PFTA 1W9TA 3ILNA 2QKDA 1KJLA 5LA9A 2OA2A 4W65A 1BXHA 3UGFA 1F9KA 5IVEA 3MI8A 2JWPA 3WG4A 2VNOA 2JEMA 2JDMA 2E7AA 1GZWA 4OULA 1OQDA 1H2KA 5IJRA 4AHZA 3MLKA 1Y43B 2D44A 4BPZA 4GWMA 1W9WA 2CWSA 3O1OA 1AYN2 5GZCA 4QQOA 2X53S 2XR4A 2VQUA 3SCFA 5HPOA 4HCCA 4QNCA 1YWKA 3CF6E 2LF3A 4Y20A 4J2BA 2WZR1 1PGW1 4WM7C 1UY3A 3UL2A 2QQJA 3CIHA 3HR9A 1HXS3 1SFPA 3FUOA 3MGUA 4LKFA 5C8CA 4KHYA 2WNVB 3DN7A 4JHZA 4YGCA 1RUD1 1WUVA 2J1TA 1S0IA 4AEDC 4FQZA 1H8TA 4XMAA 4FPCA 2WIIB 4QB6A 4XJZA 3KD1E 4C91A 5FZCA 5LK5A 4KHSA 4J2EA 5BNOB 1VBE2 4PI0A 1NCRA 5EHDA 4TSVA 3B00A 3BTAA 1ZZCA 5CA6A 5DAWA 3ZFFC 4FI9A 2D6LX 1QH7A 2LM3A 2E53A 1I5PA 2QQOA 2ZGRA 3UESA 1JODA 4IV3C 5K4LA 5FY0A 5I0DA 2HWE2 4MGQA 5JDBA 1FATA 4FT8A 4UAPA 4BYYA 3W5NA 4M3CE 1TNRA 5GM0A 1JUHA 4YZ3A 4OHWA 2DTWA 3VDDB 4YSFA 4YVWB 2WN3A 3ELNA 1VBA1 1OBNA 3OD0A 1KDMA 4E9KA 1Q9YA 4EQVA 4FPGA 1VMJA 2QXFA 1GNZA 5CBLA 1PVC3 1J83A 1W05A 2VBPA 3S57A 2UWCA 4OI0A 4K8RB 5A3OA 5CKNA 1UKGA 2PHTA 5H9PA 5IVFA 3AZVA 2VUDA 2X8KA 2GALA 5B2GB 4QM8A 1UPSA 2JXAA 1XVGE 3WT3A 1SBDA 1OOPA 4Z2WA 3AKRA 2G19A 2XBO2 1JYCA 4B4RA 5BNPB 2ZACA 4I30A 4XF4A 4F7ZA 5L7OC 3OYWA 1GZTA 1WA6X 4A2UA 1R083 5I8YA 4DU1A 1CIWA 3BUCA 1F8VA 4RGAA 4FJHA 1GZCA 4A6SA 4PBOA 4LLOA 5FZBA 4DO0A 4GB32 4YZ2A 5LZ6A 2Y6JA 4ZU5A 3IN9A 1Q8PA 1S4CA 4AHYA 4Y5TA 4MXWA 1MS4A 5T3NA 4J2DA 2FCTA 1AR83 2QBXA 1DQ1A 2YMZA 3QOPA 4CU6A 4HVQA 3D0SA 3DF0A 3FMGA 2XVLA 1UIJA 3N9QA 4AXOA 1XYOA 2WNUB 1LU1A 3N36A 5A1FA 1BVVA 5T55A 5FZ1A 4RQPB 3KV5A 1VPHA 3KB5A 1S0DA 1NY72 2VBBA 2GMPA 3OUJA 2DBNA 1FPN1 5I0RA 1FOD3 1S0BA 3IIAA 1MZ6A 4OHVA 1N1TA 3L1NA 4JGYC 3A21A 4Q0QA 5DG1A 5FMOS 4DUWA 5FYIA 3CFRA 4LBKA 3RMYA 3OPWA 3BU0A 4FK4A 3HQRA 2OUHA 1VRH3 2A5ZA 2Y38A 4HT1T 4R9DA 4DXSA 3BCWA 1VBC3 3RJ2X 4P9GA 3OTFA 1GSLA 3OBAA 1BJQA 4EE2A 3F2ZA 2G4IA 2XJQA 5A3MA 1UN1A 1E5HA 3SNNA 1DG6A 2C9KA 2Y0OA 4TLFA 2GNTA 2PYTA 3ETPA 1PGL2 4ZS3A 4NAOA 4LKSA 3O1RA 2Y34A 5FPZA 1YIFA 4NHLA 3NNGA 5FZOA 2CY6A 1CAXA 2H6BA 5KR7A 5AC91 3CBNA 4LE3A 1UMHA 4GWNA 2ZA9A 1T6BX 1PMJX 2OX0A 1IKPA 1AXKA 3GHMA 3ZXJA 2XKPA 2YZ4A 3GBWA 2BZDA 2QNKA 1W0OA 4M3RA 1RVF2 3A0KA 1PO13 5IATA 3K46A 2GP5A 2Y8KA 5J36A 4QAWA 4HBNA 4YLZA 5A3LA 3O0VA 4J2AA 1BBT3 1SMVA 3LDRA 1JZ2A 3BKZA 2W2IA 1ZBE1 2B9VA 1NT0A 1HX6A 3V65A 1W6QB 3SJJA 2JG8A 1D4M1 2YXSA 3RG0A 4CU9A 3BYWA 3NKGA 3LSEA 2DTUA 2YGLA 4JQRA 2C9AA 3DXUA 4RS5B 4BWOA 1I1EA 4N43B 5A7SA 3SEPA 4ZZ5A 3FLRA 3USUA 4W6WA 5L9VA 2EALA 2ORXA 4GULA 4H2AA 4Q4W3 1MMOG 2EIBA 5FZAA 4CU8A 5A33B 5FAXA 2XJVA 3GXUA 1V6LA 2JENA 5EYYA 4AFBA 3U10A 2WO1A 3SISA 4YPJA 1OMIA 4HMZA 4IGOA 4OZOA 3VBOA 3VGIA 3UNPA 5DUWA 4N9HA 3SCHA 1MTYG 3L2YA 5KXCA 3AP7A 1UQXA 1NA1C 3FL7A 2XWJB 1CN1A 3JXSA 3U07A 4YW2A 4LO6B 1KQRA 4LKDA 4YVSB 4ZPIA 3MYXA 4BXFA 2A6ZA 1V0AA 4FJJA 1ZRIA 4CPBD 4FJ7A 3AP6A 5F5QA 4HL0A 3ZXAC 4B4PA 5LEKA 4LO8A 4AGGA 2HWF2 2BVVA 3M8LA 2RMU1 4Q8LA 3FJSA 1VIWB 2DWRA 2WS92 2Q1ZB 3ZYHA 3JQWA 1H2LA 1YIPA 1LHWA 2WSUA 3WW3A 5A3PA 2BP6A 5K9YA 1F2NA 1RUI2 3WF0A 1OA3A 4YM2A 4U36A 2RR13 3WW2A 2QJVA 3ZFEA 1MZEA 3LEKA 4Y1XA 2BRTA 2IVIB 2WUHA 1RUOA 3LIHA 3VD4A 4AQTA 4S2HA 1JN2P 3AYEA 4AEDB 5FPXA 2YC2A 3SUQA 5A6QA 1E5SA 5C8CC 3FC0A 4XF9A 1MS3A 4FPJA 5FZMA 1JH5A 1APNA 2Q1FA 1PVXA 3BPSA 3OEBA 1H8TC 1JYNA 1MS8A 3ZFFB 4ARYA 3EMRA 4A7KA 1WLTA 3NQHA 5IZ7A 1W2TA 4RL5A 2ZGLA 3PU3A 3WNLA 4X5NA 3URFA 4CYDA 2HH9A 2YV8A 4Y1UA 1UXXX 1VMHA 3PVOA 3TEYA 4CZSA 4IT5A 1W8UA 5FP4A 1FMD1 4NIDA 1RITA 3AX4A 4HLTA 4LBJA 4OVEA 4RHV1 4ZXEA 1AYN3 3H1WA 3NGIA 2QQNA 1H2MA 3ILFA 4JV4A 3THDA 3WP5A 1AJOA 2WC2A 2NMNA 1JYWA 2DVBA 1H4HA 1VBD2 3NWKA 4JKMA 3GCXA 4OZXA 5F3GA 5FY5A 5IAVA 4MLOA 1ND2B 5T50A 5FZDA 3TWIA 3B9CA 4QQPA 4QXBA 3WEZA 4BQYA 4Y1VA 3J8F3 4RFRB 4YW6A 3T30A 5H9SA 5LCWL 2XJSA 4XF1A 1CAVA 5FMOL 4C90A 5I91A 3MW3A 1V9U3 3V0AA 1IPSA 3LA2A 2GU9A 2NYYA 4HN1A 4ET7A 4BQ4A 1DIWA 1OOPC 1RUC3 3T08A 1VBE3 2DU0A 2HWC2 2W87A 5J48A 4AKHA 1ZZBA 3FLPA 3UIQA 3KS7A 2R16A 2VR4A 2X5IB 1L7LA 4I9LA 2A6YA 4K3UA 4NN0A 5AFBA 1XL3C 3LWCA 1RIRA 3UV9A 2VJ4A 2HWE3 5IK7A 3ORJA 3PJYA 4Q2FA 4AVCA 4MH0E 2W92A 4UFKA 3ROUA 3ATGA 1YQ2A 1SDWA 2QQPA 3L9JT 2CDOA 4JDOA 5A3TA 5LW9A 2QQUA 1QJX2 4XBNA 4CCCA 4CCNA 3IDBB 4FJLA 1OF4A 3S0MA 2Y0IA 4WM8A 3POIA 4QGNA 4IE5A 5E1RA 4DS0A 1RHI3 1VLNA 1W8NA 1Q8VA 2ENRA 3JCIA 1WA4A 4WBBA 3SUNA 4NPRA 4EZHA 1X50A 4MX3A 2Q8CA 3DECA 1D0HA 5CAZA 4IESA 2VZ1A 4KNCA 2ZGSA 2QUOA 4IEPA 3M70A 4ZKTB 3OGJA 2C6SA 4AGRA 3WNXA 3AMMA 4DEQA 4Y5SA 2LW8A 3KWVA 4AI9A 1AR63 2ZJCA 2ZX3A 1C8M2 2J1RA 1CVNA 1EAH2 1XNAA 3ZFGB 1BZWA 3LKJA 1DF0A 3SNMA 5HV4A 4K6BA 1RMU2 3VZMA 1VP6A 4XTPA 2I74A 2VY0A 3POSA 4L97A 3RS6A 5CG9A 2PHLA 2VUCA 5FY7A 2QQWA 4CUCA 3LPGA 5BXXA 4DTXA 2HWD1 1YYNA 4NPMA 4MGKE 5GZEA 2QQIA 3G6JB 3MICA 4D7YA 1ULPA 2E26A 2RDNA 1RL3A 5FYVA 2W68A 3KT7A 5L9BA 3DL3A 4A42A 3IDAA 2F4PA 4I3PA 2V4AA 4XUPA 5FOJB 1W3VA 1MEC1 2XPJA 2AACA 2ZZQA 5EJZB 1KEXA 1G9AA 4PF5A 5I8SA 4AKGA 2IFWA 1PO22 2KXLA 2JH8A 4FK0A 5I0TA 4XAEA 2PHUA 5E88A 5BUVA 3V64A 3A22A 2RDRA 4XQ4A 2JG8C 2JD4A 3RRDA 1DBNA 1W2AX 4A6OA 2VE1A 2NP0A 2P1MB 1I3HA 5EXOA 1HJGA 2N7GA 2B9UA 3WP3A 3A7QA 4M3CB 4PDWA 4JRLA 3WHUA 2BBVA 3LOBA 2RS33 3E97A 4OUSA 1NA1B 1JYXA 1CZVA 1S0FA 4D7TA 1C5HA 2W47A 3VBOC 1KDKA 2DCZA 3WG1A 1O91A 2P6HA 3LF7A 4LIVA 1DQ6A 3H3UA 1W8WA 4CE8A 3N9NA 5EV7A 1Q8OA 1VAKA 1G9BA 1X8MA 4IV1A 3ZSLA 1RVF3 4IEUA 1GZWB 4I0AA 5KXEA 3HN1A 1WCDJ 1QJEA 3U11A 4LITA 5JMOA 2A7AA 1GOHA 4PQQA 4A7ZA 3L0MA 1N47A 3I54A 2XGXA 4FXGB 1DGRA 4Q4V3 4QX0A 5FZHA 4EWAA 2GP3A 1OLRA 3ZIXA 3DCQA 1LGBA 2AGSA 2VULA 1DZQA 1QY4A 2XJTA 1ALYA 4FJXA 2OVQB 2A71A 2RDSA 4Y20B 3WF2A 1VJ2A 1IZ3A 2Q0AA 2I45A 1JUIA 2WINB 3CKHA 4XCAA 3W5MA 3ZFEC 3FUQA 4PLNA 4FPEA 3KT4A 4MGZE 5C8CB 3D4KA 1GQGA 1AR73 3MW2A 5FYMA 4B7EA 3ZPOA 1JYTA 3GYDA 5FJHA 5BNNA 2P3JA 2PHRA 1H8TB 1LHVA 2VIXA 2VCBA 4XJ8A 2GH2A 4KHQA 2VC9A 2ZEXA 3O1SA 1HB4A 3OEAA 4XMIA 3ZYJB 3RWUA 5IT6A 1VBB1 3JBG1 5A6YA 2Q5TA 4Q8KA 1W0NA 3IBMA 3KVAA 1NCRB 2DV9A 1XSQA 1UL9A 1YJLA 1FI2A 1ULEA 3LFIA 4M3WA 1JS9A 1SCRA 1H4GA 3Q8AA 2HWF3 3MO4A 5SV5A 5SV8A 3RWNA 4DY3A 5FV3A 3SKJE 2R061 1LOFA 3NDKA 3ZN5A 3OBTA 4KMQA 1Z7S1 5LA0A 4L2NA 5FDBA 3ME2A 4YWAA 5FZFA 1SQ4A 2AUYA 4RYDA 1ZBA1 2OVPB 1OA2A 3GALA 1W6NA 2P3KA 3HNMA 3WF1A 5KXDA 1Y9QA 1QQP1 5FYTA 1GWMA 3T1MA 3TNPB 2W91A 2B45X 4P9JA 3POFA 4WVVA 2W5FA 2O14A 2ZAHA 3UK9A 2R072 3VV1A 4YNIA 1QH6A 4AW7A 4BE3A 3HGLA 1J1TA 4DTPA 1OOPB 3CL1A 3HNYM 4PIZA 4W8JA 5IWFA 2DCYA 3D0JA 4XVHA 1XQNA 2K2SA 2WNOA 5CFDA 3RZZA 2BPA2 1K3IA 3RPQA 2RVAA 1PIV1 4B8EA 2WR9A 1ODMA 4OQ9A 3MBWA 3HN3A 4YG6A 2F4LA 1YUDA 2AEYA 2W1QA 1U5IA 3HBZA 5JUVA 3MLLA 1LHOA 1OFSA 5CKMA 1C3HA 1NZIA 1QXRA 2D3SA 3KV9A 3O0XA 4CDXB 5ACA1 3DUIA 4HONA 1S0CA 1CD3G 4P9IA 4TWTA 3VKNA 3AP9A 4AEKA 3C6OB 2PQQA 3TJYA 4JKKA 1JYIA 2R30A 4YZ1A 4R52A 5FY1A 1DQ0A 2OQ7A 3MDPA 5KXBA 3PMSA 4H3WA 1S1AA 4OMDA 5F2WA 3WLUA 1AL21 4MYEA 2YC4A 3NJZA 2VVDA 1X7NA 4UXAA 4WM8C 1A8MA 1YI9A 2ARBA 2Y60A 5FR3A 3UYJA 1W99A 1O7FA 4MHRA 4YARA 1H30A 1ZZ8A 2R041 4R9BA 2VCAA 1VBA3 4P5YA 2E33A 1QDCA 5HBAA 4M01A 3B5LB 2BU9A 4FFGA 3SKVA 3TAYA 3AJYA 2GNDA 3D6EA 5FWEA 2IXHA 1TMF1 2MMBA 2ERFA 3H8XA 1QIQA 2JIGA 1R1A1 4YFZA 4YGDA 3N7JA 5FZOB 2W95A 2FDJA 2VECA 4LHLA 1UW8A 4FOWA 1SACA 4FPKA 4YW5A 1XMGE 3OGGA 3OGSA 4ASKA 1AXZA 2OYQA 4IE0A 4A3ZA 4FJGA 5DN2A 4XBQA 1PVC2 3ZSEA 2P1QB 4NIHA 3NW4A 1QXJA 1MPXA 4BJ0A 1KFUL 2VZVA 3LSDA 5FBZA 5D21A 5JIAA 3CDZB 1FZ4E 5FMBA 1MS9A 3I2FA 3PMEA 3B94A 5FMCA 1OKOA 2IXIA 1NQJA 5D8AB 1KJRA 1H9PA 2ZABA 3PJQA 4KH9A 2AR6A 4K7JA 4AHWA 1R082 1HN0A 1C8M3 1FYUA 1PK6A 1EAH3 1LESA 1XU5E 4KG0A 4MGSA 5K7PA 4PDWC 1UYXA 1HRI2 3KCCA 3PUSA 4FJ5A 4B1LA 4CP1A 1S55A 3HPNA 3KGLA 5T5OA 2GAUA 2BGCA 1F31A 2XB6C 2ZMKA 5CYYA 1JU3A 2GZWA 5A1AA 2P17A 2KR2A 3TOJA 4IV1C 5IK4A 3HBKA 1Q8QA 3BPZA 4GH4A 5FZGA 1F5JA 4G9SB 4QKDA 1F4HA 2ORZA 3LEGA 2P3YA 5H37A 4RD7A 2UURA 4DTSA 1CLQA 2CAVA 1AX0A 2VZPA 4I0WB 4XDQA 5AC93 1FOD2 2BGOA 2GMMA 3FBMA 4ZU4A 3OPZA 2CYFA 2DVFA 1YXWA 4KWJA 4IEVA 1RUF1 2VW1A 5L7OA 3BVOA 1WLDA 1GUIA 2XLAA 4Q0UA 5FLJA 4AVTA 1CAWA 2AYHA 3UO2A 1VRH2 1O3RA 4LIUA 1CPMA 1V6OA 4KI4A 1ENSA 1VBC2 5C4WA 5A7PA 5A32A 2PHDA 4CDQC 1XVEE 5EPAA 4BK5A 2Y64A 1JU4A 2W0XA 2ZX1A 1ZM1A 4GAMC 4RA0A 3O7OA 1D4M3 5E8AA 2B46X 1I6XA 4UW5A 4E4BA 1JI6A 2W1UA 3WXPA 5I8TA 3B93A 5BNNC 1U12A 1Q9XA 3ZXLA 3JU9A 3VKLA 4D3WA 3WDWA 1Z0HA 5FPBA 2J7MA 2O1QA 1PO12 2AZ5A 2J22A 4RGKA 4N53A 1XVBE 1BEV1 1S0EA 3I59A 2VOKA 5JR7B 1JZ8A 1ZRCA 1QNWA 2XG3A 3AL5A 4XHBA 1LOFC 4JRQA 2EIDA 3WQBA 5DMYA 1M4WA 1STMA 2WT2A 2DF7A 4LORA 3E6CC 3RZLA 5JPMB 2JIJA 4AFCA 1A78A 2G9FA 1H1AA 2H4TA 5LEJA 1TQ5A 2SLIA 4M42A 2PLV2 4D69A 4Q4W2 4H7LA 4B7KA 5DXDA 1S0JA 2D40A 2RMU3 4Y3OA 5G05L 4K20A 3HD8B 1AX1A 1RB8G 1BMV2 3GF6A 1OQ1A 3ECQA 5FZ0A 5JSRA 1LOEA 4YW7A 3V0AB 3SPZA 3AK0A 4PJYA 2PN5A 4LTAA 3LIGA 1Y7BA 2C1FA 4M4RA 2V09A 1VAVA 3PU8A 1U5ZA 2XQRA 4XJWA 5CFDC 3I7DA 1FNYA 4DEVA 4KU8A 4NIIA 5ANQA 4AF9A 2WA3A 3AB0A 4FQ4A 3CMGA 5GLWA 2AEZA 5FZ7A 1ULOA 3C7FA 4RR3B 4C0BA 1SLBA 1B09A 1NX9A 3BIWE 3OCPA 3H8OA 4RN5A 2WJSA 1MR5A 4HETA 1U0AA 1QOOA 1ZRRA 5A6ZA 2WWSA 2KM2A 4QNDA 2HD0A 4GZ9A 4IGQA 2ET7A 2VNVA 1XNDA 1LCLA 1NE4A 2WQZC 2BVBA 4PLMA 4WM8B 4CVUA 4DUXA 1OUSA 1OSGA 2Z2SB 5JSPA 2UY8A 2ZEYA 3Q8CA 5AVAA 1FMD3 1N3OA 3CLPA 5D1IA 4UBHA 5FRAA 4AE2A 1SEFA 1O5LA 2R073 1FZ9E 2CGNA 4E2QA 1UCXA 2VOVA 3K4ZA 2F6BA 1UO9A 2OIIA 4JDMA 4XF3A 4DUVA 5IK5A 3EO6A 4UFMA 4EN7B 2E7QA 3CJIA 3SUPA 1WLWA 5IFPA 3MFAA 1LR5A 4BMEA 2A6XA 3IWZA 1XSRA 3ES4A 1JZ5A 1C4RA 4N7IA 3RZKA 1K42A 1W6PA 5GLUA 1WW6A 2WO3A 1BK0A 2XOMA 2D6PA 4NRPA 4PI2A 5F3CA 5J1XA 3C2UA 4QPIA 2NLRA 3KV6A 4AK3A 2VZOA 1SLCA 4MOAA 3ZKYA 3SI6A 5F8PA 2D6OX 3GNEA 2WWUA 1L7QA 3MIEA 3L2HA 4Q4Y2 3IKWA 1NUKA 1ZZ6A 3POWA 4XFHA 3ENRA 4AVVA 4P5HA 4DTNA 3GM8A 5FZLA 3AFGA 2EXKA 1K5MA 1VR3A 4OI4A 1DP0A 4QT6A 5FXZA 5KHHA 5CG8A 4RL7A 2C0ZA 3HVDA 2W94A 