2E32A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
240
Chain Sequence
EYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords F-box only protein 2
total genus 57
structure length 240
sequence length 249
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00646 F-box F-box domain
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2e32A01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e32A02
3OG2A 2EIDA 2WAAA 1UXZA 3ACIA 4L0PA 3WF2A 4MO3M 2Y6LA 1US3A 2WO3A 1UMHA 2VCAA 1J84A 4PQQA 4KMQA 2OKXA 5IFTA 1CZTA 1GNYA 3UNPA 1PX3A 2W92A 3IB3A 4MOAA 2VOTA 3C7EA 1K3IA 1ULPA 1OT5A 3FN9A 5JUVA 1OF4A 4KWUA 2VMEA 4I6JB 2YFZA 5JXIA 1UWWA 3LPGA 4QAWA 4OYUA 1I5PA 2WO1A 1KEXA 1W0NA 2VCCA 3OBAA 5JMOA 1P22A 4JKMA 2YB7A 1XPWA 3SKJE 4XUOA 1F4AA 2WYSA 3SEPA 3LEIA 1P8JA 2W91A 2QQKA 2ORXA 4LPLA 3NJVA 3I2FA 2VZOA 2QQOA 2J1VA 2XQXA 3C7FA 4QX1A 3BN6A 3EB7A 3F2ZA 5JR2A 2QQIA 2OVPB 3I3DA 3IDAA 2VZVA 2J7MA 1JYXA 3K46A 4DEQA 1H6YA 3VD7A 3OGRA 2RJ2A 3MUY1 3HN3A 3E1F1 2P1PB 3CMGA 3T09A 1O8SA 3T0DA 2W1SA 3HPNA 2DCJA 1OF3A 4ZXEA 3WF3A 5JXGA 1LDKE 2YG0A 4OMCA 4DEVA 1O59A 1UY4A 2EIBA 4AAXA 4P00B 4UI9L 5EJ1B 3T2QA 5F7UA 2VM9A 4BK5A 3VD4A 3CZUA 2Y6JA 3I2JA 3C6PB 5LA2A 4OZOA 3WNLA 3U37A 1J83A 4CUAA 1L7QA 4GWJA 4QDSA 2J22A 4D0QA 2E33A 1CIYA 4XUTA 2J1RA 1NKGA 3FHAA 2J1SA 2VZTA 2C26A 2VZPA 2WDBA 5LCWL 3ZM8A 3VD9A 2HYXA 5HPOA 1UYZA 2P1MB 2J1AA 4A4AA 2V4VA 4QB6A 2BERA 2ZEZA 3WQBA 2W5FA 4QPWA 4D8MA 5HXMA 2RV9A 2VZ1A 1O8PA 1JYWA 4GZ9A 4ET7A 3L2OB 5IYYA 2VZRA 1R64A 2E31A 4DUWA 2WAOA 2Y64A 2ZEYA 1D7PM 1GOGA 3LEKA 4OUEA 1GQPA 5DMYA 1UY0A 4QB2A 4XUPA 2VR4A 4P5YA 4E8CA 1F4HA 1EUUA 3HEIA 2P1OB 4A41A 4A3ZA 2ZEWA 2VZSA 1HN1A 3AC0A 3I2HA 3FHQA 1WCQA 4QDQA 3OGVA 2J1EA 3GGLA 4OMDA 2WUHA 2VMFA 5IJRA 2VQUA 4CU6A 2X10A 2BZDA 4JKLA 3D3AA 5IHRA 5I0DA 4ARYA 3C8XA 1KGYA 1OD3A 2CDPA 3ABZA 4AG4A 2ZXQA 1EUTA 1W9WA 1NAEA 2VCBA 3FL7A 2W47A 1W9TA 3IAQA 3UESA 2E26A 3DECA 2W94A 5B4NA 3NJXA 4JKKA 3OGMB 3DYOA 2JKXA 3VDCA 4QB1A 2CDOA 4KI5M 1UX7A 4CUCA 2WN3A 2JDAA 2YC2A 1XNAA 1YQ2A 1JZ7A 2BGOA 4XVHA 4W8JA 4A44A 3ECQA 4CUBA 1NX9A 4W50A 1DLCA 4M4RA 4P08A 3C6NB 1TVGA 2QQNA 3ACFA 5G05L 1NEXB 3CQOA 2WN2A 3I2IA 1JZ5A 4JHZA 4E8DA 2Y6HA 2YC4A 5IFPA 3C6OB 3I2GA 1UZ0A 4QX0A 3WEZA 4XUQA 2VMDA 3V7DB 5DPNA 3GXUA 3THCA 2QQMA 2QBXA 3WF1A 2ORZA 1MPXA 3WF4A 2ZEXA 2WO2A 4BXSV 1W8OA 3CIHA 3A23A 2KD7A 4FI9A 3NQHA 2W95A 4RN5A 1SG3A 2JD9A 2L9LA 4W4ZA 2C4XA 5EIYB 3C7OA 3MV11 1JZ4A 2BGPA 1JZ2A 3THDA 3I2KA 4MADA 1JU3A 3WNPA 1JZ8A 5DQ0A 2VJXA 4QX3A 1PMJX 1LNSA 4TXWA 2OVQB 1NUKA 2Y6KA 4DUVA 2VL4A 3I3EA 2WQ8A 3C7GA 4P02B 2B9VA 2XOMA 4QDRA 4XURA 3ACHA 2VZQA 2VZ3A 4BK4A 2RVAA 3MV01 3NNGA 2C9KA 3MUZ1 1GOFA 1UMIA 4XZUG 3ACGA 3T2OA 3I97A 3SEEA 2DCKA 4LHSA 3C7HA 4BDVB 5LA0A 2J1TA 4ZZ8A 4XUNA 2P1QB 4BJ0A 3IIIA 1UY2A 1UYYA 4RYDA 4DXRA 3T0BA 3MKSB 3LQCA 3P6BA 5JXJA 2Y6GA 4DUXA 4HG6B 2VC9A 1H6XA 3HNBM 5G04L 4A6OA 1US2A 1K12A 5DN2A 5JXHA 2EIEA 2WABA 4CU8A 3OGSA 4GWIA 4PF1A 3WNKA 3T0AA 2JE8A 3K75B 4CU9A 2VQTA 1GU3A 1XNTA 2R7EB 5IBKB 2VMCA 3K77A 3WF0A 4ARXA 1JZ3A 2BBAA 4MGSA 2W3JA 3A22A 2WBKA 3OEAA 3WNNA 3SKVA 1BHGA 2QQLA 5CZKA 2P1NB 4M4PA 3MO4A 1UY1A 1SDDB 1RYYA 4QX2A 2OVRB 4TTGA 3W5NA 2V5DA 3CKHA 4Z2AA 2W1WA 2XONA 3LPFA 1DP0A 3VD5A 1W99A 1SHWB 2X09A 1UYXA 1FS1A 3WSOA 4UOJA 4ZY9A 4MGQA 2LW8A 4DXSA 5C70A 2EICA 2W87A 4A42A 3JXSA 3CDZB 2B4KA 2ID4A 1GMMA 5C7GA 2J1UA 3IAPA 3K4ZA 4LKSA 3VD3A 2PQSA 3PUHA 1JHJA 1L7RA 3CZJA 3HJRA 1CZSA 4CU7A 2W46A 3NRUA 3OGKB 3DYPA 3T08A 5FUIA 1OH4A 2HLEA 3LE0A 3GDBA 2XHNA 1CX1A 3VDAA 4A45A 2Y8KA 3A21A 5LA1A 2X05A 2VO5A 1JYVA 3PUIA 2W9XA 2E32A 1W8NA 4UAPA 2VTFA 3LEGA 5A1AA 2QQJA 1ULOA 3UETA 5C71A 2DDUA 4ZZ5A 3HNMA 3A7QA 2Z4FA 3OGLB 1JI6A 2W1UA 4LQRA 1XC6A 3EYPA 3OB8A 1JYNA 1K42A 1GOHA 3T2PA 4JX0A 1GUIA 3J7HA 2LS6A 2VZUA 1UXXX 5J1XA 3WNMA 1PMHX 3WNOA 4YPJA 1T2XA 5CYYA 3VDBA 1DYOA 1CZVA 3K4AA 3I3BA 3GM8A 1JZ6A 3MBWA 3BGAA 1IQDC 3HOBA 1W9SA 2V72A 2W1QA 4CVUA 1WKYA 3K4DA 2YFUA 3DYMA 4PT6A 3W5MA 4IUGA 1JU4A 5B4XA 1UY3A 2WZEA 4DXTA 2WZ8A 5EJZB 3P1IA 3ETPA 1K45A 3HNYM 1PX4A 3OEBA 1TG7A
chains in the Genus database with same CATH superfamily
