2E32A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
240
Chain Sequence
b'EYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 57
structure length 240
sequence length 249
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00646 F-box F-box domain
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2e32A01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e32A02
2ID4A 1L7QA 3MV01 2ORZA 3C7GA 2WABA 5DQ0A 3WQBA 4UAPA 3DYOA 2C26A 4D8MA 2ORXA 2ZXQA 4PQQA 3DECA 2RJ2A 2VCBA 5F7UA 2VZOA 1WCQA 2JDAA 4ARXA 2DDUA 2YG0A 1F4AA 3WF1A 4CU9A 3VDBA 3T0BA 2L9LA 3I97A 4W8JA 1W99A 1PMHX 2ZEZA 4QB1A 2Y8KA 4CUCA 1MPXA 2W1SA 2VQUA 4TTGA 3FHAA 2W1UA 5JUVA 3A21A 4UOJA 1GUIA 1W8OA 4YPJA 3I3DA 3NJXA 1OH4A 1JZ3A 1NX9A 2W5FA 2CDPA 2J1TA 1CZVA 1NUKA 3GGLA 1PX3A 2QQOA 3WF0A 3VD4A 3C7HA 3HJRA 3T0AA 2ZEYA 3IB3A 1ULPA 4A3ZA 4BJ0A 5HPOA 3OGLB 5IBKB 1PMJX 3VD3A 3WSOA 2QQJA 3T09A 3W5MA 2W3JA 4XUOA 1UY0A 2WO2A 3CIHA 2VMCA 4GZ9A 2VMDA 2J7MA 2R7EB 5IHRA 2YC4A 3L2OB 4W4ZA 1EUUA 2WZ8A 2QQLA 3AC0A 3K4ZA 3MUZ1 3SKJE 3T08A 2JE8A 2X09A 4P08A 1GOHA 3EB7A 3FN9A 3FL7A 3PUIA 1EUTA 2WO1A 3HNYM 3OGMB 4QDQA 3K46A 2W95A 5A1AA 3K75B 1H6YA 3I2HA 2VC9A 2X05A 2EIEA 2J1AA 2VZ1A 3VD5A 3WNKA 4DXRA 4E8DA 3I3BA 1J84A 3LE0A 3DYPA 3F2ZA 3GM8A 5G05L 5LA2A 2XHNA 3P1IA 1GQPA 3DYMA 1DYOA 1DP0A 1JZ2A 4CUAA 4QX0A 2YC2A 5B4XA 2W1WA 2P1QB 3VD9A 1K3IA 2BGOA 3GXUA 5IFTA 3UESA 2P1MB 2ZEWA 1JZ8A 1K42A 2VZRA 3T2QA 3ZM8A 1P22A 4P02B 3OGKB 4LHSA 4OMCA 2DCJA 3OGSA 2C4XA 5C70A 3UETA 1GOFA 3OEAA 5G04L 1O59A 1UY3A 2ZEXA 1OF3A 1GU3A 3J7HA 3I2FA 4A44A 2C9KA 1IQDC 4I6JB 3SEPA 3LPFA 2W91A 4QX3A 4MO3M 2P1OB 2XOMA 1JYVA 3WF3A 1UYZA 4BK5A 2RV9A 1UMHA 4DUWA 1O8PA 3T2OA 1RYYA 1HN1A 3CMGA 1US2A 3PUHA 4A4AA 3JXSA 1BHGA 4JHZA 3V7DB 2E31A 4AAXA 5JXIA 4A41A 4DUVA 2YB7A 3LQCA 4FI9A 5EJ1B 3ACHA 4ARYA 2VJXA 3I2GA 3WNNA 2VCCA 3HEIA 2XQXA 1H6XA 2OVRB 3ABZA 3IAQA 1WKYA 2W9XA 4P5YA 1PX4A 4XZUG 3A22A 5DPNA 3OEBA 4LKSA 4OMDA 1US3A 2Y64A 3ETPA 2WAAA 3EYPA 4JKLA 3OG2A 3IAPA 2WZEA 1JU3A 4BDVB 1W9SA 2QQNA 2WN3A 3GDBA 2WO3A 3MUY1 1GNYA 2BGPA 4M4RA 3VDCA 1JZ6A 3I3EA 4QDSA 4QB2A 3I2IA 3LEIA 1FS1A 3NRUA 3NQHA 1K12A 4BK4A 3CZJA 2P1NB 2W1QA 3CKHA 4QAWA 1J83A 4XUQA 4QB6A 5JMOA 2EICA 4RN5A 3THCA 2E33A 3LPGA 5I0DA 4LPLA 4HG6B 4KI5M 4DXSA 2VZSA 1ULOA 4CVUA 2VO5A 4DXTA 2XONA 1OF4A 1JHJA 2VCAA 2BBAA 4QX1A 4IUGA 4JX0A 3WEZA 2VTFA 4DEQA 3WNLA 3CDZB 2QQMA 3CZUA 4P00B 4KWUA 3C8XA 4A45A 1LDKE 4QX2A 1UY1A 5LA1A 2QQIA 2E26A 4A42A 5C71A 4QPWA 5EJZB 3FHQA 2B4KA 2W87A 1R64A 2EIDA 4RYDA 1SG3A 1W0NA 4XURA 2JD9A 2VQTA 2Y6GA 4MOAA 3A23A 4UI9L 4OUEA 2Y6JA 2QBXA 1JU4A 4XUNA 3HPNA 1JYWA 3IIIA 2WDBA 5IFPA 3ECQA 2P1PB 2VMEA 4XVHA 3WF4A 2VMFA 3T0DA 3U37A 1TG7A 2V5DA 3ACFA 1GMMA 4XUPA 3C7EA 4MADA 2J22A 2VZTA 1YQ2A 3SEEA 3C6PB 1JI6A 4OYUA 3MBWA 2J1EA 4JKMA 2WYSA 1UX7A 1W9WA 3C6NB 3D3AA 4CUBA 1TVGA 3OGVA 1K45A 4E8CA 2V4VA 3NJVA 2RVAA 3ACIA 3K4DA 3UNPA 3THDA 5DMYA 2LS6A 3SKVA 4DEVA 1XPWA 3T2PA 2HLEA 1GOGA 3ACGA 4OZOA 3WF2A 5DN2A 4AG4A 3WNOA 4TXWA 3MV11 1UY4A 2WBKA 3BN6A 1CZTA 1JZ5A 4CU6A 1T2XA 4KMQA 1NEXB 3OGRA 3OB8A 1UY2A 1XNTA 4M4PA 1O8SA 5CYYA 2BZDA 2DCKA 3LEKA 5B4NA 4GWIA 1UMIA 3MKSB 3IDAA 2W47A 4PF1A 3WNPA 4MGQA 2JKXA 2BERA 2E32A 4PT6A 5HXMA 1CX1A 2CDOA 3C7FA 1XC6A 4CU7A 1KEXA 2EIBA 3I2KA 3VD7A 5C7GA 5CZKA 5LA0A 1NKGA 2W46A 4CU8A 3HNBM 1W9TA 1DLCA 2V72A 4ZXEA 2J1VA 1JYNA 1OD3A 5LCWL 4ZZ8A 1JZ7A 2VZ3A 1UXZA 2Y6KA 2YFUA 3I2JA 5IJRA 2VZPA 2VOTA 2Y6LA 5JXHA 4W50A 3OBAA 2WUHA 3K77A 2VL4A 5IYYA 3LEGA 2VZQA 2VR4A 3BGAA 2KD7A 2Z4FA 3A7QA 4LQRA 2VZUA 2J1UA 1CIYA 1OT5A 4MGSA 1SDDB 1SHWB 1L7RA 1UZ0A 4A6OA 5J1XA 1JZ4A 2WN2A 3VDAA 2OKXA 2J1RA 1UYYA 3W5NA 1I5PA 4L0PA 3C6OB 1D7PM 1LNSA 4Z2AA 2VM9A 4DUXA 2LW8A 4QDRA 2W92A 4XUTA 4BXSV 5EIYB 2OVPB 2J1SA 3E1F1 1JYXA 1CZSA 4D0QA 2B9VA 2VZVA 1UWWA 1UYXA 3HN3A 3WNMA 4GWJA 2WAOA 2YFZA 1KGYA 1UXXX 3P6BA 5JR2A 2PQSA 1XNAA 3CQOA 2HYXA 1P8JA 2W94A 3K4AA 4JKKA 3C7OA 4ET7A 1F4HA 4ZY9A 2OVQB 4ZZ5A 5FUIA 3NNGA 3HOBA 2QQKA 5JXJA 2WQ8A 5JXGA 3HNMA 1NAEA 3MO4A 1W8NA 2X10A 2Y6HA
chains in the Genus database with same CATH superfamily
3L1NA 2O8OA 1PIV2 2FCTA 2PFWA 2ZGOA 1WLWA 5LB6A 1L7QA 2K5SA 1O5UA 3MV01 1DQ2A 3ZFEC 2CYFA 3C7GA 3KT7A 5EYXA 3WQBA 5JZGA 4UAPA 1C5HA 1E5SA 4V1PA 3ZXEA 2JG9C 2HBTA 4FJ8A 2R6QA 1LB2A 1BK0A 1JW6A 3W9AA 1FPN2 3BKZA 2A70A 5IK5A 3TEXA 1ASJ3 3DECA 3GALA 2VCBA 2O1QA 4W6WA 4WBBA 4YG0A 2R042 3ME2A 1COV2 2WSVA 3P5BA 3BIEA 4JVAA 3N9QA 3VHOA 1HXS1 5FZDA 3ZFGA 4IEQA 4YLZA 1KRIA 1XVFE 1FOD2 2XXZA 3H50A 3I59B 5FXVA 5I0TA 1PO13 1JHNA 1IZ3A 1NYWA 3QEWA 4UW4A 1W99A 2WS93 5IT6A 2P6HA 2VNVA 1MEC2 1PMHX 2ZBJA 4GWMA 4N7IA 4HCCA 2XUEA 3SQ4A 4V2WA 2GP3A 3HIFA 5A3UA 3FX3A 5A6ZA 3WCSA 2O8QA 4GB31 4HKLA 4EJRA 3GHMA 5A32A 2W1UA 4JCKA 1WMXA 1YC61 4X5MA 3A21A 1VBD2 1GUIA 1V6JA 4O9EA 4YPJA 2UWBA 2K9ZA 4UBHA 2MEV2 5K4LA 4AGVA 4AEKA 3M7AA 2CDPA 2J1TA 1GP4A 4DPNA 1CPNA 1IKPA 2Q8EA 3PIJA 3WDYA 4AI3A 2BGCA 1XMGE 1FZHE 1CZVA 1NUKA 1VBE1 2VD7A 2WT0A 2QQOA 3AZVA 4ZPIA 1VBC3 1RUI1 3POBA 2QJVA 3ZYGA 4BIFA 1IG3A 2VXRA 3C7HA 3IWZA 1QQP1 1R081 1YHFA 3IB3A 1U5ZA 3KVBA 3POEA 1PK6C 3WW3A 5A6XA 1GKBA 2EF6A 5A33B 3ST7A 4CTEA 4O65A 4XBLA 2QXFA 1D0GA 4PHZA 4J25A 2ZZJA 4E2GA 5A70A 1I1EA 1W9YA 2P34A 3EQEA 1WW7A 3PVBB 2ARBA 4ZS3A 1HQWA 2W3JA 4UFHA 3WG3A 4AR2A 4NR1A 5IVJA 3C95A 1GYKA 1MVQA 1O5LA 2YY1A 3POWA 4NHXA 2KM2A 5F3GA 5GM0A 1S0BA 4Q1PA 3V65A 3ZYFA 4AF9A 1PGL1 3GCWA 3UJOA 3Q8EA 3H7JA 3AYAA 4S2HA 4WVVA 2IVIB 2D40A 3BALA 5JOYA 1OUSA 2OPKA 3HWJA 4OZXA 3AMHA 1GP6A 4P08A 3SNMA 3EB7A 1QWRA 2ZGLA 5FZEA 2WFPA 3DF0A 1S55A 3THTA 2PHTA 2VIXA 1QJX1 2XLGA 5FZ6A 5IVYA 3U0ZA 2WO1A 5C33A 1VPHA 4E3SA 4P9GA 3W21A 1D0HA 4QDQA 3VBOA 1AYN1 3I8TA 3J26N 1POV1 2CHHA 2ZOEB 3WQ0A 4FJMA 4Q4Y2 2ZHMA 3AZZA 3D0JA 3K75B 2JHAA 1S4CA 4IEVA 2C1FA 4YZ3A 1KFUL 5FPVA 2HWC1 4UYBA 5IVBA 4MG2A 2VG9A 4A3XA 1CQ9A 2J1AA 4LBNA 4WM7C 1ZBA3 2WJSA 3AKSA 3MIHA 5JCTA 5FO7B 3KCXA 4AQ2A 2R49A 5I8YA 1W8WA 2A6ZA 1J84A 3HGKE 1AYM1 5LA2A 2PYTA 3ZR5A 4IERA 4NE9A 1V6LA 5IVCA 1DF0A 1M06G 4L99A 4XIOA 4EN6B 1JUHA 1RUD1 3DYMA 1AR71 3H8RA 2YUEA 4YW3A 5KBFA 3GJAA 5FY5A 3FFZA 1LAJA 1NXD1 4ZONA 3H1MA 1W0OA 2W1WA 5DDJ3 3VD9A 4FOYA 3HP9A 1FNZA 1FPOA 2B8IA 3ZM8A 4P02B 1RVF2 4S2FA 1GR3A 1W6QA 2F4PA 1W03A 5FP3A 4OMCA 3USUB 5ACA1 3OGSA 1RUOA 4QPIC 5LWBA 1RUJ2 1TME1 1O59A 4M0HA 4D94A 1GU3A 1W05A 4DTXA 1PVC3 3HQUA 1OQEA 3OOXA 3MLKA 4TYSA 3RZHA 4OVEA 2OIIA 4ZXKA 2P1OB 4Q4W3 2RV9A 4DUWA 1XNBA 4XF0A 3ILNA 5L7OB 2WLQA 1US2A 3RRDA 1YQ5A 4KI6A 4NUBA 5JIUA 5KC6A 1MVEA 5D8AA 4FOQA 2E31A 3NNFA 2W39A 5JXIA 5L9BA 4A41A 4DUVA 5J96B 3MIDA 4HK8A 3S30A 2X8KA 4C8DA 3HGLA 1QMJA 4WZFA 2VOKA 4Y20B 2MPFA 4P9YA 5L19A 3KS7A 2Z42A 2TUNA 4ARYA 3CO2A 2FZ2A 1QJY2 1MS5A 3SISA 4IGPA 2AEYA 1LENA 2FDFA 3WINE 5DAXA 4JGYA 1XQNA 2RS11 4A7ZA 2R1BA 3NAPC 3L0MA 4NAOA 1FZ2E 4QNCA 2XQXA 3S0MA 1GBGA 1LOAA 3ABZA 1WKYA 2AC1A 1GZCA 3IAQA 3PNAA 3QBQA 3OUIA 4XZUG 3A22A 3ZFEB 1IPSA 3NV3A 5CFDA 5DUWA 1RXFA 4OHVA 4OMDA 1UNBA 1US3A 1EV12 3AP4A 4RFT0 4KHQA 3J8F2 1UU6A 5L9VA 1DZQA 5LEKA 2CWSA 4AQ6A 2H0VA 5H9PA 5A3NA 2R061 2ZCWA 3NKTA 3O0WA 4JKLA 4EP9A 4DU3A 1IG0A 3OG2A 3IAPA 4LBOA 2WZEA 1JU3A 2B9UA 2JIJA 3G7DA 4OHXA 1NE6A 1X50A 3ZLIA 4IV1A 2QQNA 2WN3A 3GDBA 3RMDA 4J6GA 4QXBA 2BGPA 2HEWF 4RS5A 4XFAA 3I3EA 4R9BA 1WMDA 5HV0A 2GSYA 3KHBA 4CCOA 1LGBA 1N1YA 1FT9A 3LEIA 2B8MA 4H3WA 4UFKA 2X5IA 1NCQA 3NRUA 5DAVA 3LOBA 1KITA 1F2NA 1W2NA 1WCSA 2XJVA 3QD6A 4B08A 1K12A 3O0XA 1SBFA 3NO8A 3OPWA 4LKFA 4RL7A 2YDEA 4BK4A 2E63A 2CL2A 3P3PA 1N3PA 1GFF2 4XF3A 2DF7A 1JOJA 4UFMA 1VBA1 2OPWA 3GBFA 4C0HA 5DZFA 1FV2A 3IMNA 5FMOL 3TYJA 2V4AA 3N7MA 3T3YA 3OCPA 4IV3C 4M45A 2ZGTA 3U14A 1UOBA 1WD3A 4LUMA 4MLOA 1QJZA 2HEYF 3VBRB 3ZFFB 1OQ1A 1RUH1 2A5ZA 1VBE3 4HKOA 4KWKA 2Q30A 4F7ZA 2ZGNA 1LU2A 1RJ8A 1QQP3 1V6IA 2BFUS 2DYCA 3JU9A 2XVKA 4GKYA 1W8ZA 4HG6B 4X6QB 4DO0A 2VZSA 1ZREA 1N1VA 4DXTA 2VQ0A 1I3HA 3O7OA 1H1AA 5E1RA 4QX1A 3TEWA 4NO4A 4IEZA 4IUGA 1QOOA 4JX0A 3WEZA 2VTFA 5F9TA 1V0AA 1NZIA 2C5DA 2LTNA 2YHJA 2A6XA 3WNLA 2A7AA 4KBBA 1J58A 2HWE3 2P37A 1UF2C 1W9FA 2QUOA 1Y43B 3C8XA 4N43C 4COYA 3E6CC 1UL9A 3MIFA 5KXEA 5FREA 2JG8C 4Y22B 3DGTA 3KQ4B 4QKBA 2D5FA 2QQIA 4LORA 3KCCA 2LUWA 2RHPA 2A6VA 4A42A 3O1RA 4XXAA 3WDTA 2Q4SA 1VRH1 3FHQA 1F9KA 5BUVA 5J48A 2B4KA 3VHRA 3ZXFA 1QJX3 4MXVA 5FKBA 4XABA 2QQVA 1HJGA 1J3RA 4PDWA 2LM3A 1JODA 1UIKA 2CSGA 4JGZA 1AYN3 4XQWA 4AHWA 1POV3 5C8CB 2NQYA 5FR3A 4KHYA 4I2OA 3G6JB 1S0JA 4ZU4A 1SFPA 3RQ0A 3RWUA 2YV8A 4NRPA 2HWC3 1AR91 1Y4WA 5I0SA 2JD9A 2VQTA 4BQ5A 3S5AA 4XOGA 2VCMA 1Z7S2 2XVLA 2JECA 1OA2A 4DY3A 2QBXA 4WM7B 5C6CA 2VULA 3VBFA 5LK5A 2ET1A 2VBBA 1AYM3 4DU4A 1O4YA 1QNYA 4FPCA 4Q29A 4XUNA 5C3PA 2KR2A 1H9WA 1UKGA 1JS9A 2EAAA 3WNXA 3ECQA 4QGLA 4XF4A 4YM3A 1AR73 2VMEA 4XVHA 4QM9A 1AXKA 3KWVA 1NCRB 4CEYB 1CN1A 5AFBA 1UZVA 1TG7A 2RG4A 3OD4A 4P9IA 4AFMA 4HKWA 4M00A 1YJLA 1VP6A 4NHYA 1X33A 3OTFA 3V0AA 2FMDA 3RMXA 5EJ3A 4M3TA 3ACFA 2PLV2 2VZTA 2C6SA 4FJ9A 4YGCA 5F2WA 3ZYBA 5ACA3 5T50A 2HWD1 3EBRA 4QPIB 4DNYA 2WYSA 4OUMA 1TME3 4QQPA 5KXCA 1SLBA 1W9WA 1S0EA 3B9IA 3MF9A 3C6NB 5A7WB 1EPZA 2AZ5A 3ZFGC 1TVGA 3AKRA 3KM5A 4NPLA 3DL3A 1ZM1A 2WO7A 2HJIA 2H0BA 4XJAA 4DTRA 4IQPA 4LO4B 4IEUA 5FYBA 3WVJA 1H8TC 1VBB2 1XU1A 1G9BA 4QX7A 3OBRA 3VUOA 3UNPA 2WZR2 2RJKA 4Q8LA 2YB5A 3H8XA 2P6CA 3SKVA 1RUC2 3GZUC 4QQHA 4LHLA 1XPWA 1O3QA 1O7FA 2YU1A 3E5QA 2FYOA 4QQOA 4XCBA 5FOBB 2XBO1 2ZX2A 4AG4A 3DKQA 4Y26A 4CP9A 1LGCA 3ZSLA 4IETA 3CJIC 3MW2A 4M3WA 1LCLA 1UY4A 5BNNA 4YGBA 5DUUA 3TNQA 3BB6A 4BH9A 1WLTA 4UWDA 1Y7BA 2OYQA 2JG9A 3NAPB 2GNTA 3J9SA 1O8SA 2DCYA 2ZACA 1URXA 3MGUA 2YZ4A 5JSRA 2XJSA 3TBDA 4YGDA 1U0AA 2R072 3UGHA 1YIPA 1UMIA 3TEZA 5APAA 3IDAA 4BQ1A 2W47A 5LW9A 4PF1A 3WNPA 4TZDA 5I93A 4CCEA 3ZPOA 4A6SA 4MGQA 3IN9A 2JKXA 5JZGC 1LODA 2R063 2BERA 1RUG2 2ZKNA 1QDCA 2OZMA 2CDOA 3C7FA 1XC6A 4CU7A 1KEXA 2ZX1A 5F39A 4RSUA 5FPUA 4BQXA 3I2KA 1R1A1 2GALA 2AENA 3MLJA 1OPOA 4RHV2 4YVWC 3NWKA 1LRHA 2VOXA 4E4SA 5LA0A 1FMD1 3MDPA 1VLNA 2XUMA 1YQ6A 5FUPA 2HEVF 4GD4A 5KHHA 3L2HA 3WCRA 5JUVA 4HVQA 1OD3A 4Y4YA 4S2DA 1Y9MA 5F8PA 4QPGC 1PGSA 1Y9QA 1AJOA 2Y6KA 1X8MA 2CY6A 2YFUA 4COVA 2A73B 4XJWA 1VBA3 1XXNA 2VECA 1ZX5A 2Y26A 3H1YA 2VOTA 5ERLA 4BA6A 5F3EA 1CAUA 1Q8PA 1RHI1 2ET7A 4W50A 5C8WA 4KI4A 1XB9A 4IV3B 4IXLA 3K77A 4NHKA 1YIFA 1PK6A 5CG9A 1ZRCA 2VZQA 2VR4A 5FMBA 1YWKA 1OLRA 4ES9A 3B7MA 3OUHA 1LHOA 3CQ8A 1I6XA 2J1UA 2LALA 1GNHA 1JYIA 1BXHA 1SHWB 1SDDB 3E4YA 1GQGA 2FQPA 3H42B 4I0AA 1UZ0A 4JDOA 5EHDA 3UYJA 4LBQB 3PU8A 2WSUA 1VAMA 2LF6A 1W6NB 5GZEA 3O14A 4Y3OA 1O3SA 4B7EA 1C1LA 2VVDA 3U11A 2QDRA 1JXNA 4TLGA 2JH9A 3HT1A 4MHRA 4Q4V2 1H8VA 3UO3A 4N43B 4ICGC 4DUXA 2JG8B 1REDA 5DAPA 2GAUA 2LROA 2BRTA 1TQ5A 1AXYA 1V9U2 1R092 1VRH3 2XVGA 3TAYA 1VMHA 3MPBA 1AZDA 3T2TA 2YC0A 4JTNA 4FFGA 1BVP1 1CZSA 3OGGA 3GYDA 1UYXA 2I07B 3HN3A 3KT1A 1IQAA 1PM7A 4DFSA 4HZFA 2NM1A 4L11A 1OA3A 1WA4A 5D8AC 1KGYA 1HV0A 2JDHA 1AR93 2Q1ZB 2WNVA 2Y34A 2YBKA 3J7NA 5FLJA 4KU8A 4HETA 2HYKA 1QJU2 3BOWA 3E5XA 3QEVA 4LEJA 1HJFA 1XYOA 1W6OB 2WNUA 3VDDB 3OSDA 1UD1A 2D43A 5IREA 3BU7A 2DUOA 2YPJA 4NIIA 2Z5WA 3K4AA 5CFCA 4QWNA 2D6OX 4K6BA 4MXWB 2QCSB 3ILFA 5FUIA 2VUDA 1UW8A 1W6PB 3NNGA 4CUGA 5HI0A 4M0NA 3CHXA 4M42A 1AR82 1JTZX 5JXJA 1V70A 1ZRRA 1MS3A 2PQQA 2WQ8A 3POSA 5CVRA 3NSTA 5GZFA 5CFDC 3HNMA 5JZGB 4DTJA 3MO4A 2J1RA 1BKZA 2OZ6A 2HBUA 2Y60A 3LAGA 4CPBD 5A7WA 4XFBA 2ID4A 1BCXA 2AUYA 4BISA 4CA9A 4KG0A 3KHCA 2VBPA 4NN0A 1KS4A 4PI2A 4IV1C 3HQRA 4E4DX 3LZJA 3JD72 2VNOA 2RM23 3ZFGB 2ZXQA 3PJYA 4RS5C 1GZWA 2Q5TA 4NPMA 1YFUA 4Z8BA 2NP0A 1BJQA 