3CQOA 1V6MA 3J8F2 4BMBA 3RWKX 1EPZA 4I0BA 2LTNA 4DPNA 2CNAA 1V9U2 2X05A 4NOTA 3NO8A 2H0VA 3ZSMA 4XILA 2GC2A 3LGRA 4IEOA 4E4ZA 1RUJ2 2PA7A 4KHWA 4X8PA 3GGLA 4QQ2A 1RUC2 4PDWB 1POV0 2WT1A 2E9QA 4ADOA 1NEXB 1J58A 1MVEA 1PK6C 3ILRA 2P1PB 3CNAA 3DPRA 3E5XA 3NRUA 3JUUA 4K21A 2XONA 4NJ4A 4N7UA 1UWWA 3CQ8A 1LKNA 1EP0A 3CFOA 1HV1A 1UZZA 2YU2A 4Y1ZA 5DUUA 1RINA 4IV1B 3W21A 4BM8A 2RKHA 3WQ0A 5JCTA 3H3LA 3I2JA 2K5SA 3QERA 2TEPA 1PNGA 3AKPA 1FZ8E 3KT1A 5GALA 2QDRA 1CZSA 2XVKA 2Q8OA 3RMBA 4FVVA 5A3UA 2GN3A 3KHCA 3VL9A 5F37A 3CFPA 3C8XA 1EV12 2NZ9A 4JRPA 4AHXA 4GH4C 1RHI2 2BFUL 1YRZA 3I2GA 4K9SA 1XNCA 3M3IA 3VBHA 1UU6A 1ODNA 2VCMA 3RZJA 1P8JA 2HWD3 3T2TA 5FO9B 1J84A 4YZ4A 2XQXA 4WZCA 4I02A 3I3MA 1BYHA 2VZUA 3B02A 1XE7A 2YB5A 1NXMA 5FY4A 3I49A 2VQ0A 1G7YA 4L11A 4NWWA 2A6VA 1MEC3 4C8DA 4CCJA 1ENQA 4HFSA 1MHZG 5ABJC 4U2AA 1GP6A 3BGAA 1RUE1 4V2VA 1XE8A 1AR62 4FSJA 4NWVA 4QKBA 3TN92 2ZMNA 5BNNB 5C4WC 1HRI3 2VL4A 2OPKA 2QCSB 3AMHA 4GALA 2LROA 3KF5A 3DGTA 2WAAA 3LA7A 1P22A 1W8TA 4AAXA 4KHUA 2QE3A 3MIDA 1IG0A 1MACA 4CCDA 2YHJA 5FLIA 2DUQA 1CESA 4XUNA 4OI2A 1MVQA 2P5GA 1DYOA 1RUH1 2MW2A 1UYYA 1TG7A 1YFXA 3SQ4A 5FK7A 2WSVA 1REDA 3KD5E 3K3NA 5JWPA 1QF3A 1W04A 3E5QA 1IH7A 4N53C 3HJRA 5LBEA 2WO7A 2ZHLA 1ZX5A 3AFKA 5GLVA 3UETA 2VW0A 1E57A 4CDWB 2WYFA 1W6NB 4I01A 2EA7A 2IWGB 3OGMB 1HB3A 1CX4A 1UY2A 4S2FA 5F5CA 4GMP0 5EJ3A 4MXVA 4CCMA 3DYMA 3V7DB 2CU5A 3OGRA 4META 2Y6KA 3J7NA 4LO7A 1OF3A 2RS32 4M3ZA 2D6NA 1N1CA 5DDJ2 2GC0A 3I3QA 2G1MA 1IS5A 5BV6A 3N1EA 1ENRA 4N90A 5T5LA 2QQLA 4ARXA 1ST8A 5CFDB 2R6QA 4JDNA 1UY0A 4LBQA 1R091 1YJKA 4WV8A 5CZKA 3ZPYA 2RS11 2IFRA 1LODA 1RMU1 3M3OA 4QB2A 3F95A 3U4XA 2D98A 1XVFE 2VVEA 2BWCA 3I2HA 2FW3A 3U4SA 2I07B 3C3VA 2BYVE 1ULFA 4MZUA 4Q4V2 4DQAA 3KF3A 1VBB3 3JBG3 4AAPA 1QOTA 2FD8A 5FIXA 2DUPA 4Q4X2 1PGSA 2MEV2 4FPFA 4XHXA 4ASLA 1DQ4A 4LBOA 2FZ2A 3NNFA 1OKQA 5FK8A 5IW0A 2JECA 2PLV3 1ASJ1 1GICA 3UKTA 3K48A 4I3GA 2LS6A 2R063 3B7MA 3J7HA 3SQOA 4QKNA 5FYSA 1AR72 1Z7S3 2GSYA 2J42A 2XJPA 3B3QE 4AQ2A 4UFIA 2V5YA 4IEXA 1AXYA 1WMXA 1LTEA 2DURA 3IIIA 1ZBA3 3R0RA 2VG9A 2WQ8A 3QNNA 4Z2AA 1AVBA 3FZ3A 5DZFA 1QQP3 4ORFA 1TME1 2D7FA 2VZTA 4HPKA 3CJIC 4FPOB 4LO4B 5KHKA 3FX3A 4EYWA 4IERA 4P9YA 3SH5A 2P1NB 3PUHA 4EN6B 3ZSKA 4HK9A 3LZZA 5BNQA 4Q1RA 4XIKA 3SH3A 3VB9A 4NPLA 3FLTA 1GP5A 3LFMA 1WAFA 2B8IA 3APBA 4QPIC 1MQTA 3POGA 4KI5M 1MZFA 2ZX4A 3H9AA 5T5JA 1GWKA 5JI7A 3VD5A 2FHRA 4ES8A 3VZKA 1PIV3 1V6JA 2Y6GA 5CU1A 2B5HA 4P00B 4WM7B 5FPLA 1EPWA 3BVCA 4LPLA 4BH9A 2PQSA 1QJU1 2Y33A 3OF1A 1W2OA 2J1UA 3MEPA 1I5ZA 5ANNA 1W6MA 1KXGA 5FWJA 1RTVA 5KC6A 2IXLA 4S2DA 5ACA3 2FCUA 1K5MC 1NOVA 1SLTA 4FFFA 1KGYA 1S2EA 2R7EB 4RFT0 1SHWB 1IS6A 3T1LA 3INAA 4ZU7A 4O65A 2P3IA 3CZUA 3NSTA 4Y33A 2WZR2 3IMNA 1PGW2 4M0NA 4PT6A 1PK6B 3OGKB 2O0OA 2OZSA 2ZGPA 4IV3B 4K1ZA 2WFF1 4HN0A 3NAPA 1NE6A 2OKXA 1LOCA 1YO8A 2Q1MA 1NKGA 5C8WA 5IFTA 2R043 1RUD2 3H42B 2WRAA 3MZHA 1XU3E 3DPRC 4HKWA 4Z8BA 4Q4Y3 1GBGA 4LOTA 4Y26A 4XFGA 3WDTA 3I2KA 4JC1A 2A73B 1AJKA 3ON7A 2HWB1 2B7YA 3ITQA 4IEWA 3K2OA 2QQVA 4GH4B 4AL9A 1H6XA 1IHMA 4EJRA 4W50A 5A7QA 3TAFA 1O4YA 1R1A3 4FAGA 3MFCA 2P1OB 3RVHA 1SFNA 1U5YA 4CP9A 1GLHA 4QX1A 4COVA 1LOAA 3TYJA 1QJY1 1C1LA 4AEMA 4ZZ8A 3CO2A 2V73A 2JDPA 3AP4A 3BN6A 5CKQA 5EWSA 3ZR5A 2J1SA 3NJYA 1G9CA 3AZZA 3VBHC 4HXCA 1LOGA 5L7OB 4MUVA 4UWDA 1VBA2 4B08A 4YM1A 4CEYA 1JYVA 1RUG1 2ARCA 3Q8EA 1NLQA 1RUJ3 1CIYA 4GMP1 4DY5A 5A32B 1UKRA 4BXSV 4X5MA 3AJZA 1PZ8A 2VZQA 1W39A 1JW6A 1WMFA 2ID4A 3ABZA 4C1XA 5C70A 1AR91 5HCHA 1COV1 2GC1A 3IAQA 1GU3A 1WCSA 3VUOA 2W9XA 3MIBA 3KD4A 3VDCA 3NJVA 5FO8B 5GJ6A 1E5RA 2VQTA 5AVPA 3O1MA 2ILMA 3FE5A 3O1VA 3N35A 2Z79A 1AHSA 4DU4A 3ZXFA 4XTMA 1O6UA 1BCXA 2WZPP 3R4DB 4N53B 2X29A 5I0UA 1LULA 2XUEA 2FDHA 2JPNA 1GOGA 2E31A 1EV13 4FOYA 3T3YA 2K9ZA 2AENA 4XQWA 3C7OA 3N9OA 4JGYB 3PVNA 1CQ9A 2TUNA 1HQWA 1SLLA 4MV2A 2R0FA 4EP9A 5JXIA 4UOJA 1HXS1 2VMGA 3EBRA 3A23A 2IUWA 4QQHA 2ZTNA 3KM5A 1G9DA 4PBPA 2R49A 4XURA 1UX6A 1CJPA 3TN93 1OC1A 5HI0A 4C0HA 3V0BB 5CVRA 1FPN2 2YYOA 1W9YA 2D93A 4HKLA 1XYPA 2VNRA 1C5IA 1RC6A 2B8MA 1WD3A 4OUEA 4QPYA 4HG6B 2D5HA 2DEBA 5FUIA 2Y6LA 2RS51 3VBFA 4XW3A 2D6MA 2VVFA 3C6NB 3WCRA 1JZ6A 2C5DA 3RI8A 3K77A 1D0GA 1J3QA 4XABA 4FVMA 3E6BA 4PLOA 1IGOA 3ZMOA 2A75A 4NRQA 3RQ0A 5AC92 4QU1A 3ST7A 2TNFA 1BK1A 3KV4A 3ACHA 4LO5B 3VZNA 2WN2A 2KA3A 2PXJA 4I09A 2CTVA 2HBUA 3O0WA 2Y6FA 3OUIA 1UOBA 4PCRA 1N1SA 2YBSA 3ZXDA 2FCVA 3S7IA 2GNMA 1UF2C 2RM21 4K1YA 1UMZA 3EHKA 5E89A 5DDJ3 5BY5A 3HOBA 4CCLA 5JXGA 1FZ1E 1D4M2 5FZ6A 4QHOA 5FFOC 1MS1A 1UOJA 3MHZA 5C9AA 3CJIB 2JDKA 3POJA 1FZ5E 4XZPA 2R1DA 4XJUA 3VD7A 1HIXA 2Y26A 4X6RB 3ZX7A 5LBCA 3NAEA 1GQHA 1FZ2E 1W6PB 2LALA 1CX1A 4E27A 4KU7A 2ZBJA 2E51A 5FREA 4B29A 4QPIB 1GR3A 3J7LA 1AR81 4FBFA 3NNLA 2WAOA 1WMEA 1TEIA 2VBDA 4EZ4A 1FX5A 2WT0A 3MIGA 4M45A 2RV9A 3LCPA 5F1RA 2VUAA 1MQTC 5FMDA 4Q4X3 2PTMA 1JZ7A 2MEV3 4OQ8A 1BQPA 2JE7A 2OYZA 3VDAA 4DXRA 2ZHNA 5EZWA 1AZDA 4TLGA 3NJXA 2RMU2 1UU4A 1MHYG 2VMDA 3VDDA 5C3SA 3SVIA 4YVWA 4D0QA 4GJYA 4Q5OA 3BTXA 4EV0A 3D8CA 4D7SA 4DXZA 1AYM1 5T54A 2FMDA 2QQMA 3K4AA 3P1IA 1VBC1 5CIRA 3IT8A 3HT1A 5F3EA 2VMEA 2A3WA 3QLQA 4XF0A 4FJ9A 1UD1A 3WG2A 1IS3A 4XE9A 1C28A 2OPWA 1TZOA 4LUMA 2WA4A 1XXNA 2VPVA 4WVMA 4XJ9A 2ZGMA 4XDOA 1YI7A 1O4ZA 1UU5A 3KHBA 3BODA 3NAPC 2EXJA 3LDBA 3L8BA 2XUMA 1G8WA 4XFCA 2RE9A 3LOIA 4JAAA 1OLMA 4KGGA 5LA1A 1QWRA 1VE0A 1X9PA 4Z82A 4P9LA 2JHCA 1S2BA 3IPVA 1BBT1 2VOWA 2QZ3A 4W6YA 4LJHA 4IETA 3J7MA 3O14A 4LT5A 4E2GA 3VBHB 1GOFA 4OHXA 4TXWA 3PHMA 1FMD2 4QM9A 4COYA 3H7JA 2KD7A 3B69A 4AI1A 5LY1A 1UZYA 4RHV2 1D2QA 1MS0A 4CDUC 3BTZA 4RQPA 5JSOA 2V4VA 2C4XA 3RSJA 4CUAA 3OYWB 2WZR3 3W58A 3WNMA 4CEYC 3GZEA 3JD71 3FN9A 1JZ3A 3D3AA 1IOAA 3HWJA 2ZHKA 2L9LA 2YY1A 5K0UC 1IQDC 3H8RA 4ISRA 4BQ5A 5EYXA 3V56A 4Y4YA 3UT0A 5EFUA 3WDXA 3WNKA 5J96B 4E4HA 2WO2A 2ARAA 2W1WA 1RUD3 1WWYA 2WQ4A 3LPFA 4MXWB 1UXZA 2BJSA 5GZGA 1VRBA 1WW7A 4NRMA 5E16A 3VKFC 3WF4A 1REEA 2HYKA 4UFHA 5J37A 1JMUB 3WR0A 1FZ7E 2XLFA 3KCXA 3WD5A 1HRV1 2WWJA 3RI9A 3ZIWA 4MG2A 5DAVA 4CEWA 1E5IA 3PUIA 4M3XA 4FP2A 2VUJA 4UW6A 3THPA 3KQ4B 3M2MA 2YGMA 3POEA 1X33A 4XOGA 2PFWA 4I9QA 4YZ5A 2RR11 3H7YA 4FJKA 3WOGA 3N7MA 3T4VA 3JB8A 4QX5A 3S5AA 4NAMA 2JDUA 1DQ2A 1OLME 2XKOA 2ZKLA 4CCOA 3OGLB 1OH4A 1NZCA 1US2A 2QVSB 1W6QA 5DQ0A 5T5PA 3RYPA 3VKOA 2YC0A 1RJ8A 1GWLA 3MUY1 3SC7X 3QACA 1NAEA 4RS5A 1R64A 2VAUA 3MV01 1CAXB 4XXAA 4LBQB 3OOXA 1SFYA 3WZ1A 4JX0A 4LBQD 4ATFA 4DB5A 2VNGA 3J9SA 5JOXA 4M4PA 1ZRDA 1DGWX 1UX7A 4FOQA 4LQRA 3GZAA 1LGNA 2PAMA 3FFZA 1D2SA 1O4TA 2XH6A 3MPPG 3VBFC 3E4WA 2ZS6B 4O7XA 1AYN1 3QNOA 2VM9A 1KS5A 1VB4A 2W3JA 4XUTA 4YVSA 5GLTA 2JG8B 3VZLA 2J1AA 1OQEA 3VHNA 3EYPA 2HWD2 2RG4A 3NV3A 5D2AA 2HEVF 2VMIA 3AL6A 3C7GA 5F6LB 2QTWB 3WG3A 4Z07A 3USUB 1A3KA 4IE6A 4V1PA 4V2WA 5JMCA 1DGWA 4B1MA 2B7MA 1RUH3 1MEC2 3N9LA 3WX5A 5FCCA 2ATFA 1WW5A 2WFPA 3IZOA 4PIXA 1OHFA 4GJZA 4IW3A 4IDZA 3VBOB 2PFVA 1IKQA 5C7GA 4E8CA 3N4MA 1FPN3 1HQNA 4MVTA 2JB8A 2VMHA 2P4EA 1C57A 1VBE1 3WV6A 4W4ZA 5H9QA 2ET1A 1D4VB 3JB4C 5FYCA 5KHIA 4DTJA 1YQCA 4QHZA 4HPKB 4QMAA 3WQ1A 5C9AC 2GDFA 5IREA 3LD8A 2IVJA 2JICA 5IYYA 2HWE1 4JQTA 5JZGA 1BLZA 2V72A 2Z69A 3VBRA 3H0OA 3ZN4A 1DCSA 1DLLA 1MQTB 3DV8A 4N8MA 4KWUA 2G9ZA 4CA9A 4M3TA 1UYPA 2Z5WA 5BYNA 4BDVB 4YG3A 3ZKUA 1R093 3QEIA 2RS13 2WL1A 4GKYA 2E7TA 3ZFEB 5FZ3A 2BNNA 1FS1A 5LWBA 2EAKA 1UAIA 5ABJA 3GJAA 1Q43A 3PURA 1W6MB 4XFAA 2DVGA 2UWBA 4LOSA 4GQ7A 1IQAA 1SPPA 4AGVA 2YG0A 4HSLA 4LA3A 3I97A 1ZBE3 4DTRA 4Q26A 1XOYA 1W8FA 2XBO1 1WZXA 4J1WA 3VDDC 5FZ4A 4EN9B 2B1EA 4YVWC 5ERLA 1V6NA 3EB7A 5IBKB 1HV0A 1N1VA 4FCAA 4ISQA 2A1XA 4DTOA 3PIJA 1BKZA 1ND2A 4A44A 5JOWA 1ULDA 1ULCA 4GB31 3G7DA 3O1UA 3GZTB 5FYHA 2ZCWA 3H3ZA 4LR4A 4EYUA 3NAPB 3TBDA 1WBLA 4QXKA 1PM4A 2H0BA 1PM7A 5EJ1B 4BZ4A 5LASA 1FXZA 1GKBA 1Z78A 3A0NA 2RJLA 2JE9A 2DUOA 4ATEA 2P5BA 2PHWA 3D82A 5T52A 4JZRA 4EN8B 5JXJA 5F2SA 1VBB2 2BFUS 3JBG2 1J3RA 4AVAA 5B4NA 1NY71 4IGPA 2A70A 2X5IA 5EQUA 3MF9A 2RCUA 3MW4A 3SH4A 4OI1A 3UJQA 3I2OA 4XETA 4M3CF 3UGHA 5KC5A 5DABA 1Y9MA 4I6JB 3AC0A 3T2OA 2CWMA 2R062 3RFRA 5ISLA 5FXWA 1Y9GA 2JH9A 1CAVB 1Z7S2 4YGEA 1X9TA 2NQYA 1SBEA 4QD2A 5FXXA 4CEYB 2X09A 4FXKB 1ZBA2 1OLQA 2PAEA 1GMMA 5L73A 3POYA 3ZN6A 3VBSA 4QX7A 4RQPC 4IE7A 2JDYA 1QJU3 1QQP2 2DCTA 3QD6A 3R05A 1PGL1 2ZGNA 1RYYA 2NMOA 4M00A 4NHXA 4LLFA 3OSDA
chains in the Genus database with same CATH topology
