2E32A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
240
Chain Sequence
EYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 57
structure length 240
sequence length 249
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00646 F-box F-box domain
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2e32A01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e32A02
3V7DB 2ZEWA 1YQ2A 3HPNA 4BDVB 1O59A 5JXGA 1ULOA 2HYXA 4DXSA 1H6YA 3I3DA 3EYPA 3FN9A 3GM8A 1SHWB 3FHQA 4KWUA 3WNOA 3HNBM 1JZ5A 3WNPA 3VDBA 1GUIA 4P08A 3HN3A 1KEXA 3LPGA 1MPXA 2W92A 1OT5A 2VMFA 4GZ9A 4CU7A 4QDRA 2OVRB 2J1EA 2WQ8A 1K45A 3I3BA 2VZUA 4QX2A 2LS6A 4AAXA 5IYYA 3OGSA 2X10A 2ZEXA 5EJ1B 2QQJA 1UY2A 3K4ZA 2WBKA 5IJRA 3OGVA 1UMHA 5IFPA 4A42A 3HOBA 2WO1A 5DPNA 1GOGA 4TTGA 1J84A 3SKVA 3CQOA 3SEEA 2Y6HA 5DMYA 2X09A 3K4DA 2VZTA 2YC4A 3IAPA 2VZOA 2OVQB 3ZM8A 1EUTA 2VCCA 4XZUG 1IQDC 1W9TA 2E31A 1UMIA 3T08A 1SG3A 2ORXA 4DEQA 3DECA 1T2XA 3T09A 4UAPA 3NJXA 2Y8KA 5EJZB 3C7EA 3MBWA 4A45A 2E26A 2QQIA 5HPOA 5G04L 1RYYA 3T0BA 3LEIA 1XNTA 2W3JA 1GQPA 2EIDA 1XNAA 3ACFA 3OGLB 3GDBA 3I2KA 3U37A 2Y6LA 2WZEA 3MUY1 3CMGA 2E33A 3I97A 4MGSA 4D8MA 1GOFA 4P00B 1L7RA 1H6XA 1JYVA 3LEGA 5LCWL 2J1RA 3WNMA 5LA1A 3HNYM 1UYXA 3WF3A 2Y6GA 3ECQA 1OH4A 3VDAA 3MV11 3NJVA 3OGKB 2WDBA 4ARYA 3THDA 1R64A 3I2GA 4XUNA 1UX7A 2WZ8A 2Y6JA 4JX0A 4DEVA 4OMDA 1NKGA 5DQ0A 4DXRA 2P1PB 3VD5A 3WF2A 3EB7A 2KD7A 2XHNA 3NQHA 2YFZA 2VO5A 5C71A 2WABA 1JZ2A 2WN2A 2VL4A 4MO3M 3T0DA 3THCA 4HG6B 3WF1A 4JKKA 1UYYA 4E8DA 5LA0A 1DYOA 2BZDA 4ZZ5A 4ZZ8A 3A7QA 4GWJA 4PT6A 2QQKA 2Z4FA 3BGAA 3UNPA 2PQSA 2W47A 4OZOA 3WNLA 3VDCA 3IIIA 1NUKA 1CIYA 4OYUA 4RYDA 1XC6A 1JZ3A 4W8JA 1W8OA 4P02B 4YPJA 4A41A 2W1SA 4Z2AA 4CUBA 3W5NA 1DP0A 5CYYA 3ACGA 3UESA 2J1TA 3L2OB 2DCJA 2VMDA 3DYMA 2C4XA 4ARXA 2X05A 2QQMA 1UXXX 1JZ8A 2P1OB 3OEBA 3C6NB 1TVGA 5C70A 1F4AA 3WQBA 2WAAA 1DLCA 2V5DA 4DUWA 1JZ4A 1JU3A 2ZEZA 4M4RA 5C7GA 4I6JB 2XONA 3K46A 2P1MB 2J7MA 3OG2A 4LHSA 1JHJA 1GNYA 2VMCA 3OEAA 2RJ2A 4ZXEA 2P1QB 3IAQA 3MO4A 5JXHA 5JXJA 1W9WA 3CIHA 1W8NA 3C6PB 3GGLA 3C7FA 1JYXA 3T2OA 4OUEA 2W9XA 1JYNA 1US3A 4BK4A 2WUHA 3HEIA 5G05L 2VTFA 2L9LA 3NRUA 4LQRA 1P8JA 3C6OB 2VOTA 4XUTA 4ET7A 3SKJE 2OVPB 2V4VA 4MGQA 4L0PA 1NX9A 3F2ZA 3J7HA 1FS1A 3VD7A 2W46A 1P22A 1OD3A 2VZ1A 1L7QA 3ACIA 4XUPA 1K12A 4QB6A 4UI9L 1W0NA 3OGMB 2VZVA 2JD9A 5JR2A 1UY1A 2W1QA 4PF1A 2VCBA 2QQNA 2VCAA 4CUAA 3PUIA 1UY3A 4CVUA 3GXUA 5A1AA 5IFTA 2WYSA 1CX1A 2E32A 3NNGA 2YFUA 4FI9A 4QX3A 4LPLA 2VM9A 2DCKA 1K42A 2CDPA 5IHRA 3VD4A 1HN1A 1D7PM 3T2QA 4E8CA 2OKXA 5HXMA 5JMOA 1CZVA 4QDSA 4XUQA 1EUUA 2B4KA 3P1IA 4A3ZA 4KI5M 1J83A 2Y64A 1O8SA 2Y6KA 1JI6A 2VR4A 2P1NB 3A23A 1PMHX 1JZ6A 2RV9A 5B4NA 2EIEA 4QX0A 4QDQA 4A44A 2QBXA 2VZQA 2ZXQA 1CZSA 1KGYA 2VZRA 2W95A 1ULPA 3WNKA 5FUIA 5CZKA 1NAEA 2EIBA 4QAWA 5JUVA 3LQCA 3CZJA 3ETPA 4BXSV 5LA2A 3C7OA 3WF0A 2BBAA 2ID4A 4BK5A 4DUVA 2B9VA 3I2FA 4CU6A 3VD9A 3WSOA 1OF3A 1GOHA 4LKSA 4BJ0A 2JDAA 3K75B 4XUOA 2WO2A 1WCQA 2R7EB 1PMJX 3BN6A 4JKMA 2YB7A 3A22A 4AG4A 4OMCA 2BGOA 5F7UA 1US2A 1BHGA 5I0DA 1UZ0A 1JZ7A 4QPWA 3LPFA 1SDDB 3MV01 1F4HA 1K3IA 2C26A 4JHZA 4QB1A 4TXWA 3T2PA 3UETA 4JKLA 2LW8A 4W50A 3I2IA 1CZTA 1NEXB 2W5FA 4CU8A 2JE8A 2CDOA 4M4PA 4RN5A 3WNNA 4DUXA 3HJRA 3T0AA 2W1WA 2BGPA 3MUZ1 4IUGA 1UWWA 3K77A 3C7GA 4QB2A 4W4ZA 2J1UA 2EICA 3LEKA 1UXZA 2VMEA 3A21A 3HNMA 3AC0A 3PUHA 4GWIA 2XQXA 5JXIA 3OBAA 2VQUA 3C7HA 4XURA 2VJXA 3OGRA 2J1VA 3CKHA 3LE0A 2W1UA 1GMMA 4P5YA 5EIYB 4PQQA 5J1XA 4ZY9A 1XPWA 3IB3A 1JYWA 4DXTA 3W5MA 2WAOA 5DN2A 1W99A 4MADA 2VZPA 3DYOA 3ABZA 2WN3A 2W91A 2XOMA 3D3AA 3I3EA 2ZEYA 1I5PA 3OB8A 3DYPA 1OF4A 1UY0A 4D0QA 2YG0A 2W94A 3CDZB 2DDUA 4A6OA 3FHAA 2J1SA 4A4AA 4XVHA 3C8XA 5IBKB 2QQLA 4CUCA 4MOAA 3FL7A 2JKXA 2VQTA 1W9SA 3E1F1 5B4XA 1LNSA 3JXSA 3WF4A 2J22A 2ORZA 2YC2A 1UY4A 2QQOA 4CU9A 3MKSB 2RVAA 1UYZA 2VC9A 1O8PA 2BERA 2HLEA 3CZUA 3VD3A 2V72A 3K4AA 2VZSA 3IDAA 3WEZA 2C9KA 4QX1A 1WKYA 4KMQA 3I2JA 1JU4A 2VZ3A 4UOJA 2WO3A 1GU3A 1TG7A 2W87A 3I2HA 3ACHA 1PX4A 1LDKE 2J1AA 3SEPA 1PX3A 3P6BA
chains in the Genus database with same CATH superfamily
3RMAA 1V6IA 4LHNA 5FY1A 4WV8A 4YFZA 5LBBA 4A3XA 3NNLA 1O59A 2ZMNA 4CRQA 2X8KA 5JXGA 4FQZA 2EXHA 1ULOA 2OQ6A 4WVZA 2VULA 2HYXA 4GH4A 4IV1C 4DXSA 4CDQC 1ZBE2 1YCIA 2ARAA 3GM8A 3UJOA 1ZA4A 2PLV1 4KWUA 3J8F3 2HWE2 3LEMA 1JZ5A 5F5IA 1VB4A 4DNYA 4P08A 5A33B 3HN3A 1RUI2 3B00A 1Q8VA 1W8HA 3LPGA 1WD3A 4QHZA 4QQ2A 4XIKA 3UKVA 4BE3A 3I3MA 2ERFA 4K3UA 4BLJA 4A7KA 2JENA 2W52A 4GZ9A 3E5XA 1I6XA 1N1SA 2WQ8A 5JDBA 5FO9B 3M3OA 5GLTA 5J3UA 1LCLA 2LS6A 4D6QA 3QEXA 4GKXA 1VRH2 4V2WA 4X5NA 5EJ1B 2QQJA 3U07A 4LO8A 2FDKA 5I0UA 3R4DB 1PGL2 1V6OA 4O65A 5GLWA 4MGTA 4LKEA 4LULA 4YM0A 4QKDA 3KLSA 1V6KA 3SUPA 3OGVA 1KRIA 1UMHA 4RD7A 4CCLA 4BYYA 5CG8A 2DFBA 5LBEA 1YFWA 1VBA3 2FW3A 1EV11 3NKGA 1FMD2 1CESA 1PNGA 3ZXEA 2VU9A 1M06G 2QFEA 2RS32 1ASJ2 3CQOA 1SEFA 5GZGA 2LTNA 1A34A 4HXCA 1D4VB 1LJ7A 2VZTA 2YC4A 1UOFA 3IIAA 2P3IA 5SV5A 3W59A 1EUTA 3HD8B 1FV2A 3M3QA 4GWMA 3HMYA 3SC7X 2GMEA 3EO6A 4XMAA 2H6CA 1HV0A 5FZ9A 4N53A 4FJJA 4XF3A 4ZKTB 1XYOA 4M0HA 1OLQA 3H7JA 3N9QA 5EFUA 1C3HA 2WZR3 1LENA 2B42B 2X5IB 3GHNA 2RDSA 3FFZA 2B46X 1H8VA 1T2XA 1W9YA 2DUQA 3MYXA 4UAPA 3RJ2X 5EJZB 2Y8KA 3ZXFA 1G9CA 1DF0A 2ZGQA 3SQ4A 2E7TA 2QQIA 3USUA 1LHUA 5HCFA 4BIOA 4Q4X3 2AR6A 1Q3EA 3TWIA 2ZCWA 1QGLA 4JQTA 1Q9XA 4CP1A 2ETEA 5KBFA 3BB6A 2IXJA 2WA4A 2W3JA 1OPMA 4OLLA 4M01A 4UYBA 4XQDA 1HQWA 1RITA 1XE7A 3ACFA 2CTVA 4DU3A 4YSFA 1XNDA 4GIQA 1RB8G 1AYN2 3SCHA 3SH3A 3T4VA 2FDFA 5CB7A 1OQDA 4FP3A 4DRRA 3SUQA 1WW6A 3S6PA 3DGTA 5BPXA 3MDPA 3LEGA 3POBA 5BV6A 2DCYA 3RMXA 1SLLA 3AYDA 1ALYA 1QWRA 1UYXA 1JUIA 1LRHA 1W0PA 3GBGA 1TME2 1H1IA 5CIRA 4PIZA 2JECA 4Y5Z0 1I1EA 2KXLA 3MPBA 5FMBA 3FUQA 4RHV1 3B5LB 2R6QA 1MQTB 3AKRA 5A32A 3WDWA 5FZBA 1R091 5IVBA 2AC1A 3LSDA 4YM1A 3HIFA 4LBQB 5KHJA 3GZTB 1ZBA3 3AYAA 1HXS3 1W0OA 2C0ZA 1MVQA 3AL6A 3DKQA 3VZMA 5FPAA 3WF2A 3LGRA 4PCRA 4H7LA 2P5BA 3H3UA 4Q0PA 5H9SA 2QQPA 2V4AA 3LD8A 3OSDA 3SI6A 4WM7B 5C71A 3RZLA 2RS52 3E6DA 5GKAC 3SCFA 2JB4A 4AQ6A 1XOYA 4N7IA 4TWTA 3MIGA 2VUJA 1QNWA 3KS7A 4LR4A 4DB5A 3S5AA 3J8F1 2JQTA 2P34A 1BVVA 4UT5A 3ROUA 3ZIWA 1K5JA 1YXWA 2JDUA 5DG1A 3ILNA 4E8DA 2B5HA 4PIYA 2ENRA 2A6YA 4IE6A 4ZZ5A 1GR3A 3FC0A 5IW0A 2ZHLA 3OGJA 4PT6A 4TLFA 2Z4FA 3POWA 4F83A 3IWZA 1A8DA 2FCUA 2RDQA 4OZOA 2VG9A 4AZZA 2HKXA 4CP2A 3IDEA 2YMZA 5LASA 2DVDA 3RYRA 5C33A 2ARXA 1U5YA 4MXVA 1W6OA 4W8JA 1OI6A 4A41A 5CKQA 2GSYA 1DP0A 2ZPXA 4D3WA 3LIHA 3DEMA 2A7AA 3O0VA 1QXJA 3L2OB 3VN4A 2FCVA 3DYMA 2C4XA 4J2DA 4AFMA 1WW7A 4EWAA 5FO7B 2E63A 4GD4A 3NDKA 1PZ7A 4BHPA 4B1LA 5CEHA 3QBQA 2P1OB 3OEBA 1TVGA 1VBA1 3VBOC 2XH6A 4BB3A 2IZWA 3R4UA 1PMIA 3KT1A 4AEJA 3E6BA 3WCSA 3ZOIA 5FO8B 1JU3A 2ZEZA 2VOKA 1VR3A 2HWF2 2XONA 2WNUA 3T2TA 4HKOA 3ZXJA 4LHSA 3SPZA 3HT1A 2P1QB 3IAQA 5FZ6A 1C57A 2D6NA 3CO2A 3HN1A 3OCPA 2IUWA 2TEPA 4IXLA 4P9WA 4Q8LA 4NMIA 5CA6A 1IS3A 1VLNA 3L1NA 2OA2A 2EALA 1W8NA 3GGLA 3PJYA 1JYXA 1SACA 1FPOA 2WZR1 2HWD2 3S9HA 1QNYA 4MHUA 1JYNA 1G9DA 3OBTA 4J2BA 3VBHB 2K0GA 1KJRA 2W2IA 3AKQA 3WV6A 4BQ2A 4W6XA 4DRVA 4BISA 1GQHA 2VNVA 3PUSA 3RZMA 1QY4A 1XRUA 4PQ9A 5F39A 1P8JA 4Q4X1 3C6OB 5I0SA 4XAEA 4G3YC 2D6MA 2WINB 3POGA 4RR3B 2OVPB 1NYWA 2V4VA 4XZPA 3VKMA 4XCAA 4MGQA 4JGYC 5EYYA 4Y20A 2GN3A 4I09A 3H1YA 3UGGA 2P37A 3BI3A 3F2ZA 5FZMA 5KXCA 4AVCA 5L9BA 2HYKA 2VVEA 2VUDA 1P22A 2ZTNA 5JZGB 1OD3A 4KHYA 2YPJA 1ENSA 1DGWA 3AP4A 1RIRA 2B1EA 2AUYA 3ACIA 1ZRRA 1GYKA 4XUPA 1K12A 5A80A 3SCGA 3VKNA 2WNEA 4UI9L 2HH9A 1GKBA 5BNOC 3Q9OA 3OGMB 2VZVA 1SBDA 2JD9A 3HGLA 1GANA 4HN0A 3NV3A 5ISLA 3NMBA 4PF1A 2A1XA 1KFUL 3H9AA 1EP0A 1RUF2 2VCBA 4KGQA 3LOIA 4MLOA 3ZXAC 1OLME 2VUCA 2IXCA 2XB6C 3AMPA 2AEZA 4XF0A 5DDJ2 3FLTA 5I8TA 3GXUA 5IFTA 2HEVF 4Z07A 1ZZCA 4HETA 1RVF2 2WYSA 1CX1A 4UW3A 5K0UC 2VD7A 3NSTA 2MEV3 1OHFA 2E32A 2XL7A 3NNGA 2YFUA 4LE3A 4LPLA 2GP3A 4BQ4A 2GNDA 4R52A 5IHRA 1ZBA1 3N7KA 4DY5A 1HXS1 4COWA 1ZNPA 1W2OA 3VBUB 1D7PM 1O4TA 2ZOEB 3T2QA 1O3TA 4HVOA 1QH6A 1LOEA 2BNOA 4XACA 3WG2A 1PO22 5JVVA 3VBOA 3NAEA 4XUQA 2QCSB 1EUUA 3NAPB 4IEWA 2R1BA 4RL5A 5FZ7A 4BQ5A 1W2TA 4Z92B 5F6KA 1WWYA 2J42A 2Y64A 4CXXA 4YW6A 1U5ZA 4FTBA 3RMCA 1ND3C 1XNKA 3SNMA 1X50A 2DCTA 4KG0A 5LWBA 4AEMA 1FZ1E 1R083 2EIEA 2VW0A 4QX0A 5FZIA 3WOGA 1RUC3 2SBAA 3ZR5A 2O14A 2EAKA 2VZQA 4LHLA 3WG1A 2VTXJ 2W95A 4XFAA 1ULPA 1WCDJ 2JPNA 3N7MA 3WNKA 3ZYBA 1YC61 4DU1A 1QJEA 1TMF3 5CZKA 5FWJA 1H30A 1YQ6A 2EIBA 4LOTA 5JUVA 4Y24A 3ZSKA 3LQCA 1OFSA 3CZJA 5DXDA 3N9LA 1J3RA 5F32A 3VZJA 1QJY2 1EV12 3G6JB 1ULFA 1W6PB 1C5IA 3C7OA 1Q9YA 5BNNB 4C0BA 3J4UH 4BK5A 3CLPA 1JXNA 3J7MA 1ND2C 2DURA 1CAWB 3H50A 1FZHE 3I2FA 4QXHA 2ZHMA 1OF3A 4OUMA 1TQ5A 3BOPA 3HR9A 3L9JT 3KWVA 2A6VA 4QPIC 3IMNA 5LBFA 4B4RA 4AEDB 4DS0A 2JDAA 3CHXA 1GWKA 1X82A 4AKIA 1APNA 4CCKA 1VMHA 1W90A 4COUA 5BNOA 4OHYA 2YB7A 5IVJA 2OW4A 4IEOA 4RS5B 3TAYA 1XNCA 5F2WA 1IG3A 3ZFGC 3UIQA 2MNGA 5F7UA 5IVFA 3QERA 3MEPA 3ZFEB 5IVVA 1UKGA 2E6VA 1UZ0A 2RM22 5AVPA 3CFRA 4FSJA 2YU1A 4QWNA 1EAH3 4N90A 4EN0A 2C26A 4TXWA 1GP4A 1RUJ3 1SPPB 2QZ3A 5K0UA 2CGPA 3PUAA 4IEYA 1LOCA 3I2IA 1YI7A 3M3EA 2YV8A 4W50A 1W2NA 3LFIA 3S7EA 3AP7A 3AB0A 3PHMA 4CU8A 2JE8A 2Z42A 1AJOA 1K5MC 4A7YA 2CU5A 2VBDA 3ZYJB 1CIWA 5FP4A 2BWCA 1WW5A 5FYHA 1LOAA 2BGPA 4XFFA 2VVDA 3OBZA 2RG4A 1RHI3 3K77A 4KHQA 1YUDA 5F3EA 1N1VA 4XCBA 1UXZA 4COVA 1LEMA 4CPBD 2VXRA 2VBBA 2YZ4A 4AI0A 4URTA 1LHVA 3TEYA 4UFLA 5FMOS 1BYHA 1V6NA 3D6EA 5FP9A 3HNMA 5C8CC 3VBFC 1HW5A 3MLKA 2DCZA 1ND3A 2GC0A 4FOQA 4QKBA 3WP4A 2ET7A 1WD4A 2BJSA 4FFHA 2Y0IA 3Q8EA 4ASMB 4AI6A 2I07B 3WDYA 2GU9A 4XURA 2QTWB 1IHMA 1WGPA 2J1VA 4OUSA 2VJ4A 4E2QA 2ZX0A 2NMNA 5C4WA 4M3XA 1AL23 1WMFA 4KWKA 2IXKA 5T5JA 3V56A 4UWDA 5F37A 2X53S 5K9YA 1RUNA 2C5DA 2K5SA 2VZPA 4GQ7A 5GALA 4K20A 4LE4A 5FY9A 2WN3A 3I49A 2W91A 3KV5A 4AFDA 2XJSA 1ND2A 1BK0A 4FPFA 5A7PA 1OF4A 3SHRA 5CAZA 4HVQA 3I2DA 3H8RA 4XFCA 4M41A 3ILFA 4A6OA 2Z69A 4QPIA 1DGRN 1VBD3 1HRI3 1QDOA 2J1SA 2O1QA 3IPVA 4LA3A 2AENA 3VZNA 2XJTA 4IEZA 4GKYA 4KH9A 5EZWA 3O7OA 4B29A 3AKTA 3KV9A 4FOWA 5D8AC 2JKXA 3NW4A 5F8PA 5A7SA 1W9SA 3WX5A 2VECA 3E1F1 2D98A 1O91A 2FDHA 1FXZA 3QESA 2ZABA 4NHMA 5H9PA 3ZFGA 3RWKX 1XSRA 2ORZA 4RR3A 1W6MA 1RUC1 1H2MA 1S0FA 2HJIA 1V00A 2YC2A 3VBRB 2XKPA 5K7PA 1WZXA 5HV0A 2B8MA 3OPWA 4AAPA 3OUHA 1TMF1 1NZIA 4ISQA 3A4UA 2P3JA 1XQNA 4AGRA 4NHYA 4CP0A 2HLEA 4QQPA 5FPUA 4ISRA 4FPLA 1XVCE 4R4ZA 4AHXA 5E1RA 3WW3A 5LY2A 5C6CA 4MG2A 5HCBA 1J1TA 1K5MA 5FZDA 2JG8B 3SH5A 2VZSA 3IDAA 1VAVA 5FY4A 4QX1A 1ZRDA 2RS13 3WXPA 1O4ZA 2YHJA 3I59B 4KMQA 3POSA 1FZ4E 4X5MA 1ZRIA 2X29A 1F9KA 4Q2FA 1B35B 5A7WB 2Y0OA 3JCIA 1ODMA 2W87A 2RMU2 5KHGA 1V9U3 2EXIA 4CSWA 2ZBJA 2OT7A 4UFIA 4RQPC 1UMZA 1PX3A 4UFKA 4IEUA 5AC91 5BNPC 5C70A 2ZEWA 1WUVA 3E4WA 4QQOA 1X33A 4BDVB 1W6QA 3AM2A 3OOXA 4JCKA 4ONUA 4XQWA 2V73A 2E51A 3VBFA 3H1MA 2B7MA 4E9KA 3NGIA 1LESA 4S2GA 4TLGA 3I3DA 4RFRB 1ONAA 2OVUA 3OYWA 1PVXA 1HV1A 3GZAA 3VBUA 5J36A 1UIJA 3WNOA 1LHOA 1YFYA 1YFUA 2EA7A 3HNBM 1A8MA 3QETA 1TZOA 1HRV2 1EAH1 2BRTA 5A7OA 5FYBA 3UK9A 5HXVA 1RUJ1 3ZPYA 4Q27A 1SLTA 4DTSA 1UN1A 2F17A 2VMFA 5L9RA 1LGBA 1OSGA 1YFXA 5H9RA 3ZYFA 2OVRB 1Q8OA 3KSCA 3POFA 4QPGC 4IETA 4CE8A 2R49A 5FYIA 1KS4A 3AL5A 5A3NA 4MXWB 4FJMA 2VZUA 5JOWA 1IS6A 1YJLA 1MS8A 2ZA9A 5I0RA 1N47A 1F5JA 4KHNA 2JIGA 4HT1T 4META 4LBLA 1U12A 2OPWA 4XTMA 5FY5A 5CFDB 1MZEA 4QMAA 1RHI1 4E4SA 3ATGA 1UY2A 1ENRA 2UY9A 1KJLA 3RMDA 4ZONA 1W04A 2Q30A 1F2NA 2HD0A 3SPYA 3RWNA 3ZSEA 1UOBA 3AFKA 4IW3A 4OULA 4XDQA 3KV4A 1DCSA 4A42A 4R9DA 1WLCA 4CEYB 5CKMA 2D40A 4Y3OA 4TTGA 3FFQA 