4ADOA 1H9WA 2N7GA 3ZKUA 2AACA 3WCRA 4AOCA 1V9U1 2P2KA 4IV3C 5CKNA 3TN93 1JYCA 3ACIA 3ATGA 4L0PA 1W90A 1YQCA 2ATFA 4MO3M 1ULFA 3A0KA 1POV1 2Q8DA 5AFBA 1SFNA 2OUJA 5I93A 1W05A 3KT4A 3RGBA 2D7FA 3WLUA 1J84A 3UGFA 2XUEA 1OI6A 2UWBA 5FO9B 2AGSA 5IFTA 1VBA1 2JG9A 3L2YA 1XE7A 1Z7S1 2DVBA 3RI9A 4QHZA 4CP1A 3NVCA 5FZFA 4BQ1A 4MOAA 2VIXA 4LLOA 3SQOA 3NNJA 4AKIA 3DKWA 1CAXB 4A7YA 1MS5A 3NJZA 1FNZA 5IT6A 3RYRA 1OT5A 1U5IA 4KWUA 5LBBA 1OKOA 1PIV2 2HWE1 5HCFA 4B4PA 4BCUA 4ORFA 4L99A 4TSVA 3KQ4B 2VMEA 3POBA 4LO7A 1S0EA 4RHV3 1W6NA 3CJXA 5FMDA 1WLDA 2DV9A 4JS4A 3JBG1 1UOBA 1LOAA 1UWWA 5F6LB 4MXWB 4QAWA 5F5CA 4IGOA 3WHTA 2HKXA 5D21A 5IK8A 2RS52 2WO1A 2OT7A 3V0BA 2RMU3 3ROUA 5FPXA 5FOJB 3AMPA 4FPOB 1F2NA 4KG8A 3WG3A 2HWC1 2ZX0A 1MS8A 1BVP1 2WNEA 3KT1A 3SKJE 1ENRA 4XUOA 1NXMA 1S2BA 2AENA 1XNCA 1WA4A 3ES1A 4HFSA 4MXWA 3SEPA 4HK8A 2VXJA 3KS7A 1P8JA 3KV4A 2OPWA 3DGTA 4JC1A 2MZWB 2W91A 4LPLA 5FP4A 3NJVA 2VZOA 3WG2A 2XJSA 2J1VA 2XQXA 3C7FA 3CBNA 4Q4Y3 5IVCA 2ZX1A 4FJJA 4FJIA 3DPRC 4DU1A 2ZGNA 3F2ZA 3ALQA 1POQA 3AP9A 3RZKA 3KGZA 4EWAA 3AM2A 2ADEA 2CAVA 2VZVA 4AQSA 2J7MA 3WX5A 1JYXA 3K46A 4RS5C 1PZ9A 2A6ZA 2DFCA 2VQAA 3IMMA 4LE4A 1W9YA 3RMDA 3VD7A 4ES8A 1H4GA 5GZFA 1G6NA 3HN3A 1FMD2 1RUI2 2R6QA 1QJY1 2VUAA 3E1F1 5FPBA 1HQWA 4CSWA 3FX3A 2W1SA 5H37A 4NHYA 2XGXA 1KDMA 2Y38A 4FOQA 1OF3A 4ZXEA 3WF3A 1V6JA 4Y1XA 3T4HB 4K1YA 1YJLA 1LDKE 4OMCA 3LA3A 4LKFA 1W8WA 1UY4A 3AZZA 1VRH1 2B8IA 2ET7A 4FJGA 5FLJA 4YARA 2NN8A 5A3LA 1IPKA 3VUOA 2ARAA 4YGEA 4UW3A 4UI9L 4MXVA 1X9TA 4LE3A 3QESA 5F7UA 2JJ6A 4G9SB 2XL9A 4J1WA 2PN5A 3GJAA 3POEA 3E6CC 1VRH2 2Y6JA 2TUNA 1LEDA 1IS3A 2FDGA 3N9PA 4Y1UA 4Q27A 1MEC3 4LOTA 1JXNA 5FZEA 2D44A 5LA2A 4CCLA 1FPN3 4CZSA 2MMBA 4XCAA 3JCIA 2QQVA 3VHNA 1GLHA 1IGOA 4UBGA 2XJRA 5FXXA 3GHNA 5L9VA 2FBEA 4HN1A 4CUAA 2P3JA 1PO12 2ZGOA 1XRUA 2E33A 3OPWA 4CCKA 4E4BA 4EP9A 1IKQA 1NOVA 2DUPA 3IIAA 4LKEA 5L9RA 2R1DA 2D6LX 3GZTB 2J1RA 3FHAA 2DCZA 4LT5A 1OUSA 3BOWA 1SPPA 2R072 4K8FA 3RG0A 5C3PA 5LCWL 1AR92 2P4EA 1TMF3 2VZPA 1MVQA 1WGPA 5JMCA 1OD5A 1E5SA 4JHTA 1R093 1UYZA 4FPGA 4SLIA 1V6KA 2DVDA 3ZVXA 4AAPA 4A4AA 2D6PA 2ZEZA 4WZCA 3VBSC 3BVOA 1H1AA 1RUD1 2A5ZA 3AZYA 4KI4A 2AR6A 4WVMB 2I07B 1PIV3 3KHBA 1O8PA 5FYCA 4GZ9A 3WHUA 4ET7A 2HWB1 3ZO0B 1R64A 2GP3A 2RCUA 2UYAA 2GP5A 5FZAA 4AQ2A 1LHOA 4XHBA 3RZMA 3I49A 1D7PM 4FPKA 1GQPA 4H7MA 3TL8B 4P9LA 4NIAA 1R1ZA 1UY0A 3NW4A 2XVKA 2JICA 3MF9A 1Y7BA 2BEOA 2D6KA 2R063 4QNCA 2VR4A 4QB2A 1F4HA 4DRRA 4M0HA 4XXAA 3HP9A 3ELNA 2ZZJA 1U0AA 3T2TA 1IS4A 1J1TA 1R083 2P5GA 2JIGA 5JIUA 4BH9A 3I3MA 2CL2A 1NG0A 3BU0A 4I30A 1XVBE 2HWE2 1R1A3 2BDRA 2VZSA 2K9ZA 4M01A 3NV3A 3AP4A 2K0GA 2K2SA 3Q8AA 3IBMA 5I8SA 4IEUA 4TLFA 4XDQA 2JQTA 1O3TA 1RUOA 2FDHA 4RHV1 2G9FA 2J1EA 1CD3G 4QX5A 4NVPA 1IS5A 4KI6A 4OMDA 2WUHA 2ENRA 4UFLA 2HEWF 1W3XA 2VQUA 3H8UA 2X10A 3CHXA 3N9OA 1ND2C 2BNOA 4P5HA 5CBLA 3AMQA 3TAGA 4NRPA 4ARYA 4BMBA 4IGQA 3U1XA 1MZ5A 4YNIA 3UL2A 2YPDA 3H7JA 1AUYA 4UW4A 3VZMA 1RMU3 1NA1B 4Q8KA 4XQ4A 1AR72 3VL8A 3TEWA 3BIEA 2R1BA 5M0TA 2JH8A 2TBVA 2I74A 1EUTA 4M3CE 3LSDA 4K21A 5E89A 1W9WA 1NAEA 1AYN2 2KR2A 5IVBA 2F17A 5L7OA 3ZSJA 3RWUA 2HEYF 3PMSA 2B5HA 1MS4A 2Z42A 3UGHA 1H2MA 2E26A 4P9IA 2JHCA 1GWLA 1ZRIA 4JKKA 2DVAA 4C90A 3IPVA 1NZCA 1OVPA 1NLQA 4B8EA 1WCDJ 1UX7A 4MSVA 3O1RA 2QDNA 3RZZA 3LEMA 1YUDA 4OZXA 4EJRA 4QXHA 2P34A 4P9XA 5FYBA 3JBG3 4V2WA 4CEWC 1XSQA 4FTEA 3U11A 4ZU4A 2XH6A 4FSJA 4CCJA 1REDA 1NX9A 2UY9A 5DABA 3QLQA 4Q4W3 1CAVB 5BNNB 5FPLA 3ZR6A 2QQNA 1BZWA 1G8WA 1YLLA 3VBHB 2WN2A 1JMUB 1H4HA 1VALA 1XOYA 2D6MA 4BQ5A 1GNHA 2G19A 2ZABA 3VBUC 4JS5A 2FW3A 4FJMA 2YGLA 4YW3A 1AYN1 1G9BA 1UZ0A 1ZRFA 1BEV1 1LHNA 2RG4A 3NAEA 1DU3D 2MEV1 3GXUA 1PZ8A 2P5BA 3THCA 1AR71 4HVQA 3WF1A 4LOSA 1W2TA 3ZXFA 3BPZA 5IK4A 1W9FA 3VHPA 4BXSV 5C4WC 4EWEA 5E1RA 3KF3A 3NDKA 3D5OA 1W8OA 3A23A 1XU5E 5A33A 1RVF1 4AZZA 1N3QA 4RN5A 1SG3A 1UD1A 3H7YA 4Q0UA 4Q0PA 1W04A 2Y0OA 3IM0A 4GULA 3O0WA 2H6CA 5A7NA 5ACA3 1Q8SA 4BQ2A 3MV11 1AJOA 1XE0A 3HQXA 5CKMA 3AMHA 1YNAA 2OQ6A 2VGDA 4K40A 4E4DX 4MADA 5K0UB 4WZFA 1Z0HA 2WNVA 4YM2A 1JZ8A 3ZPOA 2GC1A 3HN1A 4UFKA 5CVRA 5FK7A 5T5OA 1W28A 2UU8A 1PMJX 1LNSA 2KM2A 4CTEA 3J2PA 1EAH3 1JHNA 1NUKA 4P14A 2H6BA 3F95A 4GD4A 5KHJA 1XL3C 2BVBA 4PDWC 1QIQA 2GMEA 3SNMA 5JSRA 3H3UA 2RVAA 1RUG3 1W8HA 1ZBA2 2VPVA 2CY6A 3MV01 2QCSB 3MUZ1 3ZSMA 2HWB2 4CXXA 1E5HA 5A7WB 5FMOS 3ACGA 