3DYMA 3V7DB 2WZ8A 3OGRA 2Y6KA 4UI9L 4FJLA 1O8PA 1OF4A 1OF3A 1T2XA 3L2OB 3MKSB 4M3ZA 1W8NA 1EUUA 3N1EA 2HYXA 3RMAA 2VZRA 2QQLA 3T0AA 3THCA 4ARXA 3SUNA 3E1F1 1UY0A 5CZKA 3DECA 2VJXA 2VCCA 2VZ1A 2Y6HA 4QB2A 2JDAA 1L7RA 4DEQA 2LW8A 3IB3A 1XVFE 1W9SA 3I2HA 2FW3A 2J1RA 1XNAA 4MADA 4KHNA 4GWJA 4DU3A 1GNYA 3SPYA 2VO5A 4A41A 4CUCA 3OG2A 1FZIE 2EIEA 3LPGA 1XMFE 4DTXA 3WSOA 4L0PA 4JS5A 2QQIA 4RNGA 1ULPA 2E26A 3T0DA 3HP9A 5HXMA 3SQ0A 4A42A 4DTMA 3IDAA 4XUPA 2LS6A 3J7HA 1XC6A 2EICA 3DYPA 5EJZB 1KEXA 4QB1A 4AKGA 3OB8A 2P5OA 1FZ0E 1K45A 3IIIA 2JH8A 4FK0A 2FYOA 2WQ8A 2YB7A 3QNNA 4FJ8A 3J27A 2WABA 4Z2AA 3A22A 2JE8A 2VZTA 4M3YA 3I3BA 4A6OA 4EYWA 4M3UA 2P1MB 2BGPA 2P1NB 3PUHA 1XNTA 1UY4A 3A7QA 4LHSA 1JYXA 1WAFA 2B8IA 1CZVA 3WNOA 4XUQA 3SQ2A 1XPWA 4KI5M 2W47A 3VD5A 4GWIA 3SEEA 2Y6GA 4P00B 4CU7A 2B4KA 3QETA 4LPLA 4XUOA 2PQSA 3QEWA 2J1UA 2WYSA 2JKXA 4ADNA 5JMOA 1GOHA 4PQQA 3FHQA 3L0MA 4QX0A 1KGYA 2R7EB 3NE6A 1SHWB 2WZEA 1K12A 5EIYB 1FZHE 3E4YA 4FJXA 2OVQB 4JS4A 3CZUA 3K75B 3WF2A 2J1EA 4PT6A 3T2PA 3W5MA 3OGKB 1WCQA 3CKHA 3HEIA 2OZSA 3LEIA 1O8SA 3RMDA 3ZM8A 2OKXA 4JKLA 1NKGA 5IFTA 1XU3E 5DPNA 3LDSA 2VIXA 1FXXA 2VCBA 1GQPA 4KHQA 2VC9A 2ZEXA 4DXTA 3OEAA 3I2KA 3RWUA 3WNNA 1PX3A 1W0NA 3K2OA 4FK2A 1H6XA 3U37A 2VZSA 4W50A 3TAFA 3LE0A 1OT5A 3VD3A 4MO3M 2P1OB 4M3WA 1UY1A 4QX1A 3MO4A 4ZZ8A 3SKJE 3BN6A 3NDKA 3WNPA 4IUGA 2J1SA 4KMQA 5LA0A 3NCIA 1WAJA 4B08A 1JYVA 4RYDA 3I3DA 2OVPB 2X10A 1CIYA 3HNMA 3WF1A 1F4AA 1H6YA 4BXSV 5C71A 2W91A 3ACFA 4X5MA 2VZQA 2ID4A 3ABZA 4AG4A 4FJIA 2ZXQA 2W5FA 5C70A 2YFZA 1UYZA 4HCBA 1GU3A 3IAQA 2W9XA 3VDCA 3HGLA 3NJVA 4DTPA 4W8JA 3HNYM 2VQTA 3N1BA 4XVHA 4DU4A 1K3IA 2RVAA 2E32A 4OMCA 2JPNA 1GOGA 1JHJA 2E31A 3HN3A 2W1QA 3MBWA 1EUTA 5JUVA 3C7OA 3IAPA 2BBAA 1XVDE 1W8OA 2JHPA 2OZMA 4EP9A 2JD9A 5JXIA 4UOJA 2HLEA 2YFUA 3A23A 3C6OB 5JR2A 3TJYA 4JKKA 4XURA 4OMDA 3K4DA 2VJ5A 2DCJA 2YC4A 2MZWB 3ACIA 1DLCA 2WDBA 3NHGA 1W99A 4OUEA 2VCAA 4HG6B 1LNSA 4P5YA 2DEBA 3LZIA 5FUIA 2E33A 2Y6LA 1PMHX 3SKVA 3C6NB 2MMBA 5F7UA 1JZ6A 4AKIA 3LZJA 3K77A 4FVMA 3LQCA 3MV11 3DYOA 2W95A 4CUBA 4ZY9A 2Z4FA 1XMGE 4QPWA 2PFTA 1W9TA 3ACHA 2WN2A 4OYUA 3OGSA 3C7HA 2OYQA 4A3ZA 2OVRB 4FJGA 3C95A 5DN2A 4BK4A 2V5DA 2P1QB 3HOBA 5JXGA 1FZ1E 2VMCA 5IJRA 1MPXA 4BJ0A 2VZVA 3CDZB 1FZ4E 1FZ5E 1W9WA 3VD7A 3I2FA 3NAEA 4QDRA 1FZ2E 2VQUA 5HPOA 4HCCA 4QNCA 1CX1A 2LF3A 1SG3A 4J2BA 3QEXA 3SCXA 2WAOA 3TAGA 1UY3A 4E8DA 2QQJA 1XU5E 3CIHA 3QEVA 4MGSA 1UYXA 4M45A 2RV9A 4QX2A 4FJ5A 5G04L 4KHYA 4JHZA 2DCKA 3HPNA 1OD3A 2J1TA 1JZ7A 3VDAA 4DXRA 4QB6A 5CYYA 2VTFA 3T0BA 3KD1E 1JU3A 3NJXA 5A1AA 4XZUG 4KHSA 4J2EA 3I3EA 1MHYG 2VMDA 3SVIA 3C6PB 1F4HA 2ORZA 3LEGA 4FI9A 4D0QA 5H37A 2WBKA 4DTSA 1CLQA 1I5PA 2QQOA 2RJ2A 3UESA 2VZPA 3K4AA 2QQMA 3P1IA 5I0DA 1HN1A 5B4XA 2BGOA 4MGQA 2VMEA 4UAPA 3W5NA 3S9HA 4FJ9A 1GUIA 2WN3A 1Q9YA 2VZ3A 4KI4A 2LF6A 3C94A 2QXFA 1XVEE 3LDBA 3L8BA 1J83A 2Y64A 4BK5A 1JU4A 5IHRA 4GAMC 3HL8A 1UMIA 1IG9A 5LA1A 4E4BA 1JI6A 2W1UA 3P6BA 2JHCA 1Q9XA 1XVGE 2XHNA 1JZ4A 4RG8A 3GDBA 2J7MA 4P08A 1UZ0A 2J22A 3ACGA 1XVBE 4FJMA 4DU1A 1GOFA 4TXWA 1JZ8A 4FJHA 2KD7A 2Y6JA 3I2IA 2EIDA 4JRQA 5DMYA 2CDPA 2V4VA 2C4XA 4CUAA 4J2DA 2QBXA 4CU6A 3WNMA 1JZ3A 3FN9A 2BERA 2H4TA 3D3AA 4M42A 2L9LA 1IQDC 5G05L 3WNKA 2WO2A 2W1WA 2ZEZA 3LPFA 3ECQA 1UXZA 3HNBM 3WF4A 3SQ1A 3SPZA 1WKYA 1FZ7E 3L1NA 3A21A 4M4RA 3PUIA 1O59A 4M3XA 4DUWA 3CFRA 2W1SA 3VD9A 3MUZ1 4FK4A 4DEVA 2VOTA 4DXSA 3VDBA 4I9QA 3CMGA 3OBAA 3F2ZA 4FJKA 1ULOA 3T2QA 3C7FA 3SNNA 1TVGA 2C9KA 1NX9A 3ETPA 3T09A 4RN5A 1FZ6E 2ZEWA 4LKSA 2W46A 3NNGA 3OGLB 1UMHA 4QNDA 2HD0A 1OH4A 4GZ9A 4QDSA 4E3SA 1PMJX 1US2A 5DQ0A 4DUXA 2ATQA 4CVUA 2BZDA 3MUY1 4M3RA 1NAEA 3K46A 3J2PA 2Y8KA 2ZEYA 4QAWA 1R64A 3MV01 2DY4A 4J2AA 3SUOA 1JZ2A 2B9VA 1FZ9E 4JX0A 3K4ZA 4DUVA 3SJJA 4M4PA 3TL8B 4CU9A 1UX7A 3SUPA 2DTUA 4D8MA 4LQRA 5IFPA 2C26A 1JZ5A 3SEPA 4ZZ5A 1K42A 4M41A 3E4WA 2ORXA 1MMOG 2EIBA 2WO3A 4CU8A 2XOMA 4P02B 3QNOA 2VM9A 3GXUA 3TAEA 2W3JA 4XUTA 5J1XA 2WO1A 2J1VA 2J1AA 3EYPA 4YPJA 2VZOA 4MOAA 4OZOA 3SI6A 3UNPA 3C7GA 1L7QA 1MTYG 1NUKA 3FL7A 2JHAA 2B7MA 3JXSA 4DTNA 4AI6A 3GM8A 4FJJA 4TTGA 5C7GA 2PFVA 4FJ7A 4E8CA 3WF3A 1DP0A 3C7EA 2W94A 3CQOA 4QX3A 4W4ZA 2VMFA 4FJNA 4DTJA 2X05A 4KI6A 3OGVA 5IREA 3WF0A 3LD8A 5JXHA 5IYYA 4KHWA 3GGLA 4A45A 3LEKA 2V72A 2WUHA 1LDKE 4ADOA 3VD4A 3HGKE 1NEXB 4KWUA 3QESA 4M3TA 1CZTA 2DDUA 4BDVB 2P1PB 2YC2A 3NRUA 3SUQA 3QEIA 2XONA 1UWWA 3CQ8A 1FS1A 3CFOA 3I2JA 1FYZE 3QERA 3OEBA 1D7PM 1FZ8E 1JYNA 1CZSA 3RMBA 2YG0A 4ARYA 1XVCE 3I97A 1XMHE 3CFPA 3C8XA 3NQHA 5IZ7A 3WNLA 4RL5A 4JRPA 4DTRA 4DTUA 4X5NA 3RMCA 3I2GA 2B1EA 1UXXX 3EB7A 5IBKB 1P8JA 3WQBA 1J84A 4A44A 4DTOA 2XQXA 2VZUA 2YB5A 4ZXEA 3TABA 3CZJA 2QQKA 3NGIA 2QQNA 3THDA 1MHZG 5LA2A 5EJ1B 3BGAA 4PF1A 1JYWA 4JKMA 4QDQA 3WEZA 5JXJA 1SDDB 2VL4A 5LCWL 5B4NA 2WAAA 1P22A 2RCUA 4AAXA 4KHUA 1US3A 4ET7A 4XUNA 3QEPA 3T08A 4I6JB 2P5GA 1DYOA 1PX4A 2W87A 1UYYA 1TG7A 3SQ4A 4AKHA 3AC0A 3T2OA 3KD5E 3UIQA 2JH9A 1IH7A 2VR4A 4I9LA 1BHGA 3HJRA 1XL3C 2X09A 3UETA 2VJ4A 1GMMA 4A4AA 2W92A 4EPHA 1YQ2A 3OGMB 3FHAA 1FZ3E 1UY2A 1RYYA 2CDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DYM A;  3V7D B;  2WZ8 A;  3OGR A;  2Y6K A;  4UI9 L;  1O8P A;  1OF4 A;  1OF3 A;  1T2X A;  3L2O B;  3MKS B;  1W8N A;  1EUU A;  3T0A A;  2HYX A;  4ARX A;  2VZR A;  2QQL A;  3THC A;  3E1F 1;  1UY0 A;  5CZK A;  3DEC A;  2VJX A;  2VCC A;  2VZ1 A;  2Y6H A;  4QB2 A;  2JDA A;  1L7R A;  4DEQ A;  2LW8 A;  3IB3 A;  1W9S A;  3I2H A;  2J1R A;  1XNA A;  4MAD A;  4GWJ A;  1GNY A;  4A41 A;  2VO5 A;  4CUC A;  3OG2 A;  2EIE A;  3LPG A;  3WSO A;  4L0P A;  2QQI A;  1ULP A;  2E26 A;  3T0D A;  5HXM A;  4A42 A;  3IDA A;  4XUP A;  2LS6 A;  3J7H A;  1XC6 A;  2EIC A;  3DYP A;  5EJZ B;  1KEX A;  4QB1 A;  3OB8 A;  1K45 A;  3III A;  2WQ8 A;  2YB7 A;  4Z2A A;  2WAB A;  3A22 A;  2JE8 A;  2VZT A;  3I3B A;  4A6O A;  2P1M B;  2BGP A;  2P1N B;  3PUH A;  1XNT A;  1UY4 A;  3A7Q A;  4LHS A;  1JYX A;  1CZV A;  3WNO A;  4XUQ A;  1XPW A;  4KI5 M;  2W47 A;  3VD5 A;  4GWI A;  3SEE A;  2Y6G A;  4P00 B;  4CU7 A;  2B4K A;  4LPL A;  4XUO A;  2PQS A;  2J1U A;  2WYS A;  2JKX A;  5JMO A;  1GOH A;  4PQQ A;  3FHQ A;  4QX0 A;  1KGY A;  2R7E B;  1SHW B;  2WZE A;  1K12 A;  5EIY B;  2OVQ B;  3CZU A;  3K75 B;  3WF2 A;  2J1E A;  4PT6 A;  3T2P A;  3W5M A;  3OGK B;  1WCQ A;  3CKH A;  3HEI A;  3LEI A;  1O8S A;  3ZM8 A;  2OKX A;  4JKL A;  1NKG A;  5IFT A;  5DPN A;  2VCB A;  1GQP A;  2VC9 A;  2ZEX A;  4DXT A;  3OEA A;  3I2K A;  3WNN A;  1PX3 A;  1W0N A;  1H6X A;  3U37 A;  2VZS A;  4W50 A;  3LE0 A;  1OT5 A;  3VD3 A;  4MO3 M;  2P1O B;  1UY1 A;  4QX1 A;  3MO4 A;  4ZZ8 A;  3SKJ E;  3BN6 A;  3WNP A;  4IUG A;  2J1S A;  4KMQ A;  5LA0 A;  1JYV A;  4RYD A;  3I3D A;  2OVP B;  2X10 A;  1CIY A;  3HNM A;  3WF1 A;  1F4A A;  1H6Y A;  4BXS V;  5C71 A;  2W91 A;  3ACF A;  2VZQ A;  2ID4 A;  3ABZ A;  4AG4 A;  2ZXQ A;  2W5F A;  5C70 A;  2YFZ A;  1UYZ A;  1GU3 A;  3IAQ A;  2W9X A;  3VDC A;  3NJV A;  4W8J A;  3HNY M;  2VQT A;  4XVH A;  1K3I A;  2RVA A;  2E32 A;  4OMC A;  1GOG A;  3MBW A;  1JHJ A;  2E31 A;  3HN3 A;  2W1Q A;  1EUT A;  5JUV A;  3C7O A;  3IAP A;  2BBA A;  1W8O A;  2JD9 A;  5JXI A;  4UOJ A;  2HLE A;  2YFU A;  3A23 A;  3C6O B;  5JR2 A;  4JKK A;  4XUR A;  4OMD A;  3K4D A;  2DCJ A;  2YC4 A;  3ACI A;  1DLC A;  2WDB A;  1W99 A;  4OUE A;  2VCA A;  4HG6 B;  1LNS A;  4P5Y A;  5FUI A;  2E33 A;  2Y6L A;  1PMH X;  3SKV A;  3C6N B;  5F7U A;  1JZ6 A;  3K77 A;  3LQC A;  3MV1 1;  3DYO A;  2W95 A;  4CUB A;  4ZY9 A;  2Z4F A;  4QPW A;  3ACH A;  1W9T A;  2WN2 A;  4OYU A;  3OGS A;  3C7H A;  4A3Z A;  2OVR B;  5DN2 A;  4BK4 A;  2V5D A;  2P1Q B;  3HOB A;  5JXG A;  2VMC A;  5IJR A;  1MPX A;  4BJ0 A;  2VZV A;  3CDZ B;  1W9W A;  3VD7 A;  3I2F A;  4QDR A;  2VQU A;  5HPO A;  1CX1 A;  1SG3 A;  4E8D A;  2WAO A;  1UY3 A;  2QQJ A;  3CIH A;  4MGS A;  1UYX A;  2RV9 A;  4QX2 A;  5G04 L;  4JHZ A;  2DCK A;  3HPN A;  1OD3 A;  2J1T A;  1JZ7 A;  3VDA A;  4DXR A;  4QB6 A;  5CYY A;  2VTF A;  3T0B A;  1JU3 A;  3NJX A;  5A1A A;  4XZU G;  3I3E A;  2VMD A;  4D0Q A;  3C6P B;  1F4H A;  2ORZ A;  3LEG A;  4FI9 A;  2WBK A;  1I5P A;  2QQO A;  2RJ2 A;  3UES A;  2VZP A;  3K4A A;  2QQM A;  3P1I A;  5I0D A;  1HN1 A;  5B4X A;  2BGO A;  4MGQ A;  2VME A;  4UAP A;  3W5N A;  1GUI A;  2WN3 A;  2VZ3 A;  1J83 A;  4BK5 A;  2Y64 A;  5IHR A;  1JU4 A;  1UMI A;  5LA1 A;  1JI6 A;  2W1U A;  3P6B A;  2XHN A;  1JZ4 A;  3GDB A;  2J7M A;  4P08 A;  1UZ0 A;  2J22 A;  3ACG A;  1GOF A;  4TXW A;  1JZ8 A;  2KD7 A;  2Y6J A;  3I2I A;  2EID A;  5DMY A;  2CDP A;  2V4V A;  2C4X A;  4CUA A;  4CU6 A;  2QBX A;  3WNM A;  1JZ3 A;  3FN9 A;  2BER A;  3D3A A;  2L9L A;  1IQD C;  5G05 L;  3WNK A;  2WO2 A;  2W1W A;  2ZEZ A;  3LPF A;  3ECQ A;  1UXZ A;  3HNB M;  3WF4 A;  1WKY A;  3A21 A;  4M4R A;  3PUI A;  1O59 A;  4DUW A;  3VD9 A;  2W1S A;  3MUZ 1;  4DEV A;  2VOT A;  4DXS A;  3VDB A;  3CMG A;  3OBA A;  3F2Z A;  1ULO A;  3T2Q A;  3C7F A;  1TVG A;  2C9K A;  1NX9 A;  3ETP A;  3T09 A;  4RN5 A;  2ZEW A;  4LKS A;  2W46 A;  3NNG A;  3OGL B;  1UMH A;  1OH4 A;  4GZ9 A;  4QDS A;  1PMJ X;  1US2 A;  5DQ0 A;  4DUX A;  4CVU A;  2BZD A;  3MUY 1;  1NAE A;  3K46 A;  2Y8K A;  2ZEY A;  4QAW A;  1R64 A;  3MV0 1;  1JZ2 A;  2B9V A;  4JX0 A;  3K4Z A;  4DUV A;  4M4P A;  4CU9 A;  1UX7 A;  4D8M A;  4LQR A;  5IFP A;  2C26 A;  1JZ5 A;  3SEP A;  4ZZ5 A;  1K42 A;  2ORX A;  2EIB A;  2WO3 A;  4CU8 A;  2XOM A;  4P02 B;  2VM9 A;  3GXU A;  2W3J A;  4XUT A;  5J1X A;  2WO1 A;  2J1V A;  2J1A A;  3EYP A;  4YPJ A;  2VZO A;  4MOA A;  4OZO A;  3UNP A;  3C7G A;  1L7Q A;  1NUK A;  3FL7 A;  3JXS A;  3GM8 A;  4TTG A;  5C7G A;  4E8C A;  3WF3 A;  1DP0 A;  3C7E A;  2W94 A;  3CQO A;  4QX3 A;  4W4Z A;  2VMF A;  2X05 A;  3OGV A;  3WF0 A;  5JXH A;  5IYY A;  3GGL A;  3LEK A;  2V72 A;  2WUH A;  1LDK E;  3VD4 A;  1NEX B;  4KWU A;  1CZT A;  2DDU A;  4BDV B;  2P1P B;  2YC2 A;  3NRU A;  2XON A;  1UWW A;  1FS1 A;  3I2J A;  3OEB A;  1D7P M;  1JYN A;  1CZS A;  2YG0 A;  4ARY A;  3I97 A;  3C8X A;  3NQH A;  3WNL A;  3I2G A;  1UXX X;  3EB7 A;  5IBK B;  1P8J A;  3WQB A;  1J84 A;  4A44 A;  2XQX A;  2VZU A;  4ZXE A;  3CZJ A;  2QQK A;  2QQN A;  3THD A;  5LA2 A;  5EJ1 B;  3BGA A;  4PF1 A;  1JYW A;  4JKM A;  4QDQ A;  3WEZ A;  5JXJ A;  1SDD B;  2VL4 A;  5LCW L;  5B4N A;  2WAA A;  1P22 A;  4AAX A;  1US3 A;  4ET7 A;  4XUN A;  3T08 A;  4I6J B;  3AC0 A;  1DYO A;  1PX4 A;  2W87 A;  1UYY A;  1TG7 A;  3T2O A;  4A45 A;  2VR4 A;  1BHG A;  3HJR A;  2X09 A;  3UET A;  4A4A A;  1GMM A;  2W92 A;  1YQ2 A;  3OGM B;  3FHA A;  1UY2 A;  1RYY A;  2CDO A; 
#chains in the Genus database with same CATH topology