2Y33A 1J58A 2VW2A 5JIAA 2P1BA 3ZYIB 3SEEA 5GLVA 3HWJA 2Y6HA 3O12A 1FATA 2X09A 2BVBA 2GAUA 3K4DA 2CGNA 2PHLA 4YGCA 5C4WC 1DQ6A 5IVCA 1W2AX 1POV0 4U2AA 3TN93 3ZKUA 2OVQB 3AXDA 5FZKA 5HI0A 4CDXC 1O3QA 1CGPA 1AL21 1ACCA 3S30A 1ZZ6A 3AP9A 1OPOA 2GC3A 1IQDC 4XZUG 2BTVC 2XVKA 3RFRA 1FNZA 4LUMA 3N9NA 5JOZA 4NROA 4N43C 2LUWA 4ZPIA 4I02A 5FMDA 1SG3A 4HANA 1OQEA 3ZYRA 3O1UA 3QACA 1FX5A 1GFF2 1AF9A 4M00A 2G19A 5A6YA 2DEBA 1AR92 1KDMA 1ULEA 3K51A 4G9SB 5J96B 4EPHA 1ZZ8A 2XJQA 4LBQD 3JB4C 1REDA 5HPOA 4FPKA 4HPKB 4IEQA 5G04L 2ZGLA 2JD4A 4FJ8A 1RYYA 1X9TA 2JDMA 4LO6B 1VBD1 4PLMA 4X6QB 4XF9A 2Z2SB 3T0BA 1LKNA 3LFMA 4RQPA 2JEMA 2R1DA 4LITA 1BKZA 2EIDA 2R0FA 3HT2A 3IZOA 4OQ9A 4EYUA 3OGLB 5FOBB 3I2KA 5DAQA 1W2UA 2Y6LA 5FXZA 4UFHA 4YVSB 4Q4Y3 3CMGA 2OYZA 2ZHNA 3KVAA 4OI1A 4AI9A 2QJVA 3LDBA 1L7RA 1JYVA 5LZ6A 1FZ0E 1QMJA 1C8M1 5LA1A 4Q4W3 3SLIA 4FJ5A 1POQA 3HNYM 4KU7A 5IK5A 3D8CA 3WF3A 4CCMA 5CVRA 1FZ7E 2Y6GA 3ECQA 3R0RA 4AFCA 5ACA2 5C3QA 3GALA 5IK4A 1RL3A 4AL9A 5FQ0A 5FR3A 4ZHNA 3MV11 1RUH3 1A6CA 4ARYA 4QPGA 4XAAA 4QQLA 3VHPA 3J7LA 3LZJA 1NA1B 5L36A 1LGNA 3GNEA 2RS11 3OD0A 3BU0A 1XVEE 3I2GA 3EBRA 1GZ9A 1CR7A 2CHHA 4KHWA 4FK0A 1UX7A 2OIIA 2WZ8A 3MW3A 4JX0A 5F3CA 3M70A 2CAUA 2PQQA 4DEVA 4OMDA 3VZOA 5DQ0A 1LHNA 1UOJA 4DXRA 1V9U1 2DY4A 4QXCA 3JD73 5ANQA 1BBT3 1D4M2 2Y34A 4DTUA 3DXUA 3WP6A 3K48A 1WW4A 3EB7A 2NLRA 2XHKA 2ZJCA 2PHDA 2KD7A 4J2AA 3PMEA 4FO9A 4HMZA 4YVWB 1SFPA 4K21A 5A6ZA 1MMOG 3FX3A 3V0BA 2PAEA 4ASKA 3F95A 2VL4A 4ITCA 1LR5A 3THCA 4FJ7A 1UYPA 1G9FA 3EXUA 5LEJA 3Q8FA 4QNDA 4DIQA 1UYYA 2UURA 4UF0B 5LA0A 4CDXA 2BZDA 3CJIC 3WG3A 2D6OX 5FLHA 5I8YA 3G7DA 4GWJA 1Z78A 2DUPA 2H0BA 2G4IA 2VIXA 1ZZ9A 4Q4V3 4FAGA 1C1LA 3BGAA 4N43A 5I0TA 1VBC3 1G86A 1VBB2 2W47A 1TE1B 2BNMA 5AFBA 4YNIA 1X8EA 3IIIA 1CIYA 2WL1A 4RYDA 5L73A 2EVXA 5CADA 4OHWA 4QGLA 4Z2AA 2Y38A 4YPJA 3B94A 3UO2A 2D3PA 4B3NA 3IBMA 2Q8CA 4EWEA 4MV2A 3I3QA 3ACGA 3MFCA 1UU6A 5CYYA 1SLCA 3E5QA 3VBSB 3VL9A 1OOPB 3DPRB 2DCJA 1O6UA 2VMDA 2G9ZA 5T3NA 4ARXA 4BXFA 4I9LA 1PZ9A 5DZGA 4D94A 3MICA 2DVGA 5JI9A 1PZ8A 2EXKA 2P6CA 2ZX3A 5E16A 3C6NB 1LULA 1FAYA 4YZ5A 3AP5A 1FZ8E 1MHZG 1SFYA 2V5DA 1FZ9E 4L99A 1RGSA 5DG2A 2MEV2 5T5OA 5C5TA 1W06A 4M4RA 4I6JB 1SLAA 1JYIA 2J7MA 5L19A 3J9SA 4KHUA 4HSJA 3T30A 2Q1MA 3TN91 2D5HA 4K8FA 4AW7A 2JE9A 5A3TA 1ENXA 2ARCA 1N1TA 3MO4A 1VBE3 4XF1A 4H3WA 5FKBA 1S2EA 4IE0A 4PLOA 3WLUA 4AXOA 5CFCB 5JXJA 1W9WA 2XG3A 4LUKA 2IVJA 4LTAA 3O1TA 2JB8A 4FAHA 3RNSA 3TAEA 3B9IA 1JYTA 1HB3A 4CDWB 4OUEA 2W9XA 2OZ6A 2ZGSA 5KC5A 5L7OC 4FT8A 3PURA 3KMHA 1HLCA 4CCNA 2MHFA 3HEIA 5G05L 3LZIA 4PJYA 2R073 2VTFA 4XDPA 3UKNA 2JHAA 2AYHA 2L9LA 3N7LA 3K3OA 5L9VA 4LQRA 5APAA 2VGDA 2HBUA 2VOTA 3BTYA 1AX2A 3KCCA 3KZ4C 4SBVA 4ET7A 3SKJE 4HLTA 5DUVA 1R082 2WYFA 2ZKLA 4XPVA 5SV8A 4E4ZA 4N8MA 1RUC2 3NNMA 4K7JA 3I8TA 4L0PA 4AVTA 1NX9A 4Z2WA 5DAPA 3C94A 1RUD3 3ME2A 2N7GA 2YYOA 3J7HA 3U10A 4XBQA 1REFA 4IESA 2W46A 2DU1A 1BCXA 2XR4A 5DABA 2VZ1A 4Q4Y1 1MS9A 2ADEA 3KHBA 3HBZA 4RFT0 5FY0A 3ZN6B 3V0AB 1R1A3 4J1WA 1NCQC 4O9EA 4XJ9A 4NN0A 1CD3G 4IGOA 4NRMA 1PO13 4CP9B 3VDDB 1O7FA 4Q4W1 1JHNA 1FPN2 3CJIA 3TYJA 5CFDA 1BJQA 1WMDA 5FK7A 1DDLA 2W1QA 4MGKE 4RGAA 1L3JA 4UBHA 4JC1A 1LOFC 4HCBA 1WA6X 3SNNA 4UFJA 1FZ3E 1PIV3 2VCAA 4GJZA 2WNUC 3PUIA 4CUAA 2ZHKA 1RUH1 1UY3A 4FTSA 1WMEA 2OUHA 3PVNA 1W6NB 4B08A 2TNFA 4OZXA 1RMU2 2WT0A 4MX3A 3RRDA 3JUUA 5FXVA 4PDWB 3O14A 3WT3A 1I3HA 1HQNA 1VRBA 3KHCA 2JG9C 4Q29A 4HL0A 3TJYA 3FHIB 3N9OA 3ZFFC 1VPHA 3CL1A 2JH8A 4FI9A 4QX3A 2FDIA 2VM9A 4BZ4A 4QU2A 2K46A 4GAZA 5DZFA 2QKDA 1XMFE 3JD71 1BBT1 5H9QA 3VD4A 1N1CA 4FPEA 1CAUA 4NAOA 1BK1A 2A3YA 5FYZA 2ZGKA 3AK0A 4L97A 3CBNA 4FQ4A 2OKXA 5HXMA 4NWVA 1CZVA 4BWOA 3JZVA 2YUEA 4KWJA 1IZ3A 2B4KA 3VHOA 3LA2A 4LKDA 3BPSA 2MZWB 5HCAA 4KI5M 4JDOA 4EN6B 3FZ3A 2R042 3FE5A 3LA7A 4M3CA 4DY3A 1O8SA 2WQZC 4NHKA 1IKPA 2P3YA 3DUIA 4L8QA 5A3OA 3QH6A 5HV4A 3LKJA 3ZYPA 3CQ8A 3SCXA 1PMHX 4I30A 2RV9A 5B4NA 1JZ6A 1PK6B 3AP6A 5JOXA 4Q4V1 4FBFA 5T52A 3HP9A 3MI8A 1QJX3 4OCTA 1AYM3 1VBC1 2JDKA 2YGMA 5FZOA 1JYCA 5L7OA 3WG4A 3MFAA 4M3WA 2DYCA 4A7ZA 4BQ1A 4IDZA 5FUIA 1JW6A 2R062 3B93A 1QHDA 2HEYF 4FJIA 3AXEA 2OQ7A 3ASIA 4RSUA 5BXXA 4JZRA 3ETPA 5ANNA 4CPBA 1UPSA 4BXSV 4JRAA 1QXRA 1V0AA 2D43A 3KVBA 4WM8B 2BBAA 5C3OA 5LRRA 4Y22B 2ID4A 4CDUB 4YW3A 3RJRA 2VOVA 4DUVA 5LA9A 5JI7A 1LECA 2XBO3 2B9VA 1WA4A 3UL2A 5FYSA 5FMCA 2YBKA 1AR73 4CU6A 3WSOA 3DV8A 5IUQA 3KD5E 1GOHA 1PM7A 4ADNA 4OFGA 1RUE2 1Q5OA 1VALA 1QQP2 1WBLA 1W8FA 2A71A 1WCKA 1KDKA 4R9CA 5BYNA 2FQPA 1NCQA 2PHUA 1H9WA 4AVSA 4GAMC 2R7EB 3PNAA 3SQ0A 4Y1UA 3GBWA 2FDGA 5BUVA 1Z7S2 3W58A 1VBE1 2DF7A 1MHYG 4FPJA 3UJQA 3PDQA 1UW8A 2BGOA 1LOFA 1GSLA 2X5IC 1LHWA 4JGZB 4JHTA 4YGDA 1KFXL 1DIWA 3OD4A 4P9JA 2I45A 4JVAA 4Y1ZA 1NY71 1HRI2 3O1SA 3MV01 4AQSA 4QB1A 4FXKB 2O0OA 2R071 3D5OA 1AR82 2CL2A 5I8SA 4FJGA 2JG9A 1Y3TA 3AMHA 3ZFFA 5C9AB 2BNNA 2RDRA 4MZUA 4EWDA 2G9FA 3HGKE 2LRPA 1AR62 2PHWA 2WFF2 2VW1A 4PBPA 3H0OA 3IM0A 3WNNA 1CN1A 2BVVA 4AVBA 1IPJA 3HJRA 4FPHA 2AZ5A 1PGW1 2W39A 2UY8A 2HWB3 1I5ZA 1RUD1 2W1WA 2Y6FA 3JBG3 5FLJA 4IUGA 1UWWA 2G1MA 1XYPA 1POV3 2BV4A 1PVC3 1HN0A 4BPZA 1Y9QA 2KA3A 2VQ0A 4W4ZA 2C24A 2ZKNA 4MVTA 2GNTA 2I74A 3A0NA 3GCXA 3WW2A 5A33A 2VMEA 4NVPA 2IXHA 1R1A1 4COZA 1CLQA 4R9BA 3SQ1A 5D2AA 1PO11 2P2KA 3MLJA 5FYVA 1F15A 2IFWA 1L7LA 2EF6A 1W28A 3V64A 3KB5A 4PLNA 3OBAA 3A0KA 4M3YA 1XYNA 4L92A 3EHKA 4Y4RA 5FYYA 3DPRA 4EV0A 1PIV1 2VJXA 1MQTC 2QE3A 3OGRA 3CKHA 3W20A 3LE0A 2W1UA 5J1XA 3VKFC 4MYEA 2XUMA 1QJFA 3D0SA 4CXYA 4ATEA 5FZ0A 2W68A 1QF3A 4UW5A 1JYWA 4IEPA 5FV3A 4NR1A 1COV2 3NV4A 1ZBE3 4GB33 3POYA 1YQ5A 1QIQA 3NJYA 1UX6A 2P5GA 5GLUA 3DYOA 4M3RA 3L2YA 2HWE3 4QHOA 2Q0AA 1S4CA 4LIUA 4MGIE 2VNOA 4WM7C 5CKNA 2OZJA 3OUIA 4XDOA 3ALQA 4NO4A 5FAXA 2R16A 1I5PA 3D4KA 3WVJA 3OB8A 4HVRA 5LATA 4LT5A 3J2PA 2IVIB 3CDZB 2BUKA 4QGNA 5BNQA 4EE2A 5FZEA 2DDUA 2QDRA 2ZGOA 1FI2A 3FHAA 3UV9A 3NKTA 4CDWA 2QDNA 3C3VA 4XVHA 3ZN4A 4CTEA 5IBKB 2K2SA 2PLV2 2DTYA 4C0HA 4XHBA 2GP5A 3LB9A 4CUCA 5IAXA 1E5HA 2WRAA 1XE8A 4H2AA 3FL7A 1EPWA 2VQTA 4WZCA 1J59A 5KXEA 1MZ6A 1IQAA 4LOSA 4JS4A 2X5IA 3JXSA 4YZ2A 1RJ7A 1QOOA 1FV3A 2J22A 3LZZA 1QJX1 3ES1A 1AYM1 2RR13 3NNFA 1HJFA 1TEIA 4C1WA 3AZZA 4RL7A 2EAAA 4AQ2A 3S7IA 2JDHA 1E5IA 3O0WA 3GZUC 1X9PA 2DVBA 5E8AA 5FZGA 1UYZA 2VC9A 1O8PA 2BERA 1I9RA 2DBNA 2RS33 2Z5WA 1ASJ3 3VD3A 1MS4A 3ZN5A 5JWPA 3E97A 3QEWA 3LIGA 5FREA 2GDFA 4HSLA 3WEZA 2GC2A 3INAA 3WHUA 4LKFA 1GNHA 4LBKA 2Q1FA 2XBO1 4CEWB 2VCMA 4NE9A 3TN92 3WHTA 4C1XA 3GHMA 4FJHA 1AR71 1U0AA 1N3PA 1TG7A 4IV3B 3SUOA 1VB2A 3ACHA 1S0EA 2CWSA 4EQVA 1CPNA 3ELNA 3MIEA 3P6BA 4Y5TA 4JS5A 3HPNA 4XYXA 4PDWA 1W39A 4HK8A 5FJKA 4BQXA 3ZLIA 2JICA 1IPKA 4M3UA 3PUQA 4XOGA 1GBGA 1S0CA 4QGMA 4I0WB 2D6PA 2VNRA 3O0XA 5A6QA 1AHSA 2YY1A 2NYYA 3KD1E 4HONA 3VBHC 5AC93 1JOBA 5DAVA 1SHWB 1CAVB 1MQTA 3FHQA 1OUXA 3Q8CA 3VKOA 1DQ1A 4B4PA 2VE1A 4Q0VA 2G9GA 3ST7A 3VDBA 1AYN3 5A7NA 4E27A 1QJU1 1G6NA 4LBQA 1MPXA 2UWCA 2W92A 2WJSA 1CAXB 4RR3C 1DYPA 5CNAA 4QM9A 3CFPA 5FP8A 2E7AA 4CU7A 4QDRA 5ABJB 3JB8A 2J1EA 1K45A 5FPXA 3NO8A 4FFIA 4TN7A 4E2GA 3DL3A 3J7NA 3UKTA 4WM7A 4B7KA 5JZGC 1E57A 2IC1A 3CF6E 2HWB1 2WA3A 4QX5A 3JBG1 4Q5OA 2VUAA 4K40A 3NV2A 1POV1 4LBMA 1PVC1 2ZX2A 3SQOA 1IS4A 1OLMA 3E5UA 3OF1A 3PMSA 3SJJA 3AMNA 4D7SA 2FZ2A 3K4ZA 5EHDA 1GWMA 2WBKA 4ZU5A 2BFUS 2BYVE 3AMQA 3M1HA 4IE7A 4XBNA 3TB0A 3CJXA 1RUH2 3H3LA 5IFPA 4Y5SA 4LO4B 4XETA 4QNCA 3GZEA 5IK8A 2FMYA 1F8VA 2SLIA 4W6WA 3RSJA 3H8UA 1HB2A 1VJ2A 3SKVA 2JDPA 4AFBA 5IVEA 3IKWA 3U4XA 4WM8A 2YBPA 3U75A 3ENRA 4NPLA 4I3GA 1NLQA 4OI2A 5FZHA 4BMEA 2VZOA 4RHV2 1UNBA 3ZM8A 4LNVA 4EN8B 2WLQA 4I3PA 2RS53 2ILMA 2VCCA 2CGOA 4XJUA 1JMUB 4XF4A 4GB31 1ZBE1 3B01A 1R092 3VBUC 1UMIA 4DPNA 3WY6A 5FRAA 3T08A 2QXFA 2A6XA 2HWE1 1UZYA 4AKGA 4Y26A 2PMWB 4NIDA 2WNVB 1LTEA 4GULA 1UU4A 2ORXA 4I0BA 4X8NA 2DFCA 3T1MA 2BP6A 3T09A 5C5UA 3W21A 3SUNA 3QD6A 1VMJA 1C1FA 4UBGA 1BQPA 3C7EA 3MBWA 4FJXA 3NAPC 4XXAA 5EQUA 4A45A 1FYUA 4PI0A 4NIAA 5KXDA 4YW5A 5DUWA 4S2FA 2GNBA 1DHKB 2P6HA 3BIEA 4JTNA 3J8F2 5T55A 1VBC2 1SMVA 1VRH1 1XNAA 4KBBA 4YWAA 5LBCA 5LK7B 3VL8A 1A3KA 3MZHA 3U37A 4D6RA 3OPTA 3JQWA 1PGL1 1S0JA 2E33A 3AJZA 3I97A 1OQ1A 2V09A 1XU2A 4GA9A 4MGSA 3VBHA 5IK7A 3RGBA 4P00B 3RPQA 1OXCA 1G9AA 2RR11 1H6XA 4ZU4A 5FWEA 3WNMA 2YB5A 2PFVA 1RUG3 4P9GA 1UF2C 1VMFA 3RMBA 1NCRB 1SBEA 2B39A 2RS31 1ASJ1 3O5SA 4DZGA 5FZAA 5BNNC 2MMBA 2YC0A 2HWF3 2UU8A 2ZGTA 3NJVA 3OGKB 5A7QA 2VXJA 1C8M3 1W8TA 2A6WA 2H6BA 3IN9A 1YRZA 4GH4B 5IWFA 4CCDA 1S55A 3THDA 5FIXA 5GM0A 4O7XA 1R64A 3ZDSA 5JZGA 3NHGA 4YM3A 1W8WA 4S2DA 2W0XA 4AEDC 5FUNA 5T54A 2H0VA 4BIFA 1M4WA 2Y6JA 1VBA2 5F9TA 2YBSA 4H55A 2P1PB 2OZMA 2C6SA 3VD5A 4RS5C 1MS1A 2CY6A 4ICGC 2XHNA 3TEWA 1REEA 4BQWA 3ZFEC 1UQXA 1O4YA 4HFSA 1JZ2A 4DTPA 1Q56A 3I4IA 3ACLA 4R4XA 4MO3M 4FK4A 1UCXA 4BLIA 2WT2A 4HG6B 3VHNA 2WZR2 1H8TB 4KQ7A 5EP9A 1JUHA 5K4LA 2FYOA 1VP6A 4BOWA 3URFA 1AYN1 4Y4YA 5T5PA 5LRSA 5FMOL 1Y7BA 1NQJA 1G8WA 1CVNA 1RUD2 1XB9A 2RJLA 4Q4X2 2RJKA 3D0JA 3UNPA 4DTJA 5IREA 1N3OA 3AYCA 3FMGA 2QZ2A 3WNLA 5KR7A 3UGFA 4OYUA 3N4MA 1AXYA 1XC6A 2VY0A 4NOTA 3OPZA 1WMXA 2JH9A 3NAPA 3W5NA 1NXMA 5C3SA 2E7QA 1MEC3 5A1LA 1RUF3 4LK6A 4DTXA 3TABA 4Y1VA 3ZSJA 2J1TA 5DDJ3 3LDSA 5F2SA 4N53B 1PGSA 4HZFA 4NAMA 4XILA 5M0TA 1RVF3 4OVEA 5FP3A 2X05A 1AXZA 2QQMA 5FJHA 1UXXX 4GALA 3O1VA 1XL3C 3TOJA 1F4AA 3WQBA 5I91A 3ZXKA 3OY8B 4IGPA 2HWC3 3OGGA 4DMIA 3USUB 3N7JA 1XVDE 1S2KA 4A6SA 3K46A 2P1MB 4K1ZA 5C7GA 3I2OA 3E4YA 1UU5A 4QHBA 3ORJA 3LDKA 1JHJA 2W08A 3O1RA 1VE0A 5JCTA 3I7DA 3SVIA 4LO5B 2RS51 5JXHA 1UZZA 1HJGA 4IV3A 5FPVA 3ETQA 1W6PA 1XMHE 1FOD3 5BNNA 4URAA 2ZZQA 1Y9GA 3C7FA 3ZXDA 3ZYHA 5FPZA 4ES9A 3POIA 4IV1B 1CAWA 1ZBA2 2NN8A 1HXS2 1OBNA 2Q1ZB 4QPYA 2D6KA 2WUHA 4CDQB 1MR5A 2BBVA 2O8OA 2WO7A 3QH7A 2QQWA 3AZXA 3IT8A 4MH0E 2LM3A 4YGEA 4ZXKA 3KF3A 3NE6A 4AEDA 5DUXA 5J7MA 1C8NA 3NRUA 5CBLA 4QXKA 4QX7A 4FCAA 1GQGA 5C3PA 2D44A 5D1IA 1BLZA 3PIJA 3U4SA 2ZGRA 1BZWA 1YI9A 2LROA 4LBOA 4XUTA 5F5CA 3AVSA 3LWCA 2P5OA 4LLFA 4RA0A 5KHIA 4O61A 3MF6A 3Q8BA 4RS5A 4AVVA 4RG8A 1ZVFA 2JIJA 3O1MA 5IT6A 3C95A 4CYDA 3VD7A 1CX4A 3VBRC 4GMP0 1QJY3 1NG0A 5EPAA 4AHZA 4P9IA 4K9SA 1L7QA 4DOUA 2XPJA 4Y1XA 1CONA 2JX9A 5A32B 1SPPA 4P14A 4ES8A 1WLWA 2K9ZA 4LO7A 2AACA 4JRPA 2FZ1A 4QB6A 1KXGA 1W0NA 2VH9A 4XABA 4LORA 1OVSA 2IWGB 3B02A 1RUG1 4IT5A 1SLBA 5JR2A 1PNFA 3KCXA 4YLZA 4DUWA 1OA2A 1WLTA 2XBO2 1UZWA 2JG8C 3MW2A 3N3HA 4YW2A 2JDYA 1D0GA 2HWF1 1AR72 1D0HA 1RTVA 1ZM1A 1CWPA 4SLIA 3MHZA 1XVFE 2QVSB 3WQ1A 4E4DX 3U14A 3RZZA 5A1AA 1LGCA 3H8OA 3HAGA 1B35C 1XU3E 3QLQA 4QD2A 4AI2A 4XHXA 1Q43A 5FYMA 1HIXA 5E6HA 3B7MA 4LA2A 5JSOA 5FY7A 1GICA 2A3WA 1NLRA 2Q8EA 4FOYA 1B09A 1VAKA 3PVOA 2RM23 3CNAA 4MUVA 1IKQA 1CJDA 1RXFA 1HN1A 1OA4A 1YO8A 1YWKA 5IVYA 1BEV3 4AI1A 4F8AA 4AOCA 4CA9A 3RMYA 1OKQA 4AGGA 4E8CA 4OQ8A 4L2NA 1LAJA 1W3VA 3N9MA 2ADDA 3RWUA 4JAAA 5JMOA 4DINB 4HN1A 2GC1A 3NWKA 1Q8QA 5IZ7A 4JTOA 4A3ZA 3P1IA 4P9LA 3RG0A 3V65A 4AVAA 3BUCA 4F3JA 2MPFA 1J83A 2Y6KA 1JI6A 2VPVA 2P1NB 3THPA 5T50A 3MPPG 2D6LX 1R1ZA 4QDQA 4A44A 4DTMA 2ES3A 1WLDA 3S5QA 4FTEA 2ZXQA 3B3QE 5CFDC 5CISA 3OJBA 4RNGA 5T5LA 3WUDA 3O1PA 4Q8KA 3ZIXA 4B4QA 4QAWA 1AXKA 3RZGA 2EXJA 5JIUA 1MEC1 1RUF1 3M3CA 4K1YA 1OA3A 3KT4A 1W8UA 4I01A 4DU4A 4XC9A 5DDJ1 3WF0A 4CEYC 1T6GC 1KD7A 2GMMA 1RVF1 4IE5A 4YG3A 4WBBA 3BPZA 4X8PA 4INDA 2GALA 4XXPA 3BVOA 3VBRA 1YLLA 1WCUA 4XIOA 3TNPB 1Y4WA 2GN7A 4D6SA 3ZVXA 4KHSA 2VMGA 3R6SA 3VHRA 1V70A 2HWC1 1JS9A 1MZ5A 2B9UA 3EMRA 4GB32 4JV4A 4NRPA 2OYQA 4KI4A 1ULGA 3PL0A 1WCQA 1H2NA 3L8BA 1MTYG 2DV9A 1PMJX 2XMLA 2ZX1A 