5F7UA 1D4VB 1GWMA 2IC1A 2X5IC 1NCQC 3D6EA 4KWJA 2JDYA 4N9IA 4R4ZA 1WCQA 5IW0A 4IEOA 4FXKB 4BQ3A 3WF1A 1F4AA 4LO5B 4CU9A 3KV9A 5T5JA 3T0BA 4YZ1A 4ADNA 4O9GA 2VTXJ 3I2DA 1GWLA 5A32B 2XBO3 4YGEA 2VMIA 2H4TA 3S9HA 1B09A 4M01A 1PO23 3MZHA 3CJIB 3RFRA 4CUCA 2YGLA 1MPXA 1U5XA 2W1SA 2I45A 2NMOA 3VZNA 5C3RA 5FXXA 4YZ5A 3BUCA 1PO12 2WFF2 4IT5A 1Q5OA 3HL8A 3Q8CA 3WUCA 2QDNA 4AQSA 3OPZA 4FO9A 1JZ3A 1ULFA 5LK7B 1REFA 1YO8A 2W5FA 4B4QA 2OX0A 2WINB 4DRRA 1DQ6A 2Y6FA 2JHCA 2TNFA 4YW7A 1RL3A 4UF0A 2OW4A 4HXCA 4Q0PA 1AR63 1GV9A 4A3ZA 2ZEYA 4E9KA 1BBT1 1ULPA 3KGZA 5IBKB 1PMJX 3WSOA 5FY7A 3T09A 3IBMA 3RPQA 2RS51 3M1HA 2FDHA 3ZXDA 3BODA 2LRPA 1RUE2 4B3NA 1JBCA 1WBFA 4IE5A 1FMD3 4XUOA 4IL7A 2XLAA 4LTAA 1V6KA 2A3YA 2VMDA 3WQ1A 1G86A 4H7LA 2BOIA 2Q8CA 3O1UA 5K9YA 1EUUA 1QEXA 1Z0HA 3V56A 2OQ6A 5FXZA 3MUZ1 5C3SA 4Q4X2 3U78A 4JGZC 5KR7A 3D82A 2X09A 3T08A 3VBOB 2DVAA 1HKDA 1GOHA 2F6BA 3V0BB 4Q26A 1SDWA 3LOIA 1PHMA 1QJEA 1RHI3 2PHRA 4QU2A 2FCVA 1UOJA 4AW7A 1EUTA 5CKMA 3FHIB 4YM1A 4PLNA 4D7YA 1QNWA 4CCCA 5CBLA 5A7QA 1RMU2 4LBJA 3POYA 1H9PA 3VV1A 1QHDA 4NRMA 1UYPA 3NNMA 2X05A 4Q8KA 1PGW1 4FSJA 3IT8A 4G3YC 2EIEA 4FPJA 4XF1A 4YZ2A 3LDRA 3MF6A 4GULA 2CAUA 3KV5A 2HWF1 1WUVA 3POFA 4O7XA 3RMBA 5A7OA 2FBEA 5CA6A 2GC0A 3LE0A 4AKIA 3F2ZA 3M3EA 3OF1A 1CPMA 2XHNA 4P5HA 4AI6A 4PLMA 3DXTA 1LKNA 2QQWA 1GQPA 5FZIA 5GZDA 3LCPA 3U10A 1W6QB 3UJQA 1ZBA2 3W59A 4UW6A 4CUAA 4E27A 5CAZA 3LB9A 1K3IA 1XU2A 2FDIA 1SQ4A 3S7EA 4HLTA 3UESA 2OXBA 1JZ8A 3HD8B 1RC6A 3CU7A 3JQXA 2R30A 3JZVA 2ZAAA 4JRAA 3T2QA 4COUA 4K40A 3SCFA 2PXJA 2Y0OA 2WL1A 4XBNA 4LOSA 5DDJ2 3BVCA 4N53C 1OF3A 2ZGUA 3M8LA 4TN7A 3X29B 3I2FA 1BK1A 3KCYA 1MS8A 5D8AB 3U4SA 3SEPA 2XG3A 2W91A 3LPFA 4QXKA 3ETQA 4LLFA 5C4WA 1ZZCA 3SXWA 2UWAA 5FFOC 2JPNA 2XOMA 2ZJCA 4JTOA 1O6UA 1ZZ8A 3PUQA 4MXWA 4BK5A 1N47A 1UMHA 5J37A 2NYYA 4TWTA 2LF3A 1OURA 1W6PA 5D1IA 3T2OA 4BQ2A 2BPA2 3PMEA 2ZS6B 3PUHA 4CCDA 4CYDA 2CGNA 1I9RA 3JXSA 4A4AA 5BNNC 4AXOA 4JHZA 4NIAA 1TNRA 4JGYB 2R041 2VJ5A 4EWAA 5A6QA 1S0FA 1F5FA 2SBAA 4FTBA 3LQCA 1D4M2 4ZU7A 3I2GA 1FOD1 5I0DA 2VCCA 1UX6A 5CFDB 2QZ3A 4OI0A 4EE2A 1XJAA 4PQ9A 2IZWA 1MEC1 3GCXA 3GJBA 4FVMA 4BQWA 4LK6A 1XU5E 1MQTC 2JX9A 3NJZA 3PUSA 5A1LA 1H30A 5FZMA 3NKGA 4DS0A 5H9SA 4MYEA 5DPNA 1H8TA 4I9QA 4UFIA 1WLCA 4IV1B 2YBPA 4BCUA 1BMV2 4DTSA 5FBJA 1TMF2 1J3PA 4RS5B 1RIRA 2DCTA 4KGGA 2JQTA 4BDVB 5FJHA 4LMFA 5F6KA 5KHGA 4J2DA 1NCQB 2ETEA 2X5IB 4LT5A 4FK4A 3N35A 1KFXL 1LJ7A 2W52A 3AP6A 3K3NA 3UGFA 3I3MA 1IS6A 2ZHKA 3MUY1 3CJIA 4M4RA 1V00A 1DU3D 4EN0A 4GAZA 4M3CA 4QB2A 4GXLA 3VGIA 3I2IA 3AMNA 1FS1A 2GU9A 2CU5A 3TJYA 1XNDA 3AVRA 4JV4A 3OBZA 4W6YA 3R0RA 4RR3C 4JRLA 1PMIA 1LGNA 3LSEA 3E97A 3NMBA 4QPYA 5IVVA 1O3TA 2D44A 1HXS2 3FE5A 2WYFA 1PVXA 3VL8A 3CKHA 4CDWA 3DV8A 1N1TA 1F15A 2OUHA 1FZ8E 3PTYA 5FLIA 1KD7A 2YROA 5A6YA 4XUQA 3I4IA 4CZSA 4FPFA 4PCRA 5I91A 3AZWA 2HWE1 2XLFA 3MFCA 2EICA 4NVPA 4GB32 3BU0A 5CB7A 3FBMA 5FZ1A 3N7JA 2E33A 2ZA9A 1G8WA 2DBNA 1BBT3 4LPLA 1UZZA 1W2OA 4KI5M 4LO7A 4YVWA 1MMOG 1MZ5A 4AI8A 2E7QA 3ALQA 4CVUA 2VO5A 4Q4Y1 2I74A 5FQ0A 1JW2A 2RS53 2CV6A 3N7LA 4AI1A 1PZ8A 1CAWA 1ACCA 1U5IA 1RUI2 4FQ4A 1LOGA 4QPGA 4DEQA 1R082 3CZUA 4P00B 5EFUA 3CLPA 1CAVA 2DTWA 5LBFA 1DZRA 4A45A 1LDKE 1UY1A 5FPZA 4FJGA 1H4HA 5EXOA 1FYZE 5LA1A 4I3PA 2E26A 4PDWB 4AVBA 4J2BA 3FUQA 4JGZB 3QH7A 3BVOA 2YMZA 1XE8A 4QPWA 3ELNA 1B35C 1DCSA 3TNPB 4HN1A 1IGOA 5DABA 2WNVC 1DQ4A 5J7MA 2UURA 3PURA 2CWMA 3ZYHA 2XWJB 4AGRA 2WNUC 5JOWA 1RVF1 4K8RB 3VBFB 1OOPA 1ZBE1 3WG4A 5CFCC 2OZJA 3ZN4A 1LHWA 1RUJ1 4QQLA 2IWGB 1ULEA 2GN7A 2GP5A 4MOAA 3H1WA 2VW2A 2GDFA 3A23A 4OUEA 3SI6A 3WP5A 2Y6JA 3DPRC 3J7LA 5GLTA 1QJX2 4FJLA 2DVBA 3ZKYA 2BNOA 2HWF3 3KVAA 2G19A 4DINB 2RCUA 1JYWA 3V0AB 4N8MA 1IS5A 1G6NA 1JYCA 2HWC2 3AFKA 5FP4A 2VNGA 3FFQA 4D3WA 3WF4A 1AVBA 3NE6A 2WR9A 5FZAA 3TN93 3ZSEA 2E7TA 4LR4A 1O3RA 1OXCA 1KJRA 4FK0A 1GANA 1DGLA 1GQHA 2ZX3A 1ALYA 1RITA 1QJY1 1GMMA 3EJKA 1XVBE 2DY4A 3C7EA 4MADA 2J22A 4X8PA 4XUPA 3WW1A 1RUD2 1YQ2A 4FOVA 4CEWC 2YXSA 1JI6A 4OYUA 4HONA 1S0IA 5EZWA 3UKNA 1YUDA 5GLUA 3PVNA 4HMZA 4LIVA 3AP5A 4LBLA 3SPYA 1PIV3 4GJYA 2B5HA 5FPAA 3ZIWA 2UYBA 4NJ4A 4GWNA 5FJKA 4E8CA 4GQ7A 1XNKA 4XTPA 4B7KA 1Z78A 3ACIA 1ULDA 3J8F1 3MIBA 5H9RA 2WIIB 1KQRA 3Q8BA 3U75A 1FPN3 3K4DA 3KT4A 2HWB2 4XJZA 5H37A 4ADOA 4CP9B 4AL9A 4FFFA 5A3PA 3NAEA 1A8DA 3EMRA 3THDA 5BNNB 3L9JT 5FYYA 4XJUA 2DCZA 4BLIA 3ZYRA 4CDQC 4BQYA 2R043 3ZMOA 1COV3 1OHFA 4YW1A 2JG9B 2DUQA 3MFAA 1NY71 1MHZG 4NHMA 3WQ7A 3WF2A 5C3QA 1IPJA 4N90A 3T1MA 5IVEA 3VKNA 2Q1MA 2ZABA 3MV11 1FOD3 1LOEA 2WBKA 2PHUA 3SCHA 1C5IA 3BN6A 1F31A 1CZTA 3PVOA 3SHRA 4C91A 2IVJA 1T2XA 1ZRDA 1HRI2 4HOOA 1W2TA 1MEC3 2PAEA 1G9AA 1UY2A 4XIKA 2BZDA 2DCKA 2JJ6A 3LEKA 4RQPA 1MQTB 5DAQA 2RR12 4H14A 1S0GA 4EQVA 2PFTA 4XAAA 4FJ5A 3A0NA 3T1LA 1FV3A 1K5JA 4OI4A 3T4HB 5FOJB 1VBD3 3FJSA 3MKSB 1FX5A 4AEJA 5IUQA 5FPLA 2MEV3 2RS12 3FZ3A 1EYBA 1XSQA 1ZVFA 2YU2A 4ZKTB 2XL7A 2BJSA 5LEJA 1C57A 2P3YA 2E32A 4PT6A 5HXMA 4DTUA 2IXIA 2XDVA 1YCIA 1DQ1A 4FQZA 2WNEA 3RJRA 3WDUA 1S2BA 4B4PA 2G9ZA 5JWPA 5IWFA 3H7YA 1GNZA 3UK9A 4GKXA 1X9PA 4M3XA 5CZKA 5L36A 1FZ3E 1QF3A 4Y24A 3H3UA 2ZMLA 3INAA 4C1WA 2R062 1DLCA 1QU0A 2V72A 1QJFA 2PAKA 1JYNA 5DZGA 5LCWL 2JEMA 1CAUB 1OFNA 1BLZA 1JZ7A 2OUJA 4QT6A 2RMU2 1GSLA 3RSJA 5FYVA 4M3RA 1PK6B 1N3QA 5F5CA 2WWUA 3KF5A 2JWPA 2VW0A 2TEPA 4PIXA 2VZPA 2Y6LA 2VU9A 5JXHA 1PNGA 2RDSA 1XSRA 1YEWA 2IXCA 3AL5A 4I0BA 5FKCA 3VZMA 2DUPA 4K8FA 5FP7A 4QHBA 2VL4A 2Y33A 3LEGA 2PN5A 4XDOA 4G4FA 4OQ9A 5IYYA 2AREA 5CU1A 1RXGA 3WR0A 5FYUA 2VZUA 2VY0A 2FD8A 2EXKA 4OUSA 3U07A 4AKHA 1YXWA 4FJ7A 3B5LB 3NHGA 4Q0SA 5F37A 1W06A 5LRSA 4Q4Y3 2E7AA 3USSA 1ZZ7A 2RKHA 1RUH2 4LBKA 3ORJA 4OI2A 1Q9YA 1W8TA 1KDKA 5J1XA 3PU3A 4L97A 4XDQA 4XQ4A 2A3XA 4AK3A 2WN2A 3ZDVA 1H0BA 2D6NA 3VBUC 2XQRA 4AFBA 3AK0A 4KGQA 4A2UA 4GAMC 1I5PA 4XPVA 3C6OB 3N9MA 4AOCA 5FYHA 1OA4A 3Q8FA 5FCCA 3WY6A 1LNSA 3KV4A 2W68A 4Z2AA 2LW8A 4QDRA 4XUTA 1H2LA 2XH6A 4OHYA 5DAWA 4EWEA 4W6XA 4GMP0 5LZ6A 2UYAA 1OKOA 4BWOA 2OVPB 2V09A 1LULA 4PI0A 5C4WC 3AXEA 2WA4A 2WNVB 3M3CA 3A0KA 1MS9A 1Q8VA 4D0QA 1XE0A 3R4SA 4AFCA 2VOWA 1YNAA 4FVVA 5GALA 1X8EA 1UAIA 5K0UC 2BBVA 1RVF3 1LOBA 1DBNA 2WNUB 2PLV1 4FTEA 1ZBE3 2ZGKA 4D7SA 2ARCA 5ANNA 3VBSA 3SLIA 4YSFA 2OVUA 5CFCB 1RUJ3 1AJKA 4YW5A 1QH6A 1VRH2 2WA3A 4SLIA 1ND3C 2PQSA 3B69A 4XHBA 4XMIA 3KMHA 3DPRB 5FYSA 4AVAA 2ERFA 5CISA 2MZWB 1AUYA 1WGPA 2C0ZA 3DXUA 4DQAA 4META 2PA7A 2QVSB 3CBNA 3C7OA 4I30A 3WX5A 1LOFC 4HSJA 1DZTA 3F95A 3ZSMA 4URAA 4P9LA 2WZR1 1JUIA 5A3LA 2DURA 2RM21 1RUC1 1KDMA 1J3QA 4Q0VA 5T3NA 1A78A 4WV8A 1HV1A 1WCKA 1BEV2 1NAEA 4RGAA 5JVVA 3R05A 1W8NA 1EAH1 1ENRA 1L7LA 5FY1A 5HCAA 2PHXA 4N53A 4AEDC 1QJY3 3OYWA 4OFGA 4R9DA 3WP4A 4E2SA 1TNFA 2IFRA 1GZWB 1Y9GA 2ORZA 5DQ0A 2XMLA 1PZ9A 3S5QA 3WW2A 1YFYA 4YG3A 2VGDA 5IK4A 5CKNA 3O1OA 1C8M2 2JHPA 4FXGB 3SH4A 4D8MA 3QCWA 4V2VA 2A75A 1VE0A 1G7YA 1PO21 2E53A 2R071 1F5JA 4PQQA 3B93A 5FZOB 5T52A 1OFSA 3VKMA 1A34A 1WCUA 2RJ2A 4UT5A 3J8F3 4KWLA 4XZPA 2HWD2 1XL3C 2NZ9A 4DIQA 4TLFA 1S2EA 1XBFA 2JE7A 2JB8A 5FWEA 4HSLA 1XMHE 2DDUA 3QNNA 1HB3A 1IS3A 1DFQA 2YG0A 5FXWA 3VDBA 4AYUA 2JIGA 4XBQA 3N1EA 2L9LA 3I97A 4QM8A 4CDQB 4CDWC 5ABJA 1JOBA 2ZHNA 4M3ZA 2EA7A 3AXDA 1U5YA 3EHKA 3MEPA 5I8SA 2RDQA 3EO6A 1FZ6E 1MTYG 1AR61 2BOJA 1MQTA 1ONAA 3POIA 4XFCA 4RL5A 4W65A 3RZZA 2Y8KA 2VNRA 1IH7A 3QNOA 1Q9XA 2VQUA 4HANA 4TTGA 3KLSA 1PZ7A 2DVGA 4O61A 1WW5A 2VMGA 3GZAA 4K21A 1W8OA 4UF0B 5LY2A 2XBO2 3TAGA 1OH4A 1NX9A 4K1ZA 4NIGA 2WQZC 2XPJA 4LO8A 4PF5A 4CSWA 3AMQA 4WVMA 1WAJA 1OH3A 3HR9A 4QGMA 3BTYA 3UKVA 4Y5Z0 4ITCA 4NOTA 1PX3A 2QNKA 1UZWA 3WF0A 2K2SA 1CR7A 5J09A 3VD4A 1LHNA 4XMAA 3RZLA 5CEHA 5HPOA 4BJ0A 1LECA 2YPDA 5E8AA 3OGLB 3WOGA 4KHWA 2EVXA 3E6BA 2XGXA 4I02A 2QQJA 1Q8SA 3B3QE 5FY4A 4OCTA 1SLTA 2XB6C 5B2GB 4LE4A 4JAAA 3FLRA 4RR3A 2UY8A 1GLHA 5TSWA 4NHLA 1UY0A 3WDXA 4GZ9A 2ATFA 2J7MA 3OD0A 5LASA 1NQDA 5GLWA 4B1MA 1M4WA 2YC4A 3RZJA 2QQLA 1LU1A 1R1A2 1AL0G 2P17A 1XVGE 5F5IA 3SKJE 1W28A 4M41A 1OOPC 2JE8A 2P3KA 3E6DA 3UT0A 5FZLA 3JB8A 1E57A 3IPVA 5LBBA 1YI7A 3FL7A 4GH4A 1HRV2 4LA2A 1CWPA 5J3UA 1UIJA 1WMEA 4E4ZA 1AL22 4J2AA 4C1XA 1V9U1 1RB8G 3N7KA 3OGMB 1ZNPA 3K46A 2W95A 1DHKB 2JDPA 2JDUA 1AHSA 3O1PA 4FPGA 2VC9A 1QY4A 1H2MA 3NCIA 2ILMA 3LZIA 4Y5TA 3ZIXA 4KG8A 3IZOA 3TABA 5FTTC 2OQ7A 2G9GA 2VZ1A 3GBGA 3VD5A 3WNKA 5IAVA 3LDSA 4DXRA 4E8DA 4P9XA 1HQNA 2OA2A 5F32A 1Z7S3 2Z79A 1QJU1 2ZGQA 3GM8A 5G05L 4AAPA 1X9TA 3Q8AA 4BIOA 4QMAA 3FMGA 1QOSA 4LHKA 2A3WA 3JBG1 4BHPA 1B35A 4CP1A 1DP0A 1RUF2 3RVHA 2HD0A 5FO8B 1JZ2A 1TE1B 2YC2A 4QX0A 4FAHA 5FZGA 2BGOA 2RS32 3N9LA 3GXUA 5T5OA 3UV9A 5A80A 1UMZA 1JN2P 1K42A 1AR81 3H3ZA 5FP8A 1P22A 3OGKB 2XJTA 5C4WB 4FPLA 4JRQA 1W04A 5AC92 1VB4A 3SCGA 1GWKA 2DCJA 3NVCA 1WW4A 4DB5A 2BP6A 1RTVA 1XNCA 4N7UA 3UETA 3SITA 4BB3A 1MS4A 2KXLA 5G04L 4JDMA 5JDBA 1UY3A 2NN8A 3TAFA 1DIWA 2ZEXA 2PLV3 3A4UA 3DPRA 3GBWA 3J7HA 4KL1A 4A44A 2C9KA 1RGSA 4I6JB 2NLRA 4CDXA 5FMOS 3L8BA 1T6BX 4MO3M 1JYVA 1OVPA 2GNBA 1ND3B 2OT7A 4YWAA 3WF3A 1DDLA 3RYRA 3CMGA 1HN1A 4QD2A 4SBVA 3ON7A 3P3NA 3H9AA 2NPIA 2ZHLA 2XJPA 5IVFA 4DTOA 1OC1A 4AAXA 1W6MB 3QETA 5KWRA 1VBB3 1ZZBA 4INDA 3NGIA 4MGTA 5JI7A 4RQPC 2DU1A 2WZR3 4FI9A 4YRDA 2WWSA 5EJ1B 4FFHA 1RUC3 2VJXA 5FZFA 3WNNA 3QERA 4AGGA 4CEWA 3VB9A 1H1MA 2ES3A 3PVEA 1APNA 1EAH3 2D3PA 1H8TB 4FPHA 1WAFA 5GJ6A 1NZCA 3BTZA 4P5YA 1H6XA 3QEIA 4AEDB 2VUAA 2W9XA 2PFVA 4LA3A 5A3WA 4FPYA 2JH8A 4OHZA 4QGNA 4AFAA 4C90A 2MHFA 5FZOA 5A3TA 1JOPA 3QEPA 3NV1A 2EALA 1EY2A 1ASJ2 1HDKA 1K5MA 2WFF1 3S7IA 3UO2A 5BNPC 3THPA 1UU4A 4NRQA 3VHPA 5KHKA 1DGWA 4YM0A 2R073 4Q27A 3ETPA 3QH6A 4Y5SA 1FI2A 3EYPA 1X7NA 3CFRA 4IESA 4M3CB 5SV5A 4CDQA 2ZTNA 4NIHA 3R4UA 3FUOA 3ZX7A 1NA1A 1LTEA 1W9SA 3ATGA 3PHMA 4MHUA 4EN7B 4FTSA 2WS92 3VLBB 1RUG3 2WO3A 3DUIA 4FCAA 2AACA 4D6QA 4MSVA 3MYXA 3VDCA 3SQ2A 2EXJA 3ZMNA 5FO9B 3AMPA 1JZ6A 1ZRFA 4I01A 5H9QA 2GMPA 2PHFA 3W20A 4CDWB 5FWJA 3CF6E 3IDEA 3RMAA 3AYDA 1RUE1 4RHV3 1FZ4E 2GN3A 3NQHA 3R4DB 3N9PA 4MH0E 3ROUA 1BVVA 1OSGA 4DTMA 4WVWA 1O4ZA 3M70A 1KS5A 2BWAA 1J83A 2VQAA 3TRSB 2D6LX 3PL0A 4L8QA 1VBC2 1OD5A 4L92A 4Q4X1 4YVWB 5T5PA 1XVEE 4NWWA 1FZ9E 1CVNA 1W0PA 2CTVA 3BYWA 4QB6A 4KNCA 1REEA 5F6LB 3WZ1A 4A7KA 1C1FA 1QXJA 3AKPA 4Z07A 5FQ0B 5JMOA 1XVDE 4X5NA 4M3UA 2JE9A 4RN5A 1MZFA 1CAWB 2GC2A 5FY8A 5A3MA 2ARAA 3LPGA 4NIDA 2IXLA 3PDQA 4QPGB 4BE3A 4DXSA 2XJQA 4GMP1 1ULOA 1CAVB 1KXGA 1OF4A 1RMU1 3DEMA 4MX3A 4XF9A 1WMFA 4AVVA 1QOTA 2JDZA 1XYNA 1AX0A 1EPWA 1BBT2 2RE9A 4BPZA 4CE8A 4KWUA 1DG6A 3LFMA 3SJJA 2ZMNA 3H8OA 5DUVA 2RS52 2A6YA 3SVIA 4FJHA 2EXHA 4Q4V3 1OVSA 2A1XA 4I3GA 1OOPB 3VKOA 1FZ1E 3LEMA 3VBSC 4FFIA 2Z2SB 3OBTA 5JIAA 5IK8A 3OY8A 3ENRA 3ZR6A 2W87A 3VKLA 2FZ1A 5AVPA 1OLQA 5HBAA 1LEMA 2WT1A 1NOVA 1V9U3 4UXAA 2DFCA 3WD5A 4IEYA 4MGZE 2MMBA 2ZGSA 5T54A 1OQDA 4ORFA 1SG3A 1W0NA 3TN91 4JRPA 1R1ZA 5E16A 4XJ9A 1SBDA 1VJ2A 4AI0A 4UI9L 3K48A 1MHYG 1VALA 2X29A 2UWCA 3FC0A 4J2EA 1Q56A 1WD4A 5IK7A 3O12A 4EYWA 3VBUA 1UKRA 5M0TA 2GZWA 3PJQA 1D2SA 5GZCA 1YQCA 2BYVE 5F3IA 1QJU3 4BZ4A 4R52A 3IIIA 4URTA 3WUDA 2CGPA 4U2AA 1PIV1 3JBG3 1DGRN 3RYKA 2VMFA 1HIXA 4R8HA 3I54A 3AMMA 3LIHA 4HT1T 2BTVC 4AVSA 4CXWA 1JMUB 4DU1A 3LFIA 2PHDA 2CGOA 5K8SA 1D4M1 2V5DA 1J1LA 1E5IA 1FPN1 1AR83 1ULCA 5K0UA 2DTYA 4YARA 1PVC2 3RWNA 4N9HA 1CLQA 3HQXA 3MBWA 4Z82A 2B7YA 2IFWA 2J1EA 1YJKA 1COV1 1ND3A 4JKMA 2Q8DA 5AFEA 1ODMA 1VAVA 1RJ7A 1SACA 1WW6A 4IEWA 1Q43A 3JQWA 3I3QA 3M2MA 4JC1A 4Q4W2 4B8EA 4DRVA 4DXZA 3I7DA 1E5RA 3OGVA 3IDBB 1VIWB 1SPPA 3B94A 4IGOA 4Z1VA 4FJNA 3WG2A 1K45A 4LOTA 2V4VA 3OGJA 5ABJC 5F1RA 1W6MA 