 4HK8 A;  1W28 A;  2YRO A;  2JKB A;  5IVY A;  4UI9 L;  1F15 A;  1Q5O A;  2ZZJ A;  3B01 A;  4FPL A;  1RVF 1;  2BW8 A;  2CSG A;  4NHM A;  3U14 A;  1EUU A;  2EAA A;  2VU9 A;  3PUA A;  3T0A A;  3RMA A;  2VZR A;  1CWP A;  3THC A;  3ZFG A;  3GBG A;  1PIV 2;  1JOB A;  2WKK A;  2BUK A;  3M3C A;  2VCC A;  5FYY A;  3RGB A;  2CHH A;  3THT A;  2WFF 3;  3PVB B;  1I9R A;  1H1M A;  2Y6H A;  4CEW C;  2JDA A;  4ZHN A;  2D5F A;  5K8S A;  3IB3 A;  4GA9 A;  1W9S A;  5ACA 2;  1QHD A;  2EXH A;  1W6O A;  2CAU A;  2Q8D A;  4J1X A;  4MAD A;  1DGR N;  4CUG A;  4GWJ A;  4NRO A;  4RHV 3;  1VMF A;  4AVS A;  1GNY A;  3WY6 A;  2VO5 A;  4CRQ A;  2BOI A;  2WLP A;  4HSJ A;  4GKX A;  4P9W A;  1NYW A;  4LBN A;  5LAT A;  5LBF A;  2CGP A;  3N9M A;  2UWA A;  1AL2 2;  3HQU A;  3HP9 A;  4OFG A;  4CXX A;  5HXV A;  4DTM A;  1QJY 3;  3AKT A;  1XC6 A;  2DTY A;  2EIC A;  2ZGQ A;  4WVW A;  5FLH A;  3UO3 A;  3DYP A;  4QB1 A;  2R04 2;  4RS5 C;  2BNO A;  3P3P A;  3OB8 A;  4LMF A;  4BIS A;  3WP6 A;  1FZ0 E;  1OXC A;  1URX A;  2YDE A;  5CNA A;  1RUG 3;  1K45 A;  1VB2 A;  2ES3 A;  2FYO A;  4NE9 A;  1W8H A;  1YFW A;  3J27 A;  2HWF 1;  2WAB A;  4IXL A;  3VBF B;  4EN0 A;  2JE8 A;  5FXV A;  1WLC A;  1TMF 2;  2WS9 1;  3I3B A;  3NL1 A;  4XFI A;  1R1A 2;  4M3U A;  1QXP A;  2DFB A;  2XL9 A;  1RUI 1;  1N3Q A;  1XNT A;  1UY4 A;  1AR9 3;  1COV 3;  4P14 A;  2DU1 A;  1LAJ A;  4YVS C;  5JOZ A;  3WNO A;  2CL2 A;  4LA2 A;  1YQ8 A;  2K46 A;  4ONU A;  3SXW A;  3TB0 A;  3AZX A;  5C33 A;  3PTR B;  5FP7 A;  5FO7 B;  4SLI A;  4GAZ A;  1ND3 A;  5JPN B;  4COU A;  4DNY A;  1RGS A;  4LK6 A;  4XUO A;  4HVR A;  1GV9 A;  1F35 A;  1QU0 A;  4TYS A;  2JKX A;  4AYU A;  4ES9 A;  5C9A B;  5J98 B;  1YQ5 A;  3AZY A;  1TNF A;  3U1X A;  3WP4 A;  3PIG A;  1VAM A;  3NE6 A;  2DBI A;  2R32 A;  2WZE A;  3O12 A;  1K12 A;  1W9F A;  3E4Y A;  4ZON A;  4JS4 A;  4FTB A;  3K75 B;  1MZ5 A;  1GNH A;  4XAA A;  1PNF A;  2BEO A;  3T2P A;  3HEI A;  3W9A A;  1GZ9 A;  1O8S A;  3RMD A;  1JXN A;  1JOP A;  3QCW A;  5JZG C;  1SLA A;  3IM0 A;  4Y1Y A;  4E4D X;  3VBR C;  4MGI E;  3OBR A;  3M4F A;  5LK7 B;  2GC3 A;  1H9W A;  3QH6 A;  2FBE A;  2JJ6 A;  1W2U A;  2OUJ A;  1VBD 1;  4NIA A;  1REF A;  5DPN A;  5JLV A;  3LDS A;  2RS5 3;  4DXT A;  1UZW A;  4OHZ A;  2JB4 A;  3P3N A;  4QGL A;  3WNN A;  1J59 A;  2P37 A;  2QZ2 A;  3U37 A;  3LE0 A;  5IAX A;  3KZ4 C;  1OT5 A;  3VD3 A;  1KFX L;  5FY9 A;  4AFA A;  4ICG C;  4QX8 A;  3ZYG A;  1GAN A;  2HWC 1;  1B35 A;  1S2K A;  2XDV A;  3NV2 A;  3ZOI A;  4CP2 A;  3CHX A;  1RUF 2;  5A6X A;  2VOX A;  3RDI A;  3NCI A;  5DAP A;  1HQL A;  3POB A;  1OI6 A;  1OUX A;  4WVM B;  1ND2 C;  2P6C A;  4M0H A;  2X10 A;  5HV0 A;  3WDY A;  2VXJ A;  1PHM A;  2RM2 3;  3BIE A;  1DDL A;  1H6Y A;  4JRA A;  4Q27 A;  4MGT A;  5A70 A;  4CCK A;  3ACF A;  3OY8 A;  3QBQ A;  4NR1 A;  3ZXG A;  1RUN A;  3ZR6 A;  4AG4 A;  3AKQ A;  1QJX 1;  2ZXQ A;  2CV6 A;  4BQ1 A;  3IPV B;  2BTV C;  1UYZ A;  4HCB A;  5AFE A;  1UZV A;  3HQX A;  3NV4 A;  3H1M A;  2ZGK A;  2VD7 A;  4CDX A;  2X5I C;  3UJO A;  5FZI A;  4Y22 A;  4LEJ A;  1XB9 A;  1BEV 2;  1O3Q A;  4QWN A;  1HJF A;  3ZO0 B;  4OMC A;  5J3U A;  2JDZ A;  3OJB A;  3AYD A;  2P2K A;  1EUT A;  3ETQ A;  4PQ9 A;  3RMX A;  1VAL A;  2BBA A;  1NLR A;  1GFF 2;  1XVD E;  2EXI A;  4JGZ A;  1C8M 1;  3U0Z A;  2JHP A;  1EAH 1;  2XWB B;  1YEW A;  2JD9 A;  5A7W A;  4BLJ A;  2Q30 A;  3VBS C;  5A1L A;  1UNB A;  2HLE A;  2PMW B;  3HIF A;  3KGZ A;  3P5B A;  5JR2 A;  3AM2 A;  3RZH A;  2FMY A;  1FV2 A;  3S5Q A;  3H50 A;  1AYM 3;  4FOV A;  1XU2 A;  2MZW B;  1YLL A;  3ACI A;  4Y4R A;  1ZRF A;  2JG9 A;  3PL0 A;  1W06 A;  4XXP A;  4JTO A;  4X8N A;  4CEW B;  1ZNP A;  4DZG A;  2D3R A;  1PO2 1;  1T6G C;  1LNS A;  4IND A;  3ZFG C;  2OQ6 A;  3ALQ A;  4Q0P A;  1FNZ A;  4FPH A;  2O8O A;  1PMH X;  5DAQ A;  5L9R A;  4DRV A;  1X8E A;  2RJK A;  5A7O A;  3TEX A;  2B42 B;  4ZS2 A;  3MIF A;  4CXY A;  4AKI A;  3LZJ A;  3BOP A;  3IDE A;  3RYK A;  4CUB A;  3FWE A;  1V6I A;  3D5O A;  4F3J A;  3ZYP A;  1DGL A;  1CR7 A;  5GZF A;  3M3Q A;  2Z4F A;  4Y5Z 0;  2BOJ A;  3PVE A;  2PAK A;  4FTS A;  1W8Z A;  2ARE A;  4OYU A;  2OS2 A;  3C7H A;  1POV 1;  1XU1 A;  2I2S A;  3ZSJ A;  2VQA A;  2OVR B;  2XLG A;  3C95 A;  3A4U A;  3BOW A;  2DVD A;  3S7E A;  4BK4 A;  2V5D A;  5D8A A;  3AP5 A;  4O9E A;  5JIU A;  1NXD 1;  2VMC A;  2YU1 A;  5F32 A;  3S6P A;  1CON A;  3AZW A;  4LUK A;  5KHJ A;  4XC9 A;  5LBB A;  4AI2 A;  3JD7 3;  5APA A;  1W2N A;  4IQP A;  1YQ6 A;  3I8T A;  4YRD A;  2GNB A;  4PIY A;  4QDR A;  4BB3 A;  2GH8 A;  4DIN B;  1W0P A;  3ZYR A;  3BAL A;  5FJK A;  1JHN A;  2UYA A;  1SG3 A;  4Y24 A;  3BI3 A;  3QEX A;  1KD7 A;  3SCX A;  1ONA A;  3TAG A;  4E8D A;  4R4Z A;  2W08 A;  3QEV A;  2F17 A;  2GN7 A;  2YUE A;  3WVJ A;  3VHR A;  4LE4 A;  4LHK A;  4XAC A;  4QX2 A;  5KBF A;  1HRV 3;  1NCQ A;  2EVX A;  3E6D A;  5G04 L;  5C6C A;  2DCK A;  2OZ6 A;  1IPK A;  3WHT A;  2BQP A;  1OD3 A;  4YGB A;  2ADE A;  2W39 A;  1JW2 A;  1ND3 C;  1WBF A;  2VTF A;  1AL2 3;  4LXL A;  2DYC A;  3T0B A;  4BQW A;  1FV3 A;  4XZU G;  3AYC A;  3SCG A;  4DIQ A;  1NQD A;  3I3E A;  4URT A;  1KRI A;  1HB2 A;  2FDK A;  3C6P B;  4QQL A;  3U75 A;  2WBK A;  3ZDV A;  5KHG A;  3LEM A;  2RJ2 A;  4LKE A;  4UT5 A;  3VKM A;  1XRU A;  5KWR A;  1HN1 A;  5B4X A;  5DG2 A;  4QPG A;  1QMJ A;  4MSV A;  3WUC A;  2ZGO A;  4UF0 A;  5JZG B;  1TMF 3;  4RSU A;  3S9H A;  1SBF A;  4YW1 A;  3U78 A;  3VBR B;  1W3X A;  1DU3 D;  4DMI A;  1OUR A;  3ZYB A;  5CFC A;  1CAU A;  2VZ3 A;  1AL0 G;  2LF6 A;  1JBC A;  3C94 A;  1EYB A;  4CDU A;  5EP9 A;  3R4S A;  4P9X A;  4UW4 A;  4IE4 A;  5IHR A;  1NCR C;  3HL8 A;  1UMI A;  1IG9 A;  4WVZ A;  3HMY A;  4H14 A;  5ABJ B;  2FDF A;  3P6B A;  1CAW B;  1SPP B;  5FKB A;  1Y4W A;  2R07 1;  1DYP A;  2XHN A;  5K0U A;  5FY8 A;  5C4W B;  1JZ4 A;  3PNA A;  2O8Q A;  4RG8 A;  3GDB A;  1PMI A;  2JQT A;  4CP0 A;  3AMP A;  4P08 A;  3KVB A;  1UZ0 A;  3NMB A;  1G86 A;  1S0G A;  3ZYF A;  3ACG A;  4FJM A;  1NG0 A;  3DKW A;  1HKD A;  1RXF A;  2P1B A;  2ZKN A;  1IS4 A;  3LDK A;  3MF6 A;  2R1B A;  1UPI A;  1B35 C;  3I2I A;  5CIS A;  3NNJ A;  2CDP A;  1C1F A;  2Q4S A;  4CCE A;  2HKX A;  3DXT A;  5DAX A;  5FP8 A;  1RUE 2;  3FFQ A;  5LB6 A;  3I59 B;  5FQ0 A;  1LEC A;  2BER A;  3X29 B;  4AI3 A;  2A6W A;  3PUQ A;  3I2D A;  1W90 A;  3Q8F A;  3NKT A;  4HVO A;  1XNB A;  1OA4 A;  2ZEZ A;  3S30 A;  4I2O A;  4NIG A;  4B4Q A;  5DZG A;  2NN8 A;  3HNB M;  4EWD A;  4CTE A;  3SQ1 A;  1WKY A;  1LOB A;  2XML A;  4IEZ A;  1H2N A;  4YM3 A;  4HZF A;  4QGM A;  4RR3 A;  1RUH 2;  4NMI A;  5IVJ A;  2BNM A;  4CDX C;  1O59 A;  4L92 A;  2W1S A;  1U5X A;  3VD9 A;  3LB9 A;  1SCS A;  3MUZ 1;  4K8F A;  4A7Y A;  2VOT A;  4JHT A;  2BV4 A;  4MHU A;  3ACL A;  3VDB A;  1ZZ7 A;  5FTT C;  3ZN6 B;  4CDQ A;  3VBS B;  2ZGU A;  1QJF A;  3T2Q A;  1RUF 3;  4YFW A;  3N3H A;  1DHK B;  1F5F A;  1TVG A;  2VW2 A;  3T09 A;  4UFL A;  5IVB A;  4C1W A;  4AOC A;  1FZ6 E;  2ZEW A;  4JGZ C;  2W46 A;  1LHU A;  4JCK A;  1RJ7 A;  1UIK A;  4ZXK A;  3N9P A;  3EJK A;  3VBU A;  4QDS A;  4E3S A;  1QEX A;  3JQX A;  2HEW F;  2ATQ A;  2XBO 3;  1OPO A;  3OBZ A;  4D6S A;  1Q8S A;  2RDQ A;  1RXG A;  3J2P A;  3KMH A;  3BTY A;  5GKA C;  2DY4 A;  3SUO A;  1R09 2;  1LU2 A;  2RS1 2;  4GB3 3;  1PVC 1;  2ARX A;  2JG9 C;  3USS A;  4OLL A;  5HCB A;  3TL8 B;  4F8A A;  2UU8 A;  3Q9O A;  4D8M A;  1PZ7 A;  1BEV 3;  2C26 A;  2IXC A;  5DUX A;  3J4U H;  4F83 A;  1G6N A;  4M41 A;  1XYN A;  1W6O B;  1ZBE 2;  1JTZ X;  4XFF A;  5LRR A;  3AMQ A;  2NPI A;  4UFJ A;  1WGP A;  1OPM A;  4P02 B;  3ZVX A;  3TAE A;  3NVC A;  3ZYI B;  4BQ2 A;  4FFI A;  2D3P A;  2J1V A;  3MLJ A;  1LEN A;  3UGG A;  1R08 1;  1IPJ A;  3ES1 A;  2W52 A;  1WW4 A;  2NM1 A;  4IEY A;  3ASI A;  3PTY A;  4YYO A;  2CGO A;  1ASJ 2;  1HRI 1;  2JHA A;  1DZT A;  2WNV A;  3SLI A;  4Z92 B;  1LED A;  4COW A;  4AI6 A;  4CSW A;  3N7L A;  4TTG A;  2BWA A;  3ZXE A;  3WF3 A;  4D6Q A;  5F9T A;  1N3P A;  5BNO A;  3C7E A;  5D8A C;  4QX3 A;  5F5A A;  2ETE A;  2VMF A;  1TME 2;  4FJN A;  3OUH A;  4EWE A;  2YBP A;  3BB6 A;  4KGQ A;  4COZ A;  1OD5 A;  2ZHM A;  4KI6 A;  4NUB A;  1FT9 A;  2JDH A;  3OGV A;  1GP4 A;  5CB7 A;  4AEJ A;  4L8Q A;  3DEM A;  5JXH A;  3WCS A;  1K5M B;  1FOD 1;  4YM0 A;  3VHO A;  5A7N A;  3WUD A;  3HAG A;  4X6Q B;  1LDK E;  4BCU A;  3ZXK A;  3HGK E;  4IEQ A;  3OD4 A;  4ASM B;  5CAD A;  3QES A;  1VRH 1;  1CZT A;  3WDV A;  2DDU A;  3JZV A;  4AWD A;  5J09 A;  4LUL A;  1ND3 B;  5FP9 A;  1NCQ C;  1J3P A;  1QJU 2;  2OVU A;  2DFC A;  3BU7 A;  3EQE A;  1IG3 A;  1FYZ E;  2PHX A;  4J25 A;  5FUN A;  1D7P M;  5F39 A;  1LJ7 A;  2ZOE B;  1K5J A;  3DPR B;  1XVC E;  4NO4 A;  4TZD A;  2VH9 A;  1XMH E;  4GD4 A;  2UYB A;  5BNP A;  5H9R A;  1MS5 A;  2XHK A;  4DTU A;  3RMC A;  4AI0 A;  1G9F A;  1BVP 1;  1PO1 1;  3QH7 A;  1XBF A;  4TN7 A;  5FZ8 A;  3SIT A;  5IVV A;  2SBA A;  2JX9 A;  4LBL A;  3CJX A;  1A34 A;  1ENX A;  4QPG C;  3TAB A;  2WFF 2;  1XJA A;  1QKQ A;  4Z1V A;  3CZJ A;  1L3J A;  2QQK A;  4HKO A;  1WCK A;  2WLQ A;  5LA2 A;  5CFC C;  1WCU A;  1ZZ9 A;  4PF1 A;  4H55 A;  4S2G A;  2H6C A;  2IZW A;  2WNU A;  4QDQ A;  1TE1 B;  2PLV 1;  1SDD B;  4Q4W 1;  1HW5 A;  4KG8 A;  2HBT A;  2HWB 2;  3T4H B;  1BMV 1;  1Q3E A;  2WS9 3;  5IVC A;  5FP3 A;  3UKV A;  2VXR A;  3LA3 A;  5FYZ A;  1US3 A;  1RUI 3;  4UW3 A;  4QXH A;  3TEZ A;  2D97 A;  4Q1P A;  3TRS B;  4CDW A;  3QEP A;  1QJY 2;  1Y3T A;  2Z42 A;  1PX4 A;  4A45 A;  2PEL A;  5F3I A;  1DFQ A;  4AQS A;  1B35 B;  1CJD A;  1EY2 A;  5A3W A;  2ZAA A;  1BHG A;  4R8H A;  1LEM A;  2ZML A;  1RUG 2;  3AVS A;  2UY9 A;  4O9G A;  4XCB A;  4A4A A;  2OZJ A;  1YFY A;  3FBY A;  4KL1 A;  3VLB B;  1H8V A;  4EPH A;  1ZYB A;  3AMN A;  2YPJ A;  3FHA A;  1FZ3 E;  1YNA A;  4AI8 A;  2TBV A;  3WQ7 A;  4IL7 A;  3OY8 B;  4NHY A;  5L36 A;  1QJZ A;  5BPX A;  2WZ8 A;  1X82 A;  4XEZ A;  1O8P A;  1AR9 2;  2K0G A;  1COV 2;  3LAG A;  1T2X A;  2IXJ A;  3L2O B;  3MKS B;  3VN4 A;  3PLQ A;  3AYA A;  3PDQ A;  4CXW A;  2HYX A;  3I4I A;  2DVA A;  2FDI A;  3E1F 1;  4Y22 B;  5F6K A;  2VJX A;  2XVG A;  1AUY A;  4ERO A;  4RR3 C;  1UOG A;  2VTX J;  1L7R A;  4AQ6 A;  5FPV A;  4FO9 A;  5I93 A;  5IK8 A;  4N43 A;  3FHI B;  1XNK