3QNNA 4YG6A 3A22A 3U78A 1PO21 5FYCA 4AG4A 4Y20B 2PN5A 2XQRA 2P17A 3M2MA 4N9HA 2ZZJA 1FOD1 5FBZA 1DQ0A 4AI8A 2JG8A 3WNXA 1SBFA 1US2A 4YZ1A 5FYTA 4DTOA 3I59A 4XFHA 2NPIA 2OZSA 2DWRA 5LY1A 4QPWA 1GZCA 3LPFA 1SDDB 1UL9A 1B35A 1F4HA 5A7WA 4JHZA 4JKLA 4M3CE 2LW8A 2Q5TA 3THTA 1XBFA 4FPYA 2WC2A 4R9AA 1CZTA 3CFOA 4AYUA 4EJRA 3S57A 1NEXB 4UXAA 4LBNA 3WZ1A 2ZMKA 3UT0A 4M4PA 1H8TA 2FCTA 4CCEA 5A3WA 2PHXA 2UWAA 3ES4A 2C9AA 4YVSC 2RR12 3N35A 3TEZA 1FNYA 4OHVA 3BKZA 4AFAA 3MUZ1 3AX4A 1CJPA 3L0MA 1DGLA 1URXA 3C7GA 5LB6A 4B8EA 2PAMA 1QJY1 3O1OA 4DXZA 3LEKA 2WNOA 4JRLA 1YJKA 1ENQA 2D5FA 1JOPA 1GLHA 1LEDA 5JPMB 4AE2A 4KI6A 3A21A 1V6JA 2VNGA 4FP2A 3ZYGA 3PUHA 1NOVA 3BTXA 1O5LA 1TMF2 2DVFA 3M3IA 4A2UA 2GZWA 2YROA 4K8RB 1IH7A 3WCRA 2RMU3 1C4RA 4MXWA 1NA1C 5FZCA 3N1EA 1JOJA 3T3YA 2IXIA 1WCSA 1H2LA 3VBOB 2WFPA 4P5YA 4PQQA 4NIGA 4YARA 1C28A 1XPWA 2IFRA 2JHPA 4Q0UA 1QOSA 2OUJA 3MF9A 5AVAA 3W5MA 1XNBA 2WAOA 5DN2A 5DZEA 4FOVA 1W99A 3AKPA 4MADA 3OY8A 1GP6A 4UW4A 4TYSA 3UGHA 4KG8A 3WUCA 2B7YA 4YVWC 4XMIA 2PHRA 2RM21 2CV6A 2VBPA 3ABZA 4CEYA 4FJLA 2VOWA 1HRV3 5AC92 5F3IA 3FLRA 1BEV1 3I3EA 3ZR6A 5KHKA 1ULDA 5FZ8A 3DYPA 4EROA 2BGCA 4Y33A 1A78A 4IGQA 4YW7A 1UY0A 4NIIA 4D0QA 1DYKA 1ZX5A 1G7YA 4LBJA 3TAFA 2IXLA 4IV1A 5DAXA 2VJ5A 4M3ZA 3ZXGA 3C8XA 4CDQA 1DLLA 4XJ8A 4QT6A 1AUYA 3HQXA 4MOAA 3AFGA 1EAH2 4QQHA 1JZ4A 5KHHA 2AEYA 1RUJ2 4JGYB 2GH8A 5B4XA 2PAKA 4RGKA 2Z79A 1BVP1 4PIXA 5F6LB 1FXXA 3WDUA 4YM2A 4AF9A 2ZS6B 2ZACA 1IG9A 4CCOA 5JSRA 2ATQA 1EY2A 1UY4A 2AGSA 3EQEA 1SZBA 5H37A 4CU9A 3MKSB 3FBYA 5FZ3A 1XXNA 4HBNA 4HPKA 1TNFA 4ADOA 3LAGA 1HKDA 2RVAA 4QKNA 3VBSC 1OOPC 1DBNA 3DPRC 3KGLA 3LDRA 3P5BA 4FFGA 1E5SA 1RHI2 1XSQA 1YHFA 5BNOB 1W8ZA 2WSVA 3HQUA 3BCWA 2FMDA 1GZWB 1NZCA 1OLRA 1MS3A 3AZWA 4J6GA 1IPSA 3K4AA 4QX8A 4XFBA 5GLZA 2C1FA 3H3ZA 4YVSA 2V5YA 4NWWA 1H2KA 3DXTA 2JE7A 3I2JA 1JU4A 1YIFA 3T1LA 2VZ3A 3QEVA 1GU3A 4WVVA 4FPGA 4UW6A 4NIHA 4FVVA 5K0UB 3WDTA 1LDKE 3GYDA 3KD4A 4OHXA 2A75A 5CFCC 3V7DB 1YQ2A 1AR93 2D7FA 4LXLA 3RI9A 3U1XA 1AL22 1FZIE 2ZAHA 4KWLA 4CDWC 4DTRA 2RKHA 1H6YA 1F5FA 2PA7A 1STMA 2PELA 2XVLA 3EYPA 1NA1A 3FN9A 3Q8AA 4Y1YA 5FDBA 2JHCA 5J37A 2OS2A 3ZO0B 1RJ8A 1GNZA 4M42A 2QQUA 3WNPA 4Q0SA 1GUIA 1S0BA 2WKKA 3B69A 4FK2A 1KEXA 2YU2A 4XFGA 2YGLA 4NRQA 2XVGA 1ODNA 1OT5A 4O9GA 3H7YA 2Y26A 3M4FA 4XFIA 1ND3B 4BMBA 1WAJA 3R4SA 5EJ3A 5F3GA 4Z8BA 3ZXLA 4YVWA 1VBD2 5F1RA 3I3BA 1SFNA 1DQ4A 2R0HA 5B2GB 4HOOA 4QX2A 1JTZX 1QJU3 2E53A 4JDMA 3OGSA 2X10A 2WQ4A 2ZEXA 1H9PA 2YPDA 4AAXA 2XGXA 4Q26A 5ACA3 2NMOA 3SITA 4PF5A 4PBOA 2Q8OA 3ZFEA 5C4WB 3BVCA 1RUG2 4I2OA 4FJKA 2OPKA 2UWBA 4D69A 1JODA 2FBEA 4UF0A 3VDDC 3M8LA 5IJRA 2ZMLA 2WLPA 3POEA 5JAXA 3PTRB 4N9IA 2A73B 1DG6A 5EV7A 1C8M2 1QEXA 4AHWA 3MIHA 3HOBA 4C8DA 1ZRCA 2WO1A 5DPNA 3U0ZA 2WIIB 1GOGA 1FZ5E 1J84A 4K6BA 2RMU1 2RCUA 1ND2B 4CZSA 1DGRA 2WS93 1D4M3 3VZLA 5DMYA 4PDWC 3KV6A 3PU8A 3FUOA 1G9BA 4QPIB 3IAPA 3T4HB 3IPVB 3L2HA 3CEWA 4AQTA 2RS12 1YYNA 3VBSA 3RZJA 1OOPA 2JDZA 1H4GA 4E4BA 2PFWA 1W9TA 2E31A 3NCIA 1YNAA 3VLBB 1V9U2 2DU0A 4GMP3 4C90A 3ZFGB 1HRV1 3K3NA 4XBLA 4DEQA 2VMIA 3DECA 1W6MB 3FLPA 1Y43B 3NJXA 3HVDA 1HQLA 2E26A 2FDJA 3N36A 4EZ4A 1VBB3 3CU7A 5A1FA 3LEIA 3GF6A 1RINA 4GWNA 3TL8B 1XNTA 1RUI3 3WR0A 3H8XA 3RZHA 1GQPA 2TUNA 5CFCA 5FP7A 1PK6C 1UOGA 1PHMA 3VGIA 3GDBA 1K5MB 4W6YA 3KQ4B 2WZEA 2ZGNA 3MUY1 2D3SA 3WP5A 1OMIA 4D8MA 3M7AA 4J1XA 1GOFA 2D3RA 1MEC2 1UIKA 2A3XA 1NQDA 1VRH3 3ZKYA 3RYPA 2LF3A 1QDCA 3P3PA 4YZ4A 2D97A 5FFOC 5LCWL 2J1RA 4S2HA 2LALA 3JQXA 5FZ1A 5CU1A 3N9PA 1Q8PA 4WM8C 1W6QB 3ON7A 1OH4A 4LK7A 5C8CB 3VBFB 3UO3A 1J3QA 5LK5A 1DU3D 3VDAA 4CUGA 4IE4A 4CDUC 2WWJA 2WDBA 1OH3A 3PU3A 4HK9A 4YYOA 3WDXA 4MHRA 3OYWB 4XW3A 1DQ5A 2HWC2 1MS5A 1FMD3 4DO0A 5CG9A 2KR2A 4KBZA 5DUUA 3FWEA 4XUNA 5FYUA 3ZN6A 2OXBA 5A6XA 4ZU7A 3TAGA 1NLSA 1ZZBA 2VVFA 3BU7A 1WAFA 3GBFA 3V0AA 2NQYA 2RE9A 1NKGA 3TEXA 4CP9A 1AZDA 3SXWA 4P9YA 3VDDA 5JMCA 1FOD2 4QM8A 3BIWE 4KGGA 3VZKA 1AR91 2EIGA 4JGZC 3KCYA 3WP3A 3NQHA 4ORFA 4I9QA 3RDIA 4OI4A 2YFZA 2VO5A 4PHZA 1GP5A 4YRDA 2WABA 1O5UA 2VQAA 1QJZA 2WN2A 4LMFA 1W6NA 3T0DA 1ZRFA 2P4EA 4YFWA 1UD1A 1ULCA 2GNMA 3KT7A 5F5QA 5FZFA 3WF1A 4JKKA 3WQ7A 5J09A 3OTFA 4F7ZA 1NT0A 2R32A 3D82A 1S0GA 2WZPP 1DYOA 1AX0A 1CQ9A 1HB4A 4MGZE 5C9AC 2BQPA 1RUOA 5D21A 4ZZ8A 1KITA 3A7QA 3PTYA 2AH2A 2QQKA 3RI8A 4ASLA 4FPOB 1BXHA 3H1WA 5D8AB 4TZDA 1S0DA 5HCHA 1OD5A 5IATA 3SQ2A 1PM4A 2XL9A 2PQSA 1FYZE 3UYJA 3GJAA 1MS0A 3VDCA 1NUKA 3C2UA 5JR7B 1FPN3 4OHZA 1FZ2E 4AI3A 2WWUA 1JZ3A 4JGYA 1W8OA 4P02B 2W1SA 5ACA1 4CUBA 2BOIA 2PXJA 3WQ0A 3BALA 2DTUA 3FBMA 5TSWA 4C91A 1AVBA 4Q4Y2 1N1YA 1S1AA 3UESA 4E4HA 1RMU3 3HQRA 3IDBB 4XJZA 1TME3 3ITQA 3VKLA 5J98B 1OFNA 1PK6A 3DF0A 4Q4W2 1W9FA 1JZ8A 1BMV1 3QOPA 4KNCA 2NZ9A 4Z1VA 3DKWA 4QKFA 5A3UA 3PVEA 1X8MA 2WAAA 4NPMA 3EJKA 1U5IA 4YZ3A 1DLCA 2PYTA 1GZWA 2WS91 1D4M1 3BODA 1MVEA 3KGZA 3NVCA 4HKWA 2HBTA 3TBDA 4R8HA 3JU9A 3OG2A 1XJAA 4JDNA 4QXBA 1GNYA 2VMCA 3OEAA 2RJ2A 4RQPB 4XTPA 4ZXEA 5J48A 5BNPB 5JOYA 1KS5A 1LU2A 5FPLA 1DZTA 1BEV2 1IGOA 2VMHA 1KQRA 4LJHA 2XJVA 4J2EA 3S0MA 1EPZA 3CIHA 4Y22A 3C6PB 2I2SA 4ZS3A 4CDUA 1MACA 3T2OA 2R043 1LB2A 3JD72 2OX0A 1BBT2 1US3A 4GMP1 3MW4A 4BK4A 5A3MA 1W03A 2D93A 3QNOA 1WBFA 4AKHA 5FZ4A 2ZAAA 5C8WA 1YQ8A 1ZYBA 1EYBA 5EXOA 4M45A 4EZHA 4DTNA 1AL0G 1D2QA 1VBB1 4BQYA 1VIWB 4BH9A 4CXWA 4NUBA 4YW1A 3AYEA 2NM1A 5FQ0B 4N7UA 1RUI1 1X7NA 4IEXA 1UZVA 3WDVA 4W65A 5I93A 1NE6A 2A5ZA 3MIFA 2R063 1ZZ7A 3MGUA 2RHPA 2UYBA 1QU0A 3IMMA 4JGZA 4Q0QA 4QPGB 3IDCB 1OC1A 1DQ2A 1FS1A 1IS5A 3PLQA 4JQRA 1QXPA 2VAUA 4NPRA 4WVMB 3ZMNA 3ZSMA 5IAVA 3FJSA 3LF7A 5GZCA 4Q4V2 1AX1A 3BOWA 5LEKA 4P9XA 4M3CF 2XWJB 1V6LA 2WR9A 3GJBA 5C9AA 3N1BA 3ZPOA 1C5HA 2CNAA 3OUJA 4BCUA 5FY8A 1NE4A 1UAIA 1AJKA 1UY1A 3QCWA 4XQ4A 3W9AA 4V2VA 3TNQA 1ZREA 1RUE3 2DTWA 1QQP3 2QQNA 2MEV1 3QEIA 1D2SA 3OBRA 3V0BB 2BPA2 4G4FA 4CEWC 4CVUA 2DBIA 2O8QA 4KU8A 5K8SA 1FMD1 1Z7S3 4IV3C 4V1PA 5JLVA 2XJUA 3RYKA 2VOXA 2XXZA 4CDXB 3LSEA 4FPCA 4OI0A 1K42A 2DCKA 5JSPA 4NHLA 2CDPA 2PHFA 2B8IA 2FHRA 2RDNA 1H4HA 3VV1A 4N43B 4ATFA 2ARBA 4Q1PA 1AR83 2R30A 1FZ6E 1SCSA 1SDWA 4ZS2A 4LEJA 2ATFA 2QUOA 4QDSA 1VBE2 2TBVA 2ZX4A 2HWD3 5HBAA 1AR63 2WFF3 2XJPA 4AEKA 5LW9A 1N3QA 1HDKA 1QH7A 3PVBB 2A6ZA 1R081 5EYXA 4IQPA 1O3RA 2CYFA 3U11A 1XVBE 1QKQA 1NY72 2VR4A 3BTAA 5EWSA 2BFUL 2R072 5ABJC 4L9BA 3A23A 2B45X 3H42B 5DAWA 1V6MA 3HL8A 4PI2A 1MZFA 3TRSB 3MIBA 2XUEA 3RQ0A 2QBXA 1CZSA 1KGYA 2VZRA 4CCCA 1LU1A 1DZQA 1FPN1 4H7MA 2H4TA 5FKCA 1OUSA 1NAEA 2QQVA 1PGW2 3QEPA 2ET1A 2BW8A 4NJ4A 4B7EA 2PFTA 1F31A 3RS6A 4DFSA 2AREA 4FJ9A 5AFEA 4YW4A 5LA2A 2E9QA 2BDRA 4XEZA 2Q8DA 1H1AA 1RMU1 5ERLA 1R1A2 1W3XA 4GXLA 3ZDVA 1H0BA 1TME1 5GZDA 4BM8A 3VB9A 1PO12 1ST8A 4CCJA 4YGBA 1COV3 1TNRA 5KXBA 2XLGA 5C8CA 4L11A 3VD9A 2JKBA 2F4LA 4FXGB 3POJA 5IYYA 3SMHA 3DN7A 3K2OA 4LKSA 4BJ0A 3K75B 4XUOA 3HBKA 2XJRA 2WSUA 1PIV2 5FXWA 2NP0A 4D7YA 4LIVA 1U5XA 2WO2A 4BU2A 1Q8SA 1O3SA 1DGWX 3BN6A 4JKMA 1UKRA 1IOAA 1Y9MA 2F6BA 2KM2A 4OMCA 4XJAA 4GJYA 3KF5A 1OVPA 3NL1A 4X6RB 2WNVC 3PIGA 4AK3A 2CWMA 2PLV3 1T6BX 2UYAA 4U36A 1BHGA 2R041 1JH5A 4J25A 4CEWA 5I0DA 1JZ7A 1XMGE 1DZRA 1JW2A 2LF6A 2GH2A 1PO23 2FD8A 1S2BA 1K3IA 5FCCA 3UETA 1LODA 1QOTA 1UPIA 4FFFA 3T2PA 5JPNB 3VUOA 2BWAA 1RC6A 3DCQA 1W05A 4NHXA 4YG0A 3CJIB 4I0AA 2W5FA 3GCWA 3BTZA 4KL1A 2Y60A 4IL7A 2CDOA 2YXSA 5FXXA 4IERA 4RN5A 1ZA7A 5E88A 1JN2P 4DUXA 4P5HA 4M0NA 2R061 1CPMA 3T0AA 3B9CA 2CAVA 1XU5E 4IEVA 5KWRA 3MIDA 3LA3A 1CAVA 5D8AA 4QB2A 2J1UA 2EICA 4AWDA 1YIPA 2QNKA 2XDVA 4RGGA 5FUPA 1QJX2 2JWPA 2YDEA 1AYM2 1NCRC 3AMMA 3NV1A 5FBJA 3WINE 3WW4A 4BQ3A 1CAXA 1GV9A 3AC0A 1RXGA 2MW2A 4GWIA 2XQXA 1CAUB 2ZGPA 4XE9A 1OKOA 5ABJA 1EV13 3USSA 4EN7B 5JXIA 2VQUA 4GH4C 2VTXA 3AZYA 2WT1A 1RUE1 3X29B 5KC6A 2WWSA 1QQP1 3C7HA 4QU1A 4WVWA 1S0IA 5FZLA 4D7TA 4DQAA 4H14A 5F5AA 5GZFA 1GMMA 5EIYB 2ZGMA 3SISA 4ZY9A 2JDNA 3IB3A 3RVHA 3AKSA 3PJQA 5FPBA 2XKOA 4XJWA 1Z7S1 4AHYA 4DXTA 4EN9B 4UFMA 3RZKA 3LOBA 4M3CB 1HX6A 4E3SA 1NXD1 3NNJA 2BEOA 4HCCA 4Z82A 4COYA 1DFQA 3J26N 3NJZA 2CSGA 1HRI1 1J3PA 2XOMA 2BU9A 3D3AA 4Q1RA 5FZOB 2ZEYA 5BNPA 1AR81 1FT9A 1YEWA 5L7OB 3I54A 1SCRA 2XWBB 4E2SA 5FOJB 4FVMA 5C3RA 2XLAA 1E5RA 2P3KA 2W94A 2YG0A 2HWD1 1H8TC 1JBCA 4TSVA 3WW1A 1AR61 2WFF1 3ILRA 3AJYA 4AGVA 4A4AA 3AZVA 5FTTC 3E6CC 2QQLA 4WZFA 2GMPA 5A70A 4LLOA 2JJ6A 1XVGE 1GZTA 4B1MA 4EYWA 4FJNA 1F35A 1W6OB 1OURA 2JXAA 3J27A 1LOGA 4EP9A 1QJU2 2PHTA 1LNSA 4MSVA 3WD5A 3APBA 3ZSLA 2HEWF 2WNVA 3WF4A 2A70A 2DVAA 1H1MA 1XE0A 2ZGUA 1YQCA 2QQOA 4BA6A 2PTMA 3ZX7A 5A3PA 4HKLA 3LCPA 2F4PA 1NCQB 4WVMA 1Z0HA 2HWB2 5E89A 3JBG2 3BYWA 4N53C 3CZUA 3R05A 3SH4A 5A3LA 1BMV2 1PVC2 4MGYE 5GJ6A 2Q4SA 3KM5A 1GWLA 3AVRA 5BY5A 4LHKA 2BOJA 2V72A 4JRQA 4RHV3 1J1LA 3KQRA 2WS92 2C9KA 2WNUB 1WKYA 1HB1A 3MLLA 1XU1A 2XLFA 3P3NA 1COV1 1LOBA 5FLIA 1R093 1IG0A 1SLIA 2DUOA 4UOJA 2WO3A 5FK8A 3ZMOA 3I2HA 1UO9A 1PX4A 1X36A 2JG9B 5GZEA 1SQ4A 2J1AA 3SEPA 3ZFFB 4AR2A 1VAMA 4M3TA 1NCRA
chains in the Genus database with same CATH topology
3V7DB 4JS5A 3E4WA 3RMAA 1YQ2A 2ZEWA 3HPNA 4BDVB 4M3UA 1O59A 5JXGA 2B7MA 1FZIE 1ULOA 3NGIA 2HYXA 4DTRA 1H6YA 4DXSA 3I3DA 3KD1E 3EYPA 3FN9A 2JHCA 3GM8A 1SHWB 3FHQA 4KWUA 3WNOA 4M42A 3HNBM 1JZ5A 3QETA 3WNPA 3VDBA 1GUIA 4P08A 3HN3A 4FK2A 1KEXA 3LPGA 4DTSA 1MPXA 2W92A 1OT5A 2VMFA 3CFPA 4GZ9A 4CU7A 1WAJA 4QDRA 2OVRB 2J1EA 2WQ8A 1K45A 3I3BA 4FJMA 2VZUA 4QX2A 2LS6A 4KHNA 4AAXA 3QEXA 2X10A 3OGSA 2ZEXA 5IYYA 4X5NA 5EJ1B 2QQJA 4FJKA 1UY2A 3SJJA 3K4ZA 2WBKA 3RMDA 5IJRA 3SUPA 3OGVA 2HD0A 3SPYA 1UMHA 5IFPA 4A42A 3HOBA 4QNCA 2WO1A 5DPNA 2FW3A 1GOGA 4TTGA 1FZ5E 1J84A 3SKVA 2RCUA 3CQOA 3SEEA 2Y6HA 5DMYA 2X09A 3K4DA 2VZTA 2YC4A 3IAPA 2VZOA 2OVQB 3ZM8A 1EUTA 2VCCA 4XZUG 1IQDC 4E4BA 4FJJA 1W9TA 2E31A 1UMIA 3NCIA 3T08A 2QXFA 1SG3A 4AKGA 2ORXA 4DEQA 3DECA 1T2XA 3T09A 2DEBA 3SUNA 4UAPA 3NJXA 4EPHA 2Y8KA 5EJZB 3C7EA 3MBWA 4FJXA 3SQ4A 2E26A 2QQIA 4A45A 5HPOA 5G04L 4FJ8A 1RYYA 3T0BA 3LEIA 1Q9XA 3TL8B 1XNTA 2W3JA 1GQPA 2EIDA 1XNAA 3ACFA 3OGLB 3GDBA 3I2KA 4DU3A 3U37A 2Y6LA 2WZEA 3MUY1 3CMGA 2E33A 3I97A 4MGSA 4D8MA 1GOFA 4P00B 3SUQA 3LDBA 1L7RA 1H6XA 1JYVA 3LEGA 2LF3A 1FZ0E 5LCWL 2J1RA 3WNMA 5LA1A 2YB5A 2PFVA 4FJ5A 3HNYM 1UYXA 3RMBA 3WF3A 1FZ7E 2Y6GA 3ECQA 1OH4A 2MMBA 3MV11 3VDAA 3NJVA 3OGKB 2WDBA 4ARYA 3THDA 3LZJA 1R64A 3NHGA 1XVEE 3I2GA 4XUNA 4KHWA 4FK0A 1UX7A 2WZ8A 2Y6JA 4JX0A 3TAGA 4DEVA 1WAFA 4OMDA 1NKGA 5DQ0A 4DXRA 2DY4A 2P1PB 2OZMA 3VD5A 3WF2A 4DTUA 3EB7A 2KD7A 4J2AA 2XHNA 3NQHA 4I9QA 3LD8A 3SI6A 2YFZA 2VO5A 5C71A 1MMOG 2WABA 1JZ2A 2WN2A 4DTPA 2VL4A 4MO3M 3T0DA 4FK4A 3THCA 4FJ7A 4HG6B 3WF1A 4JKKA 4QNDA 1UYYA 4E8DA 2FYOA 1DYOA 5LA0A 2BZDA 4ZZ5A 4ZZ8A 3A7QA 4GWJA 4PT6A 2QQKA 2Z4FA 2VIXA 3BGAA 3UNPA 3SQ2A 2PQSA 1FYZE 2W47A 4OZOA 4DTJA 5IREA 3WNLA 3VDCA 3IIIA 1NUKA 1CIYA 4OYUA 4RYDA 1XC6A 1FZ2E 1JZ3A 4W8JA 1W8OA 4P02B 4YPJA 4A41A 2W1SA 4Z2AA 4CUBA 2JH9A 3W5NA 1DP0A 5CYYA 2DTUA 3ACGA 4DTXA 3TABA 3UESA 2J1TA 3L2OB 3LDSA 2DCJA 2VMDA 3DYMA 2C4XA 4J2DA 4ARXA 2X05A 4I9LA 3NDKA 2QQMA 1UXXX 1JZ8A 1XL3C 2P1OB 3OEBA 3C6NB 1TVGA 5C70A 1F4AA 3WQBA 2WAAA 1FZ8E 1MHZG 1DLCA 2V5DA 1FZ9E 1JU3A 2ZEZA 4DUWA 1JZ4A 4M4RA 1XVDE 4I6JB 2XONA 3K46A 2P1MB 2J7MA 5C7GA 4KHUA 3OG2A 3E4YA 4LHSA 1JHJA 1GNYA 2VMCA 3OEAA 3SPZA 2RJ2A 2P1QB 3SVIA 3IAQA 3MO4A 4ZXEA 5JXHA 1XMHE 5JXJA 4J2EA 1W9WA 3L1NA 3CIHA 1W8NA 3C6PB 3GGLA 3TAEA 3C7FA 3T2OA 1JYXA 4OUEA 3S9HA 2W9XA 1JYNA 1US3A 4J2BA 4BK4A 2WUHA 3HEIA 5G05L 3LZIA 3QNOA 2VTFA 2JHAA 4AKHA 3NE6A 2L9LA 3NRUA 4LQRA 1P8JA 4M45A 4DTNA 3C6OB 2VOTA 4XUTA 4ET7A 3SKJE 2OVPB 2P5OA 2V4VA 4MGQA 4RG8A 