1QDOA 3AVSA 3NJVA 3K2OA 2RVAA 1ODNA 2B39A 1LOFA 3JD73 5KXBA 3LSDA 1YRZA 2RDNA 2DU0A 2P2KA 1TMF1 1IKQA 3E5UA 2UY9A 5DMYA 4HCBA 1CAXA 2ATQA 2F17A 2OYZA 1TEIA 3SC7X 3T2PA 2G1MA 2FMYA 1VBD1 3ACGA 4OZOA 4EN9B 3BTAA 2MEV1 1Q8OA 1FXXA 3Q9OA 4RQPB 5BV6A 3N9OA 5BNOA 2VJ4A 1W39A 3JB4C 4AEDA 3TEYA 1OI6A 4HVOA 3UKTA 4WM8A 1BZWA 1JZ5A 3U1XA 4CU6A 1DGRA 5CG8A 4KMQA 1NEXB 3OGRA 3VKFC 1V6MA 1XNTA 3CNAA 1WCDJ 1SFYA 5LRRA 1MZ6A 5B4NA 1PNFA 2V73A 5IZ7A 4P9JA 3R6SA 3NJYA 5HCHA 3WDWA 4XFGA 3O0VA 2WFF3 2AR6A 3WHTA 5KXDA 3ZOIA 5BNPB 3RZMA 5E88A 4BQ4A 2D5HA 4Q0UA 2GMEA 1WWYA 1QIQA 1IG9A 5E6HA 5LBCA 3CEWA 1UOGA 4FBFA 1G9DA 3T4VA 2K46A 1CONA 4K9SA 3KV6A 1GP5A 1MZEA 4XHXA 3VD7A 1A8MA 4ZHNA 1G9FA 1POQA 1ZZ9A 1NKGA 3HNBM 5C9AA 4CRQA 1CIWA 4XE9A 3ZFFC 3VBRC 3HT2A 4FT8A 5FBZA 4EZHA 5KHJA 4ZXEA 4GH4C 1HX6A 1RUE3 3C2UA 4ZZ8A 3D0SA 4KHUA 2BNMA 2XWBB 4JS5A 2Q0AA 2R0FA 3HAGA 4MZUA 4F3JA 2WC2A 3THCA 4B29A 1UN1A 4HK9A 1BYHA 3I2JA 1FZ0E 2UU8A 4IE4A 1HW5A 5J98B 1AX2A 3SQ1A 1UU5A 1VBE2 4EPHA 4Q4X3 3AX4A 1QQP2 1VB2A 2WUHA 4I9LA 5JLVA 1HQLA 2FDJA 1AF9A 3BGAA 5C3OA 4WZCA 2Z4FA 3SUNA 4BXFA 3VL9A 3RMCA 2FDKA 4L2NA 3WP3A 5IAXA 4GMP3 2QKDA 5ANQA 1L7RA 4A6OA 1RMU3 4PLOA 1FZ5E 1X36A 2XKPA 3HMYA 2R32A 3MPPG 1PGL2 4RD7A 2HWE2 3WXPA 2DV9A 5JSPA 1HB1A 4YFWA 4YVSA 4CDUA 2D93A 3AKTA 4LULA 1DQ5A 1JZ4A 4E4BA 3ZN5A 1OLMA 2D7FA 1QXPA 3D8CA 3AKQA 5C8CC 4BMBA 1JYTA 2XHKA 2ADDA 4L0PA 2H6CA 3N3HA 5JSOA 2FW3A 1GZ9A 5FZ7A 4BXSV 1UOFA 2BQPA 2F4LA 3HBZA 3OPTA 5A7SA 3RYPA 5EIYB 3LA3A 4CDXC 3VBSB 3ZXKA 4LJHA 1AYN2 2J1SA 3E1F1 5GLZA 2AH2A 1UWWA 5I0UA 4NWVA 3WNMA 5EP9A 4HPKA 3VBHA 4XJ8A 2WAOA 1W3XA 2YFZA 3H3LA 3ZKUA 1J59A 2P3JA 1ZZ6A 1AX1A 2PELA 1NCRC 4CEYC 4XW3A 5FUNA 3P6BA 1W90A 5JR2A 1AYM2 2K0GA 1NLRA 3B9CA 2D6KA 1YQ8A 2AEZA 5FZ9A 2ZGRA 4UW5A 2D3RA 3T30A 4MGKE 2HYXA 2W94A 1AR72 1U12A 2Z69A 3M3QA 4PBOA 1ZBE2 2R1DA 4ET7A 4BOWA 4LXLA 5C5TA 1F4HA 4ZY9A 4ZZ5A 1WBLA 3MIEA 4AWDA 2HWB1 2JXAA 1I5ZA 2P1BA 4IEXA 4N53B 3OYWB 5JMCA 4FPOB 3AZXA 4Y33A 3TAEA 2BU9A 2QQKA 2VH9A 2BDRA 5FYCA 3U4XA 3LDKA 5L9RA 2GNDA 5ACA2 5JXGA 2PTMA 1EV11 1K5MC 5FIXA 3WG1A 1D4M3 1QGLA 3W58A 2ZPXA 5DZEA 4GA9A 1TME2 3MLLA 4AE2A 1IS4A 4RFRB 4YFZA 3WW4A 4AHXA 4LK7A 2WABA 1HRI1 2E6VA 3CL1A 3K3OA 4MGIE 1NA1C 5F3CA 3DYOA 2JB4A 1ND2A 1V6NA 2BUKA 2C26A 4QXHA 5D2AA 2ORXA 2RR11 2RJLA 4CPBA 5FPXA 4GALA 4NPRA 4XFFA 5ABJB 4CCJA 1S2KA 4YW2A 3BPSA 2ARXA 2VZOA 3MIGA 3QESA 4ARXA 1TMF3 2JDAA 4TSVA 1S0DA 1SEFA 1O4TA 4K1YA 4A7YA 1NT0A 1XE7A 4W8JA 4BU2A 5L73A 4AHZA 3DN7A 3LA7A 3MW4A 5FDBA 3AJZA 1CJDA 2ZEZA 4QB1A 3AL6A 3TL8B 4WVMB 2W0XA 3I59A 4ASKA 3AM2A 3VZOA 3FHAA 3OJBA 4AFDA 3BCWA 4MGYE 1WLDA 4Y1YA 1C3HA 4UOJA 2RMU1 1SLIA 4AI2A 4EWDA 3I3DA 5BNPA 3NJXA 1NY72 2X53S 4YW4A 1SMVA 1HXS3 4FOWA 2GC1A 4X6RB 4RGGA 5SV8A 3LIGA 4DMIA 2J42A 5EWSA 3VZLA 1QKQA 3AP9A 3GGLA 5EV7A 3VHNA 4J1WA 2B45X 4RR3B 4J1XA 1HB2A 3HJRA 3PTRB 3T0AA 3TOJA 5C5UA 2ZAHA 2C9AA 3VD3A 4ISRA 4BM8A 2PAMA 4GB33 1DLLA 2ZZQA 2WZPP 2G9FA 2DVDA 2H6BA 3FLPA 2DWRA 1QH7A 4QKDA 3W5MA 1UPSA 3URFA 5JOZA 3O1SA 3B02A 2WO2A 4F83A 4AVTA 4QHOA 3CIHA 3IPVB 2VMCA 4R9AA 3WP6A 5A33A 2VE1A 4GH4B 2BNNA 2R7EB 5IHRA 1N1CA 4IEPA 1VBA2 1RUI3 4OLLA 3L2OB 2IXKA 4W4ZA 2WZ8A 5HCFA 3ZXLA 5FMCA 3AC0A 1R083 1UZYA 3JUUA 3K4ZA 4B1LA 3SQOA 3KD1E 4CCKA 2OZSA 4LBQD 3I49A 3ITQA 4HN0A 5GLVA 4XTMA 3FN9A 5FAXA 2E9QA 5A1FA 1YFXA 1FNYA 4XETA 4U36A 2JD4A 1Z7S1 2PMWB 4JS4A 3PUIA 4NROA 1UCXA 2IUWA 3HNYM 1HN0A 4F8AA 5ISLA 4QXCA 4EN8B 2JICA 2TBVA 5A1AA 4JQRA 5JOXA 1H6YA 2EAKA 4ZS2A 3I2HA 2ADEA 1A3KA 4XACA 3BI3A 4MVTA 4NAMA 4AI9A 2JKBA 2VXJA 4MV2A 1B35B 4OULA 1KJLA 3FBYA 4K3UA 3M3OA 4LHNA 3I3BA 1H2NA 4FP3A 2QTWB 2JDMA 1G9CA 3N9NA 2PHWA 3DYPA 1NG0A 4CXYA 4ATFA 3P1IA 4CCLA 3O5SA 3E4WA 3UGGA 5FY0A 4RG8A 1DYOA 2HH9A 4XAEA 5BY5A 2P3IA 1OUXA 2ZGMA 5B4XA 2P1QB 4Q5OA 5IFTA 4H55A 2P1MB 1VMJA 2ZEWA 1YLLA 1XRUA 2VZRA 5FK8A 3RWKX 2WRAA 3L2YA 4KHSA 2WQ4A 3VDDC 4CDXB 4LHSA 2VW1A 1ZRIA 3IKWA 1BEV1 4HBNA 2C4XA 1S0CA 3AYEA 3VN4A 1VBB1 3SH3A 5C70A 5IATA 1AR92 1GOFA 3OEAA 4LKEA 1RINA 1YFWA 4XILA 4HVRA 2W2IA 5FP9A 2WNOA 1RUD3 1YI9A 2JDKA 4LE3A 5BXXA 1IQDC 3J7MA 2VAUA 4QX3A 2EXIA 3USUA 1W3VA 4BYYA 1UYZA 3POGA 1C8M1 2BVVA 1O8PA 3AP7A 1RYYA 5BNOC 2BVBA 4RNGA 3LGRA 4C0BA 3KB5A 2OS2A 2YBSA 1BHGA 3VZJA 4CEWB 3V7DB 4WM8C 1DGWX 1SLLA 5EPAA 4ZU5A 3RZGA 2HWB3 2Q1FA 3V64A 1IPKA 2YB7A 5L7OA 2AGSA 3ACHA 2VMHA 1H2KA 4Y1ZA 3KD4A 3MICA 4OQ8A 1STMA 2V5YA 1EV13 1K5MB 3O1TA 2BW8A 1CD3G 1DYKA 3HEIA 3ZYJB 1H4GA 1NLQA 3ILRA 4AVCA 2OVRB 4Y20A 3M3IA 5FZBA 1RUG1 4UFJA 3QEXA 1DYPA 1IHMA 1PX4A 2RM22 1HRI3 4KBZA 5CKQA 3OEBA 3ASIA 4LKSA 1NA1B 4QKFA 1LHVA 3KSCA 1XVCE 5T5LA 4RHV1 1EAH2 1CESA 2RR13 2JDNA 5FK7A 4ATEA 3SQ0A 2Y64A 3J2PA 4UW3A 5C9AC 4XQDA 4DTNA 1LESA 4K20A 2WAAA 1FZ7E 1Y3TA 3ZPYA 3TWIA 3ZFEA 1H1IA 4PJYA 3H8UA 3ZN6B 2RS13 2WLPA 3DKWA 1SLAA 1XU3E 4LIUA 3LD8A 4EV0A 1GNYA 1LR5A 1UPIA 3PIGA 1LOCA 2ZMKA 1PO22 2P5BA 4QDSA 4DTPA 4DZGA 2VOVA 4LO6B 5LY1A 1HB4A 1W8FA 1FZIE 5HV4A 2ENRA 1Q8QA 2DBIA 3NL1A 5D21A 2Q8OA 1W8UA 2O0OA 4COZA 3GHNA 1V6OA 2NMNA 3LF7A 4Y4RA 1MS0A 3CZJA 5A3OA 2P1NB 3HN1A 3OUJA 4XC9A 4IE7A 4E4HA 2W1QA 4QAWA 4D6RA 2RMU3 3ZXJA 3CFOA 5K7PA 2QQPA 4FJIA 2D97A 1BQPA 5EQUA 4CP0A 1OPMA 2VVEA 4YM2A 1CJPA 3MHZA 4JDNA 2IXJA 1AR62 1SFNA 1ENSA 4PIYA 3ZSJA 4GJZA 3KGLA 5T55A 5FPBA 2AYHA 1HRV1 4RGKA 4YVSC 5FZ4A 4CDUC 5JI9A 4ES8A 4CP2A 1AL21 1NQJA 4DY5A 4WVZA 4Q4V1 4HL0A 1SLCA 5KC5A 1FMD2 3DCQA 3VBOC 3ZFFA 3VBRA 2WWJA 4Z2WA 1MACA 2XONA 1ZA4A 1JHJA 2VCAA 3O1VA 5I8TA 2BBAA 3C3VA 4M3CE 4Y1XA 5GKAC 2XL9A 5A7PA 1LEDA 5FZKA 1C4RA 1R091 1XMFE 2QQMA 3CDZB 4Q0QA 1RUH3 3QOPA 4IGQA 4AHYA 5FV3A 2XJUA 3OY8B 4AQTA 4QX2A 4L9BA 4R9CA 4CCMA 2GMMA 3AB0A 4LLOA 3RS6A 1RHI2 3RDIA 2CNAA 3LA2A 3CJXA 5F5QA 3VBHC 5C71A 2A71A 3WDVA 4OHWA 3M4FA 1RUF1 5EJZB 1XYPA 3BPZA 4QU1A 1L3JA 4AZZA 3RZKA 4FJJA 2RS31 3D5OA 4YNIA 4YG6A 2DEBA 1R64A 2EIDA 3AZYA 4RYDA 4Y22A 1OBNA 5FLHA 4YYOA 3GZTB 3ZYPA 5KHIA 3VBUB 4ISQA 5AC91 5JPMB 3C94A 2G4IA 4XEZA 3FLTA 4XURA 1XOYA 1JH5A 1SZBA 4FJKA 2Y6GA 1C28A 2QE3A 2B7MA 3BOPA 3KQRA 5C8CA 1E5HA 1JU4A 5DG2A 1SCRA 4LNVA 1IOAA 5J36A 2QQUA 3SMHA 4Q1RA 3ZO0B 3HPNA 4PBPA 3WT3A 3AFGA 1O91A 2WDBA 2WT2A 4MUVA 5K0UB 5FYTA 4UBGA 3KD5E 5IFPA 2P1PB 3H0OA 3T0DA 3K51A 4NMIA 4WM7A 1POV0 4GIQA 3B01A 4FPKA 3RI8A 2WKKA 3U37A 5FYMA 5BYNA 3GF6A 1LHUA 2B42B 4LUKA 4H2AA 2D6MA 1ND2C 3SUPA 4IE0A 1NLSA 4R4XA 3JD71 3SH5A 3LKJA 5BPXA 4KU7A 1SPPB 4ONUA 4JHTA 1OLME 3IM0A 1BEV3 3JBG2 3C6PB 1NCRA 3JCIA 4P14A 3SEEA 4CEYA 5BNQA 3N4MA 1SCSA 2PHLA 1T6GC 4FP2A 4JGYC 1UX7A 2QZ2A 4BLJA 2BEOA 3ZYIB 5E89A 3PLQA 1GZTA 4YZ4A 1N3OA 3S6PA 3D3AA 4ASLA 2Y38A 3POJA 3APBA 4CUBA 4FAGA 1CAXB 2FCUA 2R16A 4P9WA 3V0BA 1ASJ1 2E51A 4M3YA 1C8M3 4QPIA 5CADA 5BNOB 2MNGA 4QHZA 1RUNA 2LS6A 3IMMA 2EIGA 4WM8B 2VBDA 4DEVA 4LKDA 4FJXA 2HWD3 2HLEA 1GOGA 2SLIA 4JQTA 4PIZA 1PO11 3ZSKA 1JYXA 3D4KA 5DN2A 4UFLA 5CNAA 2P4EA 2WS91 1GICA 4TXWA 3WNOA 3UIQA 3N1BA 2ZGPA 2P5GA 5HCBA 5FZHA 1ZA7A 1A6CA 3KZ4C 3BTXA 1MR5A 2C24A 1TZOA 2IXHA 4M3CF 2VVFA 4HFSA 4YW6A 4IE6A 3OB8A 3EXUA 3J4UH 4M4PA 5CYYA 3GZEA 5I0RA 4D69A 4I09A 2B1EA 4ASMB 3ZXAC 4QNDA 4FK2A 2DTUA 1D2QA 3GNEA 4GWIA 5FZ3A 3LWCA 5EYYA 3ZN6A 3NV2A 1N1SA 5FZ8A 1VBC1 2BV4A 2KA3A 2XKOA 2YGMA 3NAPA 5F2SA 3WHUA 3WV6A 1ST8A 2D98A 5FYZA 5C9AB 3N36A 5FYIA 3SCXA 2DVFA 1OKQA 1CX1A 1X82A 3RGBA 2MW2A 2CAVA 1ENQA 2EIBA 4Y1UA 4I0WB 2HKXA 3NW4A 5C7GA 1ZYBA 4AKGA 3KF3A 4CXXA 2W46A 2P5OA 4CU8A 3HVDA 1W9TA 1VAKA 2B46X 2W08A 3ZVXA 2J1VA 3TB0A 1W2AX 2N7GA 1NE4A 2VZ3A 3NNLA 1UXZA 3RG0A 1FAYA 5JAXA 3RNSA 1YYNA 2GH8A 3RMYA 5FY9A 4XFHA 3QACA 1EP0A 2DFBA 3PMSA 4QX5A 4XDPA 5IJRA 2RDRA 4X8NA 5JPNB 4XXPA 1W8HA 1R1A3 2D6PA 3OBAA 5AVAA 4QKNA 1DQ0A 2YYOA 1NXMA 1QXRA 3HBKA 4G9SB 5F5AA 4D7TA 1HRV3 4EROA 2Y0IA 4AEMA 1C8NA 2D3SA 2KD7A 2XJRA 4YVSB 3RI9A 3A7QA 4LQRA 4CDUB 1AL23 1F8VA 4H7MA 3S57A 2GH2A 4QX8A 1CIYA 2JENA 2XR4A 4IV3A 1OT5A 3J27A 4IDZA 4MGSA 4PDWC 5JR7B 3PUAA 2FHRA 1ZBA1 3LDBA 5A7NA 3ZDSA 4QQ2A 4BMEA 1VR3A 3NDKA 4JZRA 4KH9A 4COWA 1CX4A 3QLQA 3SUQA 3AYCA 4LITA 1R093 3VDAA 2OKXA 3ZXGA 5FMDA 4XCAA 3UL2A 1UQXA 1SBEA 4LBMA 2BWCA 1UYYA 3VBFC 3ACLA 3W5NA 4LBQA 4XFIA 5CIRA 3MW3A 1D7PM 2VUCA 1W6NA 5GZGA 2VM9A 5DDJ1 3ES4A 5LBEA 2W92A 4EYUA 2ZX4A 4HPKB 3VBHB 4KHNA 2VTXA 5LA9A 3NNJA 1Q3EA 3VZKA 1AXZA 1RUF3 4Z92B 1J1TA 3FWEA 1VRBA 2VPVA 2ZX0A 2RS33 4D6SA 4N43A 3IIAA 4DOUA 4OI1A 2B9VA 3AJYA 4IW3A 2ZKLA 4S2GA 2VZVA 5FZ0A 1VMFA 2JG8A 4Y1VA 5FZCA 1MS1A 3O1MA 4GWJA 1PGW2 2A6WA 1PVC1 3BIWE 3B00A 1UXXX 1FXZA 5AC93 1PM4A 1OMIA 1ULGA 2HWF2 2VUJA 5HXVA 3CFPA 2I2SA 3SUOA 2GNMA 4RA0A 5DXDA 3RJ2X 3WLUA 4Q4W1 5L7OC 5DG1A 4CCNA 4EZ4A 1XNAA 5LATA 3CQOA 2BFUL 3SNNA 2O14A 3NV4A 1P8JA 4K7JA 1WZXA 4JKKA 2GC3A 3TN92 2QFEA 2OVQB 3IDCB 4FPEA 4KQ7A 4XYXA 5DUXA 4E2QA 1WA6X 3SPZA 1HLCA 1ENXA 3I2OA 4Q2FA 2R0HA 4B4RA 3HOBA 1W6OA 3LZZA 3VDDA 5FRAA 1UO9A 1S1AA 1CGPA 3ES1A 2FDGA 1FATA 1F35A 1ND2B 1W2UA 3MI8A 2X10A 1FYUA 2Y6HA 1BMV1
chains in the Genus database with same CATH topology
3L1NA 2ID4A 1L7QA 3MV01 2ORZA 3C7GA 2WABA 5DQ0A 3WQBA 4UAPA 3DYOA 2C26A 4FJ8A 2JHPA 4D8MA 2ORXA 3LZJA 4P5YA 2ZXQA 4PQQA 3DECA 2RJ2A 2VCBA 5F7UA 2VZOA 1XL3C 3QESA 1WCQA 2JDAA 4ARXA 1XMHE 2DDUA 3QNNA 2YG0A 1F4AA 3WF1A 4CU9A 1XVFE 3VDBA 3T0BA 3N1EA 4ADNA 2L9LA 3I97A 4M3ZA 3QEWA 4W8JA 1W99A 2H4TA 3S9HA 1FZ6E 1PMHX 1MTYG 4HCCA 3SQ4A 4RL5A 2ZEZA 4QB1A 2Y8KA 4CUCA 3TL8B 1IH7A 3QNOA 1Q9XA 1MPXA 2W1SA 2VQUA 4TTGA 3FHAA 2W1UA 5JUVA 3A21A 4X5MA 4UOJA 1GUIA 1W8OA 4YPJA 3HL8A 3I3DA 3NJXA 3TAGA 1OH4A 1JZ3A 1NX9A 2W5FA 2CDPA 2J1TA 1WAJA 2JHCA 1XMGE 1FZHE 1CZVA 1NUKA 3GGLA 1PX3A 2QQOA 3WF0A 3VD4A 3C7HA 3HJRA 3T0AA 2ZEYA 3IB3A 1ULPA 4A3ZA 4BJ0A 5HPOA 3OGLB 5IBKB 1PMJX 3VD3A 3WSOA 4KHWA 2QQJA 3T09A 2QXFA 3W5MA 2W3JA 4XUOA 1UY0A 2WO2A 3C95A 3CIHA 2VMCA 4GZ9A 2VMDA 2J7MA 2R7EB 5IHRA 3L2OB 2YC4A 4W4ZA 1EUUA 2WZ8A 2QQLA 3AC0A 3K4ZA 3MUZ1 1XVGE 3KD1E 3SKJE 2OZSA 3T08A 4M41A 2JE8A 2X09A 4P08A 1GOHA 3EB7A 3FN9A 3FL7A 2VIXA 4JS4A 3PUIA 1EUTA 2WO1A 4J2AA 3HNYM 4E3SA 3OGMB 4QDQA 3K46A 2W95A 4FJMA 5A1AA 3K75B 2JHAA 1H6YA 3I2HA 2VC9A 3NCIA 2X05A 3LZIA 2EIEA 3TABA 2J1AA 2VZ1A 3VD5A 3WNKA 3LDSA 4DXRA 4E8DA 3RMBA 3I3BA 1J84A 3HGKE 3LE0A 3DYPA 4AKIA 3F2ZA 3GM8A 5G05L 5LA2A 2XHNA 3P1IA 4AI6A 3E4WA 1GQPA 3DYMA 4RG8A 1DYOA 1DP0A 1JZ2A 2HD0A 4CUAA 4QX0A 2YC2A 5B4XA 2W1WA 2P1QB 3VD9A 1K3IA 2BGOA 3GXUA 5IFTA 3HP9A 3UESA 2P1MB 2ZEWA 1JZ8A 1K42A 2VZRA 3T2QA 2B8IA 3ZM8A 1P22A 4P02B 3OGKB 4KHSA 4LHSA 4JRQA 4OMCA 2DCJA 3OGSA 2C4XA 5C70A 3UETA 1GOFA 3OEAA 5G04L 1O59A 1UY3A 3TAFA 1OF3A 2ZEXA 1GU3A 3J7HA 4DTXA 3I2FA 4A44A 2C9KA 1IQDC 4I6JB 3SEPA 3LPFA 2W91A 4QX3A 3L8BA 4MO3M 2P1OB 2JPNA 2XOMA 1JYVA 3WF3A 1UYZA 4BK5A 2RV9A 1UMHA 4DUWA 1O8PA 3T2OA 2LF3A 1RYYA 1HN1A 3CMGA 4RNGA 1US2A 3PUHA 4KI6A 4A4AA 3JXSA 1BHGA 4JHZA 3V7DB 2E31A 4DTOA 4AAXA 3QETA 5JXIA 2VJ5A 4A41A 4DUVA 3NGIA 2YB7A 3HGLA 3LQCA 4FI9A 5EJ1B 3ACHA 4ARYA 2VJXA 3I2GA 3WNNA 3QERA 2VCCA 3HEIA 1WAFA 3L0MA 1FZ2E 4FVMA 4QNCA 1XU5E 1H6XA 2OVRB 3QEIA 2XQXA 1WKYA 2PFVA 2W9XA 3ABZA 3IAQA 2JH8A 3QEXA 1PX4A 4XZUG 3A22A 3QEPA 5DPNA 3OEBA 4LKSA 4OMDA 1US3A 1XVCE 4I9QA 4KHQA 3SQ0A 2Y64A 3J2PA 4DTSA 4DTNA 3ETPA 2WAAA 1FZ7E 3EYPA 4JKLA 3CFRA 4EP9A 4DU3A 3OG2A 3IAPA 2WZEA 1JU3A 4BDVB 1W9SA 4J2DA 4FK4A 1XU3E 2QQNA 2WN3A 3LD8A 3RMDA 3GDBA 2WO3A 3MUY1 1GNYA 2BGPA 4M4RA 3VDCA 3SQ2A 3I3EA 4QDSA 4DTPA 1JZ6A 4QB2A 3I2IA 3LEIA 1FS1A 3TJYA 3RMAA 3NRUA 1FZIE 1FZ4E 3NQHA 4B08A 1K12A 4BK4A 4DTMA 3CZJA 2P1NB 2W1QA 3CKHA 4QAWA 1J83A 3CFOA 4FJIA 1FZ8E 4M45A 1XVEE 4XUQA 1FZ9E 4QB6A 5JMOA 1XVDE 