3BTYA 1N47A 4YW4A 2UURA 5BNOC 2NP0A 4JV4A 1XNDA 2HJIA 1FV3A 3POJA 1VBB2 4QKDA 2PHTA 3SEEA 5EPAA 3LDBA 3QEPA 4JTNA 3IWZA 4L9BA 3VKMA 2J1TA 1AYN3 2HWD1 2EIGA 1PM4A 4XFAA 3WNXA 3ZR5A 1AR91 1C8M1 4IW3A 1FZ9E 2R071 2A3YA 3NO8A 5FJHA 3WVJA 2WINB 4RYDA 4JGYB 3ENRA 5FP7A 2VE1A 1EP0A 3NL1A 1RJ8A 1BMV2 3L0MA 1VBC3 5DUWA 5A3UA 3RDIA 5KXEA 4A6OA 4QXBA 1PO11 2VC9A 1H30A 2BRTA 4TLGA 5A3OA 5JAXA 5EFUA 2WL1A 4Q4X1 2CAUA 2G1MA 1ZBE1 1FZ0E 4CU8A 3R4UA 5LZ6A 4AK3A 4PF1A 5FZ9A 2VBBA 1WW5A 1YHFA 4GAZA 3WDYA 3K75B 4PJYA 4RQPB 1FI2A 5CNAA 1V6IA 2ZGTA 3ACLA 2VMCA 2WC2A 3K3NA 4UWDA 1EYBA 1HRI3 2VMGA 1LOBA 2VD7A 1TEIA 1X50A 2VOVA 3J9SA 1U5ZA 1JZ3A 3JZVA 1ST8A 1OQ1A 2AEYA 4EZ4A 2ZTNA 4FQZA 3CNAA 3WOGA 2B45X 1IPSA 1YFUA 2EAAA 4A3XA 2PLV3 4CEYA 1QXRA 1RUJ1 3AVSA 1X8EA 2HBTA 3GZAA 3ILRA 4HOOA 4DY5A 4D94A 3O1UA 4H14A 5DDJ1 1RYYA 3N9NA 4TTGA 3BTXA 2Y34A 4Q1RA 1GV9A 1RITA 4Z2AA 2W1WA 2PHUA 2ARXA 3PJQA 4Z82A 1X36A 1SHWB 5BY5A 1POV3 3V64A 1FS1A 1OUXA 4HLTA 4PI0A 4GWMA 2QZ3A 3IDCB 3OGJA 3S0MA 4DY3A 2ATQA 4XF4A 4AEMA 5LY2A 2XVLA 3GCXA 4F8AA 5KHKA 1DG6A 3LD8A 2VVEA 3OJBA 4UFHA 4RA0A 2DTYA 1MQTC 3FLTA 1HB3A 5I8TA 3ZFGC 5FDBA 2JG9B 3T4VA 5FZ1A 5K9YA 3MICA 2FCTA 4Q4V1 2V09A 4QPGA 3VD3A 1L7RA 3HJRA 3QEWA 3BI3A 3AXDA 4K8RB 1VB4A 1CZSA 1TNFA 2WNUA 2ZGKA 2ZAAA 3AP6A 3J8F3 4XFGA 3MI8A 3LDSA 1JTZX 2X5IB 1KFXL 5FP9A 1PVC3 4AGGA 3OGKB 1UNBA 1J3RA 1DDLA 5EHDA 2LUWA 1LB2A 3N1BA 3HWJA 3LKJA 2XHNA 1OQDA 4COYA 2IFWA 4OQ9A 2DTWA 1QH7A 4M41A 3A21A 3DCQA 1LULA 5LEJA 1FOD2 3FWEA 4XF9A 5A3NA 3RS6A 2HD0A 2VO5A 1OOPB 1HLCA 5AC92 3SH4A 2W9XA 1RB8G 4LBQD 2P6HA 3VDDB 3OUHA 3IT8A 1Z7S3 3HQUA 3LEGA 5A1AA 3SPZA 1R1A1 2QQJA 1DQ0A 4AI6A 1U5XA 4LA2A 5FPZA 3U4XA 1SEFA 4WM8A 2OZJA 2WZPP 4OQ8A 1O3SA 4DS0A 1AR93 1NA1C 1LODA 1LR5A 1PK6C 4XJ9A 4ZZ5A 3HNMA 3GZUC 1PNFA 1ND2B 2VVDA 3IZOA 2E53A 2Z4FA 4JGYA 3OGLB 1JI6A 2R041 3DV8A 3IMNA 1VMJA 3LFIA 3N7LA 3S7IA 5C8CA 1GOHA 1S2KA 2WSUA 4MHRA 3ZMNA 3ETQA 2Q30A 4EN9B 2PAMA 4XDPA 1S0CA 4QQPA 3TAYA 2XJTA 3ZFEC 4MV2A 5F3IA 3LSEA 2FZ1A 1KQRA 4W6WA 4AHZA 4QGNA 1WLTA 2RDNA 3O1SA 4XETA 1UZWA 2LALA 5DUXA 3I3BA 3PVEA 3GM8A 5D2AA 3ZFGB 1YJKA 3N35A 4C0HA 1UCXA 3BGAA 4JZRA 1ASJ2 2Q5TA 4QX7A 4CDWB 5C3SA 1AF9A 1JUHA 5A1LA 4HXCA 4SBVA 2R061 2V72A 3ITQA 3HL8A 3K4DA 2YFUA 3QERA 1R1A2 4GAMC 3ASIA 3MGUA 4YWAA 1JN2P 5DAXA 5A3MA 1K5JA 1ULGA 5JOZA 4V1PA 1JU4A 4DTMA 2ZMLA 1PO23 5DAQA 2ZJCA 3ZFFC 1B09A 2Q4SA 1W6OB 3VV1A 5C5TA 5C5UA 5EJZB 3P1IA 2DU0A 4Q4X2 4DFSA 1B35C 4PDWA 2RM23 2BWAA 5CFDB 5KHHA 5BXXA 1LCLA 4MGKE 3ZN6A 5JZGC 5JZGA 4DU3A 1FPN1 1O4YA 1QWRA 4P9YA 3R4DB 4ZHNA 3VDDA 2PHRA 5FP3A 1UZZA 4E4ZA 2OX0A 1WAJA 2RDRA 4MH0E 1BYHA 4AHWA 2IXJA 2QKDA 2WO3A 2Y6LA 4H7LA 4ISQA 2W08A 3JB8A 4FJXA 4PQQA 2VQ0A 4IV1C 3FUOA 5APAA 3H8RA 2DFBA 4M3CB 1XMHE 1KS4A 3IB3A 3Q9OA 2JDMA 3ZYBA 3SCXA 1ZRRA 2LF3A 2ERFA 3C7EA 4Y33A 5FK8A 1K3IA 2EA7A 4RS5A 4Q4Y1 5FREA 3FMGA 3MFAA 2FDFA 4UBHA 1OLQA 2VNOA 1NE6A 4I6JB 4CP2A 5JXIA 3GCWA 3JD71 3LPGA 4Y1YA 3NNLA 4BE3A 5LBCA 1BCXA 4K1ZA 2OZSA 3B9IA 2UYBA 3QEXA 2BW8A 5FZCA 3PDQA 1OA3A 3VBUA 3LAGA 3OPZA 4O65A 3SQ0A 1HQLA 3ZXEA 1QJFA 2EXHA 4LK7A 1DZTA 3RQ0A 4QPYA 1YYNA 1VAMA 1HRV2 3AL5A 5H9PA 3TAFA 3FE5A 5IAVA 2QQOA 4QPGB 4H2AA 4LULA 2D3RA 4C91A 4LORA 1LGNA 2FMDA 4L97A 1ZZ8A 3FC0A 1L7LA 4IE4A 3ZYGA 2B42B 2E7AA 3OBZA 1OPMA 4Q5OA 1H6YA 1LHVA 4L2NA 1ZBE3 1N1YA 4QPIB 1WCSA 2MNGA 3OGRA 2RJ2A 3B3QE 1CPMA 1XSRA 3MUY1 1VB2A 4IE7A 5KWRA 1O8SA 2GAUA 3WCSA 3BKZA 3USUA 3EXUA 2DTUA 3I59B 5FXWA 2GDFA 4FJLA 3KD1E 1H2NA 2BFUL 2D97A 2YG0A 2ZOEB 4S2GA 5FY4A 3SUQA 3N9QA 4FTSA 2Y33A 3KMHA 3WQ7A 3PTYA 1I1EA 3WW3A 2VMIA 5CIRA 5FZOA 3B00A 4PI2A 1UZYA 4GWNA 3KD5E 3THTA 4KH9A 5DZGA 3ME2A 4B3NA 3CZUA 4YZ4A 4PQ9A 5T54A 2NMOA 3RWKX 1QEXA 2VXRA 2WLQA 2DURA 4NRQA 1URXA 4LITA 1EAH2 4OZOA 4QKBA 4AW7A 2Z69A 2ZHMA 1J83A 1GQGA 2BOJA 4CDWA 3CFPA 1L7QA 3KVAA 4CDXB 2Y0IA 3ZYRA 3QEVA 3H1YA 2J22A 5DZFA 4D0QA 4DTNA 4XUTA 5HCAA 4ZS2A 5JZGB 1XVGE 1FYUA 2VBPA 3LDKA 1I9RA 2ZGQA 4BQ4A 5GLUA 1LGBA 2R0FA 1CPNA 5IVYA 5BNPA 5J7MA 5E6HA 3RFRA 5KBFA 2J1SA 3BUCA 2WDBA 4NE9A 5I91A 1NLSA 1IHMA 2QVSB 4MVTA 5IUQA 3X29B 2X8KA 5IREA 3M2MA 2J1AA 5K0UA 1QU0A 2BERA 4UW6A 1VBC1 1V00A 5FRAA 4JCKA 4S2HA 2GN7A 3AL6A 4I0AA 4LBJA 4Q0QA 4D8MA 3PHMA 1VBC2 2VZ1A 