4L0PA 1NX9A 3C94A 3F2ZA 3C95A 3J7HA 1FS1A 3VD7A 2W46A 1P22A 1OD3A 2VZ1A 4KHYA 1L7QA 2B1EA 3ACIA 4XUPA 4JRPA 1K12A 4QB6A 4UI9L 3N1BA 1W0NA 3OGMB 2VZVA 2JD9A 3HGLA 5JR2A 1UY1A 2W1QA 4PF1A 4HCBA 3SNNA 1FZ3E 2VCBA 2QQNA 3QEIA 2VCAA 4CUAA 3PUIA 1UY3A 4CVUA 1XVFE 3GXUA 5A1AA 5IFTA 4B08A 1XU3E 2WYSA 1CX1A 3TJYA 2E32A 2JH8A 3NNGA 2YFUA 4FI9A 4QX3A 4LPLA 2VM9A 2DCKA 1K42A 2CDPA 1XMFE 5IHRA 3VD4A 2B8IA 1HN1A 1D7PM 3T2QA 1FZ6E 4E8CA 2OKXA 5HXMA 3RWUA 5JMOA 1CZVA 4QDSA 3NAEA 4XUQA 5IZ7A 1EUUA 2B4KA 3P1IA 4A3ZA 4RL5A 2MZWB 4KI5M 1J83A 2Y64A 1XVBE 1O8SA 2Y6KA 1JI6A 3RMCA 2VR4A 2P1NB 3CQ8A 3SCXA 1PMHX 3A23A 2RV9A 5B4NA 3HL8A 1JZ6A 1FZ1E 2EIEA 4QX0A 4QDQA 3HP9A 4A44A 4DTMA 2QBXA 2VZQA 2ZXQA 1CZSA 1KGYA 4M3WA 2VZRA 2W95A 1ULPA 2JPNA 3WNKA 4DU1A 2H4TA 5FUIA 4RNGA 1NAEA 5CZKA 3QEPA 2EIBA 4QAWA 5JUVA 2PFTA 4FJIA 3LQCA 3CZJA 4FJ9A 3ETPA 4BXSV 5LA2A 3C7OA 4DU4A 3WF0A 1Q9YA 2BBAA 2ID4A 4BK5A 4DUVA 2B9VA 1FZHE 3I2FA 4CU6A 3VD9A 3WSOA 1OF3A 3KD5E 1GOHA 4ADNA 4KHSA 3K2OA 4LKSA 4BJ0A 2JDAA 3K75B 4XUOA 2OYQA 4AKIA 4KI4A 2WO2A 1WCQA 3L8BA 1MTYG 4GAMC 1PMJX 3SQ0A 2R7EB 3QNNA 3BN6A 2YB7A 3A22A 4JKMA 4AG4A 1MHYG 4OMCA 2BGOA 3UIQA 5F7UA 3QERA 1US2A 4DTOA 1BHGA 5I0DA 1UZ0A 1JZ7A 2OZSA 1XMGE 3CFRA 4QPWA 2LF6A 3LPFA 1SDDB 3MV01 1F4HA 1K3IA 2C26A 4JHZA 4QB1A 4TXWA 3T2PA 3UETA 4JKLA 4FJGA 2LW8A 4W50A 3I2IA 1CZTA 3CFOA 1NEXB 2W5FA 3HGKE 4CU8A 2JE8A 2CDOA 4M4PA 4RN5A 3WNNA 4DUXA 3HJRA 3T0AA 2W1WA 1XU5E 2BGPA 3MUZ1 4IUGA 1UWWA 3K77A 3L0MA 3C7GA 4KHQA 4QB2A 4W4ZA 2J1UA 2EICA 3LEKA 1UXZA 2VMEA 1CLQA 3SQ1A 4KI6A 3A21A 3HNMA 3AC0A 3PUHA 4GWIA 2XQXA 5JXIA 3OBAA 2VQUA 1IH7A 4M3YA 4AI6A 3N1EA 3C7HA 4XURA 2VJXA 3OGRA 2J1VA 3CKHA 3LE0A 2W1UA 1GMMA 4P5YA 2VJ4A 4PQQA 5EIYB 5J1XA 4ZY9A 1XPWA 3IB3A 2JHPA 4M3XA 1JYWA 4DXTA 3W5MA 2WAOA 5DN2A 4E3SA 1W99A 4MADA 2VZPA 4HCCA 2P5GA 3DYOA 4M3RA 3ABZA 2WN3A 4FJLA 2W91A 2XOMA 3D3AA 3I3EA 2ZEYA 1I5PA 3OB8A 3DYPA 1OF4A 4FVMA 3J2PA 1UY0A 4D0QA 2YG0A 2W94A 3CDZB 4M41A 2DDUA 4A6OA 3FHAA 3TAFA 2J1SA 4A4AA 2VJ5A 4XVHA 4M3ZA 3C8XA 5IBKB 2QQLA 4CUCA 1XVGE 4MOAA 3FL7A 2JKXA 4EYWA 4FJNA 1W9SA 2VQTA 3E1F1 3J27A 4EP9A 5B4XA 1LNSA 4JS4A 3QESA 3JXSA 1FXXA 3WF4A 2J22A 2ORZA 1IG9A 2YC2A 2ATQA 1UY4A 2QQOA 4CU9A 5H37A 3MKSB 4ADOA 2RVAA 1UYZA 2VC9A 1O8PA 2BERA 2HLEA 3CZUA 3VD3A 1XVCE 3QEWA 2V72A 4JRQA 3K4AA 2VZSA 3IDAA 3WEZA 2C9KA 4QX1A 1WKYA 4KMQA 3I2JA 1FZ4E 4X5MA 1JU4A 2VZ3A 3QEVA 4UOJA 4FJHA 2WO3A 1GU3A 1TG7A 2W87A 3I2HA 3SUOA 3ACHA 1PX4A 1LDKE 2J1AA 3SEPA 1PX3A 4M3TA 3P6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7D B;  2ZEW A;  1YQ2 A;  3HPN A;  4BDV B;  1O59 A;  5JXG A;  1ULO A;  2HYX A;  4DXS A;  1H6Y A;  3I3D A;  3EYP A;  3FN9 A;  3GM8 A;  1SHW B;  3FHQ A;  4KWU A;  3WNO A;  3HNB M;  1JZ5 A;  3WNP A;  3VDB A;  1GUI A;  4P08 A;  3HN3 A;  1KEX A;  3LPG A;  1MPX A;  2W92 A;  1OT5 A;  2VMF A;  4GZ9 A;  4CU7 A;  4QDR A;  2OVR B;  2J1E A;  2WQ8 A;  1K45 A;  3I3B A;  2VZU A;  4QX2 A;  2LS6 A;  4AAX A;  5IYY A;  3OGS A;  2X10 A;  2ZEX A;  5EJ1 B;  2QQJ A;  1UY2 A;  3K4Z A;  2WBK A;  5IJR A;  3OGV A;  1UMH A;  5IFP A;  4A42 A;  3HOB A;  2WO1 A;  5DPN A;  1GOG A;  4TTG A;  1J84 A;  3SKV A;  3CQO A;  3SEE A;  2Y6H A;  5DMY A;  2X09 A;  3K4D A;  2VZT A;  2YC4 A;  3IAP A;  2VZO A;  2OVQ B;  3ZM8 A;  1EUT A;  2VCC A;  4XZU G;  1IQD C;  1W9T A;  2E31 A;  1UMI A;  3T08 A;  1SG3 A;  2ORX A;  4DEQ A;  3DEC A;  1T2X A;  3T09 A;  4UAP A;  3NJX A;  2Y8K A;  5EJZ B;  3C7E A;  3MBW A;  4A45 A;  2E26 A;  2QQI A;  5HPO A;  5G04 L;  1RYY A;  3T0B A;  3LEI A;  1XNT A;  2W3J A;  1GQP A;  2EID A;  1XNA A;  3ACF A;  3OGL B;  3GDB A;  3I2K A;  3U37 A;  2Y6L A;  2WZE A;  3MUY 1;  3CMG A;  2E33 A;  3I97 A;  4MGS A;  4D8M A;  1GOF A;  4P00 B;  1L7R A;  1H6X A;  1JYV A;  3LEG A;  5LCW L;  2J1R A;  3WNM A;  5LA1 A;  3HNY M;  1UYX A;  3WF3 A;  2Y6G A;  3ECQ A;  1OH4 A;  3VDA A;  3MV1 1;  3NJV A;  3OGK B;  2WDB A;  4ARY A;  3THD A;  1R64 A;  3I2G A;  4XUN A;  1UX7 A;  2WZ8 A;  2Y6J A;  4JX0 A;  4DEV A;  4OMD A;  1NKG A;  5DQ0 A;  4DXR A;  2P1P B;  3VD5 A;  3WF2 A;  3EB7 A;  2KD7 A;  2XHN A;  3NQH A;  2YFZ A;  2VO5 A;  5C71 A;  2WAB A;  1JZ2 A;  2WN2 A;  2VL4 A;  4MO3 M;  3T0D A;  3THC A;  4HG6 B;  3WF1 A;  4JKK A;  1UYY A;  4E8D A;  5LA0 A;  1DYO A;  2BZD A;  4ZZ5 A;  4ZZ8 A;  3A7Q A;  4GWJ A;  4PT6 A;  2QQK A;  2Z4F A;  3BGA A;  3UNP A;  2PQS A;  2W47 A;  4OZO A;  3WNL A;  3VDC A;  3III A;  1NUK A;  1CIY A;  4OYU A;  4RYD A;  1XC6 A;  1JZ3 A;  4W8J A;  1W8O A;  4P02 B;  4YPJ A;  4A41 A;  2W1S A;  4Z2A A;  4CUB A;  3W5N A;  1DP0 A;  5CYY A;  3ACG A;  3UES A;  2J1T A;  3L2O B;  2DCJ A;  2VMD A;  3DYM A;  2C4X A;  4ARX A;  2X05 A;  2QQM A;  1UXX X;  1JZ8 A;  2P1O B;  3OEB A;  3C6N B;  1TVG A;  5C70 A;  1F4A A;  3WQB A;  2WAA A;  1DLC A;  2V5D A;  4DUW A;  1JZ4 A;  1JU3 A;  2ZEZ A;  4M4R A;  5C7G A;  4I6J B;  2XON A;  3K46 A;  2P1M B;  2J7M A;  3OG2 A;  4LHS A;  1JHJ A;  1GNY A;  2VMC A;  3OEA A;  2RJ2 A;  4ZXE A;  2P1Q B;  3IAQ A;  3MO4 A;  5JXH A;  5JXJ A;  1W9W A;  3CIH A;  1W8N A;  3C6P B;  3GGL A;  3C7F A;  1JYX A;  3T2O A;  4OUE A;  2W9X A;  1JYN A;  1US3 A;  4BK4 A;  2WUH A;  3HEI A;  5G05 L;  2VTF A;  2L9L A;  3NRU A;  4LQR A;  1P8J A;  3C6O B;  2VOT A;  4XUT A;  4ET7 A;  3SKJ E;  2OVP B;  2V4V A;  4MGQ A;  4L0P A;  1NX9 A;  3F2Z A;  3J7H A;  1FS1 A;  3VD7 A;  2W46 A;  1P22 A;  1OD3 A;  2VZ1 A;  1L7Q A;  3ACI A;  4XUP A;  1K12 A;  4QB6 A;  4UI9 L;  1W0N A;  3OGM B;  2VZV A;  2JD9 A;  5JR2 A;  1UY1 A;  2W1Q A;  4PF1 A;  2VCB A;  2QQN A;  2VCA A;  4CUA A;  3PUI A;  1UY3 A;  4CVU A;  3GXU A;  5A1A A;  5IFT A;  2WYS A;  1CX1 A;  2E32 A;  3NNG A;  2YFU A;  4FI9 A;  4QX3 A;  4LPL A;  2VM9 A;  2DCK A;  1K42 A;  2CDP A;  5IHR A;  3VD4 A;  1HN1 A;  1D7P M;  3T2Q A;  4E8C A;  2OKX A;  5HXM A;  5JMO A;  1CZV A;  4QDS A;  4XUQ A;  1EUU A;  2B4K A;  3P1I A;  4A3Z A;  4KI5 M;  1J83 A;  2Y64 A;  1O8S A;  2Y6K A;  1JI6 A;  2VR4 A;  2P1N B;  3A23 A;  1PMH X;  1JZ6 A;  2RV9 A;  5B4N A;  2EIE A;  4QX0 A;  4QDQ A;  4A44 A;  2QBX A;  2VZQ A;  2ZXQ A;  1CZS A;  1KGY A;  2VZR A;  2W95 A;  1ULP A;  3WNK A;  5FUI A;  5CZK A;  1NAE A;  2EIB A;  4QAW A;  5JUV A;  3LQC A;  3CZJ A;  3ETP A;  4BXS V;  5LA2 A;  3C7O A;  3WF0 A;  2BBA A;  2ID4 A;  4BK5 A;  4DUV A;  2B9V A;  3I2F A;  4CU6 A;  3VD9 A;  3WSO A;  1OF3 A;  1GOH A;  4LKS A;  4BJ0 A;  2JDA A;  3K75 B;  4XUO A;  2WO2 A;  1WCQ A;  2R7E B;  1PMJ X;  3BN6 A;  4JKM A;  2YB7 A;  3A22 A;  4AG4 A;  4OMC A;  2BGO A;  5F7U A;  1US2 A;  1BHG A;  5I0D A;  1UZ0 A;  1JZ7 A;  4QPW A;  3LPF A;  1SDD B;  3MV0 1;  1F4H A;  1K3I A;  2C26 A;  4JHZ A;  4QB1 A;  4TXW A;  3T2P A;  3UET A;  4JKL A;  2LW8 A;  4W50 A;  3I2I A;  1CZT A;  1NEX B;  2W5F A;  4CU8 A;  2JE8 A;  2CDO A;  4M4P A;  4RN5 A;  3WNN A;  4DUX A;  3HJR A;  3T0A A;  2W1W A;  2BGP A;  3MUZ 1;  4IUG A;  1UWW A;  3K77 A;  3C7G A;  4QB2 A;  4W4Z A;  2J1U A;  2EIC A;  3LEK A;  1UXZ A;  2VME A;  3A21 A;  3HNM A;  3AC0 A;  3PUH A;  4GWI A;  2XQX A;  5JXI A;  3OBA A;  2VQU A;  3C7H A;  4XUR A;  2VJX A;  3OGR A;  2J1V A;  3CKH A;  3LE0 A;  2W1U A;  1GMM A;  4P5Y A;  5EIY B;  4PQQ A;  5J1X A;  4ZY9 A;  1XPW A;  3IB3 A;  1JYW A;  4DXT A;  3W5M A;  2WAO A;  5DN2 A;  1W99 A;  4MAD A;  2VZP A;  3DYO A;  3ABZ A;  2WN3 A;  2W91 A;  2XOM A;  3D3A A;  3I3E A;  2ZEY A;  1I5P A;  3OB8 A;  3DYP A;  1OF4 A;  1UY0 A;  4D0Q A;  2YG0 A;  2W94 A;  3CDZ B;  2DDU A;  4A6O A;  3FHA A;  2J1S A;  4A4A A;  4XVH A;  3C8X A;  5IBK B;  2QQL A;  4CUC A;  4MOA A;  3FL7 A;  2JKX A;  2VQT A;  1W9S A;  3E1F 1;  5B4X A;  1LNS A;  3JXS A;  3WF4 A;  2J22 A;  2ORZ A;  2YC2 A;  1UY4 A;  2QQO A;  4CU9 A;  3MKS B;  2RVA A;  1UYZ A;  2VC9 A;  1O8P A;  2BER A;  2HLE A;  3CZU A;  3VD3 A;  2V72 A;  3K4A A;  2VZS A;  3IDA A;  3WEZ A;  2C9K A;  4QX1 A;  1WKY A;  4KMQ A;  3I2J A;  1JU4 A;  2VZ3 A;  4UOJ A;  2WO3 A;  1GU3 A;  1TG7 A;  2W87 A;  3I2H A;  3ACH A;  1PX4 A;  1LDK E;  2J1A A;  3SEP A;  1PX3 A;  3P6B A; 
#chains in the Genus database with same CATH topology
 3RMA A;  1V6I A;  4LHN A;  5FY1 A;  4WV8 A;  4YFZ A;  5LBB A;  4A3X A;  3NNL A;  1O59 A;  2ZMN A;  4CRQ A;  2X8K A;  5JXG A;  4FQZ A;  2EXH A;  1ULO A;  2OQ6 A;  4WVZ A;  2VUL A;  2HYX A;  4GH4 A;  4IV1 C;  4DXS A;  4CDQ C;  1ZBE 2;  1YCI A;  2ARA A;  3GM8 A;  3UJO A;  1ZA4 A;  2PLV 1;  4KWU A;  3J8F 3;  2HWE 2;  3LEM A;  1JZ5 A;  5F5I A;  1VB4 A;  4DNY A;  4P08 A;  5A33 B;  3HN3 A;  1RUI 2;  3B00 A;  1Q8V A;  1W8H A;  3LPG A;  1WD3 A;  4QHZ A;  4QQ2 A;  4XIK A;  3UKV A;  4BE3 A;  3I3M A;  2ERF A;  4K3U A;  4BLJ A;  4A7K A;  2JEN A;  2W52 A;  4GZ9 A;  3E5X A;  1I6X A;  1N1S A;  2WQ8 A;  5JDB A;  5FO9 B;  3M3O A;  5GLT A;  5J3U A;  1LCL A;  2LS6 A;  4D6Q A;  3QEX A;  4GKX A;  1VRH 2;  4V2W A;  4X5N A;  5EJ1 B;  2QQJ A;  3U07 A;  4LO8 A;  2FDK A;  5I0U A;  3R4D B;  1PGL 2;  1V6O A;  4O65 A;  5GLW A;  4MGT A;  4LKE A;  4LUL A;  4YM0 A;  4QKD A;  3KLS A;  1V6K A;  3SUP A;  3OGV A;  1KRI A;  1UMH A;  4RD7 A;  4CCL A;  4BYY A;  5CG8 A;  2DFB A;  5LBE A;  1YFW A;  1VBA 3;  2FW3 A;  1EV1 1;  3NKG A;  1FMD 2;  1CES A;  1PNG A;  3ZXE A;  2VU9 A;  1M06 G;  2QFE A;  2RS3 2;  1ASJ 2;  3CQO A;  1SEF A;  5GZG A;  2LTN A;  1A34 A;  4HXC A;  1D4V B;  1LJ7 A;  2VZT A;  2YC4 A;  1UOF A;  3IIA A;  2P3I A;  5SV5 A;  3W59 A;  1EUT A;  3HD8 B;  1FV2 A;  3M3Q A;  4GWM A;  3HMY A;  3SC7 X;  2GME A;  3EO6 A;  4XMA A;  2H6C A;  1HV0 A;  5FZ9 A;  4N53 A;  4FJJ A;  4XF3 A;  4ZKT B;  1XYO A;  4M0H A;  1OLQ A;  3H7J A;  3N9Q A;  5EFU A;  1C3H A;  2WZR 3;  1LEN A;  2B42 B;  2X5I B;  3GHN A;  2RDS A;  3FFZ A;  2B46 X;  1H8V A;  1T2X A;  1W9Y A;  2DUQ A;  3MYX A;  4UAP A;  3RJ2 X;  5EJZ B;  2Y8K A;  3ZXF A;  1G9C A;  1DF0 A;  2ZGQ A;  3SQ4 A;  2E7T A;  2QQI A;  3USU A;  1LHU A;  5HCF A;  4BIO A;  4Q4X 3;  2AR6 A;  1Q3E A;  3TWI A;  2ZCW A;  1QGL A;  4JQT A;  1Q9X A;  4CP1 A;  2ETE A;  5KBF A;  3BB6 A;  2IXJ A;  2WA4 A;  2W3J A;  1OPM A;  4OLL A;  4M01 A;  4UYB A;  4XQD A;  1HQW A;  1RIT A;  1XE7 A;  3ACF A;  2CTV A;  4DU3 A;  4YSF A;  1XND A;  4GIQ A;  1RB8 G;  1AYN 2;  3SCH A;  3SH3 A;  3T4V A;  2FDF A;  5CB7 A;  1OQD A;  4FP3 A;  4DRR A;  3SUQ A;  1WW6 A;  3S6P A;  3DGT A;  5BPX A;  3MDP A;  3LEG A;  3POB A;  5BV6 A;  2DCY A;  3RMX A;  1SLL A;  3AYD A;  1ALY A;  1QWR A;  1UYX A;  1JUI A;  1LRH A;  1W0P A;  3GBG A;  1TME 2;  1H1I A;  5CIR A;  4PIZ A;  2JEC A;  4Y5Z 0;  1I1E A;  2KXL A;  3MPB A;  5FMB A;  3FUQ A;  4RHV 1;  3B5L B;  2R6Q A;  1MQT B;  3AKR A;  5A32 A;  3WDW A;  5FZB A;  1R09 1;  5IVB A;  2AC1 A;  3LSD A;  4YM1 A;  3HIF A;  4LBQ B;  5KHJ A;  3GZT B;  1ZBA 3;  3AYA A;  1HXS 3;  1W0O A;  2C0Z A;  1MVQ A;  3AL6 A;  3DKQ A;  3VZM A;  5FPA A;  3WF2 A;  3LGR A;  4PCR A;  4H7L A;  2P5B A;  3H3U A;  4Q0P A;  5H9S A;  2QQP A;  2V4A A;  3LD8 A;  3OSD A;  3SI6 A;  4WM7 B;  5C71 A;  3RZL A;  2RS5 2;  3E6D A;  5GKA C;  3SCF A;  2JB4 A;  4AQ6 A;  1XOY A;  4N7I A;  4TWT A;  3MIG A;  2VUJ A;  1QNW A;  3KS7 A;  4LR4 A;  4DB5 A;  3S5A A;  3J8F 1;  2JQT A;  2P34 A;  1BVV A;  4UT5 A;  3ROU A;  3ZIW A;  1K5J A;  1YXW A;  2JDU A;  5DG1 A;  3ILN A;  4E8D A;  2B5H A;  4PIY A;  2ENR A;  2A6Y A;  4IE6 A;  4ZZ5 A;  1GR3 A;  3FC0 A;  5IW0 A;  2ZHL A;  3OGJ A;  4PT6 A;  4TLF A;  2Z4F A;  3POW A;  4F83 A;  3IWZ A;  1A8D A;  2FCU A;  2RDQ A;  4OZO A;  2VG9 A;  4AZZ A;  2HKX A;  4CP2 A;  3IDE A;  2YMZ A;  5LAS