4X5NA 4M3UA 2EICA 4RN5A 3THCA 2E33A 3LPGA 5I0DA 4LPLA 4HG6B 4KI5M 4DXSA 1MMOG 2VZSA 1ULOA 4CVUA 2VO5A 4DXTA 2XONA 1OF4A 1JHJA 2VCAA 2BBAA 4QX1A 4IUGA 4JX0A 3WEZA 2VTFA 4DEQA 3WNLA 1XMFE 2QQMA 3CDZB 3CZUA 4P00B 4KWUA 3C8XA 3SJJA 4A45A 1LDKE 4QX2A 1UY1A 3SVIA 4FJGA 5LA1A 1FYZE 4FJHA 2QQIA 2E26A 4A42A 4J2BA 5C71A 4QPWA 1FZ1E 5EJZB 3FHQA 4FJJA 2B4KA 2W87A 2DEBA 1R64A 2EIDA 4RYDA 2MMBA 4KHYA 1SG3A 3C94A 1W0NA 4XURA 4JRPA 3RWUA 4FJKA 2JD9A 2VQTA 1MHYG 2Y6GA 3A23A 4MOAA 3SI6A 4J2EA 2Y6JA 4OUEA 4FJLA 2B7MA 2QBXA 4EYWA 1JU4A 4DU4A 2RCUA 3HPNA 4XUNA 1JYWA 3IIIA 2WDBA 4UI9L 3KD5E 5IFPA 3ECQA 2P1PB 2VMEA 4XVHA 3WF4A 2VMFA 3T0DA 3NE6A 3U37A 1TG7A 4DU1A 3SUPA 4FK0A 2V5DA 4M3TA 3ACFA 1GMMA 4XUPA 1XVBE 2DY4A 3C7EA 4MADA 2J22A 2VZTA 4FJ9A 1YQ2A 3SEEA 3C6PB 1CLQA 1JI6A 4OYUA 3MBWA 2J1EA 4JKMA 2WYSA 1UX7A 1W9WA 3SPYA 3C6NB 3D3AA 4CUBA 1TVGA 3OGVA 4FJNA 1K45A 4E8CA 2V4VA 4DTRA 3NJVA 3K2OA 4M3YA 2RVAA 3ACIA 3K4DA 5H37A 4ADOA 3UNPA 3NAEA 3THDA 2YB5A 5DMYA 2LS6A 4HCBA 3SKVA 2ATQA 1XPWA 3T2PA 4FJXA 4DEVA 2HLEA 1GOGA 2FYOA 3ACGA 4OZOA 3WF2A 1MHZG 5DN2A 4AG4A 1FXXA 3WNOA 4TXWA 2VJ4A 3UIQA 3N1BA 3MV11 2P5GA 4M3WA 1UY4A 2WBKA 3BN6A 1CZTA 1JZ5A 4CU6A 1T2XA 4KMQA 1NEXB 2OYQA 3OGRA 3OB8A 1UY2A 1XNTA 4M4PA 1O8SA 5CYYA 2BZDA 2DCKA 3LEKA 5B4NA 2B1EA 5IZ7A 4QNDA 2PFTA 4FK2A 2DTUA 4FJ5A 4GWIA 1UMIA 3MKSB 3IDAA 2W47A 4PF1A 3WNPA 4MGQA 2JKXA 2BERA 2E32A 3SCXA 4PT6A 5HXMA 4DTUA 1IG9A 1CX1A 2OZMA 2CDOA 3C7FA 1XC6A 4CU7A 1KEXA 2EIBA 3I2KA 4M3XA 3VD7A 5C7GA 4AKGA 5CZKA 5LA0A 1NKGA 2P5OA 2W46A 3HNBM 4CU8A 1FZ3E 1W9TA 1DLCA 2V72A 4ZXEA 2J1VA 1JYNA 1OD3A 5LCWL 4ZZ8A 1JZ7A 4KHUA 2VZ3A 1UXZA 4JS5A 2Y6KA 4M3RA 2YFUA 3I2JA 1FZ0E 5IJRA 2VZPA 2VOTA 3SQ1A 2Y6LA 5JXHA 4EPHA 4W50A 4KI4A 3OBAA 2WUHA 4I9LA 3K77A 2VL4A 5IYYA 3LEGA 2VZQA 2VR4A 3BGAA 2KD7A 2Z4FA 3SUNA 3A7QA 4LQRA 2VZUA 3CQ8A 3RMCA 2J1UA 4AKHA 1CIYA 4FJ7A 3NHGA 3J27A 1OT5A 1SDDB 1SHWB 4MGSA 3E4YA 1L7RA 1UZ0A 3LDBA 4A6OA 1FZ5E 3NDKA 2LF6A 1Q9YA 5J1XA 1JZ4A 3SUQA 2JH9A 4E4BA 2WN2A 3VDAA 2OKXA 1UYYA 3W5NA 4GAMC 1I5PA 4L0PA 3C6OB 1D7PM 2FW3A 1LNSA 2VM9A 4Z2AA 4DUXA 2LW8A 4QDRA 2W92A 4XUTA 4KHNA 4BXSV 5EIYB 2OVPB 2J1SA 3E1F1 1JYXA 1CZSA 4D0QA 2B9VA 2VZVA 1UWWA 1UYXA 3HN3A 3WNMA 4GWJA 2WAOA 2YFZA 1KGYA 1UXXX 3CFPA 3P6BA 3SUOA 5JR2A 2PQSA 3QEVA 1XNAA 2MZWB 3CQOA 3SNNA 5IREA 2HYXA 1P8JA 2W94A 3K4AA 4JKKA 3C7OA 4ET7A 1F4HA 4ZY9A 2OVQB 4ZZ5A 5FUIA 3SPZA 3NNGA 2X10A 3TAEA 4M42A 2QQKA 3HOBA 5JXJA 2WQ8A 5JXGA 3HNMA 1NAEA 4DTJA 3MO4A 1W8NA 2J1RA 2Y6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ID4 A;  1L7Q A;  3MV0 1;  2ORZ A;  3C7G A;  2WAB A;  5DQ0 A;  3WQB A;  4UAP A;  3DYO A;  2C26 A;  4D8M A;  2ORX A;  2ZXQ A;  4PQQ A;  3DEC A;  2RJ2 A;  2VCB A;  5F7U A;  2VZO A;  1WCQ A;  2JDA A;  4ARX A;  2DDU A;  2YG0 A;  1F4A A;  3WF1 A;  4CU9 A;  3VDB A;  3T0B A;  2L9L A;  3I97 A;  4W8J A;  1W99 A;  1PMH X;  2ZEZ A;  4QB1 A;  2Y8K A;  4CUC A;  1MPX A;  2W1S A;  2VQU A;  4TTG A;  3FHA A;  2W1U A;  5JUV A;  3A21 A;  4UOJ A;  1GUI A;  1W8O A;  4YPJ A;  3I3D A;  3NJX A;  1OH4 A;  1JZ3 A;  1NX9 A;  2W5F A;  2CDP A;  2J1T A;  1CZV A;  1NUK A;  3GGL A;  1PX3 A;  2QQO A;  3WF0 A;  3VD4 A;  3C7H A;  3HJR A;  3T0A A;  2ZEY A;  3IB3 A;  1ULP A;  4A3Z A;  4BJ0 A;  5HPO A;  3OGL B;  5IBK B;  1PMJ X;  3VD3 A;  3WSO A;  2QQJ A;  3T09 A;  3W5M A;  2W3J A;  4XUO A;  1UY0 A;  2WO2 A;  3CIH A;  2VMC A;  4GZ9 A;  2VMD A;  2J7M A;  2R7E B;  5IHR A;  2YC4 A;  3L2O B;  4W4Z A;  1EUU A;  2WZ8 A;  2QQL A;  3AC0 A;  3K4Z A;  3MUZ 1;  3SKJ E;  3T08 A;  2JE8 A;  2X09 A;  4P08 A;  1GOH A;  3EB7 A;  3FN9 A;  3FL7 A;  3PUI A;  1EUT A;  2WO1 A;  3HNY M;  3OGM B;  4QDQ A;  3K46 A;  2W95 A;  5A1A A;  3K75 B;  1H6Y A;  3I2H A;  2VC9 A;  2X05 A;  2EIE A;  2J1A A;  2VZ1 A;  3VD5 A;  3WNK A;  4DXR A;  4E8D A;  3I3B A;  1J84 A;  3LE0 A;  3DYP A;  3F2Z A;  3GM8 A;  5G05 L;  5LA2 A;  2XHN A;  3P1I A;  1GQP A;  3DYM A;  1DYO A;  1DP0 A;  1JZ2 A;  4CUA A;  4QX0 A;  2YC2 A;  5B4X A;  2W1W A;  2P1Q B;  3VD9 A;  1K3I A;  2BGO A;  3GXU A;  5IFT A;  3UES A;  2P1M B;  2ZEW A;  1JZ8 A;  1K42 A;  2VZR A;  3T2Q A;  3ZM8 A;  1P22 A;  4P02 B;  3OGK B;  4LHS A;  4OMC A;  2DCJ A;  3OGS A;  2C4X A;  5C70 A;  3UET A;  1GOF A;  3OEA A;  5G04 L;  1O59 A;  1UY3 A;  2ZEX A;  1OF3 A;  1GU3 A;  3J7H A;  3I2F A;  4A44 A;  2C9K A;  1IQD C;  4I6J B;  3SEP A;  3LPF A;  2W91 A;  4QX3 A;  4MO3 M;  2P1O B;  2XOM A;  1JYV A;  3WF3 A;  1UYZ A;  4BK5 A;  2RV9 A;  1UMH A;  4DUW A;  1O8P A;  3T2O A;  1RYY A;  1HN1 A;  3CMG A;  1US2 A;  3PUH A;  4A4A A;  3JXS A;  1BHG A;  4JHZ A;  3V7D B;  2E31 A;  4AAX A;  5JXI A;  4A41 A;  4DUV A;  2YB7 A;  3LQC A;  4FI9 A;  5EJ1 B;  3ACH A;  4ARY A;  2VJX A;  3I2G A;  3WNN A;  2VCC A;  3HEI A;  2XQX A;  1H6X A;  2OVR B;  3ABZ A;  3IAQ A;  1WKY A;  2W9X A;  4P5Y A;  1PX4 A;  4XZU G;  3A22 A;  5DPN A;  3OEB A;  4LKS A;  4OMD A;  1US3 A;  2Y64 A;  3ETP A;  2WAA A;  3EYP A;  4JKL A;  3OG2 A;  3IAP A;  2WZE A;  1JU3 A;  4BDV B;  1W9S A;  2QQN A;  2WN3 A;  3GDB A;  2WO3 A;  3MUY 1;  1GNY A;  2BGP A;  4M4R A;  3VDC A;  1JZ6 A;  3I3E A;  4QDS A;  4QB2 A;  3I2I A;  3LEI A;  1FS1 A;  3NRU A;  3NQH A;  1K12 A;  4BK4 A;  3CZJ A;  2P1N B;  2W1Q A;  3CKH A;  4QAW A;  1J83 A;  4XUQ A;  4QB6 A;  5JMO A;  2EIC A;  4RN5 A;  3THC A;  2E33 A;  3LPG A;  5I0D A;  4LPL A;  4HG6 B;  4KI5 M;  4DXS A;  2VZS A;  1ULO A;  4CVU A;  2VO5 A;  4DXT A;  2XON A;  1OF4 A;  1JHJ A;  2VCA A;  2BBA A;  4QX1 A;  4IUG A;  4JX0 A;  3WEZ A;  2VTF A;  4DEQ A;  3WNL A;  3CDZ B;  2QQM A;  3CZU A;  4P00 B;  4KWU A;  3C8X A;  4A45 A;  1LDK E;  4QX2 A;  1UY1 A;  5LA1 A;  2QQI A;  2E26 A;  4A42 A;  5C71 A;  4QPW A;  5EJZ B;  3FHQ A;  2B4K A;  2W87 A;  1R64 A;  2EID A;  4RYD A;  1SG3 A;  1W0N A;  4XUR A;  2JD9 A;  2VQT A;  2Y6G A;  4MOA A;  3A23 A;  4UI9 L;  4OUE A;  2Y6J A;  2QBX A;  1JU4 A;  4XUN A;  3HPN A;  1JYW A;  3III A;  2WDB A;  5IFP A;  3ECQ A;  2P1P B;  2VME A;  4XVH A;  3WF4 A;  2VMF A;  3T0D A;  3U37 A;  1TG7 A;  2V5D A;  3ACF A;  1GMM A;  4XUP A;  3C7E A;  4MAD A;  2J22 A;  2VZT A;  1YQ2 A;  3SEE A;  3C6P B;  1JI6 A;  4OYU A;  3MBW A;  2J1E A;  4JKM A;  2WYS A;  1UX7 A;  1W9W A;  3C6N B;  3D3A A;  4CUB A;  1TVG A;  3OGV A;  1K45 A;  4E8C A;  2V4V A;  3NJV A;  2RVA A;  3ACI A;  3K4D A;  3UNP A;  3THD A;  5DMY A;  2LS6 A;  3SKV A;  4DEV A;  1XPW A;  3T2P A;  2HLE A;  1GOG A;  3ACG A;  4OZO A;  3WF2 A;  5DN2 A;  4AG4 A;  3WNO A;  4TXW A;  3MV1 1;  1UY4 A;  2WBK A;  3BN6 A;  1CZT A;  1JZ5 A;  4CU6 A;  1T2X A;  4KMQ A;  1NEX B;  3OGR A;  3OB8 A;  1UY2 A;  1XNT A;  4M4P A;  1O8S A;  5CYY A;  2BZD A;  2DCK A;  3LEK A;  5B4N A;  4GWI A;  1UMI A;  3MKS B;  3IDA A;  2W47 A;  4PF1 A;  3WNP A;  4MGQ A;  2JKX A;  2BER A;  2E32 A;  4PT6 A;  5HXM A;  1CX1 A;  2CDO A;  3C7F A;  1XC6 A;  4CU7 A;  1KEX A;  2EIB A;  3I2K A;  3VD7 A;  5C7G A;  5CZK A;  5LA0 A;  1NKG A;  2W46 A;  4CU8 A;  3HNB M;  1W9T A;  1DLC A;  2V72 A;  4ZXE A;  2J1V A;  1JYN A;  1OD3 A;  5LCW L;  4ZZ8 A;  1JZ7 A;  2VZ3 A;  1UXZ A;  2Y6K A;  2YFU A;  3I2J A;  5IJR A;  2VZP A;  2VOT A;  2Y6L A;  5JXH A;  4W50 A;  3OBA A;  2WUH A;  3K77 A;  2VL4 A;  5IYY A;  3LEG A;  2VZQ A;  2VR4 A;  3BGA A;  2KD7 A;  2Z4F A;  3A7Q A;  4LQR A;  2VZU A;  2J1U A;  1CIY A;  1OT5 A;  4MGS A;  1SDD B;  1SHW B;  1L7R A;  1UZ0 A;  4A6O A;  5J1X A;  1JZ4 A;  2WN2 A;  3VDA A;  2OKX A;  2J1R A;  1UYY A;  3W5N A;  1I5P A;  4L0P A;  3C6O B;  1D7P M;  1LNS A;  4Z2A A;  2VM9 A;  4DUX A;  2LW8 A;  4QDR A;  2W92 A;  4XUT A;  4BXS V;  5EIY B;  2OVP B;  2J1S A;  3E1F 1;  1JYX A;  1CZS A;  4D0Q A;  2B9V A;  2VZV A;  1UWW A;  1UYX A;  3HN3 A;  3WNM A;  4GWJ A;  2WAO A;  2YFZ A;  1KGY A;  1UXX X;  3P6B A;  5JR2 A;  2PQS A;  1XNA A;  3CQO A;  2HYX A;  1P8J A;  2W94 A;  3K4A A;  4JKK A;  3C7O A;  4ET7 A;  1F4H A;  4ZY9 A;  2OVQ B;  4ZZ5 A;  5FUI A;  3NNG A;  3HOB A;  2QQK A;  5JXJ A;  2WQ8 A;  5JXG A;  3HNM A;  1NAE A;  3MO4 A;  1W8N A;  2X10 A;  2Y6H A; 
#chains in the Genus database with same CATH topology
 3L1N A;  2O8O A;  1PIV 2;  2FCT A;  2PFW A;  2ZGO A;  1WLW A;  5LB6 A;  1L7Q A;  2K5S A;  1O5U A;  3MV0 1;  1DQ2 A;  3ZFE C;  2CYF A;  3C7G A;  3KT7 A;  5EYX A;  3WQB A;  5JZG A;  4UAP A;  1C5H A;  1E5S A;  4V1P A;  3ZXE A;  2JG9 C;  2HBT A;  4FJ8 A;  2R6Q A;  1LB2 A;  1BK0 A;  1JW6 A;  3W9A A;  1FPN 2;  3BKZ A;  2A70 A;  5IK5 A;  3TEX A;  1ASJ 3;  3DEC A;  3GAL A;  2VCB A;  2O1Q A;  4W6W A;  4WBB A;  4YG0 A;  2R04 2;  3ME2 A;  1COV 2;  2WSV A;  3P5B A;  3BIE A;  4JVA A;  3N9Q A;  3VHO A;  1HXS 1;  5FZD A;  3ZFG A;  4IEQ A;  4YLZ A;  1KRI A;  1XVF E;  1FOD 2;  2XXZ A;  3H50 A;  3I59 B;  5FXV A;  5I0T A;  1PO1 3;  1JHN A;  1IZ3 A;  1NYW A;  3QEW A;  4UW4 A;  1W99 A;  2WS9 3;  5IT6 A;  2P6H A;  2VNV A;  1MEC 2;  1PMH X;  2ZBJ A;  4GWM A;  4N7I A;  4HCC A;  2XUE A;  3SQ4 A;  4V2W A;  2GP3 A;  3HIF A;  5A3U A;  3FX3 A;  5A6Z A;  3WCS A;  2O8Q A;  4GB3 1;  4HKL A;  4EJR A;  3GHM A;  5A32 A;  2W1U A;  4JCK A;  1WMX A;  1YC6 1;  4X5M A;  3A21 A;  1VBD 2;  1GUI A;  1V6J A;  4O9E A;  4YPJ A;  2UWB A;  2K9Z A;  4UBH A;  2MEV 2;  5K4L A;  4AGV A;  4AEK A;  3M7A A;  2CDP A;  2J1T A;  1GP4 A;  4DPN A;  1CPN A;  1IKP A;  2Q8E A;  3PIJ A;  3WDY A;  4AI3 A;  2BGC A;  1XMG E;  1FZH E;  1CZV A;  1NUK A;  1VBE 1;  2VD7 A;  2WT0 A;  2QQO A;  3AZV A;  4ZPI A;  1VBC 3;  1RUI 1;  3POB A;  2QJV A;  3ZYG A;  4BIF A;  1IG3 A;  2VXR A;  3C7H A;  3IWZ A;  1QQP 1;  1R08 1;  1YHF A;  3IB3 A;  1U5Z A;  3KVB A;  3POE A;  1PK6 C;  3WW3 A;  5A6X A;  1GKB A;  2EF6 A;  5A33 B;  3ST7 A;  4CTE A;  4O65 A;  4XBL A;  2QXF A;  1D0G A;  4PHZ A;  4J25 A;  2ZZJ A;  4E2G A;  5A70 A;  1I1E A;  1W9Y A;  2P34 A;  3EQE A;  1WW7 A;  3PVB B;  2ARB A;  4ZS3 A;  1HQW A;  2W3J A;  4UFH A;  3WG3 A;  4AR2 A;  4NR1 A;  5IVJ A;  3C95 A;  1GYK A;  1MVQ A;  1O5L A;  2YY1 A;  3POW A;  4NHX A;  2KM2 A;  5F3G A;  5GM0 A;  1S0B A;  4Q1P A;  3V65 A;  3ZYF A;  4AF9 A;  1PGL 1;  3GCW A;  3UJO A;  3Q8E A;  3H7J A;  3AYA A;  4S2H A;  4WVV A;  2IVI B;  2D40 A;  3BAL A;  5JOY A;  1OUS A;  2OPK A;  3HWJ A;  4OZX A;  3AMH A;  1GP6 A;  4P08 A;  3SNM A;  3EB7 A;  1QWR A;  2ZGL A;  5FZE A;  2WFP A;  3DF0 A;  1S55 A;  3THT A;  2PHT A;  2VIX A;  1QJX 1;  2XLG A;  5FZ6 A;  5IVY A;  3U0Z A;  2WO1 A;  5C33 A;  1VPH A;  4E3S A;  4P9G A;  3W21 A;  1D0H A;  4QDQ A;  3VBO A;  1AYN 1;  3I8T A;  3J26 N;  1POV 1;  2CHH A;  2ZOE B;  3WQ0 A;  4FJM A;  4Q4Y 2;  2ZHM A;  3AZZ A;  3D0J A;  3K75 B;  2JHA A;  1S4C A;  4IEV A;  2C1F A;  4YZ3 A;  1KFU L;  5FPV A;  2HWC 1;  4UYB A;  5IVB A;  4MG2 A;  2VG9 A;  4A3X A;  1CQ9 A;  2J1A A;  4LBN A;  4WM7 C;  1ZBA 3;  2WJS A;  3AKS A;  3MIH A;  5JCT A;  5FO7 B;  3KCX A;  4AQ2 A;  2R49 A;  5I8Y A;  1W8W A;  2A6Z A;  1J84 A;  3HGK E;  1AYM 1;  5LA2 A;  2PYT A;  3ZR5 A;  4IER A;  4NE9 A;  1V6L A;  5IVC A;  1DF0 A;  1M06 G;  4L99 A;  4XIO A;  4EN6 B;  1JUH A;  1RUD 1;  3DYM A;  1AR7 1;  3H8R A;  2YUE A;  4YW3 A;  5KBF A;  3GJA A;  5FY5 A;  3FFZ A;  1LAJ A;  1NXD 1;  4ZON A;  3H1M A;  1W0O A;  2W1W A;  5DDJ 3;  3VD9 A;  4FOY A;  3HP9 A;  1FNZ A;  1FPO A;  2B8I A;  3ZM8 A;  4P02 B;  1RVF 2;  4S2F A;  1GR3 A;  1W6Q A;  2F4P A;  1W03 A;  5FP3 A;  4OMC A;  3USU B;  5ACA 1;  3OGS A;  1RUO A;  4QPI C;  5LWB A;  1RUJ 2;  1TME 1;  1O59 A;  4M0H A;  4D94 A;  1GU3 A;  1W05 A;  4DTX A;  1PVC 3;  3HQU A;  1OQE A;  3OOX A;  3MLK