3GF6A 4DIQA 1VBE3 1WZXA 5FWEA 5CISA 2G4IA 1UL9A 5J3UA 4QHOA 1DQ5A 5CADA 1YCIA 5T55A 1NQJA 2WAOA 4AR2A 1Q5OA 4NWWA 3LEKA 5FZ3A 2ZKNA 4OUEA 5FY8A 5HXVA 5A33B 1WBFA 4P9JA 4M3UA 4E8CA 2R32A 1EUUA 4YLZA 4XFCA 4FJNA 4MHUA 3OUJA 4NPMA 4PCRA 2P1OB 1YRZA 4X6QB 1DYPA 1YIFA 3TBDA 1AXYA 1VAVA 2ZEWA 2Q1ZB 2BOIA 3QCWA 3HMYA 4N53C 1HRV3 5C8CB 1VIWB 3EJKA 5F5QA 3BALA 5LASA 2A1XA 2XKPA 4B1MA 1G9DA 3K51A 4GALA 4BK4A 2WFF3 1DFQA 1EAH1 3GGLA 4CEWA 2OYQA 1J3QA 1FYZE 2WS92 4QM9A 3VBOB 2VMFA 5IJRA 1H2KA 3FBMA 3L2HA 1N1VA 2BZDA 4JKLA 2G9GA 3RNSA 5I0DA 2YU2A 4YG3A 2K5SA 3C8XA 3VBUB 2HWC3 2PXJA 2Y6FA 4EN7B 1X8MA 4AE2A 2E9QA 3WY6A 3ABZA 2A6VA 4AG4A 1F31A 4BQWA 2ZXQA 1NCQC 5KC5A 3NE6A 2VCBA 4MGYE 2PMWB 2RJLA 4AI2A 3FL7A 1V0AA 1TZOA 3LB9A 2PAKA 4PBPA 4U36A 5FLIA 4BIOA 3SQ1A 1QXPA 5EZWA 3AKQA 3KF5A 4OULA 3AZVA 3DECA 3UESA 2W94A 1XMFE 4R9DA 1UYPA 4LTAA 4RS5B 5LK5A 4CYDA 5B4NA 5GZCA 1ZZ7A 3NJXA 2ETEA 3OGMB 3DYOA 1XBFA 4I09A 5FPVA 5GLWA 3W59A 2WZR1 3VDCA 4CEYC 5J09A 3APBA 4CUCA 2WN3A 2WJSA 1Y9GA 2YC2A 5A7QA 1XVCE 4GKXA 4OUSA 3N7JA 4LBKA 2VNVA 5FMOL 1Q9XA 4BQ3A 3PVNA 2BGOA 3WR0A 2B9UA 4W8JA 3UIQA 4P9WA 2BUKA 3WXPA 2TNFA 1QMJA 5K4LA 1FOD3 3MIDA 5DG1A 1MEC2 3CU7A 4M3CF 3UV9A 4M4RA 4GJYA 1ULEA 3C6NB 1TVGA 5F2WA 3LFMA 3POGA 1LOEA 2V73A 4FOWA 2A71A 1TME1 3D6EA 3ACFA 1ZNPA 1NEXB 4XTMA 4HKLA 2NMNA 4AVCA 2VTXJ 3BODA 3I2IA 4JHZA 3MDPA 1CGPA 1VJ2A 3OY8B 2Y6HA 4QGLA 1FZ4E 3MYXA 2IC1A 3PLQA 5IFPA 3DN7A 1GNZA 4QD2A 2GC2A 1FZ3E 4HVRA 5FZMA 4KBBA 4KHNA 3KM5A 2TEPA 1LEMA 1WUVA 2WNUC 4GIQA 4Q0VA 1SFPA 3M7AA 5KHGA 1TMF2 3H9AA 4S2DA 5DPNA 5FUPA 2QBXA 2JDYA 2D43A 5F3GA 3WF4A 3HQRA 3WT3A 2ZEXA 5CU1A 3B94A 2WO2A 3O0VA 4FOVA 1GWKA 2Z5WA 1NLRA 4AVTA 1O3RA 5LATA 5I8YA 3NQHA 4ASMB 1IG9A 3ZN6B 1QJEA 1ASJ3 2JD9A 3DF0A 4DXZA 5IVFA 2DUQA 3LF7A 1CVNA 4W4ZA 4IV1A 1J58A 2C4XA 2GMMA 1APNA 4N43C 2VVFA 4FPCA 4XW3A 3J7NA 4AKGA 2HWD3 3AKRA 2BGPA 2UWCA 5FZOB 2ZHKA 3RSJA 5LBFA 4XMAA 1PO22 1GP6A 2WNOA 5FYZA 3ZLIA 2H0VA 5F32A 4COVA 2VJXA 1SQ4A 1S0DA 2XHKA 2F4LA 3WINE 3SITA 3USUB 2WQ8A 1QY4A 4FJ9A 1TE1B 2A6WA 4IETA 2G9ZA 3MLJA 3ACHA 4PLOA 3FJSA 3V65A 4LO8A 1LESA 3PUAA 4PIZA 5FFOC 2VZ3A 5FKBA 5FZIA 2A3XA 2WLPA 3I7DA 1W6QB 4KHQA 4QU1A 4OLLA 1D2SA 1XYNA 1QXJA 5BNPC 5FZ4A 4ICGC 1GOFA 1N3OA 5A7SA 1GZ9A 5J98B 4XZUG 2PLV2 1O4ZA 4XIKA 1Q8OA 1AYM2 5FO8B 1DQ6A 3M3CA 5FPUA 1CWPA 3I97A 1NT0A 2FDJA 5I0TA 2DCKA 2I45A 4B4QA 1BBT3 4IT5A 4XILA 4LHSA 1YC61 3NSTA 4QKNA 4QWNA 5LA0A 4ZZ8A 1V6OA 3E5XA 4XUNA 1ND2A 2P1QB 1SLLA 4YZ1A 3WG4A 1Q56A 3LZIA 1BJQA 1CIWA 2JXAA 3IIIA 4B1LA 1UY2A 3ZXLA 1SFYA 4FT8A 2E6VA 1FMD1 1W2UA 2YPJA 5F5IA 4X6RB 1BK1A 2OA2A 1RUD3 2JDUA 3URFA 5JXJA 5FLHA 3OUIA 4DUXA 3RMBA 2VW1A 3SCHA 2FYOA 4AFAA 4HKWA 1JUIA 2P37A 2EIEA 4V2VA 4WM7C 2GNMA 4MX3A 4RR3B 3WZ1A 4N43B 2WABA 2VH9A 3J8F2 3WDVA 4WVZA 1MS9A 4NPLA 1YFYA 2JE8A 5EJ3A 2VQTA 4AVVA 2R30A 3R6SA 5CFCA 1KRIA 2ZZQA 4BMEA 2JH9A 4NIGA 1AR82 1UF2C 4DTOA 3K77A 4YW1A 3WF0A 4KWJA 2ARCA 4O7XA 2PHXA 3HR9A 4GB32 3SH3A 1HV0A 1X7NA 3QEIA 5BNQA 2YROA 1OH3A 1UU5A 2ZGRA 4QQOA 2YYOA 2PELA 1JOPA 1ZX5A 3SUPA 1BHGA 3AYEA 1SLBA 2QQLA 4HZFA 5FZBA 1MZEA 3AMNA 3ZYFA 2P1NB 5L19A 3O1PA 3MO4A 1CONA 4RQPC 1UU6A 2DU1A 2GU9A 3OD0A 1VBD2 4E2QA 1GQHA 1SDDB 1C1FA 1Y4WA 1FPOA 4ZS3A 5FO7B 4MGTA 3CKHA 2H4TA 3NHGA 4LNVA 1I3HA 1HB2A 4DTUA 2XONA 3LPFA 3MIBA 3DEMA 4R4XA 2X09A 5ISLA 1NCQA 2HBUA 3K48A 5L73A 5JIAA 3MPBA 3RRDA 2DYCA 2VBDA 4E2SA 2E7TA 4I9QA 4ISRA 1W8UA 4XF0A 1N1SA 1ASJ1 3WW1A 3QNNA 5FZ7A 2MW2A 4DTPA 3AVRA 1D0GA 1NCRC 1AHSA 1BXHA 3JXSA 4JGZA 5FZ0A 4BQYA 4CCMA 5FMCA 3DXTA 4CDQA 4NRMA 2CYFA 2ID4A 4EQVA 1LOFA 3S57A 4IEXA 2J1UA 2EXIA 1CESA 4WBBA 1C5HA 4LKSA 4W65A 4IV1B 4M3TA 1SDWA 3PUHA 3RMYA 3RYPA 5J96B 2ZGLA 3C95A 1IQAA 1H8VA 1REFA 2QE3A 3BYWA 3D82A 4UFIA 4XBNA 5C9AA 4CU7A 5T52A 3HD8B 3NRUA 1SCSA 1XB9A 3HBKA 3T08A 2QZ2A 1N1CA 1QNYA 2XBO3 2JE9A 2Q1FA 1OH4A 5DDJ3 3GDBA 2JG9C 3PNAA 1NA1A 4LUMA 4A45A 2Y8KA 1AYM1 2RS33 1XXNA 2YGMA 5L36A 5LA1A 1H2LA 3SXWA 1MACA 2DEBA 1ZA7A 3E4YA 5FYMA 3VHRA 1FV2A 4Q4W1 4G3YC 4URTA 2RS53 2ZHLA 1K5MC 2BJSA 5FY5A 5FYTA 1HDKA 5A32A 4IV3A 1ULOA 4META 4EPHA 4FXGB 1Q9YA 1HN0A 1W6PB 3DL3A 3ZFEA 3E5QA 3LOBA 3OY8A 5A3WA 1UKGA 1VBA3 4BXFA 1BBT2 4RG8A 1YO8A 1ZA4A 1F5FA 2W1UA 3EYPA 3OB8A 4JDOA 4LQRA 