A;  2DVD A;  3RYR A;  5C33 A;  2ARX A;  1U5Y A;  4MXV A;  1W6O A;  4W8J A;  1OI6 A;  4A41 A;  5CKQ A;  2GSY A;  1DP0 A;  2ZPX A;  4D3W A;  3LIH A;  3DEM A;  2A7A A;  3O0V A;  1QXJ A;  3L2O B;  3VN4 A;  2FCV A;  3DYM A;  2C4X A;  4J2D A;  4AFM A;  1WW7 A;  4EWA A;  5FO7 B;  2E63 A;  4GD4 A;  3NDK A;  1PZ7 A;  4BHP A;  4B1L A;  5CEH A;  3QBQ A;  2P1O B;  3OEB A;  1TVG A;  1VBA 1;  3VBO C;  2XH6 A;  4BB3 A;  2IZW A;  3R4U A;  1PMI A;  3KT1 A;  4AEJ A;  3E6B A;  3WCS A;  3ZOI A;  5FO8 B;  1JU3 A;  2ZEZ A;  2VOK A;  1VR3 A;  2HWF 2;  2XON A;  2WNU A;  3T2T A;  4HKO A;  3ZXJ A;  4LHS A;  3SPZ A;  3HT1 A;  2P1Q B;  3IAQ A;  5FZ6 A;  1C57 A;  2D6N A;  3CO2 A;  3HN1 A;  3OCP A;  2IUW A;  2TEP A;  4IXL A;  4P9W A;  4Q8L A;  4NMI A;  5CA6 A;  1IS3 A;  1VLN A;  3L1N A;  2OA2 A;  2EAL A;  1W8N A;  3GGL A;  3PJY A;  1JYX A;  1SAC A;  1FPO A;  2WZR 1;  2HWD 2;  3S9H A;  1QNY A;  4MHU A;  1JYN A;  1G9D A;  3OBT A;  4J2B A;  3VBH B;  2K0G A;  1KJR A;  2W2I A;  3AKQ A;  3WV6 A;  4BQ2 A;  4W6X A;  4DRV A;  4BIS A;  1GQH A;  2VNV A;  3PUS A;  3RZM A;  1QY4 A;  1XRU A;  4PQ9 A;  5F39 A;  1P8J A;  4Q4X 1;  3C6O B;  5I0S A;  4XAE A;  4G3Y C;  2D6M A;  2WIN B;  3POG A;  4RR3 B;  2OVP B;  1NYW A;  2V4V A;  4XZP A;  3VKM A;  4XCA A;  4MGQ A;  4JGY C;  5EYY A;  4Y20 A;  2GN3 A;  4I09 A;  3H1Y A;  3UGG A;  2P37 A;  3BI3 A;  3F2Z A;  5FZM A;  5KXC A;  4AVC A;  5L9B A;  2HYK A;  2VVE A;  2VUD A;  1P22 A;  2ZTN A;  5JZG B;  1OD3 A;  4KHY A;  2YPJ A;  1ENS A;  1DGW A;  3AP4 A;  1RIR A;  2B1E A;  2AUY A;  3ACI A;  1ZRR A;  1GYK A;  4XUP A;  1K12 A;  5A80 A;  3SCG A;  3VKN A;  2WNE A;  4UI9 L;  2HH9 A;  1GKB A;  5BNO C;  3Q9O A;  3OGM B;  2VZV A;  1SBD A;  2JD9 A;  3HGL A;  1GAN A;  4HN0 A;  3NV3 A;  5ISL A;  3NMB A;  4PF1 A;  2A1X A;  1KFU L;  3H9A A;  1EP0 A;  1RUF 2;  2VCB A;  4KGQ A;  3LOI A;  4MLO A;  3ZXA C;  1OLM E;  2VUC A;  2IXC A;  2XB6 C;  3AMP A;  2AEZ A;  4XF0 A;  5DDJ 2;  3FLT A;  5I8T A;  3GXU A;  5IFT A;  2HEV F;  4Z07 A;  1ZZC A;  4HET A;  1RVF 2;  2WYS A;  1CX1 A;  4UW3 A;  5K0U C;  2VD7 A;  3NST A;  2MEV 3;  1OHF A;  2E32 A;  2XL7 A;  3NNG A;  2YFU A;  4LE3 A;  4LPL A;  2GP3 A;  4BQ4 A;  2GND A;  4R52 A;  5IHR A;  1ZBA 1;  3N7K A;  4DY5 A;  1HXS 1;  4COW A;  1ZNP A;  1W2O A;  3VBU B;  1D7P M;  1O4T A;  2ZOE B;  3T2Q A;  1O3T A;  4HVO A;  1QH6 A;  1LOE A;  2BNO A;  4XAC A;  3WG2 A;  1PO2 2;  5JVV A;  3VBO A;  3NAE A;  4XUQ A;  2QCS B;  1EUU A;  3NAP B;  4IEW A;  2R1B A;  4RL5 A;  5FZ7 A;  4BQ5 A;  1W2T A;  4Z92 B;  5F6K A;  1WWY A;  2J42 A;  2Y64 A;  4CXX A;  4YW6 A;  1U5Z A;  4FTB A;  3RMC A;  1ND3 C;  1XNK A;  3SNM A;  1X50 A;  2DCT A;  4KG0 A;  5LWB A;  4AEM A;  1FZ1 E;  1R08 3;  2EIE A;  2VW0 A;  4QX0 A;  5FZI A;  3WOG A;  1RUC 3;  2SBA A;  3ZR5 A;  2O14 A;  2EAK A;  2VZQ A;  4LHL A;  3WG1 A;  2VTX J;  2W95 A;  4XFA A;  1ULP A;  1WCD J;  2JPN A;  3N7M A;  3WNK A;  3ZYB A;  1YC6 1;  4DU1 A;  1QJE A;  1TMF 3;  5CZK A;  5FWJ A;  1H30 A;  1YQ6 A;  2EIB A;  4LOT A;  5JUV A;  4Y24 A;  3ZSK A;  3LQC A;  1OFS A;  3CZJ A;  5DXD A;  3N9L A;  1J3R A;  5F32 A;  3VZJ A;  1QJY 2;  1EV1 2;  3G6J B;  1ULF A;  1W6P B;  1C5I A;  3C7O A;  1Q9Y A;  5BNN B;  4C0B A;  3J4U H;  4BK5 A;  3CLP A;  1JXN A;  3J7M A;  1ND2 C;  2DUR A;  1CAW B;  3H50 A;  1FZH E;  3I2F A;  4QXH A;  2ZHM A;  1OF3 A;  4OUM A;  1TQ5 A;  3BOP A;  3HR9 A;  3L9J T;  3KWV A;  2A6V A;  4QPI C;  3IMN A;  5LBF A;  4B4R A;  4AED B;  4DS0 A;  2JDA A;  3CHX A;  1GWK A;  1X82 A;  4AKI A;  1APN A;  4CCK A;  1VMH A;  1W90 A;  4COU A;  5BNO A;  4OHY A;  2YB7 A;  5IVJ A;  2OW4 A;  4IEO A;  4RS5 B;  3TAY A;  1XNC A;  5F2W A;  1IG3 A;  3ZFG C;  3UIQ A;  2MNG A;  5F7U A;  5IVF A;  3QER A;  3MEP A;  3ZFE B;  5IVV A;  1UKG A;  2E6V A;  1UZ0 A;  2RM2 2;  5AVP A;  3CFR A;  4FSJ A;  2YU1 A;  4QWN A;  1EAH 3;  4N90 A;  4EN0 A;  2C26 A;  4TXW A;  1GP4 A;  1RUJ 3;  1SPP B;  2QZ3 A;  5K0U A;  2CGP A;  3PUA A;  4IEY A;  1LOC A;  3I2I A;  1YI7 A;  3M3E A;  2YV8 A;  4W50 A;  1W2N A;  3LFI A;  3S7E A;  3AP7 A;  3AB0 A;  3PHM A;  4CU8 A;  2JE8 A;  2Z42 A;  1AJO A;  1K5M C;  4A7Y A;  2CU5 A;  2VBD A;  3ZYJ B;  1CIW A;  5FP4 A;  2BWC A;  1WW5 A;  5FYH A;  1LOA A;  2BGP A;  4XFF A;  2VVD A;  3OBZ A;  2RG4 A;  1RHI 3;  3K77 A;  4KHQ A;  1YUD A;  5F3E A;  1N1V A;  4XCB A;  1UXZ A;  4COV A;  1LEM A;  4CPB D;  2VXR A;  2VBB A;  2YZ4 A;  4AI0 A;  4URT A;  1LHV A;  3TEY A;  4UFL A;  5FMO S;  1BYH A;  1V6N A;  3D6E A;  5FP9 A;  3HNM A;  5C8C C;  3VBF C;  1HW5 A;  3MLK A;  2DCZ A;  1ND3 A;  2GC0 A;  4FOQ A;  4QKB A;  3WP4 A;  2ET7 A;  1WD4 A;  2BJS A;  4FFH A;  2Y0I A;  3Q8E A;  4ASM B;  4AI6 A;  2I07 B;  3WDY A;  2GU9 A;  4XUR A;  2QTW B;  1IHM A;  1WGP A;  2J1V A;  4OUS A;  2VJ4 A;  4E2Q A;  2ZX0 A;  2NMN A;  5C4W A;  4M3X A;  1AL2 3;  1WMF A;  4KWK A;  2IXK A;  5T5J A;  3V56 A;  4UWD A;  5F37 A;  2X53 S;  5K9Y A;  1RUN A;  2C5D A;  2K5S A;  2VZP A;  4GQ7 A;  5GAL A;  4K20 A;  4LE4 A;  5FY9 A;  2WN3 A;  3I49 A;  2W91 A;  3KV5 A;  4AFD A;  2XJS A;  1ND2 A;  1BK0 A;  4FPF A;  5A7P A;  1OF4 A;  3SHR A;  5CAZ A;  4HVQ A;  3I2D A;  3H8R A;  4XFC A;  4M41 A;  3ILF A;  4A6O A;  2Z69 A;  4QPI A;  1DGR N;  1VBD 3;  1HRI 3;  1QDO A;  2J1S A;  2O1Q A;  3IPV A;  4LA3 A;  2AEN A;  3VZN A;  2XJT A;  4IEZ A;  4GKY A;  4KH9 A;  5EZW A;  3O7O A;  4B29 A;  3AKT A;  3KV9 A;  4FOW A;  5D8A C;  2JKX A;  3NW4 A;  5F8P A;  5A7S A;  1W9S A;  3WX5 A;  2VEC A;  3E1F 1;  2D98 A;  1O91 A;  2FDH A;  1FXZ A;  3QES A;  2ZAB A;  4NHM A;  5H9P A;  3ZFG A;  3RWK X;  1XSR A;  2ORZ A;  4RR3 A;  1W6M A;  1RUC 1;  1H2M A;  1S0F A;  2HJI A;  1V00 A;  2YC2 A;  3VBR B;  2XKP A;  5K7P A;  1WZX A;  5HV0 A;  2B8M A;  3OPW A;  4AAP A;  3OUH A;  1TMF 1;  1NZI A;  4ISQ A;  3A4U A;  2P3J A;  1XQN A;  4AGR A;  4NHY A;  4CP0 A;  2HLE A;  4QQP A;  5FPU A;  4ISR A;  4FPL A;  1XVC E;  4R4Z A;  4AHX A;  5E1R A;  3WW3 A;  5LY2 A;  5C6C A;  4MG2 A;  5HCB A;  1J1T A;  1K5M A;  5FZD A;  2JG8 B;  3SH5 A;  2VZS A;  3IDA A;  1VAV A;  5FY4 A;  4QX1 A;  1ZRD A;  2RS1 3;  3WXP A;  1O4Z A;  2YHJ A;  3I59 B;  4KMQ A;  3POS A;  1FZ4 E;  4X5M A;  1ZRI A;  2X29 A;  1F9K A;  4Q2F A;  1B35 B;  5A7W B;  2Y0O A;  3JCI A;  1ODM A;  2W87 A;  2RMU 2;  5KHG A;  1V9U 3;  2EXI A;  4CSW A;  2ZBJ A;  2OT7 A;  4UFI A;  4RQP C;  1UMZ A;  1PX3 A;  4UFK A;  4IEU A;  5AC9 1;  5BNP C;  5C70 A;  2ZEW A;  1WUV A;  3E4W A;  4QQO A;  1X33 A;  4BDV B;  1W6Q A;  3AM2 A;  3OOX A;  4JCK A;  4ONU A;  4XQW A;  2V73 A;  2E51 A;  3VBF A;  3H1M A;  2B7M A;  4E9K A;  3NGI A;  1LES A;  4S2G A;  4TLG A;  3I3D A;  4RFR B;  1ONA A;  2OVU A;  3OYW A;  1PVX A;  1HV1 A;  3GZA A;  3VBU A;  5J36 A;  1UIJ A;  3WNO A;  1LHO A;  1YFY A;  1YFU A;  2EA7 A;  3HNB M;  1A8M A;  3QET A;  1TZO A;  1HRV 2;  1EAH 1;  2BRT A;  5A7O A;  5FYB A;  3UK9 A;  5HXV A;  1RUJ 1;  3ZPY A;  4Q27 A;  1SLT A;  4DTS A;  1UN1 A;  2F17 A;  2VMF A;  5L9R A;  1LGB A;  1OSG A;  1YFX A;  5H9R A;  3ZYF A;  2OVR B;  1Q8O A;  3KSC A;  3POF A;  4QPG C;  4IET A;  4CE8 A;  2R49 A;  5FYI A;  1KS4 A;  3AL5 A;  5A3N A;  4MXW B;  4FJM A;  2VZU A;  5JOW A;  1IS6 A;  1YJL A;  1MS8 A;  2ZA9 A;  5I0R A;  1N47 A;  1F5J A;  4KHN A;  2JIG A;  4HT1 T;  4MET A;  4LBL A;  1U12 A;  2OPW A;  4XTM A;  5FY5 A;  5CFD B;  1MZE A;  4QMA A;  1RHI 1;  4E4S A;  3ATG A;  1UY2 A;  1ENR A;  2UY9 A;  1KJL A;  3RMD A;  4ZON A;  1W04 A;  2Q30 A;  1F2N A;  2HD0 A;  3SPY A;  3RWN A;  3ZSE A;  1UOB A;  3AFK A;  4IW3 A;  4OUL A;  4XDQ A;  3KV4 A;  1DCS A;  4A42 A;  4R9D A;  1WLC A;  4CEY B;  5CKM A;  2D40 A;  4Y3O A;  4TTG A;  3FFQ A;  2Y33 A;  1J58 A;  2VW2 A;  5JIA A;  2P1B A;  3ZYI B;  3SEE A;  5GLV A;  3HWJ A;  2Y6H A;  3O12 A;  1FAT A;  2X09 A;  2BVB A;  2GAU A;  3K4D A;  2CGN A;  2PHL A;  4YGC A;  5C4W C;  1DQ6 A;  5IVC A;  1W2A X;  1POV 0;  4U2A A;  3TN9 3;  3ZKU A;  2OVQ B;  3AXD A;  5FZK A;  5HI0 A;  4CDX C;  1O3Q A;  1CGP A;  1AL2 1;  1ACC A;  3S30 A;  1ZZ6 A;  3AP9 A;  1OPO A;  2GC3 A;  1IQD C;  4XZU G;  2BTV C;  2XVK A;  3RFR A;  1FNZ A;  4LUM A;  3N9N A;  5JOZ A;  4NRO A;  4N43 C;  2LUW A;  4ZPI A;  4I02 A;  5FMD A;  1SG3 A;  4HAN A;  1OQE A;  3ZYR A;  3O1U A;  3QAC A;  1FX5 A;  1GFF 2;  1AF9 A;  4M00 A;  2G19 A;  5A6Y A;  2DEB A;  1AR9 2;  1KDM A;  1ULE A;  3K51 A;  4G9S B;  5J96 B;  4EPH A;  1ZZ8 A;  2XJQ A;  4LBQ D;  3JB4 C;  1RED A;  5HPO A;  4FPK A;  4HPK B;  4IEQ A;  5G04 L;  2ZGL A;  2JD4 A;  4FJ8 A;  1RYY A;  1X9T A;  2JDM A;  4LO6 B;  1VBD 1;  4PLM A;  4X6Q B;  4XF9 A;  2Z2S B;  3T0B A;  1LKN A;  3LFM A;  4RQP A;  2JEM A;  2R1D A;  4LIT A;  1BKZ A;  2EID A;  2R0F A;  3HT2 A;  3IZO A;  4OQ9 A;  4EYU A;  3OGL B;  5FOB B;  3I2K A;  5DAQ A;  1W2U A;  2Y6L A;  5FXZ A;  4UFH A;  4YVS B;  4Q4Y 3;  3CMG A;  2OYZ A;  2ZHN A;  3KVA A;  4OI1 A;  4AI9 A;  2QJV A;  3LDB A;  1L7R A;  1JYV A;  5LZ6 A;  1FZ0 E;  1QMJ A;  1C8M 1;  5LA1 A;  4Q4W 3;  3SLI A;  4FJ5 A;  1POQ A;  3HNY M;  4KU7 A;  5IK5 A;  3D8C A;  3WF3 A;  4CCM A;  5CVR A;  1FZ7 E;  2Y6G A;  3ECQ A;  3R0R A;  4AFC A;  5ACA 2;  5C3Q A;  3GAL A;  5IK4 A;  1RL3 A;  4AL9 A;  5FQ0 A;  5FR3 A;  4ZHN A;  3MV1 1;  1RUH 3;  1A6C A;  4ARY A;  4QPG A;  4XAA A;  4QQL A;  3VHP A;  3J7L A;  3LZJ A;  1NA1 B;  5L36 A;  1LGN A;  3GNE A;  2RS1 1;  3OD0 A;  3BU0 A;  1XVE E;  3I2G A;  3EBR A;  1GZ9 A;  1CR7 A;  2CHH A;  4KHW A;  4FK0 A;  1UX7 A;  2OII A;  2WZ8 A;  3MW3 A;  4JX0 A;  5F3C A;  3M70 A;  2CAU A;  2PQQ A;  4DEV A;  4OMD A;  3VZO A;  5DQ0 A;  1LHN A;  1UOJ A;  4DXR A;  1V9U 1;  2DY4 A;  4QXC A;  3JD7 3;  5ANQ A;  1BBT 3;  1D4M 2;  2Y34 A;  4DTU A;  3DXU A;  3WP6 A;  3K48 A;  1WW4 A;  3EB7 A;  2NLR A;  2XHK A;  2ZJC A;  2PHD A;  2KD7 A;  4J2A A;  3PME A;  4FO9 A;  4HMZ A;  4YVW B;  1SFP A;  4K21 A;  5A6Z A;  1MMO G;  3FX3 A;  3V0B A;  2PAE A;  4ASK A;  3F95 A;  2VL4 A;  4ITC A;  1LR5 A;  3THC A;  4FJ7 A;  1UYP A;  1G9F A;  3EXU A;  5LEJ A;  3Q8F A;  4QND A;  4DIQ A;  1UYY A;  2UUR A;  4UF0 B;  5LA0 A;  4CDX A;  2BZD A;  3CJI C;  3WG3 A;  2D6O X;  5FLH A;  5I8Y A;  3G7D A;  4GWJ A;  1Z78 A;  2DUP A;  2H0B A;  2G4I A;  2VIX A;  1ZZ9 A;  4Q4V 3;  4FAG A;  1C1L A;  3BGA A;  4N43 A;  5I0T A;  1VBC 3;  1G86 A;  1VBB 2;  2W47 A;  1TE1 B;  2BNM A;  5AFB A;  4YNI A;  1X8E A;  3III A;  1CIY A;  2WL1 A;  4RYD A;  5L73 A;  2EVX A;  5CAD A;  4OHW A;  4QGL A;  4Z2A A;  2Y38 A;  4YPJ A;  3B94 A;  3UO2 A;  2D3P A;  4B3N A;  3IBM A;  2Q8C A;  4EWE A;  4MV2 A;  3I3Q A;  3ACG A;  3MFC A;  1UU6 A;  5CYY A;  1SLC A;  3E5Q A;  3VBS B;  3VL9 A;  1OOP B;  3DPR B;  2DCJ A;  1O6U A;  2VMD A;  2G9Z A;  5T3N A;  4ARX A;  4BXF A;  4I9L A;  1PZ9 A;  5DZG A;  4D94 A;  3MIC A;  2DVG A;  5JI9 A;  1PZ8 A;  2EXK A;  2P6C A;  2ZX3 A;  5E16 A;  3C6N B;  1LUL A;  1FAY A;  4YZ5 A;  3AP5 A;  1FZ8 E;  1MHZ G;  1SFY A;  2V5D A;  1FZ9 E;  4L99 A;  1RGS A;  5DG2 A;  2MEV 2;  5T5O A;  5C5T A;  1W06 A;  4M4R A;  4I6J B;  1SLA A;  1JYI A;  2J7M A;  5L19 A;  3J9S A;  4KHU A;  4HSJ A;  3T30 A;  2Q1M A;  3TN9 1;  2D5H A;  4K8F A;  4AW7 A;  2JE9 A;  5A3T A;  1ENX A;  2ARC A;  1N1T A;  3MO4 A;  1VBE 3;  4XF1 A;  4H3W A;  5FKB A;  1S2E A;  4IE0 A;  4PLO A;  3WLU A;  4AXO A;  5CFC B;  5JXJ A;  1W9W A;  2XG3 A;  4LUK A;  2IVJ A;  4LTA A;  3O1T A;  2JB8 A;  4FAH A;  3RNS A;  3TAE A;  3B9I A;  1JYT A;  1HB3 A;  4CDW B;  4OUE A;  2W9X A;  2OZ6 A;  2ZGS A;  5KC5 A;  5L7O C;  