A;  4TYS A;  3RZH A;  4OVE A;  2OII A;  4ZXK A;  2P1O B;  4Q4W 3;  2RV9 A;  4DUW A;  1XNB A;  4XF0 A;  3ILN A;  5L7O B;  2WLQ A;  1US2 A;  3RRD A;  1YQ5 A;  4KI6 A;  4NUB A;  5JIU A;  5KC6 A;  1MVE A;  5D8A A;  4FOQ A;  2E31 A;  3NNF A;  2W39 A;  5JXI A;  5L9B A;  4A41 A;  4DUV A;  5J96 B;  3MID A;  4HK8 A;  3S30 A;  2X8K A;  4C8D A;  3HGL A;  1QMJ A;  4WZF A;  2VOK A;  4Y20 B;  2MPF A;  4P9Y A;  5L19 A;  3KS7 A;  2Z42 A;  2TUN A;  4ARY A;  3CO2 A;  2FZ2 A;  1QJY 2;  1MS5 A;  3SIS A;  4IGP A;  2AEY A;  1LEN A;  2FDF A;  3WIN E;  5DAX A;  4JGY A;  1XQN A;  2RS1 1;  4A7Z A;  2R1B A;  3NAP C;  3L0M A;  4NAO A;  1FZ2 E;  4QNC A;  2XQX A;  3S0M A;  1GBG A;  1LOA A;  3ABZ A;  1WKY A;  2AC1 A;  1GZC A;  3IAQ A;  3PNA A;  3QBQ A;  3OUI A;  4XZU G;  3A22 A;  3ZFE B;  1IPS A;  3NV3 A;  5CFD A;  5DUW A;  1RXF A;  4OHV A;  4OMD A;  1UNB A;  1US3 A;  1EV1 2;  3AP4 A;  4RFT 0;  4KHQ A;  3J8F 2;  1UU6 A;  5L9V A;  1DZQ A;  5LEK A;  2CWS A;  4AQ6 A;  2H0V A;  5H9P A;  5A3N A;  2R06 1;  2ZCW A;  3NKT A;  3O0W A;  4JKL A;  4EP9 A;  4DU3 A;  1IG0 A;  3OG2 A;  3IAP A;  4LBO A;  2WZE A;  1JU3 A;  2B9U A;  2JIJ A;  3G7D A;  4OHX A;  1NE6 A;  1X50 A;  3ZLI A;  4IV1 A;  2QQN A;  2WN3 A;  3GDB A;  3RMD A;  4J6G A;  4QXB A;  2BGP A;  2HEW F;  4RS5 A;  4XFA A;  3I3E A;  4R9B A;  1WMD A;  5HV0 A;  2GSY A;  3KHB A;  4CCO A;  1LGB A;  1N1Y A;  1FT9 A;  3LEI A;  2B8M A;  4H3W A;  4UFK A;  2X5I A;  1NCQ A;  3NRU A;  5DAV A;  3LOB A;  1KIT A;  1F2N A;  1W2N A;  1WCS A;  2XJV A;  3QD6 A;  4B08 A;  1K12 A;  3O0X A;  1SBF A;  3NO8 A;  3OPW A;  4LKF A;  4RL7 A;  2YDE A;  4BK4 A;  2E63 A;  2CL2 A;  3P3P A;  1N3P A;  1GFF 2;  4XF3 A;  2DF7 A;  1JOJ A;  4UFM A;  1VBA 1;  2OPW A;  3GBF A;  4C0H A;  5DZF A;  1FV2 A;  3IMN A;  5FMO L;  3TYJ A;  2V4A A;  3N7M A;  3T3Y A;  3OCP A;  4IV3 C;  4M45 A;  2ZGT A;  3U14 A;  1UOB A;  1WD3 A;  4LUM A;  4MLO A;  1QJZ A;  2HEY F;  3VBR B;  3ZFF B;  1OQ1 A;  1RUH 1;  2A5Z A;  1VBE 3;  4HKO A;  4KWK A;  2Q30 A;  4F7Z A;  2ZGN A;  1LU2 A;  1RJ8 A;  1QQP 3;  1V6I A;  2BFU S;  2DYC A;  3JU9 A;  2XVK A;  4GKY A;  1W8Z A;  4HG6 B;  4X6Q B;  4DO0 A;  2VZS A;  1ZRE A;  1N1V A;  4DXT A;  2VQ0 A;  1I3H A;  3O7O A;  1H1A A;  5E1R A;  4QX1 A;  3TEW A;  4NO4 A;  4IEZ A;  4IUG A;  1QOO A;  4JX0 A;  3WEZ A;  2VTF A;  5F9T A;  1V0A A;  1NZI A;  2C5D A;  2LTN A;  2YHJ A;  2A6X A;  3WNL A;  2A7A A;  4KBB A;  1J58 A;  2HWE 3;  2P37 A;  1UF2 C;  1W9F A;  2QUO A;  1Y43 B;  3C8X A;  4N43 C;  4COY A;  3E6C C;  1UL9 A;  3MIF A;  5KXE A;  5FRE A;  2JG8 C;  4Y22 B;  3DGT A;  3KQ4 B;  4QKB A;  2D5F A;  2QQI A;  4LOR A;  3KCC A;  2LUW A;  2RHP A;  2A6V A;  4A42 A;  3O1R A;  4XXA A;  3WDT A;  2Q4S A;  1VRH 1;  3FHQ A;  1F9K A;  5BUV A;  5J48 A;  2B4K A;  3VHR A;  3ZXF A;  1QJX 3;  4MXV A;  5FKB A;  4XAB A;  2QQV A;  1HJG A;  1J3R A;  4PDW A;  2LM3 A;  1JOD A;  1UIK A;  2CSG A;  4JGZ A;  1AYN 3;  4XQW A;  4AHW A;  1POV 3;  5C8C B;  2NQY A;  5FR3 A;  4KHY A;  4I2O A;  3G6J B;  1S0J A;  4ZU4 A;  1SFP A;  3RQ0 A;  3RWU A;  2YV8 A;  4NRP A;  2HWC 3;  1AR9 1;  1Y4W A;  5I0S A;  2JD9 A;  2VQT A;  4BQ5 A;  3S5A A;  4XOG A;  2VCM A;  1Z7S 2;  2XVL A;  2JEC A;  1OA2 A;  4DY3 A;  2QBX A;  4WM7 B;  5C6C A;  2VUL A;  3VBF A;  5LK5 A;  2ET1 A;  2VBB A;  1AYM 3;  4DU4 A;  1O4Y A;  1QNY A;  4FPC A;  4Q29 A;  4XUN A;  5C3P A;  2KR2 A;  1H9W A;  1UKG A;  1JS9 A;  2EAA A;  3WNX A;  3ECQ A;  4QGL A;  4XF4 A;  4YM3 A;  1AR7 3;  2VME A;  4XVH A;  4QM9 A;  1AXK A;  3KWV A;  1NCR B;  4CEY B;  1CN1 A;  5AFB A;  1UZV A;  1TG7 A;  2RG4 A;  3OD4 A;  4P9I A;  4AFM A;  4HKW A;  4M00 A;  1YJL A;  1VP6 A;  4NHY A;  1X33 A;  3OTF A;  3V0A A;  2FMD A;  3RMX A;  5EJ3 A;  4M3T A;  3ACF A;  2PLV 2;  2VZT A;  2C6S A;  4FJ9 A;  4YGC A;  5F2W A;  3ZYB A;  5ACA 3;  5T50 A;  2HWD 1;  3EBR A;  4QPI B;  4DNY A;  2WYS A;  4OUM A;  1TME 3;  4QQP A;  5KXC A;  1SLB A;  1W9W A;  1S0E A;  3B9I A;  3MF9 A;  3C6N B;  5A7W B;  1EPZ A;  2AZ5 A;  3ZFG C;  1TVG A;  3AKR A;  3KM5 A;  4NPL A;  3DL3 A;  1ZM1 A;  2WO7 A;  2HJI A;  2H0B A;  4XJA A;  4DTR A;  4IQP A;  4LO4 B;  4IEU A;  5FYB A;  3WVJ A;  1H8T C;  1VBB 2;  1XU1 A;  1G9B A;  4QX7 A;  3OBR A;  3VUO A;  3UNP A;  2WZR 2;  2RJK A;  4Q8L A;  2YB5 A;  3H8X A;  2P6C A;  3SKV A;  1RUC 2;  3GZU C;  4QQH A;  4LHL A;  1XPW A;  1O3Q A;  1O7F A;  2YU1 A;  3E5Q A;  2FYO A;  4QQO A;  4XCB A;  5FOB B;  2XBO 1;  2ZX2 A;  4AG4 A;  3DKQ A;  4Y26 A;  4CP9 A;  1LGC A;  3ZSL A;  4IET A;  3CJI C;  3MW2 A;  4M3W A;  1LCL A;  1UY4 A;  5BNN A;  4YGB A;  5DUU A;  3TNQ A;  3BB6 A;  4BH9 A;  1WLT A;  4UWD A;  1Y7B A;  2OYQ A;  2JG9 A;  3NAP B;  2GNT A;  3J9S A;  1O8S A;  2DCY A;  2ZAC A;  1URX A;  3MGU A;  2YZ4 A;  5JSR A;  2XJS A;  3TBD A;  4YGD A;  1U0A A;  2R07 2;  3UGH A;  1YIP A;  1UMI A;  3TEZ A;  5APA A;  3IDA A;  4BQ1 A;  2W47 A;  5LW9 A;  4PF1 A;  3WNP A;  4TZD A;  5I93 A;  4CCE A;  3ZPO A;  4A6S A;  4MGQ A;  3IN9 A;  2JKX A;  5JZG C;  1LOD A;  2R06 3;  2BER A;  1RUG 2;  2ZKN A;  1QDC A;  2OZM A;  2CDO A;  3C7F A;  1XC6 A;  4CU7 A;  1KEX A;  2ZX1 A;  5F39 A;  4RSU A;  5FPU A;  4BQX A;  3I2K A;  1R1A 1;  2GAL A;  2AEN A;  3MLJ A;  1OPO A;  4RHV 2;  4YVW C;  3NWK A;  1LRH A;  2VOX A;  4E4S A;  5LA0 A;  1FMD 1;  3MDP A;  1VLN A;  2XUM A;  1YQ6 A;  5FUP A;  2HEV F;  4GD4 A;  5KHH A;  3L2H A;  3WCR A;  5JUV A;  4HVQ A;  1OD3 A;  4Y4Y A;  4S2D A;  1Y9M A;  5F8P A;  4QPG C;  1PGS A;  1Y9Q A;  1AJO A;  2Y6K A;  1X8M A;  2CY6 A;  2YFU A;  4COV A;  2A73 B;  4XJW A;  1VBA 3;  1XXN A;  2VEC A;  1ZX5 A;  2Y26 A;  3H1Y A;  2VOT A;  5ERL A;  4BA6 A;  5F3E A;  1CAU A;  1Q8P A;  1RHI 1;  2ET7 A;  4W50 A;  5C8W A;  4KI4 A;  1XB9 A;  4IV3 B;  4IXL A;  3K77 A;  4NHK A;  1YIF A;  1PK6 A;  5CG9 A;  1ZRC A;  2VZQ A;  2VR4 A;  5FMB A;  1YWK A;  1OLR A;  4ES9 A;  3B7M A;  3OUH A;  1LHO A;  3CQ8 A;  1I6X A;  2J1U A;  2LAL A;  1GNH A;  1JYI A;  1BXH A;  1SHW B;  1SDD B;  3E4Y A;  1GQG A;  2FQP A;  3H42 B;  4I0A A;  1UZ0 A;  4JDO A;  5EHD A;  3UYJ A;  4LBQ B;  3PU8 A;  2WSU A;  1VAM A;  2LF6 A;  1W6N B;  5GZE A;  3O14 A;  4Y3O A;  1O3S A;  4B7E A;  1C1L A;  2VVD A;  3U11 A;  2QDR A;  1JXN A;  4TLG A;  2JH9 A;  3HT1 A;  4MHR A;  4Q4V 2;  1H8V A;  3UO3 A;  4N43 B;  4ICG C;  4DUX A;  2JG8 B;  1RED A;  5DAP A;  2GAU A;  2LRO A;  2BRT A;  1TQ5 A;  1AXY A;  1V9U 2;  1R09 2;  1VRH 3;  2XVG A;  3TAY A;  1VMH A;  3MPB A;  1AZD A;  3T2T A;  2YC0 A;  4JTN A;  4FFG A;  1BVP 1;  1CZS A;  3OGG A;  3GYD A;  1UYX A;  2I07 B;  3HN3 A;  3KT1 A;  1IQA A;  1PM7 A;  4DFS A;  4HZF A;  2NM1 A;  4L11 A;  1OA3 A;  1WA4 A;  5D8A C;  1KGY A;  1HV0 A;  2JDH A;  1AR9 3;  2Q1Z B;  2WNV A;  2Y34 A;  2YBK A;  3J7N A;  5FLJ A;  4KU8 A;  4HET A;  2HYK A;  1QJU 2;  3BOW A;  3E5X A;  3QEV A;  4LEJ A;  1HJF A;  1XYO A;  1W6O B;  2WNU A;  3VDD B;  3OSD A;  1UD1 A;  2D43 A;  5IRE A;  3BU7 A;  2DUO A;  2YPJ A;  4NII A;  2Z5W A;  3K4A A;  5CFC A;  4QWN A;  2D6O X;  4K6B A;  4MXW B;  2QCS B;  3ILF A;  5FUI A;  2VUD A;  1UW8 A;  1W6P B;  3NNG A;  4CUG A;  5HI0 A;  4M0N A;  3CHX A;  4M42 A;  1AR8 2;  1JTZ X;  5JXJ A;  1V70 A;  1ZRR A;  1MS3 A;  2PQQ A;  2WQ8 A;  3POS A;  5CVR A;  3NST A;  5GZF A;  5CFD C;  3HNM A;  5JZG B;  4DTJ A;  3MO4 A;  2J1R A;  1BKZ A;  2OZ6 A;  2HBU A;  2Y60 A;  3LAG A;  4CPB D;  5A7W A;  4XFB A;  2ID4 A;  1BCX A;  2AUY A;  4BIS A;  4CA9 A;  4KG0 A;  3KHC A;  2VBP A;  4NN0 A;  1KS4 A;  4PI2 A;  4IV1 C;  3HQR A;  4E4D X;  3LZJ A;  3JD7 2;  2VNO A;  2RM2 3;  3ZFG B;  2ZXQ A;  3PJY A;  4RS5 C;  1GZW A;  2Q5T A;  4NPM A;  1YFU A;  4Z8B A;  2NP0 A;  1BJQ A;  5F7U A;  1D4V B;  1GWM A;  2IC1 A;  2X5I C;  1NCQ C;  3D6E A;  4KWJ A;  2JDY A;  4N9I A;  4R4Z A;  1WCQ A;  5IW0 A;  4IEO A;  4FXK B;  4BQ3 A;  3WF1 A;  1F4A A;  4LO5 B;  4CU9 A;  3KV9 A;  5T5J A;  3T0B A;  4YZ1 A;  4ADN A;  4O9G A;  2VTX J;  3I2D A;  1GWL A;  5A32 B;  2XBO 3;  4YGE A;  2VMI A;  2H4T A;  3S9H A;  1B09 A;  4M01 A;  1PO2 3;  3MZH A;  3CJI B;  3RFR A;  4CUC A;  2YGL A;  1MPX A;  1U5X A;  2W1S A;  2I45 A;  2NMO A;  3VZN A;  5C3R A;  5FXX A;  4YZ5 A;  3BUC A;  1PO1 2;  2WFF 2;  4IT5 A;  1Q5O A;  3HL8 A;  3Q8C A;  3WUC A;  2QDN A;  4AQS A;  3OPZ A;  4FO9 A;  1JZ3 A;  1ULF A;  5LK7 B;  1REF A;  1YO8 A;  2W5F A;  4B4Q A;  2OX0 A;  2WIN B;  4DRR A;  1DQ6 A;  2Y6F A;  2JHC A;  2TNF A;  4YW7 A;  1RL3 A;  4UF0 A;  2OW4 A;  4HXC A;  4Q0P A;  1AR6 3;  1GV9 A;  4A3Z A;  2ZEY A;  4E9K A;  1BBT 1;  1ULP A;  3KGZ A;  5IBK B;  1PMJ X;  3WSO A;  5FY7 A;  3T09 A;  3IBM A;  3RPQ A;  2RS5 1;  3M1H A;  2FDH A;  3ZXD A;  3BOD A;  2LRP A;  1RUE 2;  4B3N A;  1JBC A;  1WBF A;  4IE5 A;  1FMD 3;  4XUO A;  4IL7 A;  2XLA A;  4LTA A;  1V6K A;  2A3Y A;  2VMD A;  3WQ1 A;  1G86 A;  4H7L A;  2BOI A;  2Q8C A;  3O1U A;  5K9Y A;  1EUU A;  1QEX A;  1Z0H A;  3V56 A;  2OQ6 A;  5FXZ A;  3MUZ 1;  5C3S A;  4Q4X 2;  3U78 A;  4JGZ C;  5KR7 A;  3D82 A;  2X09 A;  3T08 A;  3VBO B;  2DVA A;  1HKD A;  1GOH A;  2F6B A;  3V0B B;  4Q26 A;  1SDW A;  3LOI A;  1PHM A;  1QJE A;  1RHI 3;  2PHR A;  4QU2 A;  2FCV A;  1UOJ A;  4AW7 A;  1EUT A;  5CKM A;  3FHI B;  4YM1 A;  4PLN A;  4D7Y A;  1QNW A;  4CCC A;  5CBL A;  5A7Q A;  1RMU 2;  4LBJ A;  3POY A;  1H9P A;  3VV1 A;  1QHD A;  4NRM A;  1UYP A;  3NNM A;  2X05 A;  4Q8K A;  1PGW 1;  4FSJ A;  3IT8 A;  4G3Y C;  2EIE A;  4FPJ A;  4XF1 A;  4YZ2 A;  3LDR A;  3MF6 A;  4GUL A;  2CAU A;  3KV5 A;  2HWF 1;  1WUV A;  3POF A;  4O7X A;  3RMB A;  5A7O A;  2FBE A;  5CA6 A;  2GC0 A;  3LE0 A;  4AKI A;  3F2Z A;  3M3E A;  3OF1 A;  1CPM A;  2XHN A;  4P5H A;  4AI6 A;  4PLM A;  3DXT A;  1LKN A;  2QQW A;  1GQP A;  5FZI A;  5GZD A;  3LCP A;  3U10 A;  1W6Q B;  3UJQ A;  1ZBA 2;  3W59 A;  4UW6 A;  4CUA A;  4E27 A;  5CAZ A;  3LB9 A;  1K3I A;  1XU2 A;  2FDI A;  1SQ4 A;  3S7E A;  4HLT A;  3UES A;  2OXB A;  1JZ8 A;  3HD8 B;  1RC6 A;  3CU7 A;  3JQX A;  2R30 A;  3JZV A;  2ZAA A;  4JRA A;  3T2Q A;  4COU A;  4K40 A;  3SCF A;  2PXJ A;  2Y0O A;  2WL1 A;  4XBN A;  4LOS A;  5DDJ 2;  3BVC A;  4N53 C;  1OF3 A;  2ZGU A;  3M8L A;  4TN7 A;  3X29 B;  3I2F A;  1BK1 A;  3KCY A;  1MS8 A;  5D8A B;  3U4S A;  3SEP A;  2XG3 A;  2W91 A;  3LPF A;  4QXK A;  3ETQ A;  4LLF A;  5C4W A;  1ZZC A;  3SXW A;  2UWA A;  5FFO C;  2JPN A;  2XOM A;  2ZJC A;  4JTO A;  1O6U A;  1ZZ8 A;  3PUQ A;  4MXW A;  4BK5 A;  1N47 A;  1UMH A;  5J37 A;  2NYY A;  4TWT A;  2LF3 A;  1OUR A;  1W6P A;  5D1I A;  3T2O A;  4BQ2 A;  2BPA 2;  3PME A;  2ZS6 B;  3PUH A;  4CCD A;  4CYD A;  2CGN A;  1I9R A;  3JXS A;  4A4A A;  5BNN C;  4AXO A;  4JHZ A;  4NIA A;  1TNR A;  4JGY B;  2R04 1;  2VJ5 A;  4EWA A;  5A6Q A;  1S0F A;  1F5F A;  2SBA A;  4FTB A;  3LQC A;  1D4M 2;  4ZU7 A;  3I2G A;  1FOD 1;  5I0D A;  2VCC A;  1UX6 A;  5CFD B;  2QZ3 A;  4OI0 A;  4EE2 A;  1XJA A;  4PQ9 A;  2IZW A;  1MEC 1;  3GCX A;  3GJB A;  4FVM A;  4BQW A;  4LK6 A;  1XU5 E;  1MQT C;  2JX9 A;  3NJZ A;  3PUS A;  5A1L A;  1H30 A;  5FZM A;  3NKG A;  4DS0 A;  5H9S A;  4MYE A;  5DPN A;  1H8T A;  4I9Q A;  4UFI A;  1WLC A;  4IV1 B;  2YBP A;  4BCU A;  1BMV 2;  4DTS A;  5FBJ A;  1TMF 2;  1J3P A;  4RS5 B;  1RIR A;  2DCT A;  4KGG A;  2JQT A;  4BDV B;  5FJH A;  4LMF A;  5F6K A;  5KHG A;  4J2D A;  1NCQ B;  2ETE A;  2X5I B;  4LT5 A;  4FK4 A;  3N35 A;  1KFX L;  1LJ7 A;  2W52 A;  3AP6 A;  3K3N A;  3UGF A;  3I3M A;  1IS6 A;  2ZHK A;  3MUY 1;  3CJI A;  4M4R A;  1V00 A;  1DU3 D;  4EN0 A;  