4WM8B 4BPZA 1JYNA 5GLTA 2O14A 2YDEA 4JX0A 3T2PA 3KGLA 2AC1A 3J7HA 2QXFA 2VZUA 5J1XA 1BQPA 1AVBA 2KXLA 2WZR3 2XJVA 4LBOA 4B7EA 4QU2A 2B7MA 1T2XA 4MGZE 1AR81 1ENXA 1RGSA 4YRDA 2A75A 4K20A 1DQ4A 4QX8A 4R9BA 2IUWA 4IE0A 4JAAA 1D4M3 1SMVA 3R05A 5GLZA 1FZ2E 1NCRB 2CWMA 5C8WA 2RS13 3MBWA 3O1TA 3AX4A 3RJ2X 1IQDC 1QGLA 2VNGA 3HOBA 1W9SA 2XJQA 4LO6B 4R9CA 3RI8A 1DF0A 4HBNA 1BK0A 1RUI3 2HYKA 4RL5A 2JDKA 4QKFA 4AI0A 1ND3C 1OFNA 1R081 3POFA 4YZ3A 3TB0A 1S2EA 4PT6A 4M3WA 1TMF1 2KA3A 1FXXA 4FJ7A 5F8PA 3S5AA 2BNNA 1OKQA 4LBMA 3TAEA 1UQXA 3KT7A 2WRAA 5AVPA 5FZGA 3HNYM 1K5MB 1SACA 1PX4A 2JPNA 1UAIA 4OHVA 4MLOA 2PAEA 4CUGA 1PGL1 5BUVA 1BVVA 1FZ7E 2XG3A 2Z79A 4KGQA 4YVSA 2ZGSA 1HXS3 1DQ2A 2XBO1 1VBD3 3G7DA 4INDA 4LEJA 3H50A 4ITCA 1V6LA 2SBAA 1EPWA 2OXBA 3EQEA 3LZZA 4PIXA 4PLNA 3ZOIA 4YM0A 4BB3A 1ZRDA 4GB33 1Q8QA 4JDNA 4R8HA 2VCAA 1Q43A 3M1HA 4I0WB 4DMIA 3WP6A 2W52A 1XYOA 2JHAA 4XPVA 4Z07A 1JOBA 1ONAA 2AYHA 3HT1A 1GNYA 1O5UA 2HEVF 4CCCA 1PX3A 3FZ3A 1F15A 1ZBE2 1IG0A 2W92A 1OA4A 2XWBB 2A3WA 2ZACA 3R0RA 4X5MA 2VOTA 4I9LA 4YYOA 2Q0AA 1VRH3 3EMRA 3ZMOA 3FN9A 5F37A 1QOTA 1OF4A 4Q29A 5FBJA 4YVWA 4CDUA 1XVFE 3JQXA 2C9AA 2GH2A 2MPFA 4LHLA 4Y26A 5T50A 4GKYA 4OHZA 2WT2A 1WW7A 3GALA 4RD7A 3I54A 2YFZA 2ZX4A 1ULCA 5T3NA 5L9BA 5BV6A 1M4WA 1X33A 4DZGA 4TZDA 1A8DA 4AVAA 1I5PA 1PK6B 2JDHA 1KEXA 2OIIA 1JW6A 2VU9A 3AXEA 4YW2A 1PGSA 5A3TA 4NN0A 2VCCA 3OBAA 4NR1A 5FJKA 1P22A 1FX5A 1H8TB 1ND3B 1RUG1 1VBB1 2RS32 4JKMA 1WLWA 4WV8A 4AF9A 3SUOA 3POYA 1PGW1 1F4AA 3NV2A 3OPTA 2WWUA 4NO4A 1W2NA 1UO9A 2ZGMA 2JD4A 3U4SA 3LEIA 3M4FA 1W8ZA 4XFIA 1F35A 3MF6A 3ZYPA 2ORXA 1W6NB 3KSCA 2FQPA 1ZBA1 3WDXA 1ULDA 1HB1A 2P6CA 4AFDA 1SCRA 3I4IA 4QX1A 5LWBA 3EB7A 4RQPA 4X5NA 3U10A 2CSGA 1ZZCA 3N3HA 5JR2A 1W0OA 4YGCA 2QQIA 1YFWA 3OBTA 4BU2A 1MS0A 5C4WA 3PIJA 2B8MA 5IW0A 3VBFC 5C9AC 3RYKA 2JDZA 3FFZA 4DEQA 5CFCB 4HVOA 4KU7A 3LA2A 4E4HA 5KXDA 3OYWA 1I5ZA 4WM8C 1GZWA 2GALA 1AXKA 3KWVA 3VBSA 3ZIXA 3IDBB 1YWKA 2A6XA 4FVMA 3GBFA 2P1PB 1ZZ6A 4HK9A 2Q8OA 3T09A 3OCPA 3T0DA 5IZ7A 2BNMA 1LRHA 2QQUA 3SUNA 1UPSA 1W6OA 2DCJA 3BVCA 4D6QA 4K6BA 2FCUA 2RJKA 1RUC2 1CR7A 5A6XA 4X8PA 3S30A 1WD3A 5EQUA 4XABA 4XFFA 2EIBA 3AMMA 3BPSA 4AAXA 3TNPB 1T6GC 4WM7B 2AH2A 4JRPA 5EJ1B 2VM9A 4H55A 1YFXA 2WZR2 4J2DA 1SLAA 4XE9A 3VD4A 1S4CA 3H0OA 1SLTA 2VCMA 1WCKA 4I3PA 4Q4V3 1W8TA 5LB6A 3C6PB 3TN92 3TEZA 4RHV2 5A7WA 3V56A 1S55A 5JPMB 3VKFC 1Q3EA 4DRVA 1XU1A 3U37A 5A6ZA 3KHCA 5IVJA 2SLIA 5LRSA 4GWJA 1ACCA 2CTVA 3M3IA 3MEPA 4QDSA 3Q8CA 4AKHA 4YFZA 5BNOA 4FJ8A 2QQWA 1CIYA 4LMFA 4U2AA 4HPKB 3B7MA 2WFF2 4FPHA 5AVAA 2D40A 5F2SA 1JODA 4CP0A 5C33A 2FDKA 2QTWB 4ADNA 1AR62 4N7IA 1VPHA 3PU3A 1FATA 5F39A 4HSJA 4Y5Z0 2VZTA 3D0JA 4NIIA 3T3YA 3D4KA 2C26A 4BA6A 3INAA 5F3CA 4XZPA 3ZM8A 2HYXA 4OUMA 4CE8A 2P1MB 5BPXA 4QB6A 1YQ8A 4Y24A 3VHOA 2WT1A 3WQBA 2PA7A 2XVGA 2RMU2 1RUD2 2RV9A 4PIYA 3VZJA 3KV6A 4YGDA 4CDQC 3L2OB 1UW8A 5IYYA 1AYM3 2RS31 2VZRA 4IEOA 4L8QA 2E31A 1F9KA 5BNPB 1S0JA 3UJOA 1A3KA 2OPKA 3RPQA 1CJDA 3AJYA 3CLPA 3AZWA 4BQXA 1RMU1 1LAJA 4I2OA 4XUPA 4P5YA 2QDRA 5D8AC 4M0NA 3VLBB 1UN1A 3HEIA 5BYNA 3N36A 4M3XA 4A41A 3Q8EA 1RTVA 2WA4A 3RMAA 4A3ZA 5KR7A 4XXPA 1O4TA 1HN1A 3AC0A 4FCAA 1COV1 1XNKA 4N90A 3FHQA 3ZXAC 1QF3A 1WCQA 5L7OB 1BLZA 2PYTA 3OTFA 3OGVA 2K46A 1MMOG 4Y20A 2E7QA 4URAA 4JRLA 1G9CA 3W58A 5A32B 1W6MB 3J7MA 4DNYA 5IK5A 1FMD3 4EE2A 3WQ0A 1OURA 4K3UA 3V0AB 1H8TC 1QJX1 4BYYA 3D3AA 2OYZA 5IHRA 2BP6A 3ZYIB 1FZ1E 5JDBA 1RUE3 5C8CC 4HCCA 5J36A 4FQ4A 4CCNA 3JB4C 4FAGA 1WAFA 3ZN4A 4I02A 1MQTA 4BM8A 4GJZA 2C0ZA 2ZMNA 3OGGA 5ACA2 4RGKA 3L8BA 1EPZA 5JOWA 4NAOA 2XL7A 1ZBA3 4I01A 4A7KA 1A8MA 5GLVA 1QQP2 1RUH1 3IAQA 1LHUA 1OLME 3MLLA 2R073 4ZONA 4AYUA 1PVXA 3DKQA 5CG8A 1GZCA 1WW6A 1HIXA 3B02A 5F5AA 2E51A 3BTZA 4FK4A 3ES4A 4BIFA 3P3NA 2JKXA 2B46X 2CDOA 3H3LA 1GP4A 3AYAA 5D8AB 4NIDA 1OXCA 3NNMA 2JDAA 5F9TA 3QNOA 3ZSKA 1XNAA 2MEV3 1YQ2A 1JZ7A 4ONUA 4XCBA 2WNVC 3UKNA 4DQAA 4XVHA 4K7JA 1DGRA 1DGWA 1F5JA 3NNFA 4XJAA 3ECQA 3MPPG 4N43A 4W50A 5T5JA 3SMHA 4CUBA 3MZHA 1DLCA 4LXLA 4P08A 3SISA 1O91A 3RZHA 2YB5A 3ILNA 2OUHA 1NXD1 4KWLA 1QJU2 2VJ4A 2OZMA 4FK2A 1A6CA 3NKTA 4OHXA 1AR63 4Y20B 4CRQA 4E8DA 4EN8B 4MG2A 4WVWA 1OA2A 4CEWB 4BHPA 1D0HA 1FXZA 1UZVA 2YC4A 4IEZA 4XTPA 4LKDA 1QQP1 1OLMA 