4FT8 A;  3PUR A;  3KMH A;  1HLC A;  4CCN A;  2MHF A;  3HEI A;  5G05 L;  3LZI A;  4PJY A;  2R07 3;  2VTF A;  4XDP A;  3UKN A;  2JHA A;  2AYH A;  2L9L A;  3N7L A;  3K3O A;  5L9V A;  4LQR A;  5APA A;  2VGD A;  2HBU A;  2VOT A;  3BTY A;  1AX2 A;  3KCC A;  3KZ4 C;  4SBV A;  4ET7 A;  3SKJ E;  4HLT A;  5DUV A;  1R08 2;  2WYF A;  2ZKL A;  4XPV A;  5SV8 A;  4E4Z A;  4N8M A;  1RUC 2;  3NNM A;  4K7J A;  3I8T A;  4L0P A;  4AVT A;  1NX9 A;  4Z2W A;  5DAP A;  3C94 A;  1RUD 3;  3ME2 A;  2N7G A;  2YYO A;  3J7H A;  3U10 A;  4XBQ A;  1REF A;  4IES A;  2W46 A;  2DU1 A;  1BCX A;  2XR4 A;  5DAB A;  2VZ1 A;  4Q4Y 1;  1MS9 A;  2ADE A;  3KHB A;  3HBZ A;  4RFT 0;  5FY0 A;  3ZN6 B;  3V0A B;  1R1A 3;  4J1W A;  1NCQ C;  4O9E A;  4XJ9 A;  4NN0 A;  1CD3 G;  4IGO A;  4NRM A;  1PO1 3;  4CP9 B;  3VDD B;  1O7F A;  4Q4W 1;  1JHN A;  1FPN 2;  3CJI A;  3TYJ A;  5CFD A;  1BJQ A;  1WMD A;  5FK7 A;  1DDL A;  2W1Q A;  4MGK E;  4RGA A;  1L3J A;  4UBH A;  4JC1 A;  1LOF C;  4HCB A;  1WA6 X;  3SNN A;  4UFJ A;  1FZ3 E;  1PIV 3;  2VCA A;  4GJZ A;  2WNU C;  3PUI A;  4CUA A;  2ZHK A;  1RUH 1;  1UY3 A;  4FTS A;  1WME A;  2OUH A;  3PVN A;  1W6N B;  4B08 A;  2TNF A;  4OZX A;  1RMU 2;  2WT0 A;  4MX3 A;  3RRD A;  3JUU A;  5FXV A;  4PDW B;  3O14 A;  3WT3 A;  1I3H A;  1HQN A;  1VRB A;  3KHC A;  2JG9 C;  4Q29 A;  4HL0 A;  3TJY A;  3FHI B;  3N9O A;  3ZFF C;  1VPH A;  3CL1 A;  2JH8 A;  4FI9 A;  4QX3 A;  2FDI A;  2VM9 A;  4BZ4 A;  4QU2 A;  2K46 A;  4GAZ A;  5DZF A;  2QKD A;  1XMF E;  3JD7 1;  1BBT 1;  5H9Q A;  3VD4 A;  1N1C A;  4FPE A;  1CAU A;  4NAO A;  1BK1 A;  2A3Y A;  5FYZ A;  2ZGK A;  3AK0 A;  4L97 A;  3CBN A;  4FQ4 A;  2OKX A;  5HXM A;  4NWV A;  1CZV A;  4BWO A;  3JZV A;  2YUE A;  4KWJ A;  1IZ3 A;  2B4K A;  3VHO A;  3LA2 A;  4LKD A;  3BPS A;  2MZW B;  5HCA A;  4KI5 M;  4JDO A;  4EN6 B;  3FZ3 A;  2R04 2;  3FE5 A;  3LA7 A;  4M3C A;  4DY3 A;  1O8S A;  2WQZ C;  4NHK A;  1IKP A;  2P3Y A;  3DUI A;  4L8Q A;  5A3O A;  3QH6 A;  5HV4 A;  3LKJ A;  3ZYP A;  3CQ8 A;  3SCX A;  1PMH X;  4I30 A;  2RV9 A;  5B4N A;  1JZ6 A;  1PK6 B;  3AP6 A;  5JOX A;  4Q4V 1;  4FBF A;  5T52 A;  3HP9 A;  3MI8 A;  1QJX 3;  4OCT A;  1AYM 3;  1VBC 1;  2JDK A;  2YGM A;  5FZO A;  1JYC A;  5L7O A;  3WG4 A;  3MFA A;  4M3W A;  2DYC A;  4A7Z A;  4BQ1 A;  4IDZ A;  5FUI A;  1JW6 A;  2R06 2;  3B93 A;  1QHD A;  2HEY F;  4FJI A;  3AXE A;  2OQ7 A;  3ASI A;  4RSU A;  5BXX A;  4JZR A;  3ETP A;  5ANN A;  4CPB A;  1UPS A;  4BXS V;  4JRA A;  1QXR A;  1V0A A;  2D43 A;  3KVB A;  4WM8 B;  2BBA A;  5C3O A;  5LRR A;  4Y22 B;  2ID4 A;  4CDU B;  4YW3 A;  3RJR A;  2VOV A;  4DUV A;  5LA9 A;  5JI7 A;  1LEC A;  2XBO 3;  2B9V A;  1WA4 A;  3UL2 A;  5FYS A;  5FMC A;  2YBK A;  1AR7 3;  4CU6 A;  3WSO A;  3DV8 A;  5IUQ A;  3KD5 E;  1GOH A;  1PM7 A;  4ADN A;  4OFG A;  1RUE 2;  1Q5O A;  1VAL A;  1QQP 2;  1WBL A;  1W8F A;  2A71 A;  1WCK A;  1KDK A;  4R9C A;  5BYN A;  2FQP A;  1NCQ A;  2PHU A;  1H9W A;  4AVS A;  4GAM C;  2R7E B;  3PNA A;  3SQ0 A;  4Y1U A;  3GBW A;  2FDG A;  5BUV A;  1Z7S 2;  3W58 A;  1VBE 1;  2DF7 A;  1MHY G;  4FPJ A;  3UJQ A;  3PDQ A;  1UW8 A;  2BGO A;  1LOF A;  1GSL A;  2X5I C;  1LHW A;  4JGZ B;  4JHT A;  4YGD A;  1KFX L;  1DIW A;  3OD4 A;  4P9J A;  2I45 A;  4JVA A;  4Y1Z A;  1NY7 1;  1HRI 2;  3O1S A;  3MV0 1;  4AQS A;  4QB1 A;  4FXK B;  2O0O A;  2R07 1;  3D5O A;  1AR8 2;  2CL2 A;  5I8S A;  4FJG A;  2JG9 A;  1Y3T A;  3AMH A;  3ZFF A;  5C9A B;  2BNN A;  2RDR A;  4MZU A;  4EWD A;  2G9F A;  3HGK E;  2LRP A;  1AR6 2;  2PHW A;  2WFF 2;  2VW1 A;  4PBP A;  3H0O A;  3IM0 A;  3WNN A;  1CN1 A;  2BVV A;  4AVB A;  1IPJ A;  3HJR A;  4FPH A;  2AZ5 A;  1PGW 1;  2W39 A;  2UY8 A;  2HWB 3;  1I5Z A;  1RUD 1;  2W1W A;  2Y6F A;  3JBG 3;  5FLJ A;  4IUG A;  1UWW A;  2G1M A;  1XYP A;  1POV 3;  2BV4 A;  1PVC 3;  1HN0 A;  4BPZ A;  1Y9Q A;  2KA3 A;  2VQ0 A;  4W4Z A;  2C24 A;  2ZKN A;  4MVT A;  2GNT A;  2I74 A;  3A0N A;  3GCX A;  3WW2 A;  5A33 A;  2VME A;  4NVP A;  2IXH A;  1R1A 1;  4COZ A;  1CLQ A;  4R9B A;  3SQ1 A;  5D2A A;  1PO1 1;  2P2K A;  3MLJ A;  5FYV A;  1F15 A;  2IFW A;  1L7L A;  2EF6 A;  1W28 A;  3V64 A;  3KB5 A;  4PLN A;  3OBA A;  3A0K A;  4M3Y A;  1XYN A;  4L92 A;  3EHK A;  4Y4R A;  5FYY A;  3DPR A;  4EV0 A;  1PIV 1;  2VJX A;  1MQT C;  2QE3 A;  3OGR A;  3CKH A;  3W20 A;  3LE0 A;  2W1U A;  5J1X A;  3VKF C;  4MYE A;  2XUM A;  1QJF A;  3D0S A;  4CXY A;  4ATE A;  5FZ0 A;  2W68 A;  1QF3 A;  4UW5 A;  1JYW A;  4IEP A;  5FV3 A;  4NR1 A;  1COV 2;  3NV4 A;  1ZBE 3;  4GB3 3;  3POY A;  1YQ5 A;  1QIQ A;  3NJY A;  1UX6 A;  2P5G A;  5GLU A;  3DYO A;  4M3R A;  3L2Y A;  2HWE 3;  4QHO A;  2Q0A A;  1S4C A;  4LIU A;  4MGI E;  2VNO A;  4WM7 C;  5CKN A;  2OZJ A;  3OUI A;  4XDO A;  3ALQ A;  4NO4 A;  5FAX A;  2R16 A;  1I5P A;  3D4K A;  3WVJ A;  3OB8 A;  4HVR A;  5LAT A;  4LT5 A;  3J2P A;  2IVI B;  3CDZ B;  2BUK A;  4QGN A;  5BNQ A;  4EE2 A;  5FZE A;  2DDU A;  2QDR A;  2ZGO A;  1FI2 A;  3FHA A;  3UV9 A;  3NKT A;  4CDW A;  2QDN A;  3C3V A;  4XVH A;  3ZN4 A;  4CTE A;  5IBK B;  2K2S A;  2PLV 2;  2DTY A;  4C0H A;  4XHB A;  2GP5 A;  3LB9 A;  4CUC A;  5IAX A;  1E5H A;  2WRA A;  1XE8 A;  4H2A A;  3FL7 A;  1EPW A;  2VQT A;  4WZC A;  1J59 A;  5KXE A;  1MZ6 A;  1IQA A;  4LOS A;  4JS4 A;  2X5I A;  3JXS A;  4YZ2 A;  1RJ7 A;  1QOO A;  1FV3 A;  2J22 A;  3LZZ A;  1QJX 1;  3ES1 A;  1AYM 1;  2RR1 3;  3NNF A;  1HJF A;  1TEI A;  4C1W A;  3AZZ A;  4RL7 A;  2EAA A;  4AQ2 A;  3S7I A;  2JDH A;  1E5I A;  3O0W A;  3GZU C;  1X9P A;  2DVB A;  5E8A A;  5FZG A;  1UYZ A;  2VC9 A;  1O8P A;  2BER A;  1I9R A;  2DBN A;  2RS3 3;  2Z5W A;  1ASJ 3;  3VD3 A;  1MS4 A;  3ZN5 A;  5JWP A;  3E97 A;  3QEW A;  3LIG A;  5FRE A;  2GDF A;  4HSL A;  3WEZ A;  2GC2 A;  3INA A;  3WHU A;  4LKF A;  1GNH A;  4LBK A;  2Q1F A;  2XBO 1;  4CEW B;  2VCM A;  4NE9 A;  3TN9 2;  3WHT A;  4C1X A;  3GHM A;  4FJH A;  1AR7 1;  1U0A A;  1N3P A;  1TG7 A;  4IV3 B;  3SUO A;  1VB2 A;  3ACH A;  1S0E A;  2CWS A;  4EQV A;  1CPN A;  3ELN A;  3MIE A;  3P6B A;  4Y5T A;  4JS5 A;  3HPN A;  4XYX A;  4PDW A;  1W39 A;  4HK8 A;  5FJK A;  4BQX A;  3ZLI A;  2JIC A;  1IPK A;  4M3U A;  3PUQ A;  4XOG A;  1GBG A;  1S0C A;  4QGM A;  4I0W B;  2D6P A;  2VNR A;  3O0X A;  5A6Q A;  1AHS A;  2YY1 A;  2NYY A;  3KD1 E;  4HON A;  3VBH C;  5AC9 3;  1JOB A;  5DAV A;  1SHW B;  1CAV B;  1MQT A;  3FHQ A;  1OUX A;  3Q8C A;  3VKO A;  1DQ1 A;  4B4P A;  2VE1 A;  4Q0V A;  2G9G A;  3ST7 A;  3VDB A;  1AYN 3;  5A7N A;  4E27 A;  1QJU 1;  1G6N A;  4LBQ A;  1MPX A;  2UWC A;  2W92 A;  2WJS A;  1CAX B;  4RR3 C;  1DYP A;  5CNA A;  4QM9 A;  3CFP A;  5FP8 A;  2E7A A;  4CU7 A;  4QDR A;  5ABJ B;  3JB8 A;  2J1E A;  1K45 A;  5FPX A;  3NO8 A;  4FFI A;  4TN7 A;  4E2G A;  3DL3 A;  3J7N A;  3UKT A;  4WM7 A;  4B7K A;  5JZG C;  1E57 A;  2IC1 A;  3CF6 E;  2HWB 1;  2WA3 A;  4QX5 A;  3JBG 1;  4Q5O A;  2VUA A;  4K40 A;  3NV2 A;  1POV 1;  4LBM A;  1PVC 1;  2ZX2 A;  3SQO A;  1IS4 A;  1OLM A;  3E5U A;  3OF1 A;  3PMS A;  3SJJ A;  3AMN A;  4D7S A;  2FZ2 A;  3K4Z A;  5EHD A;  1GWM A;  2WBK A;  4ZU5 A;  2BFU S;  2BYV E;  3AMQ A;  3M1H A;  4IE7 A;  4XBN A;  3TB0 A;  3CJX A;  1RUH 2;  3H3L A;  5IFP A;  4Y5S A;  4LO4 B;  4XET A;  4QNC A;  3GZE A;  5IK8 A;  2FMY A;  1F8V A;  2SLI A;  4W6W A;  3RSJ A;  3H8U A;  1HB2 A;  1VJ2 A;  3SKV A;  2JDP A;  4AFB A;  5IVE A;  3IKW A;  3U4X A;  4WM8 A;  2YBP A;  3U75 A;  3ENR A;  4NPL A;  4I3G A;  1NLQ A;  4OI2 A;  5FZH A;  4BME A;  2VZO A;  4RHV 2;  1UNB A;  3ZM8 A;  4LNV A;  4EN8 B;  2WLQ A;  4I3P A;  2RS5 3;  2ILM A;  2VCC A;  2CGO A;  4XJU A;  1JMU B;  4XF4 A;  4GB3 1;  1ZBE 1;  3B01 A;  1R09 2;  3VBU C;  1UMI A;  4DPN A;  3WY6 A;  5FRA A;  3T08 A;  2QXF A;  2A6X A;  2HWE 1;  1UZY A;  4AKG A;  4Y26 A;  2PMW B;  4NID A;  2WNV B;  1LTE A;  4GUL A;  1UU4 A;  2ORX A;  4I0B A;  4X8N A;  2DFC A;  3T1M A;  2BP6 A;  3T09 A;  5C5U A;  3W21 A;  3SUN A;  3QD6 A;  1VMJ A;  1C1F A;  4UBG A;  1BQP A;  3C7E A;  3MBW A;  4FJX A;  3NAP C;  4XXA A;  5EQU A;  4A45 A;  1FYU A;  4PI0 A;  4NIA A;  5KXD A;  4YW5 A;  5DUW A;  4S2F A;  2GNB A;  1DHK B;  2P6H A;  3BIE A;  4JTN A;  3J8F 2;  5T55 A;  1VBC 2;  1SMV A;  1VRH 1;  1XNA A;  4KBB A;  4YWA A;  5LBC A;  5LK7 B;  3VL8 A;  1A3K A;  3MZH A;  3U37 A;  4D6R A;  3OPT A;  3JQW A;  1PGL 1;  1S0J A;  2E33 A;  3AJZ A;  3I97 A;  1OQ1 A;  2V09 A;  1XU2 A;  4GA9 A;  4MGS A;  3VBH A;  5IK7 A;  3RGB A;  4P00 B;  3RPQ A;  1OXC A;  1G9A A;  2RR1 1;  1H6X A;  4ZU4 A;  5FWE A;  3WNM A;  2YB5 A;  2PFV A;  1RUG 3;  4P9G A;  1UF2 C;  1VMF A;  3RMB A;  1NCR B;  1SBE A;  2B39 A;  2RS3 1;  1ASJ 1;  3O5S A;  4DZG A;  5FZA A;  5BNN C;  2MMB A;  2YC0 A;  2HWF 3;  2UU8 A;  2ZGT A;  3NJV A;  3OGK B;  5A7Q A;  2VXJ A;  1C8M 3;  1W8T A;  2A6W A;  2H6B A;  3IN9 A;  1YRZ A;  4GH4 B;  5IWF A;  4CCD A;  1S55 A;  3THD A;  5FIX A;  5GM0 A;  4O7X A;  1R64 A;  3ZDS A;  5JZG A;  3NHG A;  4YM3 A;  1W8W A;  4S2D A;  2W0X A;  4AED C;  5FUN A;  5T54 A;  2H0V A;  4BIF A;  1M4W A;  2Y6J A;  1VBA 2;  5F9T A;  2YBS A;  4H55 A;  2P1P B;  2OZM A;  2C6S A;  3VD5 A;  4RS5 C;  1MS1 A;  2CY6 A;  4ICG C;  2XHN A;  3TEW A;  1REE A;  4BQW A;  3ZFE C;  1UQX A;  1O4Y A;  4HFS A;  1JZ2 A;  4DTP A;  1Q56 A;  3I4I A;  3ACL A;  4R4X A;  4MO3 M;  4FK4 A;  1UCX A;  4BLI A;  2WT2 A;  4HG6 B;  3VHN A;  2WZR 2;  1H8T B;  4KQ7 A;  5EP9 A;  1JUH A;  5K4L A;  2FYO A;  1VP6 A;  4BOW A;  3URF A;  1AYN 1;  4Y4Y A;  5T5P A;  5LRS A;  5FMO L;  1Y7B A;  1NQJ A;  1G8W A;  1CVN A;  1RUD 2;  1XB9 A;  2RJL A;  4Q4X 2;  2RJK A;  3D0J A;  3UNP A;  4DTJ A;  5IRE A;  1N3O A;  3AYC A;  3FMG A;  2QZ2 A;  3WNL A;  5KR7 A;  3UGF A;  4OYU A;  3N4M A;  1AXY A;  1XC6 A;  2VY0 A;  4NOT A;  3OPZ A;  1WMX A;  2JH9 A;  3NAP A;  3W5N A;  1NXM A;  5C3S A;  2E7Q A;  1MEC 3;  5A1L A;  1RUF 3;  4LK6 A;  4DTX A;  3TAB A;  4Y1V A;  3ZSJ A;  2J1T A;  5DDJ 3;  3LDS A;  5F2S A;  4N53 B;  1PGS A;  4HZF A;  4NAM A;  4XIL A;  5M0T A;  1RVF 3;  4OVE A;  5FP3 A;  2X05 A;  1AXZ A;  2QQM A;  5FJH A;  1UXX X;  4GAL A;  3O1V A;  1XL3 C;  3TOJ A;  1F4A A;  3WQB A;  5I91 A;  3ZXK A;  3OY8 B;  4IGP A;  2HWC 3;  3OGG A;  4DMI A;  3USU B;  3N7J A;  1XVD E;  1S2K A;  4A6S A;  3K46 A;  2P1M B;  4K1Z A;  5C7G A;  3I2O A;  3E4Y A;  1UU5 A;  4QHB A;  3ORJ A;  3LDK A;  1JHJ A;  2W08 A;  3O1R A;  1VE0 A;  5JCT A;  3I7D A;  3SVI A;  4LO5 B;  2RS5 1;  5JXH A;  1UZZ A;  1HJG A;  4IV3 A;  5FPV A;  3ETQ A;  1W6P A;  1XMH E;  1FOD 3;  5BNN A;  4URA A;  2ZZQ A;  1Y9G A;  3C7F A;  3ZXD A;  3ZYH A;  5FPZ A;  4ES9 A;  3POI A;  4IV1 B;  1CAW A;  1ZBA 2;  2NN8 A;  1HXS 2;  1OBN A;  2Q1Z B;  4QPY A;  2D6K A;  2WUH A;  4CDQ B;  1MR5 A;  2BBV A;  2O8O A;  2WO7 A;  3QH7 A;  2QQW A;  3AZX A;  3IT8 A;  4MH0 E;  2LM3 A;  4YGE A;  4ZXK A;  3KF3 A;  3NE6 A;  4AED A;  5DUX A;  5J7M A;  1C8N A;  3NRU A;  5CBL A;  4QXK A;  4QX7 A;  4FCA A;  1GQG A;  5C3P A;  2D44 A;  5D1I A;  1BLZ A;  3PIJ A;  3U4S A;  2ZGR A;  1BZW A;  1YI9 A;  2LRO A;  4LBO A;  4XUT A;  5F5C A;  3AVS A;  3LWC A;  2P5O A;  4LLF A;  4RA0 A;  5KHI A;  4O61 A;  3MF6 A;  3Q8B A;  4RS5 A;  4AVV A;  4RG8 A;  1ZVF A;  2JIJ A;  3O1M A;  5IT6 A;  3C95 A;  4CYD A;  3VD7 A;  1CX4 A;  3VBR C;  4GMP 0;  1QJY 3;  1NG0 A;  5EPA A;  4AHZ A;  4P9I A;  4K9S A;  1L7Q A;  4DOU A;  2XPJ A;  4Y1X A;  1CON A;  2JX9 A;  5A32 B;  1SPP A;  4P14 A;  4ES8 A;  1WLW A;  2K9Z A;  4LO7 A;  2AAC A;  4JRP A;  2FZ1 A;  4QB6 A;  1KXG