4GAZ A;  4M3C A;  4QB2 A;  4GXL A;  3VGI A;  3I2I A;  3AMN A;  1FS1 A;  2GU9 A;  2CU5 A;  3TJY A;  1XND A;  3AVR A;  4JV4 A;  3OBZ A;  4W6Y A;  3R0R A;  4RR3 C;  4JRL A;  1PMI A;  1LGN A;  3LSE A;  3E97 A;  3NMB A;  4QPY A;  5IVV A;  1O3T A;  2D44 A;  1HXS 2;  3FE5 A;  2WYF A;  1PVX A;  3VL8 A;  3CKH A;  4CDW A;  3DV8 A;  1N1T A;  1F15 A;  2OUH A;  1FZ8 E;  3PTY A;  5FLI A;  1KD7 A;  2YRO A;  5A6Y A;  4XUQ A;  3I4I A;  4CZS A;  4FPF A;  4PCR A;  5I91 A;  3AZW A;  2HWE 1;  2XLF A;  3MFC A;  2EIC A;  4NVP A;  4GB3 2;  3BU0 A;  5CB7 A;  3FBM A;  5FZ1 A;  3N7J A;  2E33 A;  2ZA9 A;  1G8W A;  2DBN A;  1BBT 3;  4LPL A;  1UZZ A;  1W2O A;  4KI5 M;  4LO7 A;  4YVW A;  1MMO G;  1MZ5 A;  4AI8 A;  2E7Q A;  3ALQ A;  4CVU A;  2VO5 A;  4Q4Y 1;  2I74 A;  5FQ0 A;  1JW2 A;  2RS5 3;  2CV6 A;  3N7L A;  4AI1 A;  1PZ8 A;  1CAW A;  1ACC A;  1U5I A;  1RUI 2;  4FQ4 A;  1LOG A;  4QPG A;  4DEQ A;  1R08 2;  3CZU A;  4P00 B;  5EFU A;  3CLP A;  1CAV A;  2DTW A;  5LBF A;  1DZR A;  4A45 A;  1LDK E;  1UY1 A;  5FPZ A;  4FJG A;  1H4H A;  5EXO A;  1FYZ E;  5LA1 A;  4I3P A;  2E26 A;  4PDW B;  4AVB A;  4J2B A;  3FUQ A;  4JGZ B;  3QH7 A;  3BVO A;  2YMZ A;  1XE8 A;  4QPW A;  3ELN A;  1B35 C;  1DCS A;  3TNP B;  4HN1 A;  1IGO A;  5DAB A;  2WNV C;  1DQ4 A;  5J7M A;  2UUR A;  3PUR A;  2CWM A;  3ZYH A;  2XWJ B;  4AGR A;  2WNU C;  5JOW A;  1RVF 1;  4K8R B;  3VBF B;  1OOP A;  1ZBE 1;  3WG4 A;  5CFC C;  2OZJ A;  3ZN4 A;  1LHW A;  1RUJ 1;  4QQL A;  2IWG B;  1ULE A;  2GN7 A;  2GP5 A;  4MOA A;  3H1W A;  2VW2 A;  2GDF A;  3A23 A;  4OUE A;  3SI6 A;  3WP5 A;  2Y6J A;  3DPR C;  3J7L A;  5GLT A;  1QJX 2;  4FJL A;  2DVB A;  3ZKY A;  2BNO A;  2HWF 3;  3KVA A;  2G19 A;  4DIN B;  2RCU A;  1JYW A;  3V0A B;  4N8M A;  1IS5 A;  1G6N A;  1JYC A;  2HWC 2;  3AFK A;  5FP4 A;  2VNG A;  3FFQ A;  4D3W A;  3WF4 A;  1AVB A;  3NE6 A;  2WR9 A;  5FZA A;  3TN9 3;  3ZSE A;  2E7T A;  4LR4 A;  1O3R A;  1OXC A;  1KJR A;  4FK0 A;  1GAN A;  1DGL A;  1GQH A;  2ZX3 A;  1ALY A;  1RIT A;  1QJY 1;  1GMM A;  3EJK A;  1XVB E;  2DY4 A;  3C7E A;  4MAD A;  2J22 A;  4X8P A;  4XUP A;  3WW1 A;  1RUD 2;  1YQ2 A;  4FOV A;  4CEW C;  2YXS A;  1JI6 A;  4OYU A;  4HON A;  1S0I A;  5EZW A;  3UKN A;  1YUD A;  5GLU A;  3PVN A;  4HMZ A;  4LIV A;  3AP5 A;  4LBL A;  3SPY A;  1PIV 3;  4GJY A;  2B5H A;  5FPA A;  3ZIW A;  2UYB A;  4NJ4 A;  4GWN A;  5FJK A;  4E8C A;  4GQ7 A;  1XNK A;  4XTP A;  4B7K A;  1Z78 A;  3ACI A;  1ULD A;  3J8F 1;  3MIB A;  5H9R A;  2WII B;  1KQR A;  3Q8B A;  3U75 A;  1FPN 3;  3K4D A;  3KT4 A;  2HWB 2;  4XJZ A;  5H37 A;  4ADO A;  4CP9 B;  4AL9 A;  4FFF A;  5A3P A;  3NAE A;  1A8D A;  3EMR A;  3THD A;  5BNN B;  3L9J T;  5FYY A;  4XJU A;  2DCZ A;  4BLI A;  3ZYR A;  4CDQ C;  4BQY A;  2R04 3;  3ZMO A;  1COV 3;  1OHF A;  4YW1 A;  2JG9 B;  2DUQ A;  3MFA A;  1NY7 1;  1MHZ G;  4NHM A;  3WQ7 A;  3WF2 A;  5C3Q A;  1IPJ A;  4N90 A;  3T1M A;  5IVE A;  3VKN A;  2Q1M A;  2ZAB A;  3MV1 1;  1FOD 3;  1LOE A;  2WBK A;  2PHU A;  3SCH A;  1C5I A;  3BN6 A;  1F31 A;  1CZT A;  3PVO A;  3SHR A;  4C91 A;  2IVJ A;  1T2X A;  1ZRD A;  1HRI 2;  4HOO A;  1W2T A;  1MEC 3;  2PAE A;  1G9A A;  1UY2 A;  4XIK A;  2BZD A;  2DCK A;  2JJ6 A;  3LEK A;  4RQP A;  1MQT B;  5DAQ A;  2RR1 2;  4H14 A;  1S0G A;  4EQV A;  2PFT A;  4XAA A;  4FJ5 A;  3A0N A;  3T1L A;  1FV3 A;  1K5J A;  4OI4 A;  3T4H B;  5FOJ B;  1VBD 3;  3FJS A;  3MKS B;  1FX5 A;  4AEJ A;  5IUQ A;  5FPL A;  2MEV 3;  2RS1 2;  3FZ3 A;  1EYB A;  1XSQ A;  1ZVF A;  2YU2 A;  4ZKT B;  2XL7 A;  2BJS A;  5LEJ A;  1C57 A;  2P3Y A;  2E32 A;  4PT6 A;  5HXM A;  4DTU A;  2IXI A;  2XDV A;  1YCI A;  1DQ1 A;  4FQZ A;  2WNE A;  3RJR A;  3WDU A;  1S2B A;  4B4P A;  2G9Z A;  5JWP A;  5IWF A;  3H7Y A;  1GNZ A;  3UK9 A;  4GKX A;  1X9P A;  4M3X A;  5CZK A;  5L36 A;  1FZ3 E;  1QF3 A;  4Y24 A;  3H3U A;  2ZML A;  3INA A;  4C1W A;  2R06 2;  1DLC A;  1QU0 A;  2V72 A;  1QJF A;  2PAK A;  1JYN A;  5DZG A;  5LCW L;  2JEM A;  1CAU B;  1OFN A;  1BLZ A;  1JZ7 A;  2OUJ A;  4QT6 A;  2RMU 2;  1GSL A;  3RSJ A;  5FYV A;  4M3R A;  1PK6 B;  1N3Q A;  5F5C A;  2WWU A;  3KF5 A;  2JWP A;  2VW0 A;  2TEP A;  4PIX A;  2VZP A;  2Y6L A;  2VU9 A;  5JXH A;  1PNG A;  2RDS A;  1XSR A;  1YEW A;  2IXC A;  3AL5 A;  4I0B A;  5FKC A;  3VZM A;  2DUP A;  4K8F A;  5FP7 A;  4QHB A;  2VL4 A;  2Y33 A;  3LEG A;  2PN5 A;  4XDO A;  4G4F A;  4OQ9 A;  5IYY A;  2ARE A;  5CU1 A;  1RXG A;  3WR0 A;  5FYU A;  2VZU A;  2VY0 A;  2FD8 A;  2EXK A;  4OUS A;  3U07 A;  4AKH A;  1YXW A;  4FJ7 A;  3B5L B;  3NHG A;  4Q0S A;  5F37 A;  1W06 A;  5LRS A;  4Q4Y 3;  2E7A A;  3USS A;  1ZZ7 A;  2RKH A;  1RUH 2;  4LBK A;  3ORJ A;  4OI2 A;  1Q9Y A;  1W8T A;  1KDK A;  5J1X A;  3PU3 A;  4L97 A;  4XDQ A;  4XQ4 A;  2A3X A;  4AK3 A;  2WN2 A;  3ZDV A;  1H0B A;  2D6N A;  3VBU C;  2XQR A;  4AFB A;  3AK0 A;  4KGQ A;  4A2U A;  4GAM C;  1I5P A;  4XPV A;  3C6O B;  3N9M A;  4AOC A;  5FYH A;  1OA4 A;  3Q8F A;  5FCC A;  3WY6 A;  1LNS A;  3KV4 A;  2W68 A;  4Z2A A;  2LW8 A;  4QDR A;  4XUT A;  1H2L A;  2XH6 A;  4OHY A;  5DAW A;  4EWE A;  4W6X A;  4GMP 0;  5LZ6 A;  2UYA A;  1OKO A;  4BWO A;  2OVP B;  2V09 A;  1LUL A;  4PI0 A;  5C4W C;  3AXE A;  2WA4 A;  2WNV B;  3M3C A;  3A0K A;  1MS9 A;  1Q8V A;  4D0Q A;  1XE0 A;  3R4S A;  4AFC A;  2VOW A;  1YNA A;  4FVV A;  5GAL A;  1X8E A;  1UAI A;  5K0U C;  2BBV A;  1RVF 3;  1LOB A;  1DBN A;  2WNU B;  2PLV 1;  4FTE A;  1ZBE 3;  2ZGK A;  4D7S A;  2ARC A;  5ANN A;  3VBS A;  3SLI A;  4YSF A;  2OVU A;  5CFC B;  1RUJ 3;  1AJK A;  4YW5 A;  1QH6 A;  1VRH 2;  2WA3 A;  4SLI A;  1ND3 C;  2PQS A;  3B69 A;  4XHB A;  4XMI A;  3KMH A;  3DPR B;  5FYS A;  4AVA A;  2ERF A;  5CIS A;  2MZW B;  1AUY A;  1WGP A;  2C0Z A;  3DXU A;  4DQA A;  4MET A;  2PA7 A;  2QVS B;  3CBN A;  3C7O A;  4I30 A;  3WX5 A;  1LOF C;  4HSJ A;  1DZT A;  3F95 A;  3ZSM A;  4URA A;  4P9L A;  2WZR 1;  1JUI A;  5A3L A;  2DUR A;  2RM2 1;  1RUC 1;  1KDM A;  1J3Q A;  4Q0V A;  5T3N A;  1A78 A;  4WV8 A;  1HV1 A;  1WCK A;  1BEV 2;  1NAE A;  4RGA A;  5JVV A;  3R05 A;  1W8N A;  1EAH 1;  1ENR A;  1L7L A;  5FY1 A;  5HCA A;  2PHX A;  4N53 A;  4AED C;  1QJY 3;  3OYW A;  4OFG A;  4R9D A;  3WP4 A;  4E2S A;  1TNF A;  2IFR A;  1GZW B;  1Y9G A;  2ORZ A;  5DQ0 A;  2XML A;  1PZ9 A;  3S5Q A;  3WW2 A;  1YFY A;  4YG3 A;  2VGD A;  5IK4 A;  5CKN A;  3O1O A;  1C8M 2;  2JHP A;  4FXG B;  3SH4 A;  4D8M A;  3QCW A;  4V2V A;  2A75 A;  1VE0 A;  1G7Y A;  1PO2 1;  2E53 A;  2R07 1;  1F5J A;  4PQQ A;  3B93 A;  5FZO B;  5T52 A;  1OFS A;  3VKM A;  1A34 A;  1WCU A;  2RJ2 A;  4UT5 A;  3J8F 3;  4KWL A;  4XZP A;  2HWD 2;  1XL3 C;  2NZ9 A;  4DIQ A;  4TLF A;  1S2E A;  1XBF A;  2JE7 A;  2JB8 A;  5FWE A;  4HSL A;  1XMH E;  2DDU A;  3QNN A;  1HB3 A;  1IS3 A;  1DFQ A;  2YG0 A;  5FXW A;  3VDB A;  4AYU A;  2JIG A;  4XBQ A;  3N1E A;  2L9L A;  3I97 A;  4QM8 A;  4CDQ B;  4CDW C;  5ABJ A;  1JOB A;  2ZHN A;  4M3Z A;  2EA7 A;  3AXD A;  1U5Y A;  3EHK A;  3MEP A;  5I8S A;  2RDQ A;  3EO6 A;  1FZ6 E;  1MTY G;  1AR6 1;  2BOJ A;  1MQT A;  1ONA A;  3POI A;  4XFC A;  4RL5 A;  4W65 A;  3RZZ A;  2Y8K A;  2VNR A;  1IH7 A;  3QNO A;  1Q9X A;  2VQU A;  4HAN A;  4TTG A;  3KLS A;  1PZ7 A;  2DVG A;  4O61 A;  1WW5 A;  2VMG A;  3GZA A;  4K21 A;  1W8O A;  4UF0 B;  5LY2 A;  2XBO 2;  3TAG A;  1OH4 A;  1NX9 A;  4K1Z A;  4NIG A;  2WQZ C;  2XPJ A;  4LO8 A;  4PF5 A;  4CSW A;  3AMQ A;  4WVM A;  1WAJ A;  1OH3 A;  3HR9 A;  4QGM A;  3BTY A;  3UKV A;  4Y5Z 0;  4ITC A;  4NOT A;  1PX3 A;  2QNK A;  1UZW A;  3WF0 A;  2K2S A;  1CR7 A;  5J09 A;  3VD4 A;  1LHN A;  4XMA A;  3RZL A;  5CEH A;  5HPO A;  4BJ0 A;  1LEC A;  2YPD A;  5E8A A;  3OGL B;  3WOG A;  4KHW A;  2EVX A;  3E6B A;  2XGX A;  4I02 A;  2QQJ A;  1Q8S A;  3B3Q E;  5FY4 A;  4OCT A;  1SLT A;  2XB6 C;  5B2G B;  4LE4 A;  4JAA A;  3FLR A;  4RR3 A;  2UY8 A;  1GLH A;  5TSW A;  4NHL A;  1UY0 A;  3WDX A;  4GZ9 A;  2ATF A;  2J7M A;  3OD0 A;  5LAS A;  1NQD A;  5GLW A;  4B1M A;  1M4W A;  2YC4 A;  3RZJ A;  2QQL A;  1LU1 A;  1R1A 2;  1AL0 G;  2P17 A;  1XVG E;  5F5I A;  3SKJ E;  1W28 A;  4M41 A;  1OOP C;  2JE8 A;  2P3K A;  3E6D A;  3UT0 A;  5FZL A;  3JB8 A;  1E57 A;  3IPV A;  5LBB A;  1YI7 A;  3FL7 A;  4GH4 A;  1HRV 2;  4LA2 A;  1CWP A;  5J3U A;  1UIJ A;  1WME A;  4E4Z A;  1AL2 2;  4J2A A;  4C1X A;  1V9U 1;  1RB8 G;  3N7K A;  3OGM B;  1ZNP A;  3K46 A;  2W95 A;  1DHK B;  2JDP A;  2JDU A;  1AHS A;  3O1P A;  4FPG A;  2VC9 A;  1QY4 A;  1H2M A;  3NCI A;  2ILM A;  3LZI A;  4Y5T A;  3ZIX A;  4KG8 A;  3IZO A;  3TAB A;  5FTT C;  2OQ7 A;  2G9G A;  2VZ1 A;  3GBG A;  3VD5 A;  3WNK A;  5IAV A;  3LDS A;  4DXR A;  4E8D A;  4P9X A;  1HQN A;  2OA2 A;  5F32 A;  1Z7S 3;  2Z79 A;  1QJU 1;  2ZGQ A;  3GM8 A;  5G05 L;  4AAP A;  1X9T A;  3Q8A A;  4BIO A;  4QMA A;  3FMG A;  1QOS A;  4LHK A;  2A3W A;  3JBG 1;  4BHP A;  1B35 A;  4CP1 A;  1DP0 A;  1RUF 2;  3RVH A;  2HD0 A;  5FO8 B;  1JZ2 A;  1TE1 B;  2YC2 A;  4QX0 A;  4FAH A;  5FZG A;  2BGO A;  2RS3 2;  3N9L A;  3GXU A;  5T5O A;  3UV9 A;  5A80 A;  1UMZ A;  1JN2 P;  1K42 A;  1AR8 1;  3H3Z A;  5FP8 A;  1P22 A;  3OGK B;  2XJT A;  5C4W B;  4FPL A;  4JRQ A;  1W04 A;  5AC9 2;  1VB4 A;  3SCG A;  1GWK A;  2DCJ A;  3NVC A;  1WW4 A;  4DB5 A;  2BP6 A;  1RTV A;  1XNC A;  4N7U A;  3UET A;  3SIT A;  4BB3 A;  1MS4 A;  2KXL A;  5G04 L;  4JDM A;  5JDB A;  1UY3 A;  2NN8 A;  3TAF A;  1DIW A;  2ZEX A;  2PLV 3;  3A4U A;  3DPR A;  3GBW A;  3J7H A;  4KL1 A;  4A44 A;  2C9K A;  1RGS A;  4I6J B;  2NLR A;  4CDX A;  5FMO S;  3L8B A;  1T6B X;  4MO3 M;  1JYV A;  1OVP A;  2GNB A;  1ND3 B;  2OT7 A;  4YWA A;  3WF3 A;  1DDL A;  3RYR A;  3CMG A;  1HN1 A;  4QD2 A;  4SBV A;  3ON7 A;  3P3N A;  3H9A A;  2NPI A;  2ZHL A;  2XJP A;  5IVF A;  4DTO A;  1OC1 A;  4AAX A;  1W6M B;  3QET A;  5KWR A;  1VBB 3;  1ZZB A;  4IND A;  3NGI A;  4MGT A;  5JI7 A;  4RQP C;  2DU1 A;  2WZR 3;  4FI9 A;  4YRD A;  2WWS A;  5EJ1 B;  4FFH A;  1RUC 3;  2VJX A;  5FZF A;  3WNN A;  3QER A;  4AGG A;  4CEW A;  3VB9 A;  1H1M A;  2ES3 A;  3PVE A;  1APN A;  1EAH 3;  2D3P A;  1H8T B;  4FPH A;  1WAF A;  5GJ6 A;  1NZC A;  3BTZ A;  4P5Y A;  1H6X A;  3QEI A;  4AED B;  2VUA A;  2W9X A;  2PFV A;  4LA3 A;  5A3W A;  4FPY A;  2JH8 A;  4OHZ A;  4QGN A;  4AFA A;  4C90 A;  2MHF A;  5FZO A;  5A3T A;  1JOP A;  3QEP A;  3NV1 A;  2EAL A;  1EY2 A;  1ASJ 2;  1HDK A;  1K5M A;  2WFF 1;  3S7I A;  3UO2 A;  5BNP C;  3THP A;  1UU4 A;  4NRQ A;  3VHP A;  5KHK A;  1DGW A;  4YM0 A;  2R07 3;  4Q27 A;  3ETP A;  3QH6 A;  4Y5S A;  1FI2 A;  3EYP A;  1X7N A;  3CFR A;  4IES A;  4M3C B;  5SV5 A;  4CDQ A;  2ZTN A;  4NIH A;  3R4U A;  3FUO A;  3ZX7 A;  1NA1 A;  1LTE A;  1W9S A;  3ATG A;  3PHM A;  4MHU A;  4EN7 B;  4FTS A;  2WS9 2;  3VLB B;  1RUG 3;  2WO3 A;  3DUI A;  4FCA A;  2AAC A;  4D6Q A;  4MSV A;  3MYX A;  3VDC A;  3SQ2 A;  2EXJ A;  3ZMN A;  5FO9 B;  3AMP A;  1JZ6 A;  1ZRF A;  4I01 A;  5H9Q A;  2GMP A;  2PHF A;  3W20 A;  4CDW B;  5FWJ A;  3CF6 E;  3IDE A;  3RMA A;  3AYD A;  1RUE 1;  4RHV 3;  1FZ4 E;  2GN3 A;  3NQH A;  3R4D B;  3N9P A;  4MH0 E;  3ROU A;  1BVV A;  1OSG A;  4DTM A;  4WVW A;  1O4Z A;  3M70 A;  1KS5 A;  2BWA A;  1J83 A;  2VQA A;  3TRS B;  2D6L X;  3PL0 A;  4L8Q A;  1VBC 2;  1OD5 A;  4L92 A;  4Q4X 1;  4YVW B;  5T5P A;  1XVE E;  4NWW A;  1FZ9 E;  1CVN A;  1W0P A;  2CTV A;  3BYW A;  4QB6 A;  4KNC A;  1REE A;  5F6L B;  3WZ1 A;  4A7K A;  1C1F A;  1QXJ A;  3AKP A;  4Z07 A;  5FQ0 B;  5JMO A;  1XVD E;  4X5N A;  4M3U A;  2JE9 