A;  1VBD 3;  3WDU A;  4JGZ B;  4KHN A;  4DU3 A;  5A33 A;  3GBF A;  1H1I A;  1HXS 2;  5A7W B;  3VZO A;  3WW1 A;  4BOW A;  3SPY A;  4R9A A;  2OW4 A;  1LGC A;  4A41 A;  3B9I A;  2JDN A;  1FPO A;  3OG2 A;  1FZI E;  1FAY A;  2EIE A;  1RUE 3;  1XMF E;  4UYB A;  4AZZ A;  3WSO A;  4L0P A;  4JS5 A;  3TNQ A;  4URA A;  2MPF A;  4Q4Y 1;  4RNG A;  4JVA A;  1LHN A;  3VBU C;  3T0D A;  4W6X A;  5HXM A;  1O3S A;  3SQ0 A;  1V70 A;  4N9I A;  2HWC 3;  4XDP A;  5FUP A;  2JG9 B;  4CPB A;  3GHN A;  4LHN A;  3VHP A;  1V6K A;  5I0S A;  2XJR A;  3O1P A;  2P5O A;  2XJU A;  2MNG A;  3AVR A;  3AXD A;  3J26 N;  4ITC A;  4FAH A;  5HCA A;  2VGD A;  4LBM A;  3RZM A;  2A3X A;  2YB7 A;  4KQ7 A;  2RS5 2;  1PZ9 A;  4FJ8 A;  1JOJ A;  1W03 A;  5A80 A;  3J8F 1;  5M0T A;  2OT7 A;  4AFM A;  5JI9 A;  1XE0 A;  4KWL A;  4YG0 A;  5L19 A;  4M3Y A;  4BQ3 A;  3VL8 A;  1V9U 1;  4GIQ A;  4RGG A;  1QJX 3;  2BGP A;  1OH3 A;  3K3O A;  4WM7 A;  3SMH A;  4UBG A;  1RUJ 1;  1OVP A;  2ZX0 A;  3TEW A;  1LB2 A;  1J1L A;  3RNS A;  1RUC 1;  2FQP A;  2XXZ A;  3E5U A;  3M7A A;  2AC1 A;  4LHS A;  1QNY A;  4BU2 A;  4DRR A;  4XUQ A;  3SQ2 A;  1XPW A;  1SZB A;  4KWK A;  1DQ5 A;  5FYB A;  3UKN A;  5J7M A;  4KBZ A;  4AED A;  4GWI A;  1A6C A;  1H0B A;  3SEE A;  1WD4 A;  4CU7 A;  2B4K A;  3QET A;  1O5U A;  2MHF A;  2WNV C;  2RM2 2;  5FOB B;  2E6V A;  3R6S A;  3QEW A;  4LNV A;  1HDK A;  3VZJ A;  4XPV A;  2GME A;  2WYS A;  4KBB A;  5FZE A;  1DYK A;  4A3X A;  4ADN A;  3ZFF A;  1YC6 1;  1SLI A;  1QDO A;  4QKF A;  3FHQ A;  4IV3 A;  1AX2 A;  5BNO C;  4G3Y C;  4XBL A;  2C24 A;  1DZR A;  1EV1 1;  1RMU 3;  5C3R A;  1RHI 1;  4FPY A;  4H7M A;  5EIY B;  1FZH E;  3KCY A;  4HAN A;  1NLS A;  3M1H A;  2D43 A;  3ZDS A;  1AR8 2;  2J1E A;  1UOF A;  1CPN A;  1WCQ A;  3LEI A;  2HJI A;  5A3N A;  4OUM A;  1HLC A;  4Q0S A;  1A8D A;  3ZM8 A;  5JAX A;  2AH2 A;  5FPA A;  3H1Y A;  4JKL A;  1NCQ B;  4R9C A;  5HCF A;  4DFS A;  1CGP A;  2LRP A;  1AR6 1;  4BHP A;  1PO2 3;  3H8U A;  4HOO A;  4MGY E;  3TN9 1;  3RYR A;  1FXX A;  4NVP A;  2ADD A;  1GQP A;  1ASJ 3;  3DKQ A;  4R4X A;  5E6H A;  3NNM A;  5DUV A;  1N1Y A;  1PX3 A;  3MIH A;  4QXC A;  4FK2 A;  3RZG A;  2LUW A;  4XYX A;  2VZS A;  3KLS A;  4MO3 M;  4LK7 A;  4GXL A;  5F5I A;  2ZPX A;  1AYM 2;  2IXK A;  2WNE A;  2B39 A;  1UY1 A;  2ZGT A;  4QU2 A;  3KQR A;  5BNP C;  4FP3 A;  4QPG B;  4QHB A;  4IUG A;  1TME 3;  3R4U A;  4L99 A;  4UF0 B;  3WNP A;  3ZMN A;  4D94 A;  5C3Q A;  3CU7 A;  3KSC A;  1WAJ A;  1POV 3;  5JOY A;  5CFC B;  3M3E A;  1Q56 A;  1CAU B;  1GYK A;  3I3D A;  3ZLI A;  4CP9 B;  5FYU A;  1F4A A;  1ZA4 A;  3NV1 A;  3Q8B A;  4FFH A;  4Q0V A;  1ZA7 A;  4AR2 A;  4B3N A;  4BQX A;  4CDU B;  5DZE A;  3MPB A;  5C71 A;  2FDG A;  1KIT A;  4FJI A;  2RHP A;  5LRS A;  2WNU C;  3WIN E;  3WW4 A;  1O3T A;  2FZ1 A;  1M06 G;  1BBT 2;  2YFZ A;  1KS4 A;  5K0U B;  2RS3 1;  4Q29 A;  1QOS A;  5DDJ 1;  4XIO A;  1X36 A;  3GZU C;  2VTX A;  4JGY A;  5GZD A;  3N1B A;  4SBV A;  2QFE A;  5TSW A;  2YPD A;  2E32 A;  4CDW C;  4K40 A;  1JHJ A;  4G4F A;  4J6G A;  5FZ9 A;  4BLI A;  2ZX2 A;  3SHR A;  4L9B A;  5FPU A;  1ACC A;  1C8N A;  3IAP A;  5JVV A;  1W8O A;  3O5S A;  4BA6 A;  5FZK A;  3JD7 2;  2QDN A;  2OZM A;  3V0B A;  3HT2 A;  4OCT A;  3IMM A;  3EXU A;  4Q4V 1;  5FBJ A;  5FQ0 B;  1R1Z A;  1YFU A;  4E2S A;  5C5T A;  2YFU A;  1ZRE A;  2G9G A;  4OHY A;  5LY2 A;  1OFN A;  2D6K A;  1YHF A;  3K51 A;  3W20 A;  4Q4X 1;  3W59 A;  2MEV 1;  2XL7 A;  2YBK A;  4E4S A;  3K4D A;  2VJ5 A;  2DCJ A;  2E63 A;  5C3O A;  5CEH A;  3AXE A;  3AKS A;  5IUQ A;  1DLC A;  3OPT A;  2WDB A;  1HRV 2;  1HB1 A;  4PHZ A;  4O61 A;  2HWB 3;  4BIO A;  1AF9 A;  3NHG A;  2EIG A;  1ZVF A;  1AR7 1;  4XQD A;  4YW4 A;  4XJA A;  4WZF A;  4AVB A;  1V00 A;  2Q8E A;  2HEY F;  4AFD A;  3LZI A;  1LRH A;  2IC1 A;  2EF6 A;  2OXB A;  3CEW A;  5C5U A;  5C3P A;  4XFB A;  2RR1 2;  2R0H A;  5GLZ A;  4BIF A;  4CDQ B;  1OVS A;  3GJB A;  2BDR A;  5F7U A;  1POQ A;  3RJR A;  3GCW A;  4FTE A;  4N43 C;  4YW3 A;  4D6R A;  1ULG A;  3LQC A;  3IDC B;  3O1T A;  3MV1 1;  5FKC A;  2A3Y A;  3DYO A;  4NHK A;  1QGL A;  4M3C A;  1YCI A;  2P34 A;  4JTN A;  4GMP 3;  4ZY9 A;  3VBU B;  1NA1 A;  3N7K A;  4DOU A;  1WMD A;  2PHF A;  4QPW A;  2PFT A;  1W9T A;  3ILN A;  2QKD A;  1KJL A;  5LA9 A;  2OA2 A;  4W65 A;  1BXH A;  3UGF A;  1F9K A;  5IVE A;  3MI8 A;  2JWP A;  3WG4 A;  2VNO A;  2JEM A;  2JDM A;  2E7A A;  1GZW A;  4OUL A;  1OQD A;  1H2K A;  5IJR A;  4AHZ A;  3MLK A;  1Y43 B;  2D44 A;  4BPZ A;  4GWM A;  1W9W A;  2CWS A;  3O1O A;  1AYN 2;  5GZC A;  4QQO A;  2X53 S;  2XR4 A;  2VQU A;  3SCF A;  5HPO A;  4HCC A;  4QNC A;  1YWK A;  3CF6 E;  2LF3 A;  4Y20 A;  4J2B A;  2WZR 1;  1PGW 1;  4WM7 C;  1UY3 A;  3UL2 A;  2QQJ A;  3CIH A;  3HR9 A;  1HXS 3;  1SFP A;  3FUO A;  3MGU A;  4LKF A;  5C8C A;  4KHY A;  2WNV B;  3DN7 A;  4JHZ A;  4YGC A;  1RUD 1;  1WUV A;  2J1T A;  1S0I A;  4AED C;  4FQZ A;  1H8T A;  4XMA A;  4FPC A;  2WII B;  4QB6 A;  4XJZ A;  3KD1 E;  4C91 A;  5FZC A;  5LK5 A;  4KHS A;  4J2E A;  5BNO B;  1VBE 2;  4PI0 A;  1NCR A;  5EHD A;  4TSV A;  3B00 A;  3BTA A;  1ZZC A;  5CA6 A;  5DAW A;  3ZFF C;  4FI9 A;  2D6L X;  1QH7 A;  2LM3 A;  2E53 A;  1I5P A;  2QQO A;  2ZGR A;  3UES A;  1JOD A;  4IV3 C;  5K4L A;  5FY0 A;  5I0D A;  2HWE 2;  4MGQ A;  5JDB A;  1FAT A;  4FT8 A;  4UAP A;  4BYY A;  3W5N A;  4M3C E;  1TNR A;  5GM0 A;  1JUH A;  4YZ3 A;  4OHW A;  2DTW A;  3VDD B;  4YSF A;  4YVW B;  2WN3 A;  3ELN A;  1VBA 1;  1OBN A;  3OD0 A;  1KDM A;  4E9K A;  1Q9Y A;  4EQV A;  4FPG A;  1VMJ A;  2QXF A;  1GNZ A;  5CBL A;  1PVC 3;  1J83 A;  1W05 A;  2VBP A;  3S57 A;  2UWC A;  4OI0 A;  4K8R B;  5A3O A;  5CKN A;  1UKG A;  2PHT A;  5H9P A;  5IVF A;  3AZV A;  2VUD A;  2X8K A;  2GAL A;  5B2G B;  4QM8 A;  1UPS A;  2JXA A;  1XVG E;  3WT3 A;  1SBD A;  1OOP A;  4Z2W A;  3AKR A;  2G19 A;  2XBO 2;  1JYC A;  4B4R A;  5BNP B;  2ZAC A;  4I30 A;  4XF4 A;  4F7Z A;  5L7O C;  3OYW A;  1GZT A;  1WA6 X;  4A2U A;  1R08 3;  5I8Y A;  4DU1 A;  1CIW A;  3BUC A;  1F8V A;  4RGA A;  4FJH A;  1GZC A;  4A6S A;  4PBO A;  4LLO A;  5FZB A;  4DO0 A;  4GB3 2;  4YZ2 A;  5LZ6 A;  2Y6J A;  4ZU5 A;  3IN9 A;  1Q8P A;  1S4C A;  4AHY A;  4Y5T A;  4MXW A;  1MS4 A;  5T3N A;  4J2D A;  2FCT A;  1AR8 3;  2QBX A;  1DQ1 A;  2YMZ A;  3QOP A;  4CU6 A;  4HVQ A;  3D0S A;  3DF0 A;  3FMG A;  2XVL A;  1UIJ A;  3N9Q A;  4AXO A;  1XYO A;  2WNU B;  1LU1 A;  3N36 A;  5A1F A;  1BVV A;  5T55 A;  5FZ1 A;  4RQP B;  3KV5 A;  1VPH A;  3KB5 A;  1S0D A;  1NY7 2;  2VBB A;  2GMP A;  3OUJ A;  2DBN A;  1FPN 1;  5I0R A;  1FOD 3;  1S0B A;  3IIA A;  1MZ6 A;  4OHV A;  1N1T A;  3L1N A;  4JGY C;  3A21 A;  4Q0Q A;  5DG1 A;  5FMO S;  4DUW A;  5FYI A;  3CFR A;  4LBK A;  3RMY A;  3OPW A;  3BU0 A;  4FK4 A;  3HQR A;  2OUH A;  1VRH 3;  2A5Z A;  2Y38 A;  4HT1 T;  4R9D A;  4DXS A;  3BCW A;  1VBC 3;  3RJ2 X;  4P9G A;  3OTF A;  1GSL A;  3OBA A;  1BJQ A;  4EE2 A;  3F2Z A;  2G4I A;  2XJQ A;  5A3M A;  1UN1 A;  1E5H A;  3SNN A;  1DG6 A;  2C9K A;  2Y0O A;  4TLF A;  2GNT A;  2PYT A;  3ETP A;  1PGL 2;  4ZS3 A;  4NAO A;  4LKS A;  3O1R A;  2Y34 A;  5FPZ A;  1YIF A;  4NHL A;  3NNG A;  5FZO A;  2CY6 A;  1CAX A;  2H6B A;  5KR7 A;  5AC9 1;  3CBN A;  4LE3 A;  1UMH A;  4GWN A;  2ZA9 A;  1T6B X;  1PMJ X;  2OX0 A;  1IKP A;  1AXK A;  3GHM A;  3ZXJ A;  2XKP A;  2YZ4 A;  3GBW A;  2BZD A;  2QNK A;  1W0O A;  4M3R A;  1RVF 2;  3A0K A;  1PO1 3;  5IAT A;  3K46 A;  2GP5 A;  2Y8K A;  5J36 A;  4QAW A;  4HBN A;  4YLZ A;  5A3L A;  3O0V A;  4J2A A;  1BBT 3;  1SMV A;  3LDR A;  1JZ2 A;  3BKZ A;  2W2I A;  1ZBE 1;  2B9V A;  1NT0 A;  1HX6 A;  3V65 A;  1W6Q B;  3SJJ A;  2JG8 A;  1D4M 1;  2YXS A;  3RG0 A;  4CU9 A;  3BYW A;  3NKG A;  3LSE A;  2DTU A;  2YGL A;  4JQR A;  2C9A A;  3DXU A;  4RS5 B;  4BWO A;  1I1E A;  4N43 B;  5A7S A;  3SEP A;  4ZZ5 A;  3FLR A;  3USU A;  4W6W A;  5L9V A;  2EAL A;  2ORX A;  4GUL A;  4H2A A;  4Q4W 3;  1MMO G;  2EIB A;  5FZA A;  4CU8 A;  5A33 B;  5FAX A;  2XJV A;  3GXU A;  1V6L A;  2JEN A;  5EYY A;  4AFB A;  3U10 A;  2WO1 A;  3SIS A;  4YPJ A;  1OMI A;  4HMZ A;  4IGO A;  4OZO A;  3VBO A;  3VGI A;  3UNP A;  5DUW A;  4N9H A;  3SCH A;  1MTY G;  3L2Y A;  5KXC A;  3AP7 A;  1UQX A;  1NA1 C;  3FL7 A;  2XWJ B;  1CN1 A;  3JXS A;  3U07 A;  4YW2 A;  4LO6 B;  1KQR A;  4LKD A;  4YVS B;  4ZPI A;  3MYX A;  4BXF A;  2A6Z A;  1V0A A;  4FJJ A;  1ZRI A;  4CPB D;  4FJ7 A;  3AP6 A;  5F5Q A;  4HL0 A;  3ZXA C;  4B4P A;  5LEK A;  4LO8 A;  4AGG A;  2HWF 2;  2BVV A;  3M8L A;  2RMU 1;  4Q8L A;  3FJS A;  1VIW B;  2DWR A;  2WS9 2;  2Q1Z B;  3ZYH A;  3JQW A;  1H2L A;  1YIP A;  1LHW A;  2WSU A;  3WW3 A;  5A3P A;  2BP6 A;  5K9Y A;  1F2N A;  1RUI 2;  3WF0 A;  1OA3 A;  4YM2 A;  4U36 A;  2RR1 3;  3WW2 A;  2QJV A;  3ZFE A;  1MZE A;  3LEK A;  4Y1X A;  2BRT A;  2IVI B;  2WUH A;  1RUO A;  3LIH A;  3VD4 A;  4AQT A;  4S2H A;  1JN2 P;  3AYE A;  4AED B;  5FPX A;  2YC2 A;  3SUQ A;  5A6Q A;  1E5S A;  5C8C C;  3FC0 A;  4XF9 A;  1MS3 A;  4FPJ A;  5FZM A;  1JH5 A;  1APN A;  2Q1F A;  1PVX A;  3BPS A;  3OEB A;  1H8T C;  1JYN A;  1MS8 A;  3ZFF B;  4ARY A;  3EMR A;  4A7K A;  1WLT A;  3NQH A;  5IZ7 A;  1W2T A;  4RL5 A;  2ZGL A;  3PU3 A;  3WNL A;  4X5N A;  3URF A;  4CYD A;  2HH9 A;  2YV8 A;  4Y1U A;  1UXX X;  1VMH A;  3PVO A;  3TEY A;  4CZS A;  4IT5 A;  1W8U A;  5FP4 A;  1FMD 1;  4NID A;  1RIT A;  3AX4 A;  4HLT A;  4LBJ A;  4OVE A;  4RHV 1;  4ZXE A;  1AYN 3;  3H1W A;  3NGI A;  2QQN A;  1H2M A;  3ILF A;  4JV4 A;  3THD A;  3WP5 A;  1AJO A;  2WC2 A;  2NMN A;  1JYW A;  2DVB A;  1H4H A;  1VBD 2;  3NWK A;  4JKM A;  3GCX A;  4OZX A;  5F3G A;  5FY5 A;  5IAV A;  4MLO A;  1ND2 B;  5T50 A;  5FZD A;  3TWI A;  3B9C A;  4QQP A;  