A;  1W0N A;  2VH9 A;  4XAB A;  4LOR A;  1OVS A;  2IWG B;  3B02 A;  1RUG 1;  4IT5 A;  1SLB A;  5JR2 A;  1PNF A;  3KCX A;  4YLZ A;  4DUW A;  1OA2 A;  1WLT A;  2XBO 2;  1UZW A;  2JG8 C;  3MW2 A;  3N3H A;  4YW2 A;  2JDY A;  1D0G A;  2HWF 1;  1AR7 2;  1D0H A;  1RTV A;  1ZM1 A;  1CWP A;  4SLI A;  3MHZ A;  1XVF E;  2QVS B;  3WQ1 A;  4E4D X;  3U14 A;  3RZZ A;  5A1A A;  1LGC A;  3H8O A;  3HAG A;  1B35 C;  1XU3 E;  3QLQ A;  4QD2 A;  4AI2 A;  4XHX A;  1Q43 A;  5FYM A;  1HIX A;  5E6H A;  3B7M A;  4LA2 A;  5JSO A;  5FY7 A;  1GIC A;  2A3W A;  1NLR A;  2Q8E A;  4FOY A;  1B09 A;  1VAK A;  3PVO A;  2RM2 3;  3CNA A;  4MUV A;  1IKQ A;  1CJD A;  1RXF A;  1HN1 A;  1OA4 A;  1YO8 A;  1YWK A;  5IVY A;  1BEV 3;  4AI1 A;  4F8A A;  4AOC A;  4CA9 A;  3RMY A;  1OKQ A;  4AGG A;  4E8C A;  4OQ8 A;  4L2N A;  1LAJ A;  1W3V A;  3N9M A;  2ADD A;  3RWU A;  4JAA A;  5JMO A;  4DIN B;  4HN1 A;  2GC1 A;  3NWK A;  1Q8Q A;  5IZ7 A;  4JTO A;  4A3Z A;  3P1I A;  4P9L A;  3RG0 A;  3V65 A;  4AVA A;  3BUC A;  4F3J A;  2MPF A;  1J83 A;  2Y6K A;  1JI6 A;  2VPV A;  2P1N B;  3THP A;  5T50 A;  3MPP G;  2D6L X;  1R1Z A;  4QDQ A;  4A44 A;  4DTM A;  2ES3 A;  1WLD A;  3S5Q A;  4FTE A;  2ZXQ A;  3B3Q E;  5CFD C;  5CIS A;  3OJB A;  4RNG A;  5T5L A;  3WUD A;  3O1P A;  4Q8K A;  3ZIX A;  4B4Q A;  4QAW A;  1AXK A;  3RZG A;  2EXJ A;  5JIU A;  1MEC 1;  1RUF 1;  3M3C A;  4K1Y A;  1OA3 A;  3KT4 A;  1W8U A;  4I01 A;  4DU4 A;  4XC9 A;  5DDJ 1;  3WF0 A;  4CEY C;  1T6G C;  1KD7 A;  2GMM A;  1RVF 1;  4IE5 A;  4YG3 A;  4WBB A;  3BPZ A;  4X8P A;  4IND A;  2GAL A;  4XXP A;  3BVO A;  3VBR A;  1YLL A;  1WCU A;  4XIO A;  3TNP B;  1Y4W A;  2GN7 A;  4D6S A;  3ZVX A;  4KHS A;  2VMG A;  3R6S A;  3VHR A;  1V70 A;  2HWC 1;  1JS9 A;  1MZ5 A;  2B9U A;  3EMR A;  4GB3 2;  4JV4 A;  4NRP A;  2OYQ A;  4KI4 A;  1ULG A;  3PL0 A;  1WCQ A;  1H2N A;  3L8B A;  1MTY G;  2DV9 A;  1PMJ X;  2XML A;  2ZX1 A;  3QNN A;  4YG6 A;  3A22 A;  3U78 A;  1PO2 1;  5FYC A;  4AG4 A;  4Y20 B;  2PN5 A;  2XQR A;  2P17 A;  3M2M A;  4N9H A;  2ZZJ A;  1FOD 1;  5FBZ A;  1DQ0 A;  4AI8 A;  2JG8 A;  3WNX A;  1SBF A;  1US2 A;  4YZ1 A;  5FYT A;  4DTO A;  3I59 A;  4XFH A;  2NPI A;  2OZS A;  2DWR A;  5LY1 A;  4QPW A;  1GZC A;  3LPF A;  1SDD B;  1UL9 A;  1B35 A;  1F4H A;  5A7W A;  4JHZ A;  4JKL A;  4M3C E;  2LW8 A;  2Q5T A;  3THT A;  1XBF A;  4FPY A;  2WC2 A;  4R9A A;  1CZT A;  3CFO A;  4AYU A;  4EJR A;  3S57 A;  1NEX B;  4UXA A;  4LBN A;  3WZ1 A;  2ZMK A;  3UT0 A;  4M4P A;  1H8T A;  2FCT A;  4CCE A;  5A3W A;  2PHX A;  2UWA A;  3ES4 A;  2C9A A;  4YVS C;  2RR1 2;  3N35 A;  3TEZ A;  1FNY A;  4OHV A;  3BKZ A;  4AFA A;  3MUZ 1;  3AX4 A;  1CJP A;  3L0M A;  1DGL A;  1URX A;  3C7G A;  5LB6 A;  4B8E A;  2PAM A;  1QJY 1;  3O1O A;  4DXZ A;  3LEK A;  2WNO A;  4JRL A;  1YJK A;  1ENQ A;  2D5F A;  1JOP A;  1GLH A;  1LED A;  5JPM B;  4AE2 A;  4KI6 A;  3A21 A;  1V6J A;  2VNG A;  4FP2 A;  3ZYG A;  3PUH A;  1NOV A;  3BTX A;  1O5L A;  1TMF 2;  2DVF A;  3M3I A;  4A2U A;  2GZW A;  2YRO A;  4K8R B;  1IH7 A;  3WCR A;  2RMU 3;  1C4R A;  4MXW A;  1NA1 C;  5FZC A;  3N1E A;  1JOJ A;  3T3Y A;  2IXI A;  1WCS A;  1H2L A;  3VBO B;  2WFP A;  4P5Y A;  4PQQ A;  4NIG A;  4YAR A;  1C28 A;  1XPW A;  2IFR A;  2JHP A;  4Q0U A;  1QOS A;  2OUJ A;  3MF9 A;  5AVA A;  3W5M A;  1XNB A;  2WAO A;  5DN2 A;  5DZE A;  4FOV A;  1W99 A;  3AKP A;  4MAD A;  3OY8 A;  1GP6 A;  4UW4 A;  4TYS A;  3UGH A;  4KG8 A;  3WUC A;  2B7Y A;  4YVW C;  4XMI A;  2PHR A;  2RM2 1;  2CV6 A;  2VBP A;  3ABZ A;  4CEY A;  4FJL A;  2VOW A;  1HRV 3;  5AC9 2;  5F3I A;  3FLR A;  1BEV 1;  3I3E A;  3ZR6 A;  5KHK A;  1ULD A;  5FZ8 A;  3DYP A;  4ERO A;  2BGC A;  4Y33 A;  1A78 A;  4IGQ A;  4YW7 A;  1UY0 A;  4NII A;  4D0Q A;  1DYK A;  1ZX5 A;  1G7Y A;  4LBJ A;  3TAF A;  2IXL A;  4IV1 A;  5DAX A;  2VJ5 A;  4M3Z A;  3ZXG A;  3C8X A;  4CDQ A;  1DLL A;  4XJ8 A;  4QT6 A;  1AUY A;  3HQX A;  4MOA A;  3AFG A;  1EAH 2;  4QQH A;  1JZ4 A;  5KHH A;  2AEY A;  1RUJ 2;  4JGY B;  2GH8 A;  5B4X A;  2PAK A;  4RGK A;  2Z79 A;  1BVP 1;  4PIX A;  5F6L B;  1FXX A;  3WDU A;  4YM2 A;  4AF9 A;  2ZS6 B;  2ZAC A;  1IG9 A;  4CCO A;  5JSR A;  2ATQ A;  1EY2 A;  1UY4 A;  2AGS A;  3EQE A;  1SZB A;  5H37 A;  4CU9 A;  3MKS B;  3FBY A;  5FZ3 A;  1XXN A;  4HBN A;  4HPK A;  1TNF A;  4ADO A;  3LAG A;  1HKD A;  2RVA A;  4QKN A;  3VBS C;  1OOP C;  1DBN A;  3DPR C;  3KGL A;  3LDR A;  3P5B A;  4FFG A;  1E5S A;  1RHI 2;  1XSQ A;  1YHF A;  5BNO B;  1W8Z A;  2WSV A;  3HQU A;  3BCW A;  2FMD A;  1GZW B;  1NZC A;  1OLR A;  1MS3 A;  3AZW A;  4J6G A;  1IPS A;  3K4A A;  4QX8 A;  4XFB A;  5GLZ A;  2C1F A;  3H3Z A;  4YVS A;  2V5Y A;  4NWW A;  1H2K A;  3DXT A;  2JE7 A;  3I2J A;  1JU4 A;  1YIF A;  3T1L A;  2VZ3 A;  3QEV A;  1GU3 A;  4WVV A;  4FPG A;  4UW6 A;  4NIH A;  4FVV A;  5K0U B;  3WDT A;  1LDK E;  3GYD A;  3KD4 A;  4OHX A;  2A75 A;  5CFC C;  3V7D B;  1YQ2 A;  1AR9 3;  2D7F A;  4LXL A;  3RI9 A;  3U1X A;  1AL2 2;  1FZI E;  2ZAH A;  4KWL A;  4CDW C;  4DTR A;  2RKH A;  1H6Y A;  1F5F A;  2PA7 A;  1STM A;  2PEL A;  2XVL A;  3EYP A;  1NA1 A;  3FN9 A;  3Q8A A;  4Y1Y A;  5FDB A;  2JHC A;  5J37 A;  2OS2 A;  3ZO0 B;  1RJ8 A;  1GNZ A;  4M42 A;  2QQU A;  3WNP A;  4Q0S A;  1GUI A;  1S0B A;  2WKK A;  3B69 A;  4FK2 A;  1KEX A;  2YU2 A;  4XFG A;  2YGL A;  4NRQ A;  2XVG A;  1ODN A;  1OT5 A;  4O9G A;  3H7Y A;  2Y26 A;  3M4F A;  4XFI A;  1ND3 B;  4BMB A;  1WAJ A;  3R4S A;  5EJ3 A;  5F3G A;  4Z8B A;  3ZXL A;  4YVW A;  1VBD 2;  5F1R A;  3I3B A;  1SFN A;  1DQ4 A;  2R0H A;  5B2G B;  4HOO A;  4QX2 A;  1JTZ X;  1QJU 3;  2E53 A;  4JDM A;  3OGS A;  2X10 A;  2WQ4 A;  2ZEX A;  1H9P A;  2YPD A;  4AAX A;  2XGX A;  4Q26 A;  5ACA 3;  2NMO A;  3SIT A;  4PF5 A;  4PBO A;  2Q8O A;  3ZFE A;  5C4W B;  3BVC A;  1RUG 2;  4I2O A;  4FJK A;  2OPK A;  2UWB A;  4D69 A;  1JOD A;  2FBE A;  4UF0 A;  3VDD C;  3M8L A;  5IJR A;  2ZML A;  2WLP A;  3POE A;  5JAX A;  3PTR B;  4N9I A;  2A73 B;  1DG6 A;  5EV7 A;  1C8M 2;  1QEX A;  4AHW A;  3MIH A;  3HOB A;  4C8D A;  1ZRC A;  2WO1 A;  5DPN A;  3U0Z A;  2WII B;  1GOG A;  1FZ5 E;  1J84 A;  4K6B A;  2RMU 1;  2RCU A;  1ND2 B;  4CZS A;  1DGR A;  2WS9 3;  1D4M 3;  3VZL A;  5DMY A;  4PDW C;  3KV6 A;  3PU8 A;  3FUO A;  1G9B A;  4QPI B;  3IAP A;  3T4H B;  3IPV B;  3L2H A;  3CEW A;  4AQT A;  2RS1 2;  1YYN A;  3VBS A;  3RZJ A;  1OOP A;  2JDZ A;  1H4G A;  4E4B A;  2PFW A;  1W9T A;  2E31 A;  3NCI A;  1YNA A;  3VLB B;  1V9U 2;  2DU0 A;  4GMP 3;  4C90 A;  3ZFG B;  1HRV 1;  3K3N A;  4XBL A;  4DEQ A;  2VMI A;  3DEC A;  1W6M B;  3FLP A;  1Y43 B;  3NJX A;  3HVD A;  1HQL A;  2E26 A;  2FDJ A;  3N36 A;  4EZ4 A;  1VBB 3;  3CU7 A;  5A1F A;  3LEI A;  3GF6 A;  1RIN A;  4GWN A;  3TL8 B;  1XNT A;  1RUI 3;  3WR0 A;  3H8X A;  3RZH A;  1GQP A;  2TUN A;  5CFC A;  5FP7 A;  1PK6 C;  1UOG A;  1PHM A;  3VGI A;  3GDB A;  1K5M B;  4W6Y A;  3KQ4 B;  2WZE A;  2ZGN A;  3MUY 1;  2D3S A;  3WP5 A;  1OMI A;  4D8M A;  3M7A A;  4J1X A;  1GOF A;  2D3R A;  1MEC 2;  1UIK A;  2A3X A;  1NQD A;  1VRH 3;  3ZKY A;  3RYP A;  2LF3 A;  1QDC A;  3P3P A;  4YZ4 A;  2D97 A;  5FFO C;  5LCW L;  2J1R A;  4S2H A;  2LAL A;  3JQX A;  5FZ1 A;  5CU1 A;  3N9P A;  1Q8P A;  4WM8 C;  1W6Q B;  3ON7 A;  1OH4 A;  4LK7 A;  5C8C B;  3VBF B;  3UO3 A;  1J3Q A;  5LK5 A;  1DU3 D;  3VDA A;  4CUG A;  4IE4 A;  4CDU C;  2WWJ A;  2WDB A;  1OH3 A;  3PU3 A;  4HK9 A;  4YYO A;  3WDX A;  4MHR A;  3OYW B;  4XW3 A;  1DQ5 A;  2HWC 2;  1MS5 A;  1FMD 3;  4DO0 A;  5CG9 A;  2KR2 A;  4KBZ A;  5DUU A;  3FWE A;  4XUN A;  5FYU A;  3ZN6 A;  2OXB A;  5A6X A;  4ZU7 A;  3TAG A;  1NLS A;  1ZZB A;  2VVF A;  3BU7 A;  1WAF A;  3GBF A;  3V0A A;  2NQY A;  2RE9 A;  1NKG A;  3TEX A;  4CP9 A;  1AZD A;  3SXW A;  4P9Y A;  3VDD A;  5JMC A;  1FOD 2;  4QM8 A;  3BIW E;  4KGG A;  3VZK A;  1AR9 1;  2EIG A;  4JGZ C;  3KCY A;  3WP3 A;  3NQH A;  4ORF A;  4I9Q A;  3RDI A;  4OI4 A;  2YFZ A;  2VO5 A;  4PHZ A;  1GP5 A;  4YRD A;  2WAB A;  1O5U A;  2VQA A;  1QJZ A;  2WN2 A;  4LMF A;  1W6N A;  3T0D A;  1ZRF A;  2P4E A;  4YFW A;  1UD1 A;  1ULC A;  2GNM A;  3KT7 A;  5F5Q A;  5FZF A;  3WF1 A;  4JKK A;  3WQ7 A;  5J09 A;  3OTF A;  4F7Z A;  1NT0 A;  2R32 A;  3D82 A;  1S0G A;  2WZP P;  1DYO A;  1AX0 A;  1CQ9 A;  1HB4 A;  4MGZ E;  5C9A C;  2BQP A;  1RUO A;  5D21 A;  4ZZ8 A;  1KIT A;  3A7Q A;  3PTY A;  2AH2 A;  2QQK A;  3RI8 A;  4ASL A;  4FPO B;  1BXH A;  3H1W A;  5D8A B;  4TZD A;  1S0D A;  5HCH A;  1OD5 A;  5IAT A;  3SQ2 A;  1PM4 A;  2XL9 A;  2PQS A;  1FYZ E;  3UYJ A;  3GJA A;  1MS0 A;  3VDC A;  1NUK A;  3C2U A;  5JR7 B;  1FPN 3;  4OHZ A;  1FZ2 E;  4AI3 A;  2WWU A;  1JZ3 A;  4JGY A;  1W8O A;  4P02 B;  2W1S A;  5ACA 1;  4CUB A;  2BOI A;  2PXJ A;  3WQ0 A;  3BAL A;  2DTU A;  3FBM A;  5TSW A;  4C91 A;  1AVB A;  4Q4Y 2;  1N1Y A;  1S1A A;  3UES A;  4E4H A;  1RMU 3;  3HQR A;  3IDB B;  4XJZ A;  1TME 3;  3ITQ A;  3VKL A;  5J98 B;  1OFN A;  1PK6 A;  3DF0 A;  4Q4W 2;  1W9F A;  1JZ8 A;  1BMV 1;  3QOP A;  4KNC A;  2NZ9 A;  4Z1V A;  3DKW A;  4QKF A;  5A3U A;  3PVE A;  1X8M A;  2WAA A;  4NPM A;  3EJK A;  1U5I A;  4YZ3 A;  1DLC A;  2PYT A;  1GZW A;  2WS9 1;  1D4M 1;  3BOD A;  1MVE A;  3KGZ A;  3NVC A;  4HKW A;  2HBT A;  3TBD A;  4R8H A;  3JU9 A;  3OG2 A;  1XJA A;  4JDN A;  4QXB A;  1GNY A;  2VMC A;  3OEA A;  2RJ2 A;  4RQP B;  4XTP A;  4ZXE A;  5J48 A;  5BNP B;  5JOY A;  1KS5 A;  1LU2 A;  5FPL A;  1DZT A;  1BEV 2;  1IGO A;  2VMH A;  1KQR A;  4LJH A;  2XJV A;  4J2E A;  3S0M A;  1EPZ A;  3CIH A;  4Y22 A;  3C6P B;  2I2S A;  4ZS3 A;  4CDU A;  1MAC A;  3T2O A;  2R04 3;  1LB2 A;  3JD7 2;  2OX0 A;  1BBT 2;  1US3 A;  4GMP 1;  3MW4 A;  4BK4 A;  5A3M A;  1W03 A;  2D93 A;  3QNO A;  1WBF A;  4AKH A;  5FZ4 A;  2ZAA A;  5C8W A;  1YQ8 A;  1ZYB A;  1EYB A;  5EXO A;  4M45 A;  4EZH A;  4DTN A;  1AL0 G;  1D2Q A;  1VBB 1;  4BQY A;  1VIW B;  4BH9 A;  4CXW A;  4NUB A;  4YW1 A;  3AYE A;  2NM1 A;  5FQ0 B;  4N7U A;  1RUI 1;  1X7N A;  4IEX A;  1UZV A;  3WDV A;  4W65 A;  5I93 A;  1NE6 A;  2A5Z A;  3MIF A;  2R06 3;  1ZZ7 A;  3MGU A;  2RHP A;  2UYB A;  1QU0 A;  3IMM A;  4JGZ A;  4Q0Q A;  4QPG B;  3IDC B;  1OC1 A;  1DQ2 A;  1FS1 A;  1IS5 A;  3PLQ A;  4JQR A;  1QXP A;  2VAU A;  4NPR A;  4WVM B;  3ZMN A;  3ZSM A;  5IAV A;  3FJS A;  3LF7 A;  5GZC A;  4Q4V 2;  1AX1 A;  3BOW A;  5LEK A;  4P9X A;  4M3C F;  2XWJ B;  1V6L A;  2WR9 A;  3GJB A;  5C9A A;  3N1B A;  3ZPO A;  1C5H A;  2CNA A;  3OUJ A;  4BCU A;  5FY8 A;  1NE4 A;  1UAI A;  1AJK A;  1UY1 A;  3QCW A;  4XQ4 A;  3W9A A;  4V2V A;  3TNQ A;  1ZRE A;  1RUE 3;  2DTW A;  1QQP 3;  2QQN A;  2MEV 1;  3QEI A;  1D2S A;  3OBR A;  3V0B B;  2BPA 2;  4G4F A;  4CEW C;  4CVU A;  2DBI A;  2O8Q A;  4KU8 A;  5K8S A;  1FMD 1;  1Z7S 3;  4IV3 C;  4V1P A;  5JLV A;  2XJU A;  3RYK A;  2VOX A;  2XXZ A;  4CDX B;  3LSE A;  4FPC A;  4OI0 A;  1K42 A;  2DCK A;  5JSP A;  4NHL A;  2CDP A;  2PHF A;  2B8I A;  2FHR A;  2RDN A;  1H4H A;  3VV1 A;  4N43 B;  4ATF A;  2ARB A;  4Q1P A;  1AR8 3;  2R30 A;  1FZ6 E;  1SCS A;  1SDW A;  4ZS2 A;  4LEJ A;  2ATF A;  2QUO A;  4QDS A;  1VBE 2;  2TBV A;  2ZX4 A;  2HWD 3;  5HBA A;  1AR6 3;  2WFF 3;  2XJP A;  4AEK A;  5LW9 A;  1N3Q A;  1HDK A;  1QH7 A;  3PVB B;  2A6Z A;  1R08 1;  5EYX A;  4IQP A;  1O3R A;  2CYF A;  3U11 A;  1XVB E;  1QKQ A;  1NY7 2;  2VR4 A;  3BTA A;  5EWS A;  2BFU L;  2R07 2;  5ABJ C;  4L9B A;  3A23 A;  2B45 X;  3H42 B;  5DAW A;  1V6M A;  3HL8 A;  4PI2 A;  1MZF A;  3TRS B;  3MIB A;  2XUE A;  