A;  4RN5 A;  1MZF A;  1CAW B;  2GC2 A;  5FY8 A;  5A3M A;  2ARA A;  3LPG A;  4NID A;  2IXL A;  3PDQ A;  4QPG B;  4BE3 A;  4DXS A;  2XJQ A;  4GMP 1;  1ULO A;  1CAV B;  1KXG A;  1OF4 A;  1RMU 1;  3DEM A;  4MX3 A;  4XF9 A;  1WMF A;  4AVV A;  1QOT A;  2JDZ A;  1XYN A;  1AX0 A;  1EPW A;  1BBT 2;  2RE9 A;  4BPZ A;  4CE8 A;  4KWU A;  1DG6 A;  3LFM A;  3SJJ A;  2ZMN A;  3H8O A;  5DUV A;  2RS5 2;  2A6Y A;  3SVI A;  4FJH A;  2EXH A;  4Q4V 3;  1OVS A;  2A1X A;  4I3G A;  1OOP B;  3VKO A;  1FZ1 E;  3LEM A;  3VBS C;  4FFI A;  2Z2S B;  3OBT A;  5JIA A;  5IK8 A;  3OY8 A;  3ENR A;  3ZR6 A;  2W87 A;  3VKL A;  2FZ1 A;  5AVP A;  1OLQ A;  5HBA A;  1LEM A;  2WT1 A;  1NOV A;  1V9U 3;  4UXA A;  2DFC A;  3WD5 A;  4IEY A;  4MGZ E;  2MMB A;  2ZGS A;  5T54 A;  1OQD A;  4ORF A;  1SG3 A;  1W0N A;  3TN9 1;  4JRP A;  1R1Z A;  5E16 A;  4XJ9 A;  1SBD A;  1VJ2 A;  4AI0 A;  4UI9 L;  3K48 A;  1MHY G;  1VAL A;  2X29 A;  2UWC A;  3FC0 A;  4J2E A;  1Q56 A;  1WD4 A;  5IK7 A;  3O12 A;  4EYW A;  3VBU A;  1UKR A;  5M0T A;  2GZW A;  3PJQ A;  1D2S A;  5GZC A;  1YQC A;  2BYV E;  5F3I A;  1QJU 3;  4BZ4 A;  4R52 A;  3III A;  4URT A;  3WUD A;  2CGP A;  4U2A A;  1PIV 1;  3JBG 3;  1DGR N;  3RYK A;  2VMF A;  1HIX A;  4R8H A;  3I54 A;  3AMM A;  3LIH A;  4HT1 T;  2BTV C;  4AVS A;  4CXW A;  1JMU B;  4DU1 A;  3LFI A;  2PHD A;  2CGO A;  5K8S A;  1D4M 1;  2V5D A;  1J1L A;  1E5I A;  1FPN 1;  1AR8 3;  1ULC A;  5K0U A;  2DTY A;  4YAR A;  1PVC 2;  3RWN A;  4N9H A;  1CLQ A;  3HQX A;  3MBW A;  4Z82 A;  2B7Y A;  2IFW A;  2J1E A;  1YJK A;  1COV 1;  1ND3 A;  4JKM A;  2Q8D A;  5AFE A;  1ODM A;  1VAV A;  1RJ7 A;  1SAC A;  1WW6 A;  4IEW A;  1Q43 A;  3JQW A;  3I3Q A;  3M2M A;  4JC1 A;  4Q4W 2;  4B8E A;  4DRV A;  4DXZ A;  3I7D A;  1E5R A;  3OGV A;  3IDB B;  1VIW B;  1SPP A;  3B94 A;  4IGO A;  4Z1V A;  4FJN A;  3WG2 A;  1K45 A;  4LOT A;  2V4V A;  3OGJ A;  5ABJ C;  5F1R A;  1W6M A;  1QDO A;  3AVS A;  3NJV A;  3K2O A;  2RVA A;  1ODN A;  2B39 A;  1LOF A;  3JD7 3;  5KXB A;  3LSD A;  1YRZ A;  2RDN A;  2DU0 A;  2P2K A;  1TMF 1;  1IKQ A;  3E5U A;  2UY9 A;  5DMY A;  4HCB A;  1CAX A;  2ATQ A;  2F17 A;  2OYZ A;  1TEI A;  3SC7 X;  3T2P A;  2G1M A;  2FMY A;  1VBD 1;  3ACG A;  4OZO A;  4EN9 B;  3BTA A;  2MEV 1;  1Q8O A;  1FXX A;  3Q9O A;  4RQP B;  5BV6 A;  3N9O A;  5BNO A;  2VJ4 A;  1W39 A;  3JB4 C;  4AED A;  3TEY A;  1OI6 A;  4HVO A;  3UKT A;  4WM8 A;  1BZW A;  1JZ5 A;  3U1X A;  4CU6 A;  1DGR A;  5CG8 A;  4KMQ A;  1NEX B;  3OGR A;  3VKF C;  1V6M A;  1XNT A;  3CNA A;  1WCD J;  1SFY A;  5LRR A;  1MZ6 A;  5B4N A;  1PNF A;  2V73 A;  5IZ7 A;  4P9J A;  3R6S A;  3NJY A;  5HCH A;  3WDW A;  4XFG A;  3O0V A;  2WFF 3;  2AR6 A;  3WHT A;  5KXD A;  3ZOI A;  5BNP B;  3RZM A;  5E88 A;  4BQ4 A;  2D5H A;  4Q0U A;  2GME A;  1WWY A;  1QIQ A;  1IG9 A;  5E6H A;  5LBC A;  3CEW A;  1UOG A;  4FBF A;  1G9D A;  3T4V A;  2K46 A;  1CON A;  4K9S A;  3KV6 A;  1GP5 A;  1MZE A;  4XHX A;  3VD7 A;  1A8M A;  4ZHN A;  1G9F A;  1POQ A;  1ZZ9 A;  1NKG A;  3HNB M;  5C9A A;  4CRQ A;  1CIW A;  4XE9 A;  3ZFF C;  3VBR C;  3HT2 A;  4FT8 A;  5FBZ A;  4EZH A;  5KHJ A;  4ZXE A;  4GH4 C;  1HX6 A;  1RUE 3;  3C2U A;  4ZZ8 A;  3D0S A;  4KHU A;  2BNM A;  2XWB B;  4JS5 A;  2Q0A A;  2R0F A;  3HAG A;  4MZU A;  4F3J A;  2WC2 A;  3THC A;  4B29 A;  1UN1 A;  4HK9 A;  1BYH A;  3I2J A;  1FZ0 E;  2UU8 A;  4IE4 A;  1HW5 A;  5J98 B;  1AX2 A;  3SQ1 A;  1UU5 A;  1VBE 2;  4EPH A;  4Q4X 3;  3AX4 A;  1QQP 2;  1VB2 A;  2WUH A;  4I9L A;  5JLV A;  1HQL A;  2FDJ A;  1AF9 A;  3BGA A;  5C3O A;  4WZC A;  2Z4F A;  3SUN A;  4BXF A;  3VL9 A;  3RMC A;  2FDK A;  4L2N A;  3WP3 A;  5IAX A;  4GMP 3;  2QKD A;  5ANQ A;  1L7R A;  4A6O A;  1RMU 3;  4PLO A;  1FZ5 E;  1X36 A;  2XKP A;  3HMY A;  2R32 A;  3MPP G;  1PGL 2;  4RD7 A;  2HWE 2;  3WXP A;  2DV9 A;  5JSP A;  1HB1 A;  4YFW A;  4YVS A;  4CDU A;  2D93 A;  3AKT A;  4LUL A;  1DQ5 A;  1JZ4 A;  4E4B A;  3ZN5 A;  1OLM A;  2D7F A;  1QXP A;  3D8C A;  3AKQ A;  5C8C C;  4BMB A;  1JYT A;  2XHK A;  2ADD A;  4L0P A;  2H6C A;  3N3H A;  5JSO A;  2FW3 A;  1GZ9 A;  5FZ7 A;  4BXS V;  1UOF A;  2BQP A;  2F4L A;  3HBZ A;  3OPT A;  5A7S A;  3RYP A;  5EIY B;  3LA3 A;  4CDX C;  3VBS B;  3ZXK A;  4LJH A;  1AYN 2;  2J1S A;  3E1F 1;  5GLZ A;  2AH2 A;  1UWW A;  5I0U A;  4NWV A;  3WNM A;  5EP9 A;  4HPK A;  3VBH A;  4XJ8 A;  2WAO A;  1W3X A;  2YFZ A;  3H3L A;  3ZKU A;  1J59 A;  2P3J A;  1ZZ6 A;  1AX1 A;  2PEL A;  1NCR C;  4CEY C;  4XW3 A;  5FUN A;  3P6B A;  1W90 A;  5JR2 A;  1AYM 2;  2K0G A;  1NLR A;  3B9C A;  2D6K A;  1YQ8 A;  2AEZ A;  5FZ9 A;  2ZGR A;  4UW5 A;  2D3R A;  3T30 A;  4MGK E;  2HYX A;  2W94 A;  1AR7 2;  1U12 A;  2Z69 A;  3M3Q A;  4PBO A;  1ZBE 2;  2R1D A;  4ET7 A;  4BOW A;  4LXL A;  5C5T A;  1F4H A;  4ZY9 A;  4ZZ5 A;  1WBL A;  3MIE A;  4AWD A;  2HWB 1;  2JXA A;  1I5Z A;  2P1B A;  4IEX A;  4N53 B;  3OYW B;  5JMC A;  4FPO B;  3AZX A;  4Y33 A;  3TAE A;  2BU9 A;  2QQK A;  2VH9 A;  2BDR A;  5FYC A;  3U4X A;  3LDK A;  5L9R A;  2GND A;  5ACA 2;  5JXG A;  2PTM A;  1EV1 1;  1K5M C;  5FIX A;  3WG1 A;  1D4M 3;  1QGL A;  3W58 A;  2ZPX A;  5DZE A;  4GA9 A;  1TME 2;  3MLL A;  4AE2 A;  1IS4 A;  4RFR B;  4YFZ A;  3WW4 A;  4AHX A;  4LK7 A;  2WAB A;  1HRI 1;  2E6V A;  3CL1 A;  3K3O A;  4MGI E;  1NA1 C;  5F3C A;  3DYO A;  2JB4 A;  1ND2 A;  1V6N A;  2BUK A;  2C26 A;  4QXH A;  5D2A A;  2ORX A;  2RR1 1;  2RJL A;  4CPB A;  5FPX A;  4GAL A;  4NPR A;  4XFF A;  5ABJ B;  4CCJ A;  1S2K A;  4YW2 A;  3BPS A;  2ARX A;  2VZO A;  3MIG A;  3QES A;  4ARX A;  1TMF 3;  2JDA A;  4TSV A;  1S0D A;  1SEF A;  1O4T A;  4K1Y A;  4A7Y A;  1NT0 A;  1XE7 A;  4W8J A;  4BU2 A;  5L73 A;  4AHZ A;  3DN7 A;  3LA7 A;  3MW4 A;  5FDB A;  3AJZ A;  1CJD A;  2ZEZ A;  4QB1 A;  3AL6 A;  3TL8 B;  4WVM B;  2W0X A;  3I59 A;  4ASK A;  3AM2 A;  3VZO A;  3FHA A;  3OJB A;  4AFD A;  3BCW A;  4MGY E;  1WLD A;  4Y1Y A;  1C3H A;  4UOJ A;  2RMU 1;  1SLI A;  4AI2 A;  4EWD A;  3I3D A;  5BNP A;  3NJX A;  1NY7 2;  2X53 S;  4YW4 A;  1SMV A;  1HXS 3;  4FOW A;  2GC1 A;  4X6R B;  4RGG A;  5SV8 A;  3LIG A;  4DMI A;  2J42 A;  5EWS A;  3VZL A;  1QKQ A;  3AP9 A;  3GGL A;  5EV7 A;  3VHN A;  4J1W A;  2B45 X;  4RR3 B;  4J1X A;  1HB2 A;  3HJR A;  3PTR B;  3T0A A;  3TOJ A;  5C5U A;  2ZAH A;  2C9A A;  3VD3 A;  4ISR A;  4BM8 A;  2PAM A;  4GB3 3;  1DLL A;  2ZZQ A;  2WZP P;  2G9F A;  2DVD A;  2H6B A;  3FLP A;  2DWR A;  1QH7 A;  4QKD A;  3W5M A;  1UPS A;  3URF A;  5JOZ A;  3O1S A;  3B02 A;  2WO2 A;  4F83 A;  4AVT A;  4QHO A;  3CIH A;  3IPV B;  2VMC A;  4R9A A;  3WP6 A;  5A33 A;  2VE1 A;  4GH4 B;  2BNN A;  2R7E B;  5IHR A;  1N1C A;  4IEP A;  1VBA 2;  1RUI 3;  4OLL A;  3L2O B;  2IXK A;  4W4Z A;  2WZ8 A;  5HCF A;  3ZXL A;  5FMC A;  3AC0 A;  1R08 3;  1UZY A;  3JUU A;  3K4Z A;  4B1L A;  3SQO A;  3KD1 E;  4CCK A;  2OZS A;  4LBQ D;  3I49 A;  3ITQ A;  4HN0 A;  5GLV A;  4XTM A;  3FN9 A;  5FAX A;  2E9Q A;  5A1F A;  1YFX A;  1FNY A;  4XET A;  4U36 A;  2JD4 A;  1Z7S 1;  2PMW B;  4JS4 A;  3PUI A;  4NRO A;  1UCX A;  2IUW A;  3HNY M;  1HN0 A;  4F8A A;  5ISL A;  4QXC A;  4EN8 B;  2JIC A;  2TBV A;  5A1A A;  4JQR A;  5JOX A;  1H6Y A;  2EAK A;  4ZS2 A;  3I2H A;  2ADE A;  1A3K A;  4XAC A;  3BI3 A;  4MVT A;  4NAM A;  4AI9 A;  2JKB A;  2VXJ A;  4MV2 A;  1B35 B;  4OUL A;  1KJL A;  3FBY A;  4K3U A;  3M3O A;  4LHN A;  3I3B A;  1H2N A;  4FP3 A;  2QTW B;  2JDM A;  1G9C A;  3N9N A;  2PHW A;  3DYP A;  1NG0 A;  4CXY A;  4ATF A;  3P1I A;  4CCL A;  3O5S A;  3E4W A;  3UGG A;  5FY0 A;  4RG8 A;  1DYO A;  2HH9 A;  4XAE A;  5BY5 A;  2P3I A;  1OUX A;  2ZGM A;  5B4X A;  2P1Q B;  4Q5O A;  5IFT A;  4H55 A;  2P1M B;  1VMJ A;  2ZEW A;  1YLL A;  1XRU A;  2VZR A;  5FK8 A;  3RWK X;  2WRA A;  3L2Y A;  4KHS A;  2WQ4 A;  3VDD C;  4CDX B;  4LHS A;  2VW1 A;  1ZRI A;  3IKW A;  1BEV 1;  4HBN A;  2C4X A;  1S0C A;  3AYE A;  3VN4 A;  1VBB 1;  3SH3 A;  5C70 A;  5IAT A;  1AR9 2;  1GOF A;  3OEA A;  4LKE A;  1RIN A;  1YFW A;  4XIL A;  4HVR A;  2W2I A;  5FP9 A;  2WNO A;  1RUD 3;  1YI9 A;  2JDK A;  4LE3 A;  5BXX A;  1IQD C;  3J7M A;  2VAU A;  4QX3 A;  2EXI A;  3USU A;  1W3V A;  4BYY A;  1UYZ A;  3POG A;  1C8M 1;  2BVV A;  1O8P A;  3AP7 A;  1RYY A;  5BNO C;  2BVB A;  4RNG A;  3LGR A;  4C0B A;  3KB5 A;  2OS2 A;  2YBS A;  1BHG A;  3VZJ A;  4CEW B;  3V7D B;  4WM8 C;  1DGW X;  1SLL A;  5EPA A;  4ZU5 A;  3RZG A;  2HWB 3;  2Q1F A;  3V64 A;  1IPK A;  2YB7 A;  5L7O A;  2AGS A;  3ACH A;  2VMH A;  1H2K A;  4Y1Z A;  3KD4 A;  3MIC A;  4OQ8 A;  1STM A;  2V5Y A;  1EV1 3;  1K5M B;  3O1T A;  2BW8 A;  1CD3 G;  1DYK A;  3HEI A;  3ZYJ B;  1H4G A;  1NLQ A;  3ILR A;  4AVC A;  2OVR B;  4Y20 A;  3M3I A;  5FZB A;  1RUG 1;  4UFJ A;  3QEX A;  1DYP A;  1IHM A;  1PX4 A;  2RM2 2;  1HRI 3;  4KBZ A;  5CKQ A;  3OEB A;  3ASI A;  4LKS A;  1NA1 B;  4QKF A;  1LHV A;  3KSC A;  1XVC E;  5T5L A;  4RHV 1;  1EAH 2;  1CES A;  2RR1 3;  2JDN A;  5FK7 A;  4ATE A;  3SQ0 A;  2Y64 A;  3J2P A;  4UW3 A;  5C9A C;  4XQD A;  4DTN A;  1LES A;  4K20 A;  2WAA A;  1FZ7 E;  1Y3T A;  3ZPY A;  3TWI A;  3ZFE A;  1H1I A;  4PJY A;  3H8U A;  3ZN6 B;  2RS1 3;  2WLP A;  3DKW A;  1SLA A;  1XU3 E;  4LIU A;  3LD8 A;  4EV0 A;  1GNY A;  1LR5 A;  1UPI A;  3PIG A;  1LOC A;  2ZMK A;  1PO2 2;  2P5B A;  4QDS A;  4DTP A;  4DZG A;  2VOV A;  4LO6 B;  5LY1 A;  1HB4 A;  1W8F A;  1FZI E;  5HV4 A;  2ENR A;  1Q8Q A;  2DBI A;  3NL1 A;  5D21 A;  2Q8O A;  1W8U A;  2O0O A;  4COZ A;  3GHN A;  1V6O A;  2NMN A;  3LF7 A;  4Y4R A;  1MS0 A;  3CZJ A;  5A3O A;  2P1N B;  3HN1 A;  3OUJ A;  4XC9 A;  4IE7 A;  4E4H A;  2W1Q A;  4QAW A;  4D6R A;  2RMU 3;  3ZXJ A;  3CFO A;  5K7P A;  2QQP A;  4FJI A;  2D97 A;  1BQP A;  5EQU A;  4CP0 A;  1OPM A;  2VVE A;  4YM2 A;  1CJP A;  3MHZ A;  4JDN A;  2IXJ A;  1AR6 2;  1SFN A;  1ENS A;  4PIY A;  3ZSJ A;  4GJZ A;  3KGL A;  5T55 A;  5FPB A;  2AYH A;  1HRV 1;  4RGK A;  4YVS C;  5FZ4 A;  4CDU C;  5JI9 A;  4ES8 A;  4CP2 A;  1AL2 1;  1NQJ A;  4DY5 A;  4WVZ A;  4Q4V 1;  4HL0 A;  1SLC A;  5KC5 A;  1FMD 2;  3DCQ A;  3VBO C;  3ZFF A;  3VBR A;  2WWJ A;  4Z2W A;  1MAC A;  2XON A;  1ZA4 A;  1JHJ A;  2VCA A;  3O1V A;  5I8T A;  2BBA A;  3C3V A;  4M3C E;  4Y1X A;  5GKA C;  2XL9 A;  5A7P A;  1LED A;  5FZK A;  1C4R A;  1R09 1;  1XMF E;  2QQM A;  3CDZ B;  4Q0Q A;  1RUH 3;  3QOP A;  4IGQ A;  4AHY A;  5FV3 A;  2XJU A;  3OY8 B;  4AQT A;  4QX2 A;  4L9B A;  4R9C A;  4CCM A;  2GMM A;  3AB0 A;  4LLO A;  3RS6 A;  1RHI 2;  3RDI A;  2CNA A;  3LA2 A;  3CJX A;  5F5Q A;  3VBH C;  5C71 A;  2A71 A;  3WDV A;  4OHW A;  3M4F A;  1RUF 1;  5EJZ B;  1XYP A;  3BPZ A;  4QU1 A;  1L3J A;  4AZZ A;  3RZK A;  4FJJ A;  2RS3 1;  3D5O A;  4YNI A;  4YG6 A;  2DEB A;  1R64 A;  2EID A;  3AZY A;  4RYD A;  4Y22 A;  1OBN A;  5FLH A;  4YYO A;  3GZT B;  3ZYP A;  5KHI A;  3VBU B;  4ISQ A;  5AC9 1;  5JPM B;  3C94 A;  2G4I A;  4XEZ A;  3FLT A;  4XUR A;  1XOY A;  1JH5 A;  1SZB A;  4FJK A;  2Y6G A;  1C28 A;  2QE3 A;  2B7M A;  3BOP A;  3KQR A;  5C8C A;  1E5H A;  1JU4 A;  5DG2 A;  1SCR A;  4LNV A;  1IOA A;  5J36 A;  2QQU A;  3SMH A;  4Q1R A;  3ZO0 B;  3HPN A;  4PBP A;  3WT3 A;  3AFG A;  1O91 A;  2WDB A;  2WT2 A;  4MUV A;  5K0U B;  5FYT A;  4UBG A;  3KD5 E;  5IFP A;  2P1P B;  3H0O A;  3T0D A;  3K51 A;  4NMI A;  4WM7 A;  1POV 0;  4GIQ A;  3B01 A;  4FPK A;  3RI8 A;  2WKK A;  3U37 A;  5FYM A;  5BYN A;  3GF6 A;  1LHU A;  2B42 B;  4LUK A;  4H2A A;  2D6M A;  1ND2 C;  3SUP A;  4IE0 A;  1NLS A;  4R4X A;  3JD7 1;  3SH5 A;  