4QXB A;  3WEZ A;  4BQY A;  4Y1V A;  3J8F 3;  4RFR B;  4YW6 A;  3T30 A;  5H9S A;  5LCW L;  2XJS A;  4XF1 A;  1CAV A;  5FMO L;  4C90 A;  5I91 A;  3MW3 A;  1V9U 3;  3V0A A;  1IPS A;  3LA2 A;  2GU9 A;  2NYY A;  4HN1 A;  4ET7 A;  4BQ4 A;  1DIW A;  1OOP C;  1RUC 3;  3T08 A;  1VBE 3;  2DU0 A;  2HWC 2;  2W87 A;  5J48 A;  4AKH A;  1ZZB A;  3FLP A;  3UIQ A;  3KS7 A;  2R16 A;  2VR4 A;  2X5I B;  1L7L A;  4I9L A;  2A6Y A;  4K3U A;  4NN0 A;  5AFB A;  1XL3 C;  3LWC A;  1RIR A;  3UV9 A;  2VJ4 A;  2HWE 3;  5IK7 A;  3ORJ A;  3PJY A;  4Q2F A;  4AVC A;  4MH0 E;  2W92 A;  4UFK A;  3ROU A;  3ATG A;  1YQ2 A;  1SDW A;  2QQP A;  3L9J T;  2CDO A;  4JDO A;  5A3T A;  5LW9 A;  2QQU A;  1QJX 2;  4XBN A;  4CCC A;  4CCN A;  3IDB B;  4FJL A;  1OF4 A;  3S0M A;  2Y0I A;  4WM8 A;  3POI A;  4QGN A;  4IE5 A;  5E1R A;  4DS0 A;  1RHI 3;  1VLN A;  1W8N A;  1Q8V A;  2ENR A;  3JCI A;  1WA4 A;  4WBB A;  3SUN A;  4NPR A;  4EZH A;  1X50 A;  4MX3 A;  2Q8C A;  3DEC A;  1D0H A;  5CAZ A;  4IES A;  2VZ1 A;  4KNC A;  2ZGS A;  2QUO A;  4IEP A;  3M70 A;  4ZKT B;  3OGJ A;  2C6S A;  4AGR A;  3WNX A;  3AMM A;  4DEQ A;  4Y5S A;  2LW8 A;  3KWV A;  4AI9 A;  1AR6 3;  2ZJC A;  2ZX3 A;  1C8M 2;  2J1R A;  1CVN A;  1EAH 2;  1XNA A;  3ZFG B;  1BZW A;  3LKJ A;  1DF0 A;  3SNM A;  5HV4 A;  4K6B A;  1RMU 2;  3VZM A;  1VP6 A;  4XTP A;  2I74 A;  2VY0 A;  3POS A;  4L97 A;  3RS6 A;  5CG9 A;  2PHL A;  2VUC A;  5FY7 A;  2QQW A;  4CUC A;  3LPG A;  5BXX A;  4DTX A;  2HWD 1;  1YYN A;  4NPM A;  4MGK E;  5GZE A;  2QQI A;  3G6J B;  3MIC A;  4D7Y A;  1ULP A;  2E26 A;  2RDN A;  1RL3 A;  5FYV A;  2W68 A;  3KT7 A;  5L9B A;  3DL3 A;  4A42 A;  3IDA A;  2F4P A;  4I3P A;  2V4A A;  4XUP A;  5FOJ B;  1W3V A;  1MEC 1;  2XPJ A;  2AAC A;  2ZZQ A;  5EJZ B;  1KEX A;  1G9A A;  4PF5 A;  5I8S A;  4AKG A;  2IFW A;  1PO2 2;  2KXL A;  2JH8 A;  4FK0 A;  5I0T A;  4XAE A;  2PHU A;  5E88 A;  5BUV A;  3V64 A;  3A22 A;  2RDR A;  4XQ4 A;  2JG8 C;  2JD4 A;  3RRD A;  1DBN A;  1W2A X;  4A6O A;  2VE1 A;  2NP0 A;  2P1M B;  1I3H A;  5EXO A;  1HJG A;  2N7G A;  2B9U A;  3WP3 A;  3A7Q A;  4M3C B;  4PDW A;  4JRL A;  3WHU A;  2BBV A;  3LOB A;  2RS3 3;  3E97 A;  4OUS A;  1NA1 B;  1JYX A;  1CZV A;  1S0F A;  4D7T A;  1C5H A;  2W47 A;  3VBO C;  1KDK A;  2DCZ A;  3WG1 A;  1O91 A;  2P6H A;  3LF7 A;  4LIV A;  1DQ6 A;  3H3U A;  1W8W A;  4CE8 A;  3N9N A;  5EV7 A;  1Q8O A;  1VAK A;  1G9B A;  1X8M A;  4IV1 A;  3ZSL A;  1RVF 3;  4IEU A;  1GZW B;  4I0A A;  5KXE A;  3HN1 A;  1WCD J;  1QJE A;  3U11 A;  4LIT A;  5JMO A;  2A7A A;  1GOH A;  4PQQ A;  4A7Z A;  3L0M A;  1N47 A;  3I54 A;  2XGX A;  4FXG B;  1DGR A;  4Q4V 3;  4QX0 A;  5FZH A;  4EWA A;  2GP3 A;  1OLR A;  3ZIX A;  3DCQ A;  1LGB A;  2AGS A;  2VUL A;  1DZQ A;  1QY4 A;  2XJT A;  1ALY A;  4FJX A;  2OVQ B;  2A71 A;  2RDS A;  4Y20 B;  3WF2 A;  1VJ2 A;  1IZ3 A;  2Q0A A;  2I45 A;  1JUI A;  2WIN B;  3CKH A;  4XCA A;  3W5M A;  3ZFE C;  3FUQ A;  4PLN A;  4FPE A;  3KT4 A;  4MGZ E;  5C8C B;  3D4K A;  1GQG A;  1AR7 3;  3MW2 A;  5FYM A;  4B7E A;  3ZPO A;  1JYT A;  3GYD A;  5FJH A;  5BNN A;  2P3J A;  2PHR A;  1H8T B;  1LHV A;  2VIX A;  2VCB A;  4XJ8 A;  2GH2 A;  4KHQ A;  2VC9 A;  2ZEX A;  3O1S A;  1HB4 A;  3OEA A;  4XMI A;  3ZYJ B;  3RWU A;  5IT6 A;  1VBB 1;  3JBG 1;  5A6Y A;  2Q5T A;  4Q8K A;  1W0N A;  3IBM A;  3KVA A;  1NCR B;  2DV9 A;  1XSQ A;  1UL9 A;  1YJL A;  1FI2 A;  1ULE A;  3LFI A;  4M3W A;  1JS9 A;  1SCR A;  1H4G A;  3Q8A A;  2HWF 3;  3MO4 A;  5SV5 A;  5SV8 A;  3RWN A;  4DY3 A;  5FV3 A;  3SKJ E;  2R06 1;  1LOF A;  3NDK A;  3ZN5 A;  3OBT A;  4KMQ A;  1Z7S 1;  5LA0 A;  4L2N A;  5FDB A;  3ME2 A;  4YWA A;  5FZF A;  1SQ4 A;  2AUY A;  4RYD A;  1ZBA 1;  2OVP B;  1OA2 A;  3GAL A;  1W6N A;  2P3K A;  3HNM A;  3WF1 A;  5KXD A;  1Y9Q A;  1QQP 1;  5FYT A;  1GWM A;  3T1M A;  3TNP B;  2W91 A;  2B45 X;  4P9J A;  3POF A;  4WVV A;  2W5F A;  2O14 A;  2ZAH A;  3UK9 A;  2R07 2;  3VV1 A;  4YNI A;  1QH6 A;  4AW7 A;  4BE3 A;  3HGL A;  1J1T A;  4DTP A;  1OOP B;  3CL1 A;  3HNY M;  4PIZ A;  4W8J A;  5IWF A;  2DCY A;  3D0J A;  4XVH A;  1XQN A;  2K2S A;  2WNO A;  5CFD A;  3RZZ A;  2BPA 2;  1K3I A;  3RPQ A;  2RVA A;  1PIV 1;  4B8E A;  2WR9 A;  1ODM A;  4OQ9 A;  3MBW A;  3HN3 A;  4YG6 A;  2F4L A;  1YUD A;  2AEY A;  2W1Q A;  1U5I A;  3HBZ A;  5JUV A;  3MLL A;  1LHO A;  1OFS A;  5CKM A;  1C3H A;  1NZI A;  1QXR A;  2D3S A;  3KV9 A;  3O0X A;  4CDX B;  5ACA 1;  3DUI A;  4HON A;  1S0C A;  1CD3 G;  4P9I A;  4TWT A;  3VKN A;  3AP9 A;  4AEK A;  3C6O B;  2PQQ A;  3TJY A;  4JKK A;  1JYI A;  2R30 A;  4YZ1 A;  4R52 A;  5FY1 A;  1DQ0 A;  2OQ7 A;  3MDP A;  5KXB A;  3PMS A;  4H3W A;  1S1A A;  4OMD A;  5F2W A;  3WLU A;  1AL2 1;  4MYE A;  2YC4 A;  3NJZ A;  2VVD A;  1X7N A;  4UXA A;  4WM8 C;  1A8M A;  1YI9 A;  2ARB A;  2Y60 A;  5FR3 A;  3UYJ A;  1W99 A;  1O7F A;  4MHR A;  4YAR A;  1H30 A;  1ZZ8 A;  2R04 1;  4R9B A;  2VCA A;  1VBA 3;  4P5Y A;  2E33 A;  1QDC A;  5HBA A;  4M01 A;  3B5L B;  2BU9 A;  4FFG A;  3SKV A;  3TAY A;  3AJY A;  2GND A;  3D6E A;  5FWE A;  2IXH A;  1TMF 1;  2MMB A;  2ERF A;  3H8X A;  1QIQ A;  2JIG A;  1R1A 1;  4YFZ A;  4YGD A;  3N7J A;  5FZO B;  2W95 A;  2FDJ A;  2VEC A;  4LHL A;  1UW8 A;  4FOW A;  1SAC A;  4FPK A;  4YW5 A;  1XMG E;  3OGG A;  3OGS A;  4ASK A;  1AXZ A;  2OYQ A;  4IE0 A;  4A3Z A;  4FJG A;  5DN2 A;  4XBQ A;  1PVC 2;  3ZSE A;  2P1Q B;  4NIH A;  3NW4 A;  1QXJ A;  1MPX A;  4BJ0 A;  1KFU L;  2VZV A;  3LSD A;  5FBZ A;  5D21 A;  5JIA A;  3CDZ B;  1FZ4 E;  5FMB A;  1MS9 A;  3I2F A;  3PME A;  3B94 A;  5FMC A;  1OKO A;  2IXI A;  1NQJ A;  5D8A B;  1KJR A;  1H9P A;  2ZAB A;  3PJQ A;  4KH9 A;  2AR6 A;  4K7J A;  4AHW A;  1R08 2;  1HN0 A;  1C8M 3;  1FYU A;  1PK6 A;  1EAH 3;  1LES A;  1XU5 E;  4KG0 A;  4MGS A;  5K7P A;  4PDW C;  1UYX A;  1HRI 2;  3KCC A;  3PUS A;  4FJ5 A;  4B1L A;  4CP1 A;  1S55 A;  3HPN A;  3KGL A;  5T5O A;  2GAU A;  2BGC A;  1F31 A;  2XB6 C;  2ZMK A;  5CYY A;  1JU3 A;  2GZW A;  5A1A A;  2P17 A;  2KR2 A;  3TOJ A;  4IV1 C;  5IK4 A;  3HBK A;  1Q8Q A;  3BPZ A;  4GH4 A;  5FZG A;  1F5J A;  4G9S B;  4QKD A;  1F4H A;  2ORZ A;  3LEG A;  2P3Y A;  5H37 A;  4RD7 A;  2UUR A;  4DTS A;  1CLQ A;  2CAV A;  1AX0 A;  2VZP A;  4I0W B;  4XDQ A;  5AC9 3;  1FOD 2;  2BGO A;  2GMM A;  3FBM A;  4ZU4 A;  3OPZ A;  2CYF A;  2DVF A;  1YXW A;  4KWJ A;  4IEV A;  1RUF 1;  2VW1 A;  5L7O A;  3BVO A;  1WLD A;  1GUI A;  2XLA A;  4Q0U A;  5FLJ A;  4AVT A;  1CAW A;  2AYH A;  3UO2 A;  1VRH 2;  1O3R A;  4LIU A;  1CPM A;  1V6O A;  4KI4 A;  1ENS A;  1VBC 2;  5C4W A;  5A7P A;  5A32 A;  2PHD A;  4CDQ C;  1XVE E;  5EPA A;  4BK5 A;  2Y64 A;  1JU4 A;  2W0X A;  2ZX1 A;  1ZM1 A;  4GAM C;  4RA0 A;  3O7O A;  1D4M 3;  5E8A A;  2B46 X;  1I6X A;  4UW5 A;  4E4B A;  1JI6 A;  2W1U A;  3WXP A;  5I8T A;  3B93 A;  5BNN C;  1U12 A;  1Q9X A;  3ZXL A;  3JU9 A;  3VKL A;  4D3W A;  3WDW A;  1Z0H A;  5FPB A;  2J7M A;  2O1Q A;  1PO1 2;  2AZ5 A;  2J22 A;  4RGK A;  4N53 A;  1XVB E;  1BEV 1;  1S0E A;  3I59 A;  2VOK A;  5JR7 B;  1JZ8 A;  1ZRC A;  1QNW A;  2XG3 A;  3AL5 A;  4XHB A;  1LOF C;  4JRQ A;  2EID A;  3WQB A;  5DMY A;  1M4W A;  1STM A;  2WT2 A;  2DF7 A;  4LOR A;  3E6C C;  3RZL A;  5JPM B;  2JIJ A;  4AFC A;  1A78 A;  2G9F A;  1H1A A;  2H4T A;  5LEJ A;  1TQ5 A;  2SLI A;  4M42 A;  2PLV 2;  4D69 A;  4Q4W 2;  4H7L A;  4B7K A;  5DXD A;  1S0J A;  2D40 A;  2RMU 3;  4Y3O A;  5G05 L;  4K20 A;  3HD8 B;  1AX1 A;  1RB8 G;  1BMV 2;  3GF6 A;  1OQ1 A;  3ECQ A;  5FZ0 A;  5JSR A;  1LOE A;  4YW7 A;  3V0A B;  3SPZ A;  3AK0 A;  4PJY A;  2PN5 A;  4LTA A;  3LIG A;  1Y7B A;  2C1F A;  4M4R A;  2V09 A;  1VAV A;  3PU8 A;  1U5Z A;  2XQR A;  4XJW A;  5CFD C;  3I7D A;  1FNY A;  4DEV A;  4KU8 A;  4NII A;  5ANQ A;  4AF9 A;  2WA3 A;  3AB0 A;  4FQ4 A;  3CMG A;  5GLW A;  2AEZ A;  5FZ7 A;  1ULO A;  3C7F A;  4RR3 B;  4C0B A;  1SLB A;  1B09 A;  1NX9 A;  3BIW E;  3OCP A;  3H8O A;  4RN5 A;  2WJS A;  1MR5 A;  4HET A;  1U0A A;  1QOO A;  1ZRR A;  5A6Z A;  2WWS A;  2KM2 A;  4QND A;  2HD0 A;  4GZ9 A;  4IGQ A;  2ET7 A;  2VNV A;  1XND A;  1LCL A;  1NE4 A;  2WQZ C;  2BVB A;  4PLM A;  4WM8 B;  4CVU A;  4DUX A;  1OUS A;  1OSG A;  2Z2S B;  5JSP A;  2UY8 A;  2ZEY A;  3Q8C A;  5AVA A;  1FMD 3;  1N3O A;  3CLP A;  5D1I A;  4UBH A;  5FRA A;  4AE2 A;  1SEF A;  1O5L A;  2R07 3;  1FZ9 E;  2CGN A;  4E2Q A;  1UCX A;  2VOV A;  3K4Z A;  2F6B A;  1UO9 A;  2OII A;  4JDM A;  4XF3 A;  4DUV A;  5IK5 A;  3EO6 A;  4UFM A;  4EN7 B;  2E7Q A;  3CJI A;  3SUP A;  1WLW A;  5IFP A;  3MFA A;  1LR5 A;  4BME A;  2A6X A;  3IWZ A;  1XSR A;  3ES4 A;  1JZ5 A;  1C4R A;  4N7I A;  3RZK A;  1K42 A;  1W6P A;  5GLU A;  1WW6 A;  2WO3 A;  1BK0 A;  2XOM A;  2D6P A;  4NRP A;  4PI2 A;  5F3C A;  5J1X A;  3C2U A;  4QPI A;  2NLR A;  3KV6 A;  4AK3 A;  2VZO A;  1SLC A;  4MOA A;  3ZKY A;  3SI6 A;  5F8P A;  2D6O X;  3GNE A;  2WWU A;  1L7Q A;  3MIE A;  3L2H A;  4Q4Y 2;  3IKW A;  1NUK A;  1ZZ6 A;  3POW A;  4XFH A;  3ENR A;  4AVV A;  4P5H A;  4DTN A;  3GM8 A;  5FZL A;  3AFG A;  2EXK A;  1K5M A;  1VR3 A;  4OI4 A;  1DP0 A;  4QT6 A;  5FXZ A;  5KHH A;  5CG8 A;  4RL7 A;  2C0Z A;  3HVD A;  2W94 A;  3CQO A;  1V6M A;  3J8F 2;  4BMB A;  3RWK X;  1EPZ A;  4I0B A;  2LTN A;  4DPN A;  2CNA A;  1V9U 2;  2X05 A;  4NOT A;  3NO8 A;  2H0V A;  3ZSM A;  4XIL A;  2GC2 A;  3LGR A;  4IEO A;  4E4Z A;  1RUJ 2;  2PA7 A;  4KHW A;  4X8P A;  3GGL A;  4QQ2 A;  1RUC 2;  4PDW B;  1POV 0;  2WT1 A;  2E9Q A;  4ADO A;  1NEX B;  1J58 A;  1MVE A;  1PK6 C;  3ILR A;  2P1P B;  3CNA A;  3DPR A;  3E5X A;  3NRU A;  3JUU A;  4K21 A;  2XON A;  4NJ4 A;  4N7U A;  1UWW A;  3CQ8 A;  1LKN A;  1EP0 A;  3CFO A;  1HV1 A;  1UZZ A;  2YU2 A;  4Y1Z A;  5DUU A;  1RIN A;  4IV1 B;  3W21 A;  4BM8 A;  2RKH A;  