3RQ0 A;  2QBX A;  1CZS A;  1KGY A;  2VZR A;  4CCC A;  1LU1 A;  1DZQ A;  1FPN 1;  4H7M A;  2H4T A;  5FKC A;  1OUS A;  1NAE A;  2QQV A;  1PGW 2;  3QEP A;  2ET1 A;  2BW8 A;  4NJ4 A;  4B7E A;  2PFT A;  1F31 A;  3RS6 A;  4DFS A;  2ARE A;  4FJ9 A;  5AFE A;  4YW4 A;  5LA2 A;  2E9Q A;  2BDR A;  4XEZ A;  2Q8D A;  1H1A A;  1RMU 1;  5ERL A;  1R1A 2;  1W3X A;  4GXL A;  3ZDV A;  1H0B A;  1TME 1;  5GZD A;  4BM8 A;  3VB9 A;  1PO1 2;  1ST8 A;  4CCJ A;  4YGB A;  1COV 3;  1TNR A;  5KXB A;  2XLG A;  5C8C A;  4L11 A;  3VD9 A;  2JKB A;  2F4L A;  4FXG B;  3POJ A;  5IYY A;  3SMH A;  3DN7 A;  3K2O A;  4LKS A;  4BJ0 A;  3K75 B;  4XUO A;  3HBK A;  2XJR A;  2WSU A;  1PIV 2;  5FXW A;  2NP0 A;  4D7Y A;  4LIV A;  1U5X A;  2WO2 A;  4BU2 A;  1Q8S A;  1O3S A;  1DGW X;  3BN6 A;  4JKM A;  1UKR A;  1IOA A;  1Y9M A;  2F6B A;  2KM2 A;  4OMC A;  4XJA A;  4GJY A;  3KF5 A;  1OVP A;  3NL1 A;  4X6R B;  2WNV C;  3PIG A;  4AK3 A;  2CWM A;  2PLV 3;  1T6B X;  2UYA A;  4U36 A;  1BHG A;  2R04 1;  1JH5 A;  4J25 A;  4CEW A;  5I0D A;  1JZ7 A;  1XMG E;  1DZR A;  1JW2 A;  2LF6 A;  2GH2 A;  1PO2 3;  2FD8 A;  1S2B A;  1K3I A;  5FCC A;  3UET A;  1LOD A;  1QOT A;  1UPI A;  4FFF A;  3T2P A;  5JPN B;  3VUO A;  2BWA A;  1RC6 A;  3DCQ A;  1W05 A;  4NHX A;  4YG0 A;  3CJI B;  4I0A A;  2W5F A;  3GCW A;  3BTZ A;  4KL1 A;  2Y60 A;  4IL7 A;  2CDO A;  2YXS A;  5FXX A;  4IER A;  4RN5 A;  1ZA7 A;  5E88 A;  1JN2 P;  4DUX A;  4P5H A;  4M0N A;  2R06 1;  1CPM A;  3T0A A;  3B9C A;  2CAV A;  1XU5 E;  4IEV A;  5KWR A;  3MID A;  3LA3 A;  1CAV A;  5D8A A;  4QB2 A;  2J1U A;  2EIC A;  4AWD A;  1YIP A;  2QNK A;  2XDV A;  4RGG A;  5FUP A;  1QJX 2;  2JWP A;  2YDE A;  1AYM 2;  1NCR C;  3AMM A;  3NV1 A;  5FBJ A;  3WIN E;  3WW4 A;  4BQ3 A;  1CAX A;  1GV9 A;  3AC0 A;  1RXG A;  2MW2 A;  4GWI A;  2XQX A;  1CAU B;  2ZGP A;  4XE9 A;  1OKO A;  5ABJ A;  1EV1 3;  3USS A;  4EN7 B;  5JXI A;  2VQU A;  4GH4 C;  2VTX A;  3AZY A;  2WT1 A;  1RUE 1;  3X29 B;  5KC6 A;  2WWS A;  1QQP 1;  3C7H A;  4QU1 A;  4WVW A;  1S0I A;  5FZL A;  4D7T A;  4DQA A;  4H14 A;  5F5A A;  5GZF A;  1GMM A;  5EIY B;  2ZGM A;  3SIS A;  4ZY9 A;  2JDN A;  3IB3 A;  3RVH A;  3AKS A;  3PJQ A;  5FPB A;  2XKO A;  4XJW A;  1Z7S 1;  4AHY A;  4DXT A;  4EN9 B;  4UFM A;  3RZK A;  3LOB A;  4M3C B;  1HX6 A;  4E3S A;  1NXD 1;  3NNJ A;  2BEO A;  4HCC A;  4Z82 A;  4COY A;  1DFQ A;  3J26 N;  3NJZ A;  2CSG A;  1HRI 1;  1J3P A;  2XOM A;  2BU9 A;  3D3A A;  4Q1R A;  5FZO B;  2ZEY A;  5BNP A;  1AR8 1;  1FT9 A;  1YEW A;  5L7O B;  3I54 A;  1SCR A;  2XWB B;  4E2S A;  5FOJ B;  4FVM A;  5C3R A;  2XLA A;  1E5R A;  2P3K A;  2W94 A;  2YG0 A;  2HWD 1;  1H8T C;  1JBC A;  4TSV A;  3WW1 A;  1AR6 1;  2WFF 1;  3ILR A;  3AJY A;  4AGV A;  4A4A A;  3AZV A;  5FTT C;  3E6C C;  2QQL A;  4WZF A;  2GMP A;  5A70 A;  4LLO A;  2JJ6 A;  1XVG E;  1GZT A;  4B1M A;  4EYW A;  4FJN A;  1F35 A;  1W6O B;  1OUR A;  2JXA A;  3J27 A;  1LOG A;  4EP9 A;  1QJU 2;  2PHT A;  1LNS A;  4MSV A;  3WD5 A;  3APB A;  3ZSL A;  2HEW F;  2WNV A;  3WF4 A;  2A70 A;  2DVA A;  1H1M A;  1XE0 A;  2ZGU A;  1YQC A;  2QQO A;  4BA6 A;  2PTM A;  3ZX7 A;  5A3P A;  4HKL A;  3LCP A;  2F4P A;  1NCQ B;  4WVM A;  1Z0H A;  2HWB 2;  5E89 A;  3JBG 2;  3BYW A;  4N53 C;  3CZU A;  3R05 A;  3SH4 A;  5A3L A;  1BMV 2;  1PVC 2;  4MGY E;  5GJ6 A;  2Q4S A;  3KM5 A;  1GWL A;  3AVR A;  5BY5 A;  4LHK A;  2BOJ A;  2V72 A;  4JRQ A;  4RHV 3;  1J1L A;  3KQR A;  2WS9 2;  2C9K A;  2WNU B;  1WKY A;  1HB1 A;  3MLL A;  1XU1 A;  2XLF A;  3P3N A;  1COV 1;  1LOB A;  5FLI A;  1R09 3;  1IG0 A;  1SLI A;  2DUO A;  4UOJ A;  2WO3 A;  5FK8 A;  3ZMO A;  3I2H A;  1UO9 A;  1PX4 A;  1X36 A;  2JG9 B;  5GZE A;  1SQ4 A;  2J1A A;  3SEP A;  3ZFF B;  4AR2 A;  1VAM A;  4M3T A;  1NCR A; 
#chains in the Genus database with same CATH homology
 3V7D B;  4JS5 A;  3E4W A;  3RMA A;  1YQ2 A;  2ZEW A;  3HPN A;  4BDV B;  4M3U A;  1O59 A;  5JXG A;  2B7M A;  1FZI E;  1ULO A;  3NGI A;  2HYX A;  4DTR A;  1H6Y A;  4DXS A;  3I3D A;  3KD1 E;  3EYP A;  3FN9 A;  2JHC A;  3GM8 A;  1SHW B;  3FHQ A;  4KWU A;  3WNO A;  4M42 A;  3HNB M;  1JZ5 A;  3QET A;  3WNP A;  3VDB A;  1GUI A;  4P08 A;  3HN3 A;  4FK2 A;  1KEX A;  3LPG A;  4DTS A;  1MPX A;  2W92 A;  1OT5 A;  2VMF A;  3CFP A;  4GZ9 A;  4CU7 A;  1WAJ A;  4QDR A;  2OVR B;  2J1E A;  2WQ8 A;  1K45 A;  3I3B A;  4FJM A;  2VZU A;  4QX2 A;  2LS6 A;  4KHN A;  4AAX A;  3QEX A;  2X10 A;  3OGS A;  2ZEX A;  5IYY A;  4X5N A;  5EJ1 B;  2QQJ A;  4FJK A;  1UY2 A;  3SJJ A;  3K4Z A;  2WBK A;  3RMD A;  5IJR A;  3SUP A;  3OGV A;  2HD0 A;  3SPY A;  1UMH A;  5IFP A;  4A42 A;  3HOB A;  4QNC A;  2WO1 A;  5DPN A;  2FW3 A;  1GOG A;  4TTG A;  1FZ5 E;  1J84 A;  3SKV A;  2RCU A;  3CQO A;  3SEE A;  2Y6H A;  5DMY A;  2X09 A;  3K4D A;  2VZT A;  2YC4 A;  3IAP A;  2VZO A;  2OVQ B;  3ZM8 A;  1EUT A;  2VCC A;  4XZU G;  1IQD C;  4E4B A;  4FJJ A;  1W9T A;  2E31 A;  1UMI A;  3NCI A;  3T08 A;  2QXF A;  1SG3 A;  4AKG A;  2ORX A;  4DEQ A;  3DEC A;  1T2X A;  3T09 A;  2DEB A;  3SUN A;  4UAP A;  3NJX A;  4EPH A;  2Y8K A;  5EJZ B;  3C7E A;  3MBW A;  4FJX A;  3SQ4 A;  2E26 A;  2QQI A;  4A45 A;  5HPO A;  5G04 L;  4FJ8 A;  1RYY A;  3T0B A;  3LEI A;  1Q9X A;  3TL8 B;  1XNT A;  2W3J A;  1GQP A;  2EID A;  1XNA A;  3ACF A;  3OGL B;  3GDB A;  3I2K A;  4DU3 A;  3U37 A;  2Y6L A;  2WZE A;  3MUY 1;  3CMG A;  2E33 A;  3I97 A;  4MGS A;  4D8M A;  1GOF A;  4P00 B;  3SUQ A;  3LDB A;  1L7R A;  1H6X A;  1JYV A;  3LEG A;  2LF3 A;  1FZ0 E;  5LCW L;  2J1R A;  3WNM A;  5LA1 A;  2YB5 A;  2PFV A;  4FJ5 A;  3HNY M;  1UYX A;  3RMB A;  3WF3 A;  1FZ7 E;  2Y6G A;  3ECQ A;  1OH4 A;  2MMB A;  3MV1 1;  3VDA A;  3NJV A;  3OGK B;  2WDB A;  4ARY A;  3THD A;  3LZJ A;  1R64 A;  3NHG A;  1XVE E;  3I2G A;  4XUN A;  4KHW A;  4FK0 A;  1UX7 A;  2WZ8 A;  2Y6J A;  4JX0 A;  3TAG A;  4DEV A;  1WAF A;  4OMD A;  1NKG A;  5DQ0 A;  4DXR A;  2DY4 A;  2P1P B;  2OZM A;  3VD5 A;  3WF2 A;  4DTU A;  3EB7 A;  2KD7 A;  4J2A A;  2XHN A;  3NQH A;  4I9Q A;  3LD8 A;  3SI6 A;  2YFZ A;  2VO5 A;  5C71 A;  1MMO G;  2WAB A;  1JZ2 A;  2WN2 A;  4DTP A;  2VL4 A;  4MO3 M;  3T0D A;  4FK4 A;  3THC A;  4FJ7 A;  4HG6 B;  3WF1 A;  4JKK A;  4QND A;  1UYY A;  4E8D A;  2FYO A;  1DYO A;  5LA0 A;  2BZD A;  4ZZ5 A;  4ZZ8 A;  3A7Q A;  4GWJ A;  4PT6 A;  2QQK A;  2Z4F A;  2VIX A;  3BGA A;  3UNP A;  3SQ2 A;  2PQS A;  1FYZ E;  2W47 A;  4OZO A;  4DTJ A;  5IRE A;  3WNL A;  3VDC A;  3III A;  1NUK A;  1CIY A;  4OYU A;  4RYD A;  1XC6 A;  1FZ2 E;  1JZ3 A;  4W8J A;  1W8O A;  4P02 B;  4YPJ A;  4A41 A;  2W1S A;  4Z2A A;  4CUB A;  2JH9 A;  3W5N A;  1DP0 A;  5CYY A;  2DTU A;  3ACG A;  4DTX A;  3TAB A;  3UES A;  2J1T A;  3L2O B;  3LDS A;  2DCJ A;  2VMD A;  3DYM A;  2C4X A;  4J2D A;  4ARX A;  2X05 A;  4I9L A;  3NDK A;  2QQM A;  1UXX X;  1JZ8 A;  1XL3 C;  2P1O B;  3OEB A;  3C6N B;  1TVG A;  5C70 A;  1F4A A;  3WQB A;  2WAA A;  1FZ8 E;  1MHZ G;  1DLC A;  2V5D A;  1FZ9 E;  1JU3 A;  2ZEZ A;  4DUW A;  1JZ4 A;  4M4R A;  1XVD E;  4I6J B;  2XON A;  3K46 A;  2P1M B;  2J7M A;  5C7G A;  4KHU A;  3OG2 A;  3E4Y A;  4LHS A;  1JHJ A;  1GNY A;  2VMC A;  3OEA A;  3SPZ A;  2RJ2 A;  2P1Q B;  3SVI A;  3IAQ A;  3MO4 A;  4ZXE A;  5JXH A;  1XMH E;  5JXJ A;  4J2E A;  1W9W A;  3L1N A;  3CIH A;  1W8N A;  3C6P B;  3GGL A;  3TAE A;  3C7F A;  3T2O A;  1JYX A;  4OUE A;  3S9H A;  2W9X A;  1JYN A;  1US3 A;  4J2B A;  4BK4 A;  2WUH A;  3HEI A;  5G05 L;  3LZI A;  3QNO A;  2VTF A;  2JHA A;  4AKH A;  3NE6 A;  2L9L A;  3NRU A;  4LQR A;  1P8J A;  4M45 A;  4DTN A;  3C6O B;  2VOT A;  4XUT A;  4ET7 A;  3SKJ E;  2OVP B;  2P5O A;  2V4V A;  4MGQ A;  4RG8 A;  4L0P A;  1NX9 A;  3C94 A;  3F2Z A;  3C95 A;  3J7H A;  1FS1 A;  3VD7 A;  2W46 A;  1P22 A;  1OD3 A;  2VZ1 A;  4KHY A;  1L7Q A;  2B1E A;  3ACI A;  4XUP A;  4JRP A;  1K12 A;  4QB6 A;  4UI9 L;  3N1B A;  1W0N A;  3OGM B;  2VZV A;  2JD9 A;  3HGL A;  5JR2 A;  1UY1 A;  2W1Q A;  4PF1 A;  4HCB A;  3SNN A;  1FZ3 E;  2VCB A;  2QQN A;  3QEI A;  2VCA A;  4CUA A;  3PUI A;  1UY3 A;  4CVU A;  1XVF E;  3GXU A;  5A1A A;  5IFT A;  4B08 A;  1XU3 E;  2WYS A;  1CX1 A;  3TJY A;  2E32 A;  2JH8 A;  3NNG A;  2YFU A;  4FI9 A;  4QX3 A;  4LPL A;  2VM9 A;  2DCK A;  1K42 A;  2CDP A;  1XMF E;  5IHR A;  3VD4 A;  2B8I A;  1HN1 A;  1D7P M;  3T2Q A;  1FZ6 E;  4E8C A;  2OKX A;  5HXM A;  3RWU A;  5JMO A;  1CZV A;  4QDS A;  3NAE A;  4XUQ A;  5IZ7 A;  1EUU A;  2B4K A;  3P1I A;  4A3Z A;  4RL5 A;  2MZW B;  4KI5 M;  1J83 A;  2Y64 A;  1XVB E;  1O8S A;  2Y6K A;  1JI6 A;  3RMC A;  2VR4 A;  2P1N B;  3CQ8 A;  3SCX A;  1PMH X;  3A23 A;  2RV9 A;  5B4N A;  3HL8 A;  1JZ6 A;  1FZ1 E;  2EIE A;  4QX0 A;  4QDQ A;  3HP9 A;  4A44 A;  4DTM A;  2QBX A;  2VZQ A;  2ZXQ A;  1CZS A;  1KGY A;  4M3W A;  2VZR A;  2W95 A;  1ULP A;  2JPN A;  3WNK A;  4DU1 A;  2H4T A;  5FUI A;  4RNG A;  1NAE A;  5CZK A;  3QEP A;  2EIB A;  4QAW A;  5JUV A;  2PFT A;  4FJI A;  3LQC A;  3CZJ A;  4FJ9 A;  3ETP A;  4BXS V;  5LA2 A;  3C7O A;  4DU4 A;  3WF0 A;  1Q9Y A;  2BBA A;  2ID4 A;  4BK5 A;  4DUV A;  2B9V A;  1FZH E;  3I2F A;  4CU6 A;  3VD9 A;  3WSO A;  1OF3 A;  3KD5 E;  1GOH A;  4ADN A;  4KHS A;  3K2O A;  4LKS A;  4BJ0 A;  2JDA A;  3K75 B;  4XUO A;  2OYQ A;  4AKI A;  4KI4 A;  2WO2 A;  1WCQ A;  3L8B A;  1MTY G;  4GAM C;  1PMJ X;  3SQ0 A;  2R7E B;  3QNN A;  3BN6 A;  2YB7 A;  3A22 A;  4JKM A;  4AG4 A;  1MHY G;  4OMC A;  2BGO A;  3UIQ A;  5F7U A;  3QER A;  1US2 A;  4DTO A;  1BHG A;  5I0D A;  1UZ0 A;  1JZ7 A;  2OZS A;  1XMG E;  3CFR A;  4QPW A;  2LF6 A;  3LPF A;  1SDD B;  3MV0 1;  1F4H A;  1K3I A;  2C26 A;  4JHZ A;  4QB1 A;  4TXW A;  3T2P A;  3UET A;  4JKL A;  4FJG A;  2LW8 A;  4W50 A;  3I2I A;  1CZT A;  3CFO A;  1NEX B;  2W5F A;  3HGK E;  4CU8 A;  2JE8 A;  2CDO A;  4M4P A;  4RN5 A;  3WNN A;  4DUX A;  3HJR A;  3T0A A;  2W1W A;  1XU5 E;  2BGP A;  3MUZ 1;  4IUG A;  1UWW A;  3K77 A;  3L0M A;  3C7G A;  4KHQ A;  4QB2 A;  4W4Z A;  2J1U A;  2EIC A;  3LEK A;  1UXZ A;  2VME A;  1CLQ A;  3SQ1 A;  4KI6 A;  3A21 A;  3HNM A;  3AC0 A;  3PUH A;  4GWI A;  2XQX A;  5JXI A;  3OBA A;  2VQU A;  1IH7 A;  4M3Y A;  4AI6 A;  3N1E A;  3C7H A;  4XUR A;  2VJX A;  3OGR A;  2J1V A;  3CKH A;  3LE0 A;  2W1U A;  1GMM A;  4P5Y A;  2VJ4 A;  4PQQ A;  5EIY B;  5J1X A;  4ZY9 A;  1XPW A;  3IB3 A;  2JHP A;  4M3X A;  1JYW A;  4DXT A;  3W5M A;  2WAO A;  5DN2 A;  4E3S A;  1W99 A;  4MAD A;  2VZP A;  4HCC A;  2P5G A;  3DYO A;  4M3R A;  3ABZ A;  2WN3 A;  4FJL A;  2W91 A;  2XOM A;  3D3A A;  3I3E A;  2ZEY A;  1I5P A;  3OB8 A;  3DYP A;  1OF4 A;  4FVM A;  3J2P A;  1UY0 A;  4D0Q A;  2YG0 A;  2W94 A;  3CDZ B;  4M41 A;  2DDU A;  4A6O A;  3FHA A;  3TAF A;  2J1S A;  4A4A A;  2VJ5 A;  4XVH A;  4M3Z A;  3C8X A;  5IBK B;  2QQL A;  4CUC A;  1XVG E;  4MOA A;  3FL7 A;  2JKX A;  4EYW A;  4FJN A;  1W9S A;  2VQT A;  3E1F 1;  3J27 A;  4EP9 A;  5B4X A;  1LNS A;  4JS4 A;  3QES A;  3JXS A;  1FXX A;  3WF4 A;  2J22 A;  2ORZ A;  1IG9 A;  2YC2 A;  2ATQ A;  1UY4 A;  2QQO A;  4CU9 A;  5H37 A;  3MKS B;  4ADO A;  2RVA A;  1UYZ A;  2VC9 A;  1O8P A;  2BER A;  2HLE A;  3CZU A;  3VD3 A;  1XVC E;  3QEW A;  2V72 A;  4JRQ A;  3K4A A;  2VZS A;  3IDA A;  3WEZ A;  2C9K A;  4QX1 A;  1WKY A;  4KMQ A;  3I2J A;  1FZ4 E;  4X5M A;  1JU4 A;  2VZ3 A;  3QEV A;  4UOJ A;  4FJH A;  2WO3 A;  1GU3 A;  1TG7 A;  2W87 A;  3I2H A;  3SUO A;  3ACH A;  1PX4 A;  1LDK E;  2J1A A;  3SEP A;  1PX3 A;  4M3T A;  3P6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...