3C6OB 4O61A 1NQDA 3I2GA 4F7ZA 4IEQA 4QX0A 3WEZA 4N9HA 4XUQA 2VMDA 2YZ4A 5DAVA 5FTTC 4XC9A 1LU1A 4UF0B 4LO5B 2IVJA 2QQMA 1Y43B 2LRPA 2YBKA 5ANNA 1MPXA 4YW6A 2DY4A 1STMA 3FFQA 2QFEA 4IE6A 4W6YA 4FK0A 3AB0A 2R062 4XJWA 4L92A 4R52A 1XNBA 1Y9QA 3UT0A 1IG3A 2EF6A 3QBQA 1QJX2 4YW7A 4AGVA 2KD7A 3D0SA 1VBA2 1O5LA 2W95A 4QXKA 1LHWA 1ZRCA 2OZ6A 4FPYA 5HBAA 1TME3 2UWAA 3B93A 4Z8BA 2WNUB 3N9LA 2BGCA 1G7YA 2L9LA 2C24A 2VUJA 1MZ6A 2ZAHA 4WVMA 4XQWA 2XPJA 1XVDE 1REEA 3I8TA 4Q8LA 3NAPB 3C7OA 3U78A 5ABJA 1GR3A 1RUI1 5CFDA 1PHMA 4Y1VA 3THDA 1DGLA 2P1BA 5FY7A 5JPNB 1JU3A 3WDUA 2RDSA 3AFGA 1YQ5A 2R042 2OVUA 2IZWA 4TXWA 3BB6A 2OVQB 2Y6KA 3ZYHA 2VL4A 5BNOB 1RMU2 4AHXA 3QOPA 3FLPA 4P02B 2B9VA 2XOMA 4HPKA 1BKZA 4BOWA 2DVGA 2ARBA 2XDVA 5F6KA 4XURA 5GKAC 5L7OC 1S0BA 2VNRA 2VZQA 4CA9A 1T6BX 2WKKA 5K7PA 3ZFGA 1PVC2 3NNGA 1UU4A 3PU8A 3A4UA 2P3YA 1RXFA 1E57A 1UMIA 1E5RA 2WQ4A 5DUUA 2PHDA 2D6OX 2IWGB 2RMU1 1FOD1 4AGRA 3SPYA 4CEYB 5I0SA 1OQEA 3IPVB 1Z78A 3T2OA 1MHZG 2A70A 4UFJA 2HWC2 3B5LB 3USSA 2C6SA 5A70A 1W03A 4DTRA 3ZXDA 4CDXC 4JRQA 2C5DA 2FCVA 4M45A 1UMZA 2DVFA 3BU7A 3IKWA 4IERA 2WO7A 4QXCA 4F3JA 4BJ0A 2PFTA 4E27A 1HKDA 3LA7A 1HXS2 4HKOA 4NOTA 3T0BA 2PHFA 3MKSB 2OW4A 5K8SA 1JW2A 5JSPA 3S6PA 2Y6GA 2WFF1 4FVVA 4IDZA 1GZWB 1PIV1 1OLRA 4XHXA 1IH7A 1H6XA 3HNBM 2HH9A 2VW0A 1US2A 2NQYA 1DGRN 1PK6A 3GBGA 3I59A 1K12A 3LCPA 4FFGA 4O9GA 2VY0A 5DN2A 3VKLA 5AC93 3PURA 5D8AA 3WUDA 2AREA 5GJ6A 5C4WB 1Z7S2 2D5FA 3IDEA 4IESA 5A1FA 3TN91 1LECA 2GMPA 4LBNA 3WNKA 1QNWA 3T0AA 4XBQA 4CU9A 4IQPA 3JQWA 1GU3A 4HL0A 1PNGA 3J27A 2JEMA 2R7EB 1SBDA 3FBYA 1VLNA 3QETA 1WWYA 3ZN5A 2V5YA 4GH4A 3B69A 2JE7A 2FDIA 3UJQA 4AVSA 1EV11 1NY72 3LIHA 1W39A 4Y4RA 5JVVA 5CB7A 3VGIA 2BBAA 2VTXA 2O1QA 4MGSA 4EWDA 1RUJ2 1HRI1 2RR12 3CEWA 3QD6A 4QPIC 1XJAA 3ZKYA 1TNRA 2ZGPA 3OOXA 4XFBA 3SKVA 4EN0A 1Y9MA 1RUC1 1KDKA 1VBE1 4JQTA 4QQ2A 5CZKA 4E9KA 3N4MA 1H8TA 2JB8A 2JX9A 3I2DA 1O3QA 2D93A 4E2GA 4X8NA 4KHWA 4FP3A 1LENA 3GHMA 2DCTA 3CFRA 4RSUA 5FIXA 3RZGA 4QX2A 3PUQA 3W5NA 1C8NA 3U0ZA 5FYHA 4Y3OA 1DP0A 1W99A 4PDWB 1CAWB 2YUEA 3GNEA 3WSOA 5FZHA 3ZSEA 1UIKA 1G86A 1B35B 1C57A 2HWF2 4UOJA 1FNYA 1WLCA 4N9IA 2JB4A 4ZY9A 5BNNC 4MGQA 2LW8A 4DXSA 5C70A 1SLIA 4LJHA 2XJPA 4QQLA 5DAWA 2EICA 4OI0A 1PO21 1QOSA 2B4KA 1UX6A 1AL0G 5A6YA 1GMMA 1EV13 3FUQA 3ZPYA 4YFWA 4BLJA 5C3QA 3IAPA 3UO3A 2Y26A 5FXZA 2FZ2A 4Q0SA 2CNAA 3SH5A 3CZJA 1DIWA 5FQ0A 1WMDA 1DCSA 3CFOA 1V6NA 4UYBA 1UPIA 1C8M2 1JH5A 4Q4V2 4M3CA 2HWD2 2W46A 3ZIWA 1RUG2 3P5BA 4AEJA 1NYWA 1QJX3 3DYPA 3VBFA 2CV6A 4M3RA 2RE9A 3J4UH 3PUSA 5FUIA 2GNTA 4N7UA 4W6XA 4O9EA 4LR4A 3TJYA 1CAUA 3UYJA 3VDAA 1ODMA 4GQ7A 2WWJA 2RS11 5SV5A 4DO0A 3CQ8A 4NAMA 4TWTA 5FPAA 3PUIA 1JYVA 1W8NA 2LM3A 2I2SA 4UAPA 2ILMA 4CPBA 1RC6A 1KS5A 4HSLA 3H8XA 3MHZA 4XMIA 5HCBA 3A0NA 4FOYA 3KCYA 2Q8CA 2R0HA 3UETA 3EBRA 1FZHE 4J6GA 2R043 2D3PA 2W0XA 1FZ6E 4FPLA 3A7QA 1RJ7A 4J2BA 3H3ZA 2LTNA 3SHRA 1AL21 1WBLA 1K42A 3ILFA 3ZDVA 1XC6A 1AJKA 2PHWA 3T1LA 5LEKA 2JECA 4YVSC 3QH6A 4AQTA 3D8CA 3N1EA 2LS6A 3KVBA 3GZEA 3N7KA 1MZFA 1Y3TA 1U12A 2AZ5A 4FFIA 3I3QA 4OCTA 5EYYA 3WNMA 4Z1VA 5HI0A 1LOGA 3ZYJB 4XBLA 4D7TA 4GA9A 1YI9A 4ATFA 4MYEA 1DQ1A 3TEXA 5CYYA 3VDBA 3J26N 1GFF2 4HANA 5DXDA 3SNNA 1PGL2 1A78A 4XFHA 2GN3A 1HRI2 4LBQA 3H42B 1AL22 1DGWX 2CU5A 1RVF2 3HIFA 3MW4A 3SCFA 4XAEA 4AEDC 4OI4A 5CFDC 4DTXA 2VMHA 3AZXA 2EAKA 2W1QA 4CVUA 3AP7A 4AHYA 2BU9A 1WKYA 2XXZA 3LGRA 3RJRA 4J2EA 3DPRB 4JRAA 4UW5A 3DYMA 1Q8VA 2BVVA 3MIHA 4FPFA 2B39A 3W5MA 4IV3B 4NMIA 5FZ8A 3SC7X 1GANA 1VAKA 5B4XA 1BMV1 1S0FA 1BEV2 2UY8A 5TSWA 1JYTA 4PHZA 1W6PA 3RVHA 3ZFEB 1FZ5E 2WZEA 4IGPA 1Q8PA 3GYDA 5F3EA 2WZ8A 1CLQA 5CG9A 1XU2A 4OI2A 3CJIB 3ETPA 1PO13 4KHUA 4AEDB 2WR9A 3UKVA 1E5IA 1RHI1 2QUOA 1H9PA 2O8OA 1TG7A 3OEBA 2JG8A 4P00B 5ANQA 4XQDA 3OYWB 2XJUA 4KHSA 3O5SA 3O12A 4XJ8A 1HW5A 3OG2A 4MUVA 2EIDA 2WAAA 1UXZA 2DBIA 2R16A 2IXHA 3LIGA 3HT2A 5C9AB 3UGGA 3WF2A 1RINA 1US3A 2EVXA 4C8DA 5I0UA 1UMHA 3MW2A 1ZZBA 2QJVA 1C1LA 3S7EA 4AFCA 4QNDA 4CCOA 4KMQA 5FMBA 2OKXA 5FYSA 2GZWA 1L3JA 1GBGA 1OFSA 1CZTA 1PZ7A 3UNPA 4UF0A 4Y5TA 4B7KA 1F8VA 3NKGA 1QQP3 1CAXA 3NJYA 5GZEA 5A6QA 1ZYBA 3CL1A 2XLFA 1KITA 5DG2A 3RZLA 2BWCA 4J2AA 4F83A 4RNGA 1ULPA 1VRBA 4LBLA 5IWFA 5JUVA 2B7YA 1C4RA 2JIJA 2IXCA 4KU8A 