3WQ0 A;  5JCT A;  3H3L A;  3I2J A;  2K5S A;  3QER A;  2TEP A;  1PNG A;  3AKP A;  1FZ8 E;  3KT1 A;  5GAL A;  2QDR A;  1CZS A;  2XVK A;  2Q8O A;  3RMB A;  4FVV A;  5A3U A;  2GN3 A;  3KHC A;  3VL9 A;  5F37 A;  3CFP A;  3C8X A;  1EV1 2;  2NZ9 A;  4JRP A;  4AHX A;  4GH4 C;  1RHI 2;  2BFU L;  1YRZ A;  3I2G A;  4K9S A;  1XNC A;  3M3I A;  3VBH A;  1UU6 A;  1ODN A;  2VCM A;  3RZJ A;  1P8J A;  2HWD 3;  3T2T A;  5FO9 B;  1J84 A;  4YZ4 A;  2XQX A;  4WZC A;  4I02 A;  3I3M A;  1BYH A;  2VZU A;  3B02 A;  1XE7 A;  2YB5 A;  1NXM A;  5FY4 A;  3I49 A;  2VQ0 A;  1G7Y A;  4L11 A;  4NWW A;  2A6V A;  1MEC 3;  4C8D A;  4CCJ A;  1ENQ A;  4HFS A;  1MHZ G;  5ABJ C;  4U2A A;  1GP6 A;  3BGA A;  1RUE 1;  4V2V A;  1XE8 A;  1AR6 2;  4FSJ A;  4NWV A;  4QKB A;  3TN9 2;  2ZMN A;  5BNN B;  5C4W C;  1HRI 3;  2VL4 A;  2OPK A;  2QCS B;  3AMH A;  4GAL A;  2LRO A;  3KF5 A;  3DGT A;  2WAA A;  3LA7 A;  1P22 A;  1W8T A;  4AAX A;  4KHU A;  2QE3 A;  3MID A;  1IG0 A;  1MAC A;  4CCD A;  2YHJ A;  5FLI A;  2DUQ A;  1CES A;  4XUN A;  4OI2 A;  1MVQ A;  2P5G A;  1DYO A;  1RUH 1;  2MW2 A;  1UYY A;  1TG7 A;  1YFX A;  3SQ4 A;  5FK7 A;  2WSV A;  1RED A;  3KD5 E;  3K3N A;  5JWP A;  1QF3 A;  1W04 A;  3E5Q A;  1IH7 A;  4N53 C;  3HJR A;  5LBE A;  2WO7 A;  2ZHL A;  1ZX5 A;  3AFK A;  5GLV A;  3UET A;  2VW0 A;  1E57 A;  4CDW B;  2WYF A;  1W6N B;  4I01 A;  2EA7 A;  2IWG B;  3OGM B;  1HB3 A;  1CX4 A;  1UY2 A;  4S2F A;  5F5C A;  4GMP 0;  5EJ3 A;  4MXV A;  4CCM A;  3DYM A;  3V7D B;  2CU5 A;  3OGR A;  4MET A;  2Y6K A;  3J7N A;  4LO7 A;  1OF3 A;  2RS3 2;  4M3Z A;  2D6N A;  1N1C A;  5DDJ 2;  2GC0 A;  3I3Q A;  2G1M A;  1IS5 A;  5BV6 A;  3N1E A;  1ENR A;  4N90 A;  5T5L A;  2QQL A;  4ARX A;  1ST8 A;  5CFD B;  2R6Q A;  4JDN A;  1UY0 A;  4LBQ A;  1R09 1;  1YJK A;  4WV8 A;  5CZK A;  3ZPY A;  2RS1 1;  2IFR A;  1LOD A;  1RMU 1;  3M3O A;  4QB2 A;  3F95 A;  3U4X A;  2D98 A;  1XVF E;  2VVE A;  2BWC A;  3I2H A;  2FW3 A;  3U4S A;  2I07 B;  3C3V A;  2BYV E;  1ULF A;  4MZU A;  4Q4V 2;  4DQA A;  3KF3 A;  1VBB 3;  3JBG 3;  4AAP A;  1QOT A;  2FD8 A;  5FIX A;  2DUP A;  4Q4X 2;  1PGS A;  2MEV 2;  4FPF A;  4XHX A;  4ASL A;  1DQ4 A;  4LBO A;  2FZ2 A;  3NNF A;  1OKQ A;  5FK8 A;  5IW0 A;  2JEC A;  2PLV 3;  1ASJ 1;  1GIC A;  3UKT A;  3K48 A;  4I3G A;  2LS6 A;  2R06 3;  3B7M A;  3J7H A;  3SQO A;  4QKN A;  5FYS A;  1AR7 2;  1Z7S 3;  2GSY A;  2J42 A;  2XJP A;  3B3Q E;  4AQ2 A;  4UFI A;  2V5Y A;  4IEX A;  1AXY A;  1WMX A;  1LTE A;  2DUR A;  3III A;  1ZBA 3;  3R0R A;  2VG9 A;  2WQ8 A;  3QNN A;  4Z2A A;  1AVB A;  3FZ3 A;  5DZF A;  1QQP 3;  4ORF A;  1TME 1;  2D7F A;  2VZT A;  4HPK A;  3CJI C;  4FPO B;  4LO4 B;  5KHK A;  3FX3 A;  4EYW A;  4IER A;  4P9Y A;  3SH5 A;  2P1N B;  3PUH A;  4EN6 B;  3ZSK A;  4HK9 A;  3LZZ A;  5BNQ A;  4Q1R A;  4XIK A;  3SH3 A;  3VB9 A;  4NPL A;  3FLT A;  1GP5 A;  3LFM A;  1WAF A;  2B8I A;  3APB A;  4QPI C;  1MQT A;  3POG A;  4KI5 M;  1MZF A;  2ZX4 A;  3H9A A;  5T5J A;  1GWK A;  5JI7 A;  3VD5 A;  2FHR A;  4ES8 A;  3VZK A;  1PIV 3;  1V6J A;  2Y6G A;  5CU1 A;  2B5H A;  4P00 B;  4WM7 B;  5FPL A;  1EPW A;  3BVC A;  4LPL A;  4BH9 A;  2PQS A;  1QJU 1;  2Y33 A;  3OF1 A;  1W2O A;  2J1U A;  3MEP A;  1I5Z A;  5ANN A;  1W6M A;  1KXG A;  5FWJ A;  1RTV A;  5KC6 A;  2IXL A;  4S2D A;  5ACA 3;  2FCU A;  1K5M C;  1NOV A;  1SLT A;  4FFF A;  1KGY A;  1S2E A;  2R7E B;  4RFT 0;  1SHW B;  1IS6 A;  3T1L A;  3INA A;  4ZU7 A;  4O65 A;  2P3I A;  3CZU A;  3NST A;  4Y33 A;  2WZR 2;  3IMN A;  1PGW 2;  4M0N A;  4PT6 A;  1PK6 B;  3OGK B;  2O0O A;  2OZS A;  2ZGP A;  4IV3 B;  4K1Z A;  2WFF 1;  4HN0 A;  3NAP A;  1NE6 A;  2OKX A;  1LOC A;  1YO8 A;  2Q1M A;  1NKG A;  5C8W A;  5IFT A;  2R04 3;  1RUD 2;  3H42 B;  2WRA A;  3MZH A;  1XU3 E;  3DPR C;  4HKW A;  4Z8B A;  4Q4Y 3;  1GBG A;  4LOT A;  4Y26 A;  4XFG A;  3WDT A;  3I2K A;  4JC1 A;  2A73 B;  1AJK A;  3ON7 A;  2HWB 1;  2B7Y A;  3ITQ A;  4IEW A;  3K2O A;  2QQV A;  4GH4 B;  4AL9 A;  1H6X A;  1IHM A;  4EJR A;  4W50 A;  5A7Q A;  3TAF A;  1O4Y A;  1R1A 3;  4FAG A;  3MFC A;  2P1O B;  3RVH A;  1SFN A;  1U5Y A;  4CP9 A;  1GLH A;  4QX1 A;  4COV A;  1LOA A;  3TYJ A;  1QJY 1;  1C1L A;  4AEM A;  4ZZ8 A;  3CO2 A;  2V73 A;  2JDP A;  3AP4 A;  3BN6 A;  5CKQ A;  5EWS A;  3ZR5 A;  2J1S A;  3NJY A;  1G9C A;  3AZZ A;  3VBH C;  4HXC A;  1LOG A;  5L7O B;  4MUV A;  4UWD A;  1VBA 2;  4B08 A;  4YM1 A;  4CEY A;  1JYV A;  1RUG 1;  2ARC A;  3Q8E A;  1NLQ A;  1RUJ 3;  1CIY A;  4GMP 1;  4DY5 A;  5A32 B;  1UKR A;  4BXS V;  4X5M A;  3AJZ A;  1PZ8 A;  2VZQ A;  1W39 A;  1JW6 A;  1WMF A;  2ID4 A;  3ABZ A;  4C1X A;  5C70 A;  1AR9 1;  5HCH A;  1COV 1;  2GC1 A;  3IAQ A;  1GU3 A;  1WCS A;  3VUO A;  2W9X A;  3MIB A;  3KD4 A;  3VDC A;  3NJV A;  5FO8 B;  5GJ6 A;  1E5R A;  2VQT A;  5AVP A;  3O1M A;  2ILM A;  3FE5 A;  3O1V A;  3N35 A;  2Z79 A;  1AHS A;  4DU4 A;  3ZXF A;  4XTM A;  1O6U A;  1BCX A;  2WZP P;  3R4D B;  4N53 B;  2X29 A;  5I0U A;  1LUL A;  2XUE A;  2FDH A;  2JPN A;  1GOG A;  2E31 A;  1EV1 3;  4FOY A;  3T3Y A;  2K9Z A;  2AEN A;  4XQW A;  3C7O A;  3N9O A;  4JGY B;  3PVN A;  1CQ9 A;  2TUN A;  1HQW A;  1SLL A;  4MV2 A;  2R0F A;  4EP9 A;  5JXI A;  4UOJ A;  1HXS 1;  2VMG A;  3EBR A;  3A23 A;  2IUW A;  4QQH A;  2ZTN A;  3KM5 A;  1G9D A;  4PBP A;  2R49 A;  4XUR A;  1UX6 A;  1CJP A;  3TN9 3;  1OC1 A;  5HI0 A;  4C0H A;  3V0B B;  5CVR A;  1FPN 2;  2YYO A;  1W9Y A;  2D93 A;  4HKL A;  1XYP A;  2VNR A;  1C5I A;  1RC6 A;  2B8M A;  1WD3 A;  4OUE A;  4QPY A;  4HG6 B;  2D5H A;  2DEB A;  5FUI A;  2Y6L A;  2RS5 1;  3VBF A;  4XW3 A;  2D6M A;  2VVF A;  3C6N B;  3WCR A;  1JZ6 A;  2C5D A;  3RI8 A;  3K77 A;  1D0G A;  1J3Q A;  4XAB A;  4FVM A;  3E6B A;  4PLO A;  1IGO A;  3ZMO A;  2A75 A;  4NRQ A;  3RQ0 A;  5AC9 2;  4QU1 A;  3ST7 A;  2TNF A;  1BK1 A;  3KV4 A;  3ACH A;  4LO5 B;  3VZN A;  2WN2 A;  2KA3 A;  2PXJ A;  4I09 A;  2CTV A;  2HBU A;  3O0W A;  2Y6F A;  3OUI A;  1UOB A;  4PCR A;  1N1S A;  2YBS A;  3ZXD A;  2FCV A;  3S7I A;  2GNM A;  1UF2 C;  2RM2 1;  4K1Y A;  1UMZ A;  3EHK A;  5E89 A;  5DDJ 3;  5BY5 A;  3HOB A;  4CCL A;  5JXG A;  1FZ1 E;  1D4M 2;  5FZ6 A;  4QHO A;  5FFO C;  1MS1 A;  1UOJ A;  3MHZ A;  5C9A A;  3CJI B;  2JDK A;  3POJ A;  1FZ5 E;  4XZP A;  2R1D A;  4XJU A;  3VD7 A;  1HIX A;  2Y26 A;  4X6R B;  3ZX7 A;  5LBC A;  3NAE A;  1GQH A;  1FZ2 E;  1W6P B;  2LAL A;  1CX1 A;  4E27 A;  4KU7 A;  2ZBJ A;  2E51 A;  5FRE A;  4B29 A;  4QPI B;  1GR3 A;  3J7L A;  1AR8 1;  4FBF A;  3NNL A;  2WAO A;  1WME A;  1TEI A;  2VBD A;  4EZ4 A;  1FX5 A;  2WT0 A;  3MIG A;  4M45 A;  2RV9 A;  3LCP A;  5F1R A;  2VUA A;  1MQT C;  5FMD A;  4Q4X 3;  2PTM A;  1JZ7 A;  2MEV 3;  4OQ8 A;  1BQP A;  2JE7 A;  2OYZ A;  3VDA A;  4DXR A;  2ZHN A;  5EZW A;  1AZD A;  4TLG A;  3NJX A;  2RMU 2;  1UU4 A;  1MHY G;  2VMD A;  3VDD A;  5C3S A;  3SVI A;  4YVW A;  4D0Q A;  4GJY A;  4Q5O A;  3BTX A;  4EV0 A;  3D8C A;  4D7S A;  4DXZ A;  1AYM 1;  5T54 A;  2FMD A;  2QQM A;  3K4A A;  3P1I A;  1VBC 1;  5CIR A;  3IT8 A;  3HT1 A;  5F3E A;  2VME A;  2A3W A;  3QLQ A;  4XF0 A;  4FJ9 A;  1UD1 A;  3WG2 A;  1IS3 A;  4XE9 A;  1C28 A;  2OPW A;  1TZO A;  4LUM A;  2WA4 A;  1XXN A;  2VPV A;  4WVM A;  4XJ9 A;  2ZGM A;  4XDO A;  1YI7 A;  1O4Z A;  1UU5 A;  3KHB A;  3BOD A;  3NAP C;  2EXJ A;  3LDB A;  3L8B A;  2XUM A;  1G8W A;  4XFC A;  2RE9 A;  3LOI A;  4JAA A;  1OLM A;  4KGG A;  5LA1 A;  1QWR A;  1VE0 A;  1X9P A;  4Z82 A;  4P9L A;  2JHC A;  1S2B A;  3IPV A;  1BBT 1;  2VOW A;  2QZ3 A;  4W6Y A;  4LJH A;  4IET A;  3J7M A;  3O14 A;  4LT5 A;  4E2G A;  3VBH B;  1GOF A;  4OHX A;  4TXW A;  3PHM A;  1FMD 2;  4QM9 A;  4COY A;  3H7J A;  2KD7 A;  3B69 A;  4AI1 A;  5LY1 A;  1UZY A;  4RHV 2;  1D2Q A;  1MS0 A;  4CDU C;  3BTZ A;  4RQP A;  5JSO A;  2V4V A;  2C4X A;  3RSJ A;  4CUA A;  3OYW B;  2WZR 3;  3W58 A;  3WNM A;  4CEY C;  3GZE A;  3JD7 1;  3FN9 A;  1JZ3 A;  3D3A A;  1IOA A;  3HWJ A;  2ZHK A;  2L9L A;  2YY1 A;  5K0U C;  1IQD C;  3H8R A;  4ISR A;  4BQ5 A;  5EYX A;  3V56 A;  4Y4Y A;  3UT0 A;  5EFU A;  3WDX A;  3WNK A;  5J96 B;  4E4H A;  2WO2 A;  2ARA A;  2W1W A;  1RUD 3;  1WWY A;  2WQ4 A;  3LPF A;  4MXW B;  1UXZ A;  2BJS A;  5GZG A;  1VRB A;  1WW7 A;  4NRM A;  5E16 A;  3VKF C;  3WF4 A;  1REE A;  2HYK A;  4UFH A;  5J37 A;  1JMU B;  3WR0 A;  1FZ7 E;  2XLF A;  3KCX A;  3WD5 A;  1HRV 1;  2WWJ A;  3RI9 A;  3ZIW A;  4MG2 A;  5DAV A;  4CEW A;  1E5I A;  3PUI A;  4M3X A;  4FP2 A;  2VUJ A;  4UW6 A;  3THP A;  3KQ4 B;  3M2M A;  2YGM A;  3POE A;  1X33 A;  4XOG A;  2PFW A;  4I9Q A;  4YZ5 A;  2RR1 1;  3H7Y A;  4FJK A;  3WOG A;  3N7M A;  3T4V A;  3JB8 A;  4QX5 A;  3S5A A;  4NAM A;  2JDU A;  1DQ2 A;  1OLM E;  2XKO A;  2ZKL A;  4CCO A;  3OGL B;  1OH4 A;  1NZC A;  1US2 A;  2QVS B;  1W6Q A;  5DQ0 A;  5T5P A;  3RYP A;  3VKO A;  2YC0 A;  1RJ8 A;  1GWL A;  3MUY 1;  3SC7 X;  3QAC A;  1NAE A;  4RS5 A;  1R64 A;  2VAU A;  3MV0 1;  1CAX B;  4XXA A;  4LBQ B;  3OOX A;  1SFY A;  3WZ1 A;  4JX0 A;  4LBQ D;  4ATF A;  4DB5 A;  2VNG A;  3J9S A;  5JOX A;  4M4P A;  1ZRD A;  1DGW X;  1UX7 A;  4FOQ A;  4LQR A;  3GZA A;  1LGN A;  2PAM A;  3FFZ A;  1D2S A;  1O4T A;  2XH6 A;  3MPP G;  3VBF C;  3E4W A;  2ZS6 B;  4O7X A;  1AYN 1;  3QNO A;  2VM9 A;  1KS5 A;  1VB4 A;  2W3J A;  4XUT A;  4YVS A;  5GLT A;  2JG8 B;  3VZL A;  2J1A A;  1OQE A;  3VHN A;  3EYP A;  2HWD 2;  2RG4 A;  3NV3 A;  5D2A A;  2HEV F;  2VMI A;  3AL6 A;  3C7G A;  5F6L B;  2QTW B;  3WG3 A;  4Z07 A;  3USU B;  1A3K A;  4IE6 A;  4V1P A;  4V2W A;  5JMC A;  1DGW A;  4B1M A;  2B7M A;  1RUH 3;  1MEC 2;  3N9L A;  3WX5 A;  5FCC A;  2ATF A;  1WW5 A;  2WFP A;  3IZO A;  4PIX A;  1OHF A;  4GJZ A;  4IW3 A;  4IDZ A;  3VBO B;  2PFV A;  1IKQ A;  5C7G A;  4E8C A;  3N4M A;  1FPN 3;  1HQN