3LKJ A;  5BPX A;  4KU7 A;  1SPP B;  4ONU A;  4JHT A;  1OLM E;  3IM0 A;  1BEV 3;  3JBG 2;  3C6P B;  1NCR A;  3JCI A;  4P14 A;  3SEE A;  4CEY A;  5BNQ A;  3N4M A;  1SCS A;  2PHL A;  1T6G C;  4FP2 A;  4JGY C;  1UX7 A;  2QZ2 A;  4BLJ A;  2BEO A;  3ZYI B;  5E89 A;  3PLQ A;  1GZT A;  4YZ4 A;  1N3O A;  3S6P A;  3D3A A;  4ASL A;  2Y38 A;  3POJ A;  3APB A;  4CUB A;  4FAG A;  1CAX B;  2FCU A;  2R16 A;  4P9W A;  3V0B A;  1ASJ 1;  2E51 A;  4M3Y A;  1C8M 3;  4QPI A;  5CAD A;  5BNO B;  2MNG A;  4QHZ A;  1RUN A;  2LS6 A;  3IMM A;  2EIG A;  4WM8 B;  2VBD A;  4DEV A;  4LKD A;  4FJX A;  2HWD 3;  2HLE A;  1GOG A;  2SLI A;  4JQT A;  4PIZ A;  1PO1 1;  3ZSK A;  1JYX A;  3D4K A;  5DN2 A;  4UFL A;  5CNA A;  2P4E A;  2WS9 1;  1GIC A;  4TXW A;  3WNO A;  3UIQ A;  3N1B A;  2ZGP A;  2P5G A;  5HCB A;  5FZH A;  1ZA7 A;  1A6C A;  3KZ4 C;  3BTX A;  1MR5 A;  2C24 A;  1TZO A;  2IXH A;  4M3C F;  2VVF A;  4HFS A;  4YW6 A;  4IE6 A;  3OB8 A;  3EXU A;  3J4U H;  4M4P A;  5CYY A;  3GZE A;  5I0R A;  4D69 A;  4I09 A;  2B1E A;  4ASM B;  3ZXA C;  4QND A;  4FK2 A;  2DTU A;  1D2Q A;  3GNE A;  4GWI A;  5FZ3 A;  3LWC A;  5EYY A;  3ZN6 A;  3NV2 A;  1N1S A;  5FZ8 A;  1VBC 1;  2BV4 A;  2KA3 A;  2XKO A;  2YGM A;  3NAP A;  5F2S A;  3WHU A;  3WV6 A;  1ST8 A;  2D98 A;  5FYZ A;  5C9A B;  3N36 A;  5FYI A;  3SCX A;  2DVF A;  1OKQ A;  1CX1 A;  1X82 A;  3RGB A;  2MW2 A;  2CAV A;  1ENQ A;  2EIB A;  4Y1U A;  4I0W B;  2HKX A;  3NW4 A;  5C7G A;  1ZYB A;  4AKG A;  3KF3 A;  4CXX A;  2W46 A;  2P5O A;  4CU8 A;  3HVD A;  1W9T A;  1VAK A;  2B46 X;  2W08 A;  3ZVX A;  2J1V A;  3TB0 A;  1W2A X;  2N7G A;  1NE4 A;  2VZ3 A;  3NNL A;  1UXZ A;  3RG0 A;  1FAY A;  5JAX A;  3RNS A;  1YYN A;  2GH8 A;  3RMY A;  5FY9 A;  4XFH A;  3QAC A;  1EP0 A;  2DFB A;  3PMS A;  4QX5 A;  4XDP A;  5IJR A;  2RDR A;  4X8N A;  5JPN B;  4XXP A;  1W8H A;  1R1A 3;  2D6P A;  3OBA A;  5AVA A;  4QKN A;  1DQ0 A;  2YYO A;  1NXM A;  1QXR A;  3HBK A;  4G9S B;  5F5A A;  4D7T A;  1HRV 3;  4ERO A;  2Y0I A;  4AEM A;  1C8N A;  2D3S A;  2KD7 A;  2XJR A;  4YVS B;  3RI9 A;  3A7Q A;  4LQR A;  4CDU B;  1AL2 3;  1F8V A;  4H7M A;  3S57 A;  2GH2 A;  4QX8 A;  1CIY A;  2JEN A;  2XR4 A;  4IV3 A;  1OT5 A;  3J27 A;  4IDZ A;  4MGS A;  4PDW C;  5JR7 B;  3PUA A;  2FHR A;  1ZBA 1;  3LDB A;  5A7N A;  3ZDS A;  4QQ2 A;  4BME A;  1VR3 A;  3NDK A;  4JZR A;  4KH9 A;  4COW A;  1CX4 A;  3QLQ A;  3SUQ A;  3AYC A;  4LIT A;  1R09 3;  3VDA A;  2OKX A;  3ZXG A;  5FMD A;  4XCA A;  3UL2 A;  1UQX A;  1SBE A;  4LBM A;  2BWC A;  1UYY A;  3VBF C;  3ACL A;  3W5N A;  4LBQ A;  4XFI A;  5CIR A;  3MW3 A;  1D7P M;  2VUC A;  1W6N A;  5GZG A;  2VM9 A;  5DDJ 1;  3ES4 A;  5LBE A;  2W92 A;  4EYU A;  2ZX4 A;  4HPK B;  3VBH B;  4KHN A;  2VTX A;  5LA9 A;  3NNJ A;  1Q3E A;  3VZK A;  1AXZ A;  1RUF 3;  4Z92 B;  1J1T A;  3FWE A;  1VRB A;  2VPV A;  2ZX0 A;  2RS3 3;  4D6S A;  4N43 A;  3IIA A;  4DOU A;  4OI1 A;  2B9V A;  3AJY A;  4IW3 A;  2ZKL A;  4S2G A;  2VZV A;  5FZ0 A;  1VMF A;  2JG8 A;  4Y1V A;  5FZC A;  1MS1 A;  3O1M A;  4GWJ A;  1PGW 2;  2A6W A;  1PVC 1;  3BIW E;  3B00 A;  1UXX X;  1FXZ A;  5AC9 3;  1PM4 A;  1OMI A;  1ULG A;  2HWF 2;  2VUJ A;  5HXV A;  3CFP A;  2I2S A;  3SUO A;  2GNM A;  4RA0 A;  5DXD A;  3RJ2 X;  3WLU A;  4Q4W 1;  5L7O C;  5DG1 A;  4CCN A;  4EZ4 A;  1XNA A;  5LAT A;  3CQO A;  2BFU L;  3SNN A;  2O14 A;  3NV4 A;  1P8J A;  4K7J A;  1WZX A;  4JKK A;  2GC3 A;  3TN9 2;  2QFE A;  2OVQ B;  3IDC B;  4FPE A;  4KQ7 A;  4XYX A;  5DUX A;  4E2Q A;  1WA6 X;  3SPZ A;  1HLC A;  1ENX A;  3I2O A;  4Q2F A;  2R0H A;  4B4R A;  3HOB A;  1W6O A;  3LZZ A;  3VDD A;  5FRA A;  1UO9 A;  1S1A A;  1CGP A;  3ES1 A;  2FDG A;  1FAT A;  1F35 A;  1ND2 B;  1W2U A;  3MI8 A;  2X10 A;  1FYU A;  2Y6H A;  1BMV 1; 
#chains in the Genus database with same CATH homology
 3L1N A;  2ID4 A;  1L7Q A;  3MV0 1;  2ORZ A;  3C7G A;  2WAB A;  5DQ0 A;  3WQB A;  4UAP A;  3DYO A;  2C26 A;  4FJ8 A;  2JHP A;  4D8M A;  2ORX A;  3LZJ A;  4P5Y A;  2ZXQ A;  4PQQ A;  3DEC A;  2RJ2 A;  2VCB A;  5F7U A;  2VZO A;  1XL3 C;  3QES A;  1WCQ A;  2JDA A;  4ARX A;  1XMH E;  2DDU A;  3QNN A;  2YG0 A;  1F4A A;  3WF1 A;  4CU9 A;  1XVF E;  3VDB A;  3T0B A;  3N1E A;  4ADN A;  2L9L A;  3I97 A;  4M3Z A;  3QEW A;  4W8J A;  1W99 A;  2H4T A;  3S9H A;  1FZ6 E;  1PMH X;  1MTY G;  4HCC A;  3SQ4 A;  4RL5 A;  2ZEZ A;  4QB1 A;  2Y8K A;  4CUC A;  3TL8 B;  1IH7 A;  3QNO A;  1Q9X A;  1MPX A;  2W1S A;  2VQU A;  4TTG A;  3FHA A;  2W1U A;  5JUV A;  3A21 A;  4X5M A;  4UOJ A;  1GUI A;  1W8O A;  4YPJ A;  3HL8 A;  3I3D A;  3NJX A;  3TAG A;  1OH4 A;  1JZ3 A;  1NX9 A;  2W5F A;  2CDP A;  2J1T A;  1WAJ A;  2JHC A;  1XMG E;  1FZH E;  1CZV A;  1NUK A;  3GGL A;  1PX3 A;  2QQO A;  3WF0 A;  3VD4 A;  3C7H A;  3HJR A;  3T0A A;  2ZEY A;  3IB3 A;  1ULP A;  4A3Z A;  4BJ0 A;  5HPO A;  3OGL B;  5IBK B;  1PMJ X;  3VD3 A;  3WSO A;  4KHW A;  2QQJ A;  3T09 A;  2QXF A;  3W5M A;  2W3J A;  4XUO A;  1UY0 A;  2WO2 A;  3C95 A;  3CIH A;  2VMC A;  4GZ9 A;  2VMD A;  2J7M A;  2R7E B;  5IHR A;  3L2O B;  2YC4 A;  4W4Z A;  1EUU A;  2WZ8 A;  2QQL A;  3AC0 A;  3K4Z A;  3MUZ 1;  1XVG E;  3KD1 E;  3SKJ E;  2OZS A;  3T08 A;  4M41 A;  2JE8 A;  2X09 A;  4P08 A;  1GOH A;  3EB7 A;  3FN9 A;  3FL7 A;  2VIX A;  4JS4 A;  3PUI A;  1EUT A;  2WO1 A;  4J2A A;  3HNY M;  4E3S A;  3OGM B;  4QDQ A;  3K46 A;  2W95 A;  4FJM A;  5A1A A;  3K75 B;  2JHA A;  1H6Y A;  3I2H A;  2VC9 A;  3NCI A;  2X05 A;  3LZI A;  2EIE A;  3TAB A;  2J1A A;  2VZ1 A;  3VD5 A;  3WNK A;  3LDS A;  4DXR A;  4E8D A;  3RMB A;  3I3B A;  1J84 A;  3HGK E;  3LE0 A;  3DYP A;  4AKI A;  3F2Z A;  3GM8 A;  5G05 L;  5LA2 A;  2XHN A;  3P1I A;  4AI6 A;  3E4W A;  1GQP A;  3DYM A;  4RG8 A;  1DYO A;  1DP0 A;  1JZ2 A;  2HD0 A;  4CUA A;  4QX0 A;  2YC2 A;  5B4X A;  2W1W A;  2P1Q B;  3VD9 A;  1K3I A;  2BGO A;  3GXU A;  5IFT A;  3HP9 A;  3UES A;  2P1M B;  2ZEW A;  1JZ8 A;  1K42 A;  2VZR A;  3T2Q A;  2B8I A;  3ZM8 A;  1P22 A;  4P02 B;  3OGK B;  4KHS A;  4LHS A;  4JRQ A;  4OMC A;  2DCJ A;  3OGS A;  2C4X A;  5C70 A;  3UET A;  1GOF A;  3OEA A;  5G04 L;  1O59 A;  1UY3 A;  3TAF A;  1OF3 A;  2ZEX A;  1GU3 A;  3J7H A;  4DTX A;  3I2F A;  4A44 A;  2C9K A;  1IQD C;  4I6J B;  3SEP A;  3LPF A;  2W91 A;  4QX3 A;  3L8B A;  4MO3 M;  2P1O B;  2JPN A;  2XOM A;  1JYV A;  3WF3 A;  1UYZ A;  4BK5 A;  2RV9 A;  1UMH A;  4DUW A;  1O8P A;  3T2O A;  2LF3 A;  1RYY A;  1HN1 A;  3CMG A;  4RNG A;  1US2 A;  3PUH A;  4KI6 A;  4A4A A;  3JXS A;  1BHG A;  4JHZ A;  3V7D B;  2E31 A;  4DTO A;  4AAX A;  3QET A;  5JXI A;  2VJ5 A;  4A41 A;  4DUV A;  3NGI A;  2YB7 A;  3HGL A;  3LQC A;  4FI9 A;  5EJ1 B;  3ACH A;  4ARY A;  2VJX A;  3I2G A;  3WNN A;  3QER A;  2VCC A;  3HEI A;  1WAF A;  3L0M A;  1FZ2 E;  4FVM A;  4QNC A;  1XU5 E;  1H6X A;  2OVR B;  3QEI A;  2XQX A;  1WKY A;  2PFV A;  2W9X A;  3ABZ A;  3IAQ A;  2JH8 A;  3QEX A;  1PX4 A;  4XZU G;  3A22 A;  3QEP A;  5DPN A;  3OEB A;  4LKS A;  4OMD A;  1US3 A;  1XVC E;  4I9Q A;  4KHQ A;  3SQ0 A;  2Y64 A;  3J2P A;  4DTS A;  4DTN A;  3ETP A;  2WAA A;  1FZ7 E;  3EYP A;  4JKL A;  3CFR A;  4EP9 A;  4DU3 A;  3OG2 A;  3IAP A;  2WZE A;  1JU3 A;  4BDV B;  1W9S A;  4J2D A;  4FK4 A;  1XU3 E;  2QQN A;  2WN3 A;  3LD8 A;  3RMD A;  3GDB A;  2WO3 A;  3MUY 1;  1GNY A;  2BGP A;  4M4R A;  3VDC A;  3SQ2 A;  3I3E A;  4QDS A;  4DTP A;  1JZ6 A;  4QB2 A;  3I2I A;  3LEI A;  1FS1 A;  3TJY A;  3RMA A;  3NRU A;  1FZI E;  1FZ4 E;  3NQH A;  4B08 A;  1K12 A;  4BK4 A;  4DTM A;  3CZJ A;  2P1N B;  2W1Q A;  3CKH A;  4QAW A;  1J83 A;  3CFO A;  4FJI A;  1FZ8 E;  4M45 A;  1XVE E;  4XUQ A;  1FZ9 E;  4QB6 A;  5JMO A;  1XVD E;  4X5N A;  4M3U A;  2EIC A;  4RN5 A;  3THC A;  2E33 A;  3LPG A;  5I0D A;  4LPL A;  4HG6 B;  4KI5 M;  4DXS A;  1MMO G;  2VZS A;  1ULO A;  4CVU A;  2VO5 A;  4DXT A;  2XON A;  1OF4 A;  1JHJ A;  2VCA A;  2BBA A;  4QX1 A;  4IUG A;  4JX0 A;  3WEZ A;  2VTF A;  4DEQ A;  3WNL A;  1XMF E;  2QQM A;  3CDZ B;  3CZU A;  4P00 B;  4KWU A;  3C8X A;  3SJJ A;  4A45 A;  1LDK E;  4QX2 A;  1UY1 A;  3SVI A;  4FJG A;  5LA1 A;  1FYZ E;  4FJH A;  2QQI A;  2E26 A;  4A42 A;  4J2B A;  5C71 A;  4QPW A;  1FZ1 E;  5EJZ B;  3FHQ A;  4FJJ A;  2B4K A;  2W87 A;  2DEB A;  1R64 A;  2EID A;  4RYD A;  2MMB A;  4KHY A;  1SG3 A;  3C94 A;  1W0N A;  4XUR A;  4JRP A;  3RWU A;  4FJK A;  2JD9 A;  2VQT A;  1MHY G;  2Y6G A;  3A23 A;  4MOA A;  3SI6 A;  4J2E A;  2Y6J A;  4OUE A;  4FJL A;  2B7M A;  2QBX A;  4EYW A;  1JU4 A;  4DU4 A;  2RCU A;  3HPN A;  4XUN A;  1JYW A;  3III A;  2WDB A;  4UI9 L;  3KD5 E;  5IFP A;  3ECQ A;  2P1P B;  2VME A;  4XVH A;  3WF4 A;  2VMF A;  3T0D A;  3NE6 A;  3U37 A;  1TG7 A;  4DU1 A;  3SUP A;  4FK0 A;  2V5D A;  4M3T A;  3ACF A;  1GMM A;  4XUP A;  1XVB E;  2DY4 A;  3C7E A;  4MAD A;  2J22 A;  2VZT A;  4FJ9 A;  1YQ2 A;  3SEE A;  3C6P B;  1CLQ A;  1JI6 A;  4OYU A;  3MBW A;  2J1E A;  4JKM A;  2WYS A;  1UX7 A;  1W9W A;  3SPY A;  3C6N B;  3D3A A;  4CUB A;  1TVG A;  3OGV A;  4FJN A;  1K45 A;  4E8C A;  2V4V A;  4DTR A;  3NJV A;  3K2O A;  4M3Y A;  2RVA A;  3ACI A;  3K4D A;  5H37 A;  4ADO A;  3UNP A;  3NAE A;  3THD A;  2YB5 A;  5DMY A;  2LS6 A;  4HCB A;  3SKV A;  2ATQ A;  1XPW A;  3T2P A;  4FJX A;  4DEV A;  2HLE A;  1GOG A;  2FYO A;  3ACG A;  4OZO A;  3WF2 A;  1MHZ G;  5DN2 A;  4AG4 A;  1FXX A;  3WNO A;  4TXW A;  2VJ4 A;  3UIQ A;  3N1B A;  3MV1 1;  2P5G A;  4M3W A;  1UY4 A;  2WBK A;  3BN6 A;  1CZT A;  1JZ5 A;  4CU6 A;  1T2X A;  4KMQ A;  1NEX B;  2OYQ A;  3OGR A;  3OB8 A;  1UY2 A;  1XNT A;  4M4P A;  1O8S A;  5CYY A;  2BZD A;  2DCK A;  3LEK A;  5B4N A;  2B1E A;  5IZ7 A;  4QND A;  2PFT A;  4FK2 A;  2DTU A;  4FJ5 A;  4GWI A;  1UMI A;  3MKS B;  3IDA A;  2W47 A;  4PF1 A;  3WNP A;  4MGQ A;  2JKX A;  2BER A;  2E32 A;  3SCX A;  4PT6 A;  5HXM A;  4DTU A;  1IG9 A;  1CX1 A;  2OZM A;  2CDO A;  3C7F A;  1XC6 A;  4CU7 A;  1KEX A;  2EIB A;  3I2K A;  4M3X A;  3VD7 A;  5C7G A;  4AKG A;  5CZK A;  5LA0 A;  1NKG A;  2P5O A;  2W46 A;  3HNB M;  4CU8 A;  1FZ3 E;  1W9T A;  1DLC A;  2V72 A;  4ZXE A;  2J1V A;  1JYN A;  1OD3 A;  5LCW L;  4ZZ8 A;  1JZ7 A;  4KHU A;  2VZ3 A;  1UXZ A;  4JS5 A;  2Y6K A;  4M3R A;  2YFU A;  3I2J A;  1FZ0 E;  5IJR A;  2VZP A;  2VOT A;  3SQ1 A;  2Y6L A;  5JXH A;  4EPH A;  4W50 A;  4KI4 A;  3OBA A;  2WUH A;  4I9L A;  3K77 A;  2VL4 A;  5IYY A;  3LEG A;  2VZQ A;  2VR4 A;  3BGA A;  2KD7 A;  2Z4F A;  3SUN A;  3A7Q A;  4LQR A;  2VZU A;  3CQ8 A;  3RMC A;  2J1U A;  4AKH A;  1CIY A;  4FJ7 A;  3NHG A;  3J27 A;  1OT5 A;  1SDD B;  1SHW B;  4MGS A;  3E4Y A;  1L7R A;  1UZ0 A;  3LDB A;  4A6O A;  1FZ5 E;  3NDK A;  2LF6 A;  1Q9Y A;  5J1X A;  1JZ4 A;  3SUQ A;  2JH9 A;  4E4B A;  2WN2 A;  3VDA A;  2OKX A;  1UYY A;  3W5N A;  4GAM C;  1I5P A;  4L0P A;  3C6O B;  1D7P M;  2FW3 A;  1LNS A;  2VM9 A;  4Z2A A;  4DUX A;  2LW8 A;  4QDR A;  2W92 A;  4XUT A;  4KHN A;  4BXS V;  5EIY B;  2OVP B;  2J1S A;  3E1F 1;  1JYX A;  1CZS A;  4D0Q A;  2B9V A;  2VZV A;  1UWW A;  1UYX A;  3HN3 A;  3WNM A;  4GWJ A;  2WAO A;  2YFZ A;  1KGY A;  1UXX X;  3CFP A;  3P6B A;  3SUO A;  5JR2 A;  2PQS A;  3QEV A;  1XNA A;  2MZW B;  3CQO A;  3SNN A;  5IRE A;  2HYX A;  1P8J A;  2W94 A;  3K4A A;  4JKK A;  3C7O A;  4ET7 A;  1F4H A;  4ZY9 A;  2OVQ B;  4ZZ5 A;  5FUI A;  3SPZ A;  3NNG A;  2X10 A;  3TAE A;  4M42 A;  2QQK A;  3HOB A;  5JXJ A;  2WQ8 A;  5JXG A;  3HNM A;  1NAE A;  4DTJ A;  3MO4 A;  1W8N A;  2J1R A;  2Y6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...