4PBOA 5E8AA 1J3PA 3MIEA 1IOAA 2A73B 1ENSA 5GALA 2GNDA 1LJ7A 3BTAA 3PIGA 4AXOA 2AEZA 2PFVA 3MFCA 4LK6A 1OOPC 4TYSA 5LW9A 4B08A 4OYUA 3V0AA 2B1EA 4HT1T 4IEVA 2FD8A 1V70A 2YMZA 3JD73 3I2OA 5D1IA 4C0BA 2R49A 4FPJA 1W0NA 1VBE2 4EV0A 4NIHA 4NPRA 4XF1A 3VB9A 5JMOA 3N7MA 3GJBA 1RUE1 1JYIA 3HGLA 2YB7A 4COZA 1XPWA 1MTYG 3KD4A 3AK0A 1WA6X 4XDOA 4L11A 3U75A 5J48A 2WYSA 1A34A 1EV12 1NY71 2WA3A 4CDWC 2XB6C 4XJUA 5EWSA 3CO2A 1FZ8E 1RUNA 2QQKA 4Y1ZA 2X29A 3I2FA 1C8M3 1XE8A 1HQNA 1SZBA 2J42A 2MEV2 4J25A 1HJFA 3BN6A 5JI9A 1VE0A 4AVBA 4Y4YA 2GC0A 4D3WA 1W2AX 2P3KA 1EY2A 5A7OA 2OVPB 3I3DA 4NJ4A 5T5PA 3VZLA 3IDAA 1AR73 5LA9A 1OBNA 3AYDA 1VMFA 4Q4X3 2RM22 3SVIA 1W6QA 3JUUA 1XQNA 5JOXA 1AX1A 5K0UC 2CGNA 1C28A 3ZFFA 4DTJA 2WS93 3MW3A 3P3PA 2JHPA 3EHKA 3CMGA 2JENA 1VBD1 4QM8A 3M3OA 2IVIB 4XF3A 2DUOA 5IK7A 3VN4A 3HPNA 5JXGA 2YBSA 4XIOA 3VBOC 5C3OA 1D4VB 5EP9A 2YHJA 1HB4A 4DEVA 5T5LA 2WYFA 4M42A 1O59A 4HONA 5FZLA 3VDDC 2P3IA 5ABJB 3BIWE 2WSVA 5FXVA 5IVEA 2LROA 1R091 2WWSA 5FZDA 4WM7A 1LOCA 4Z2WA 2FMYA 5FZKA 3T2QA 4Z92B 4BK5A 4A6SA 5FY1A 2BTVC 1FT9A 1PVC1 3TABA 2JDPA 3I2JA 1O6UA 3DPRA 1GP5A 3J8F1 4AL9A 3PJYA 1WD4A 1HX6A 5LY1A 1N3PA 1QDCA 5LRRA 3WNLA 1RVF3 5HCHA 3ZXJA 2VUDA 4JVAA 4OHWA 4NWVA 3AKSA 1ZZ9A 4XOGA 4CDXA 4JQRA 1PMIA 3NGIA 2EXKA 2IXIA 5E16A 5IVVA 3VBRA 2W68A 3WUCA 4AI3A 4AI8A 1RUH2 4RFRB 5FAXA 4A2UA 5FYUA 1NKGA 1DZRA 1WCUA 4ZKTB 4GH4C 5KHIA 3OD4A 4YW5A 3E97A 3M3EA 1MS3A 2MHFA 3POSA 3AYCA 1GSLA 4QQHA 1QH6A 5ACA1 2V4AA 3VD9A 4FTBA 2WFPA 1AX0A 3LWCA 4OFGA 5HPOA 1YEWA 2P17A 2V4VA 1ZREA 4AI9A 2YC0A 4ASKA 2YBPA 4FJ5A 1JS9A 2W5FA 4CP9B 1SLCA 4QPWA 5H9SA 5HXMA 5JOYA 2PLV1 1QHDA 4R4ZA 1ODNA 2XLGA 3SCGA 3VBRB 4ZU7A 1JYWA 2BFUS 5F1RA 1XVEE 4LBQB 5CA6A 4DUWA 1RHI3 1JOJA 4N53B 4ZXKA 2Y64A 2ZEYA 3W9AA 1GOGA 3AKPA 4J1XA 5CFCC 4OHYA 3VL9A 4BISA 1S1AA 5EXOA 5DMYA 3JD72 2IXLA 1QJY2 4FAHA 1IS6A 1COV2 2PTMA 1FZIE 2Q8EA 5JSOA 2CGOA 3S9HA 2D5HA 4FP2A 4D6SA 3CF6E 5CEHA 1PM7A 1NZIA 2VUCA 3ZSLA 5A7PA 4ES9A 4FPEA 5KXBA 1S0GA 1QJU1 1OC1A 2BBVA 3KLSA 3I2HA 3VZOA 5FQ0B 4LA3A 3T30A 4QDQA 3ZDSA 1RUJ3 3ORJA 4PLMA 1XMGE 4C1XA 3KCCA 3NAPC 2VULA 4S2FA 3NAPA 1CJPA 3PMEA 1MQTB 5EV7A 1X82A 3PTRB 2HWB3 1NCQB 3WDWA 1CX4A 3MLKA 4FO9A 5FY0A 5A3PA 3BCWA 3V0BB 4EYWA 3E4WA 1MVEA 1OHFA 2A7AA 5JI7A 4CU6A 3S5QA 4RR3C 3L1NA 4AEKA 5I0RA 1VBB3 1QKQA 1KGYA 3K2OA 1OD3A 1R092 2ADDA 3AKTA 3HVDA 4NHLA 1CAWA 3KV9A 2E63A 2Z2SB 3E5UA 3NMBA 2CDPA 4D6RA 1G9FA 1V9U3 2F6BA 4N8MA 5FUNA 2P5OA 4QGMA 4COWA 3VBFB 2HWF3 1ZVFA 4UT5A 5FR3A 2RS51 4I0BA 4PF5A 3SI6A 2EALA 4A7ZA 3VKNA 1QOOA 2W47A 1W9TA 3O0XA 1H1MA 1AR61 3QH7A 5LK7B 4CCDA 4HETA 4KNCA 2NPIA 3RZJA 2RM21 1TME2 2VOKA 5JWPA 4TN7A 3PL0A 4QB1A 3VBHA 4KI5M 4Q1PA 2ES3A 2BQPA 4LUKA 3ZXGA 1KXGA 1MEC1 5GZDA 1O7FA 3MIGA 1J59A 1YI7A 4M3YA 2C1FA 2IFRA 4JTOA 2OS2A 4AFBA 1WMEA 4A44A 3QACA 1K5MA 2X53S 2XR4A 2NM1A 1FAYA 3POIA 2XQRA 4E4SA 3E6BA 5ABJC 4KHYA 1I6XA 3DXUA 3RMXA 3T1MA 4AEDA 1LTEA 3RWNA 3CJIA 2JG8B 3POWA 1W8FA 5G05L 3CJIC 4KG0A 1POV0 3UKTA 3CQOA 3GBWA 2W39A 5JCTA 1JZ5A 2D98A 3FHIB 4EZHA 3AFKA 1WMFA 2NZ9A 4B29A 2GC3A 2RKHA 4ZU5A 2DWRA 5DAPA 4G4FA 4YVWB 4CDUB 3SJJA 2ET1A 1RUF3 3C94A 3AJZA 1LGCA 3J7LA 4GH4B 2RHPA 3FLRA 4QT6A 1QDOA 4B4RA 1WW4A 2NLRA 3V7DB 3KQRA 2ZCWA 4H3WA 2DBNA 5GZGA 5CKQA 5KXCA 4LO4B 4N53A 2ORZA 4EROA 5AC91 2GNBA 2F4PA 2BYVE 3CIHA 3B9CA 4AI1A 4R9AA 4IEPA 4D69A 4K9SA 4FI9A 5E88A 3G6JB 4FFHA 4RFT0 2WS91 4BWOA 4CDQB 2AUYA 1UOJA 4NHXA 3TYJA 1DZQA 3Q8BA 2ZBJA 2ZS6B 4IXLA 4LLFA 2DCYA 1W6MA 2Y60A 5EIYB 1COV3 4MZUA 1JZ4A 2GH8A 1KJLA 4IL7A 1HV1A 2VOWA 1AXZA 5FP8A 3JBG2 3R4SA 4GMP0 4MGIE 4NROA 3U14A 1JZ2A 3I2KA 3O1VA 2VW2A 3PVOA 3VZKA 1BEV3 3C3VA 3WNPA 5DQ0A 1YXWA 4DB5A 1RHI2 4I3GA 4QX3A 4WVVA 1SBFA 3KZ4C 4DUVA 2EXJA 2ZKLA 3VKOA 1SPPB 3VBSB 3I3EA 1OOPA 5HV4A 3C7GA 3O7OA 1J1LA 1GWMA 2ZMKA 4Q26A 4COUA 1TQ5A 4QDRA 1QJY3 1C3HA 1XYPA 2ZPXA 3HAGA 5FKCA 5B2GB 1CAUB 2CGPA 4D7YA 4M00A 3O1OA 1OPOA 1HJGA 1LOFC 1S0IA 2RR13 2XWJB 1WMXA 2VG9A 3O14A 2C9KA 3TOJA 3E6DA 3U07A 4KGGA 5DDJ2 2X5IA 2X5IC 2YV8A 2YXSA 1D2QA 2OQ7A 1V9U2 1VMHA 1CN1A 1RUE2 4YZ2A 4JGZB 2LF6A 3UO2A 3H1MA 1UOGA 3WQ1A 2XMLA 3C7HA 1RXGA 4KL1A 3Q8FA 3RMCA 4YG6A 5H9QA 4BDVB 3NCIA 1GKBA 4BZ4A 5AFEA 4UFMA 1AX2A 4DU4A 1VR3A 1M06G 4QMAA 2XKOA 