A;  4MVT A;  2JB8 A;  2VMH A;  2P4E A;  1C57 A;  1VBE 1;  3WV6 A;  4W4Z A;  5H9Q A;  2ET1 A;  1D4V B;  3JB4 C;  5FYC A;  5KHI A;  4DTJ A;  1YQC A;  4QHZ A;  4HPK B;  4QMA A;  3WQ1 A;  5C9A C;  2GDF A;  5IRE A;  3LD8 A;  2IVJ A;  2JIC A;  5IYY A;  2HWE 1;  4JQT A;  5JZG A;  1BLZ A;  2V72 A;  2Z69 A;  3VBR A;  3H0O A;  3ZN4 A;  1DCS A;  1DLL A;  1MQT B;  3DV8 A;  4N8M A;  4KWU A;  2G9Z A;  4CA9 A;  4M3T A;  1UYP A;  2Z5W A;  5BYN A;  4BDV B;  4YG3 A;  3ZKU A;  1R09 3;  3QEI A;  2RS1 3;  2WL1 A;  4GKY A;  2E7T A;  3ZFE B;  5FZ3 A;  2BNN A;  1FS1 A;  5LWB A;  2EAK A;  1UAI A;  5ABJ A;  3GJA A;  1Q43 A;  3PUR A;  1W6M B;  4XFA A;  2DVG A;  2UWB A;  4LOS A;  4GQ7 A;  1IQA A;  1SPP A;  4AGV A;  2YG0 A;  4HSL A;  4LA3 A;  3I97 A;  1ZBE 3;  4DTR A;  4Q26 A;  1XOY A;  1W8F A;  2XBO 1;  1WZX A;  4J1W A;  3VDD C;  5FZ4 A;  4EN9 B;  2B1E A;  4YVW C;  5ERL A;  1V6N A;  3EB7 A;  5IBK B;  1HV0 A;  1N1V A;  4FCA A;  4ISQ A;  2A1X A;  4DTO A;  3PIJ A;  1BKZ A;  1ND2 A;  4A44 A;  5JOW A;  1ULD A;  1ULC A;  4GB3 1;  3G7D A;  3O1U A;  3GZT B;  5FYH A;  2ZCW A;  3H3Z A;  4LR4 A;  4EYU A;  3NAP B;  3TBD A;  1WBL A;  4QXK A;  1PM4 A;  2H0B A;  1PM7 A;  5EJ1 B;  4BZ4 A;  5LAS A;  1FXZ A;  1GKB A;  1Z78 A;  3A0N A;  2RJL A;  2JE9 A;  2DUO A;  4ATE A;  2P5B A;  2PHW A;  3D82 A;  5T52 A;  4JZR A;  4EN8 B;  5JXJ A;  5F2S A;  1VBB 2;  2BFU S;  3JBG 2;  1J3R A;  4AVA A;  5B4N A;  1NY7 1;  4IGP A;  2A70 A;  2X5I A;  5EQU A;  3MF9 A;  2RCU A;  3MW4 A;  3SH4 A;  4OI1 A;  3UJQ A;  3I2O A;  4XET A;  4M3C F;  3UGH A;  5KC5 A;  5DAB A;  1Y9M A;  4I6J B;  3AC0 A;  3T2O A;  2CWM A;  2R06 2;  3RFR A;  5ISL A;  5FXW A;  1Y9G A;  2JH9 A;  1CAV B;  1Z7S 2;  4YGE A;  1X9T A;  2NQY A;  1SBE A;  4QD2 A;  5FXX A;  4CEY B;  2X09 A;  4FXK B;  1ZBA 2;  1OLQ A;  2PAE A;  1GMM A;  5L73 A;  3POY A;  3ZN6 A;  3VBS A;  4QX7 A;  4RQP C;  4IE7 A;  2JDY A;  1QJU 3;  1QQP 2;  2DCT A;  3QD6 A;  3R05 A;  1PGL 1;  2ZGN A;  1RYY A;  2NMO A;  4M00 A;  4NHX A;  4LLF A;  3OSD A; 
#chains in the Genus database with same CATH homology
 3DYM A;  3V7D B;  2WZ8 A;  3OGR A;  2Y6K A;  4UI9 L;  4FJL A;  1O8P A;  1OF4 A;  1OF3 A;  1T2X A;  3L2O B;  3MKS B;  4M3Z A;  1W8N A;  1EUU A;  3N1E A;  2HYX A;  3RMA A;  2VZR A;  2QQL A;  3T0A A;  3THC A;  4ARX A;  3SUN A;  3E1F 1;  1UY0 A;  5CZK A;  3DEC A;  2VJX A;  2VCC A;  2VZ1 A;  2Y6H A;  4QB2 A;  2JDA A;  1L7R A;  4DEQ A;  2LW8 A;  3IB3 A;  1XVF E;  1W9S A;  3I2H A;  2FW3 A;  2J1R A;  1XNA A;  4MAD A;  4KHN A;  4GWJ A;  4DU3 A;  1GNY A;  3SPY A;  2VO5 A;  4A41 A;  4CUC A;  3OG2 A;  1FZI E;  2EIE A;  3LPG A;  1XMF E;  4DTX A;  3WSO A;  4L0P A;  4JS5 A;  2QQI A;  4RNG A;  1ULP A;  2E26 A;  3T0D A;  3HP9 A;  5HXM A;  3SQ0 A;  4A42 A;  4DTM A;  3IDA A;  4XUP A;  2LS6 A;  3J7H A;  1XC6 A;  2EIC A;  3DYP A;  5EJZ B;  1KEX A;  4QB1 A;  4AKG A;  3OB8 A;  2P5O A;  1FZ0 E;  1K45 A;  3III A;  2JH8 A;  4FK0 A;  2FYO A;  2WQ8 A;  2YB7 A;  3QNN A;  4FJ8 A;  3J27 A;  2WAB A;  4Z2A A;  3A22 A;  2JE8 A;  2VZT A;  4M3Y A;  3I3B A;  4A6O A;  4EYW A;  4M3U A;  2P1M B;  2BGP A;  2P1N B;  3PUH A;  1XNT A;  1UY4 A;  3A7Q A;  4LHS A;  1JYX A;  1WAF A;  2B8I A;  1CZV A;  3WNO A;  4XUQ A;  3SQ2 A;  1XPW A;  4KI5 M;  2W47 A;  3VD5 A;  4GWI A;  3SEE A;  2Y6G A;  4P00 B;  4CU7 A;  2B4K A;  3QET A;  4LPL A;  4XUO A;  2PQS A;  3QEW A;  2J1U A;  2WYS A;  2JKX A;  4ADN A;  5JMO A;  1GOH A;  4PQQ A;  3FHQ A;  3L0M A;  4QX0 A;  1KGY A;  2R7E B;  3NE6 A;  1SHW B;  2WZE A;  1K12 A;  5EIY B;  1FZH E;  3E4Y A;  4FJX A;  2OVQ B;  4JS4 A;  3CZU A;  3K75 B;  3WF2 A;  2J1E A;  4PT6 A;  3T2P A;  3W5M A;  3OGK B;  1WCQ A;  3CKH A;  3HEI A;  2OZS A;  3LEI A;  1O8S A;  3RMD A;  3ZM8 A;  2OKX A;  4JKL A;  1NKG A;  5IFT A;  1XU3 E;  5DPN A;  3LDS A;  2VIX A;  1FXX A;  2VCB A;  1GQP A;  4KHQ A;  2VC9 A;  2ZEX A;  4DXT A;  3OEA A;  3I2K A;  3RWU A;  3WNN A;  1PX3 A;  1W0N A;  3K2O A;  4FK2 A;  1H6X A;  3U37 A;  2VZS A;  4W50 A;  3TAF A;  3LE0 A;  1OT5 A;  3VD3 A;  4MO3 M;  2P1O B;  4M3W A;  1UY1 A;  4QX1 A;  3MO4 A;  4ZZ8 A;  3SKJ E;  3BN6 A;  3NDK A;  3WNP A;  4IUG A;  2J1S A;  4KMQ A;  5LA0 A;  3NCI A;  1WAJ A;  4B08 A;  1JYV A;  4RYD A;  3I3D A;  2OVP B;  2X10 A;  1CIY A;  3HNM A;  3WF1 A;  1F4A A;  1H6Y A;  4BXS V;  5C71 A;  2W91 A;  3ACF A;  4X5M A;  2VZQ A;  2ID4 A;  3ABZ A;  4AG4 A;  4FJI A;  2ZXQ A;  2W5F A;  5C70 A;  2YFZ A;  1UYZ A;  4HCB A;  1GU3 A;  3IAQ A;  2W9X A;  3VDC A;  3HGL A;  3NJV A;  4DTP A;  4W8J A;  3HNY M;  2VQT A;  3N1B A;  4XVH A;  4DU4 A;  1K3I A;  2RVA A;  2E32 A;  4OMC A;  2JPN A;  1GOG A;  1JHJ A;  2E31 A;  3HN3 A;  2W1Q A;  3MBW A;  1EUT A;  5JUV A;  3C7O A;  3IAP A;  2BBA A;  1XVD E;  1W8O A;  2JHP A;  2OZM A;  4EP9 A;  2JD9 A;  5JXI A;  4UOJ A;  2HLE A;  2YFU A;  3A23 A;  3C6O B;  5JR2 A;  3TJY A;  4JKK A;  4XUR A;  4OMD A;  3K4D A;  2VJ5 A;  2DCJ A;  2YC4 A;  2MZW B;  3ACI A;  1DLC A;  2WDB A;  3NHG A;  1W99 A;  4OUE A;  2VCA A;  4HG6 B;  1LNS A;  4P5Y A;  2DEB A;  3LZI A;  5FUI A;  2E33 A;  2Y6L A;  1PMH X;  3SKV A;  3C6N B;  2MMB A;  5F7U A;  1JZ6 A;  4AKI A;  3LZJ A;  3K77 A;  4FVM A;  3LQC A;  3MV1 1;  3DYO A;  2W95 A;  4CUB A;  4ZY9 A;  2Z4F A;  1XMG E;  4QPW A;  2PFT A;  1W9T A;  3ACH A;  2WN2 A;  4OYU A;  3OGS A;  3C7H A;  2OYQ A;  4A3Z A;  2OVR B;  4FJG A;  3C95 A;  5DN2 A;  4BK4 A;  2V5D A;  2P1Q B;  3HOB A;  5JXG A;  1FZ1 E;  2VMC A;  5IJR A;  1MPX A;  4BJ0 A;  2VZV A;  3CDZ B;  1FZ4 E;  1FZ5 E;  1W9W A;  3VD7 A;  3I2F A;  3NAE A;  4QDR A;  1FZ2 E;  2VQU A;  5HPO A;  4HCC A;  4QNC A;  1CX1 A;  2LF3 A;  1SG3 A;  4J2B A;  3QEX A;  3SCX A;  2WAO A;  3TAG A;  1UY3 A;  4E8D A;  2QQJ A;  1XU5 E;  3CIH A;  3QEV A;  4MGS A;  1UYX A;  4M45 A;  2RV9 A;  4QX2 A;  4FJ5 A;  5G04 L;  4KHY A;  4JHZ A;  2DCK A;  3HPN A;  1OD3 A;  2J1T A;  1JZ7 A;  3VDA A;  4DXR A;  4QB6 A;  5CYY A;  2VTF A;  3T0B A;  3KD1 E;  1JU3 A;  3NJX A;  5A1A A;  4XZU G;  4KHS A;  4J2E A;  3I3E A;  1MHY G;  2VMD A;  3SVI A;  3C6P B;  1F4H A;  2ORZ A;  3LEG A;  4FI9 A;  4D0Q A;  5H37 A;  2WBK A;  4DTS A;  1CLQ A;  1I5P A;  2QQO A;  2RJ2 A;  3UES A;  2VZP A;  3K4A A;  2QQM A;  3P1I A;  5I0D A;  1HN1 A;  5B4X A;  2BGO A;  4MGQ A;  2VME A;  4UAP A;  3W5N A;  3S9H A;  4FJ9 A;  1GUI A;  2WN3 A;  1Q9Y A;  2VZ3 A;  4KI4 A;  2LF6 A;  3C94 A;  2QXF A;  1XVE E;  3LDB A;  3L8B A;  1J83 A;  2Y64 A;  4BK5 A;  1JU4 A;  5IHR A;  4GAM C;  3HL8 A;  1UMI A;  1IG9 A;  5LA1 A;  4E4B A;  1JI6 A;  2W1U A;  3P6B A;  2JHC A;  1Q9X A;  1XVG E;  2XHN A;  1JZ4 A;  4RG8 A;  3GDB A;  2J7M A;  4P08 A;  1UZ0 A;  2J22 A;  3ACG A;  1XVB E;  4FJM A;  4DU1 A;  1GOF A;  4TXW A;  1JZ8 A;  4FJH A;  2KD7 A;  2Y6J A;  3I2I A;  2EID A;  4JRQ A;  5DMY A;  2CDP A;  2V4V A;  2C4X A;  4CUA A;  4J2D A;  2QBX A;  4CU6 A;  3WNM A;  1JZ3 A;  3FN9 A;  2BER A;  2H4T A;  3D3A A;  4M42 A;  2L9L A;  1IQD C;  5G05 L;  3WNK A;  2WO2 A;  2W1W A;  2ZEZ A;  3LPF A;  3ECQ A;  1UXZ A;  3HNB M;  3WF4 A;  3SQ1 A;  3SPZ A;  1WKY A;  1FZ7 E;  3L1N A;  3A21 A;  4M4R A;  3PUI A;  1O59 A;  4M3X A;  4DUW A;  3CFR A;  2W1S A;  3VD9 A;  3MUZ 1;  4FK4 A;  4DEV A;  2VOT A;  4DXS A;  3VDB A;  4I9Q A;  3CMG A;  3OBA A;  3F2Z A;  4FJK A;  1ULO A;  3T2Q A;  3C7F A;  3SNN A;  1TVG A;  2C9K A;  1NX9 A;  3ETP A;  3T09 A;  4RN5 A;  1FZ6 E;  2ZEW A;  4LKS A;  2W46 A;  3NNG A;  3OGL B;  1UMH A;  4QND A;  2HD0 A;  1OH4 A;  4GZ9 A;  4QDS A;  4E3S A;  1PMJ X;  1US2 A;  5DQ0 A;  4DUX A;  2ATQ A;  4CVU A;  2BZD A;  3MUY 1;  4M3R A;  1NAE A;  3K46 A;  3J2P A;  2Y8K A;  2ZEY A;  4QAW A;  1R64 A;  3MV0 1;  2DY4 A;  4J2A A;  3SUO A;  1JZ2 A;  2B9V A;  1FZ9 E;  4JX0 A;  3K4Z A;  4DUV A;  3SJJ A;  4M4P A;  3TL8 B;  4CU9 A;  1UX7 A;  3SUP A;  2DTU A;  4D8M A;  4LQR A;  5IFP A;  2C26 A;  1JZ5 A;  3SEP A;  4ZZ5 A;  1K42 A;  4M41 A;  3E4W A;  2ORX A;  1MMO G;  2EIB A;  2WO3 A;  4CU8 A;  2XOM A;  4P02 B;  3QNO A;  2VM9 A;  3GXU A;  3TAE A;  2W3J A;  4XUT A;  5J1X A;  2WO1 A;  2J1V A;  2J1A A;  3EYP A;  4YPJ A;  2VZO A;  4MOA A;  4OZO A;  3SI6 A;  3UNP A;  3C7G A;  1L7Q A;  1MTY G;  1NUK A;  3FL7 A;  2JHA A;  2B7M A;  3JXS A;  4DTN A;  4AI6 A;  3GM8 A;  4FJJ A;  4TTG A;  5C7G A;  2PFV A;  4FJ7 A;  4E8C A;  3WF3 A;  1DP0 A;  3C7E A;  2W94 A;  3CQO A;  4QX3 A;  4W4Z A;  2VMF A;  4FJN A;  4DTJ A;  2X05 A;  4KI6 A;  3OGV A;  5IRE A;  3WF0 A;  3LD8 A;  5JXH A;  5IYY A;  4KHW A;  3GGL A;  4A45 A;  3LEK A;  2V72 A;  2WUH A;  1LDK E;  4ADO A;  3VD4 A;  3HGK E;  1NEX B;  4KWU A;  3QES A;  4M3T A;  1CZT A;  2DDU A;  4BDV B;  2P1P B;  2YC2 A;  3NRU A;  3SUQ A;  3QEI A;  2XON A;  1UWW A;  3CQ8 A;  1FS1 A;  3CFO A;  3I2J A;  1FYZ E;  3QER A;  3OEB A;  1D7P M;  1FZ8 E;  1JYN A;  1CZS A;  3RMB A;  2YG0 A;  4ARY A;  1XVC E;  3I97 A;  1XMH E;  3CFP A;  3C8X A;  3NQH A;  5IZ7 A;  3WNL A;  4RL5 A;  4JRP A;  4DTR A;  4DTU A;  4X5N A;  3RMC A;  3I2G A;  2B1E A;  1UXX X;  3EB7 A;  5IBK B;  1P8J A;  3WQB A;  1J84 A;  4A44 A;  4DTO A;  2XQX A;  2VZU A;  2YB5 A;  4ZXE A;  3TAB A;  3CZJ A;  2QQK A;  3NGI A;  2QQN A;  3THD A;  1MHZ G;  5LA2 A;  5EJ1 B;  3BGA A;  4PF1 A;  1JYW A;  4JKM A;  4QDQ A;  3WEZ A;  5JXJ A;  1SDD B;  2VL4 A;  5LCW L;  5B4N A;  2WAA A;  1P22 A;  2RCU A;  4AAX A;  4KHU A;  1US3 A;  4ET7 A;  4XUN A;  3QEP A;  3T08 A;  4I6J B;  2P5G A;  1DYO A;  1PX4 A;  2W87 A;  1UYY A;  1TG7 A;  3SQ4 A;  4AKH A;  3AC0 A;  3T2O A;  3KD5 E;  3UIQ A;  2JH9 A;  1IH7 A;  2VR4 A;  4I9L A;  1BHG A;  3HJR A;  1XL3 C;  2X09 A;  3UET A;  2VJ4 A;  1GMM A;  4A4A A;  2W92 A;  4EPH A;  1YQ2 A;  3OGM B;  3FHA A;  1FZ3 E;  1UY2 A;  1RYY A;  2CDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...