3HBZA 1UYYA 2JKBA 4DXRA 1G9AA 1UOFA 3LQCA 3WP4A 1ZM1A 4CCEA 2XBO2 4FBFA 4EN6B 4UXAA 3TWIA 2HWE3 2FHRA 3P6BA 2BPA2 5EYXA 3M8LA 3ZFFB 1KD7A 4HG6B 2ZX3A 3WDTA 2Q1MA 4LIVA 5G04L 1NE4A 3NV4A 3PVBB 1ALYA 2ZGUA 3WP3A 4ZPIA 1CAVA 1KFUL 1N1TA 4IEYA 5BNNA 5JXHA 3H1WA 4OI1A 5FWJA 4KWKA 4QPIA 5LBEA 3LZJA 3KV5A 3OGSA 4GWIA 1ENQA 3WG1A 3VBOA 5CAZA 5FYIA 1W2OA 4KQ7A 1R082 1XNTA 5IBKB 1D4M2 4CXWA 4ARXA 2DF7A 2RS12 3OSDA 1PGW2 5SV8A 4AQ6A 1MHYG 2W3JA 3A22A 2ZHNA 4FFFA 2WBKA 1IKPA 3NV1A 5FYVA 3OEAA 3WNNA 1QJU3 5C3RA 2ZA9A 5IATA 4M4PA 1UY1A 4RR3A 1RUF2 5JR7B 2O0OA 1B35A 2BV4A 4AWDA 2ZX2A 4DINB 2OVRB 1YQ6A 3HGKE 2O8QA 3LOIA 5DZEA 4YVSB 3SLIA 2V5DA 3M3QA 4EYUA 3SQ2A 3H8OA 1ND3A 3VD5A 5FY9A 1YIPA 3W21A 4C1WA 2VAUA 1UYXA 5IAXA 1CQ9A 3B01A 4AFMA 3VBRC 3DUIA 3ZXKA 2WQZC 1DBNA 4RGAA 4BLIA 1LU2A 1UKRA 5FYYA 1VP6A 1H1IA 4IE5A 2VOXA 2W87A 4A42A 1DLLA 3CDZB 4LHKA 3ST7A 3TRSB 5FCCA 2PFWA 3WW2A 4Q4W2 5C6CA 3AP5A 1AZDA 2RDQA 1JBCA 2JDNA 5C7GA 3SQ4A 2IXKA 2NYYA 3K4ZA 2WT0A 1HRV1 5J37A 2WIIB 1MR5A 2PQSA 1JHJA 1AL23 4DPNA 4YG0A 2A6YA 4NHMA 4FJKA 3UK9A 3TEYA 1QJZA 4KBZA 3ZX7A 1XU3E 4IEWA 4CXYA 4RGGA 1GYKA 2HLEA 3LE0A 4HMZA 2RR11 4YGBA 1CX1A 3MIFA 3THPA 1W0PA 3N9MA 2GSYA 4DTSA 3BOPA 4P9GA 4XEZA 4D7SA 2PHLA 4QPGC 2X05A 5FOBB 4CP9A 1GICA 2PQQA 4YM3A 5FBZA 1RL3A 2E32A 1RIRA 2QQPA 2XUMA 4XACA 1DHKB 1KJRA 2VTFA 1RUH3 4Y22A 4Y5SA 3WV6A 4XJZA 4Q4Y2 2VECA 5A80A 1OMIA 5C71A 3O1MA 3C2UA 2DDUA 1UIJA 2CHHA 5FZ6A 1RUF1 4Y22B 2WNVB 3LDRA 2CWSA 4YM1A 2YU1A 4XYXA 2JG8C 1GUIA 2H0BA 1UXXX 1MS1A 3L9JT 5GM0A 1U5YA 4NUBA 4HCBA 3KCXA 1DYKA 2QNKA 4GMP3 1PMHX 3KB5A 1HXS1 3NWKA 3WNOA 4DOUA 4YPJA 2W2IA 5JLVA 3JU9A 1D4M1 2D6NA 2XLAA 1W3VA 4YVWC 4GMP1 4CDUC 4HN0A 1V6MA 1DYOA 3ON7A 5DUVA 1CZVA 1FPN2 1NCRA 1IPJA 3M70A 4JDMA 3IN9A 1AR83 3K4AA 3W20A 4YSFA 4JGZC 1SBEA 1JZ6A 4LIUA 4CPBD 3OF1A 1BBT1 3OBRA 4XAAA 4GB31 4ASLA 4RL7A 2HWF1 2YY1A 1OVSA 1C5IA 4GXLA 2VJ5A 4IUGA 1OSGA 4QHBA 5FV3A 1RUC3 4LHNA 1X9PA 3VZNA 1UY3A 4FJHA 2JWPA 3WD5A 4DXTA 5HV0A 1H0BA 4YZ5A 1GZTA 5ERLA 4ATEA 5KC6A 3WW4A 4E3SA 4M3ZA 3VBHC 1IZ3A 4OVEA 3WP5A 1K45A 3TNQA 1W06A 4JGYC 1LKNA 4Q2FA 4FXKB 2D3SA 4NHKA 3K3OA 5H9RA 3EO6A
chains in the Genus database with same CATH topology
4KHSA 4ADOA 3OG2A 2EIDA 2WAAA 1UXZA 3ACIA 4L0PA 1WAJA 3WF2A 4MO3M 2Y6LA 1US3A 2WO3A 1UMHA 2VCAA 4FJXA 1J84A 4QNDA 4PQQA 4KMQA 2OKXA 2JHAA 5IFTA 1CZTA 1GNYA 3UNPA 1PX3A 1XMHE 2W92A 3IB3A 2VIXA 4MOAA 4X5MA 3SCXA 2VOTA 4I9LA 4AKIA 2LF3A 3C7EA 4J2AA 1K3IA 4RNGA 1ULPA 1OT5A 3FN9A 5JUVA 1OF4A 4KWUA 1XVFE 2VMEA 4I6JB 4JS4A 2YFZA 2PFVA 5JXIA 1UWWA 3LPGA 4B08A 4QAWA 4OYUA 2B1EA 1I5PA 2WO1A 1KEXA 2OZSA 1W0NA 3QEXA 2VCCA 3OBAA 5JMOA 1P22A 4JKMA 3HGLA 2YB7A 1XPWA 1MTYG 3SKJE 3SUOA 3SQ0A 4XUOA 1F4AA 2WYSA 3SEPA 3LEIA 1P8JA 1FZ8E 2MZWB 3TAFA 2ORXA 2QQKA 2W91A 2VZOA 3I2FA 2QQOA 3NJVA 4LPLA 2J1VA 2XQXA 3C7FA 4FJJA 4QX1A 4FJIA 3BN6A 3EB7A 4DU1A 4X5NA 3F2ZA 5JR2A 2QQIA 2OVPB 3I3DA 3IDAA 2VZVA 2J7MA 1JYXA 3K46A 4DEQA 3SVIA 1H6YA 3RMDA 3VD7A 4DTJA 3OGRA 2RJ2A 3MUY1 3HN3A 2JHPA 4FVMA 3E1F1 2P1PB 3CMGA 3T09A 1O8SA 3T0DA 5IZ7A 2W1SA 5H37A 3HPNA 3SUNA 2DCJA 2DTUA 1OF3A 4ZXEA 3WF3A 5JXGA 4FJLA 3KD1E 1LDKE 2YG0A 4OMCA 4DEVA 3SUQA 4M42A 1O59A 1UY4A 2B8IA 2EIBA 4FJGA 4AAXA 4P00B 4UI9L 4JRPA 5EJ1B 3T2QA 3KD5E 3QESA 2VM9A 5F7UA 4BK5A 4J2DA 3VD4A 3CZUA 2Y6JA 3TABA 3I2JA 3C6PB 5LA2A 4OZOA 2MMBA 3WNLA 3U37A 1J83A 4CUAA 3CFPA 1L7QA 4GWJA 4QDSA 3QEVA 4AKHA 4FJ8A 2J22A 4D0QA 1CIYA 2E33A 4DTNA 4XUTA 4E4BA 4EP9A 3NGIA 1XVGE 4ADNA 2J1RA 1NKGA 3FHAA 2J1SA 2VZTA 2C26A 2VZPA 2WDBA 5LCWL 3ZM8A 3VD9A 2HYXA 5HPOA 5IREA 1UYZA 2P1MB 2J1AA 4A4AA 2V4VA 4QB6A 2BERA 2ZEZA 3WQBA 4FJ5A 2W5FA 4QPWA 4D8MA 5HXMA 4KI4A 2RV9A 2VZ1A 1O8PA 1JYWA 4GZ9A 4ET7A 3L2OB 5IYYA 2VZRA 1XVEE 1R64A 2RCUA 2E31A 4DUWA 2WAOA 2Y64A 2ZEYA 1D7PM 1GOGA 3LEKA 4OUEA 1GQPA 3TL8B 5DMYA 1UY0A 4QB2A 4M3UA 4XUPA 2VR4A 4QNCA 4P5YA 4E8CA 1F4HA 1EUUA 1FZIE 3HP9A 3HEIA 4FJNA 3S9HA 2P5GA 2P1OB 4M3XA 4A41A 1XVBE 3RMAA 4A3ZA 2ZEWA 2VZSA 1HN1A 3AC0A 3I2HA 3FHQA 1WCQA 4QDQA 3OGVA 1XMGE 1MMOG 2J1EA 3GGLA 4KI6A 2OYQA 4OMDA 2WUHA 1FYZE 2VMFA 5IJRA 4EYWA 3E4WA 2VQUA 4CU6A 2X10A 2BZDA 4JKLA 3D3AA 3L1NA 5IHRA 5I0DA 4ARYA 3TAGA 1FZ1E 3C8XA 4HCCA 3K2OA 1KGYA 1OD3A 1WAFA 2CDPA 3ABZA 2P5OA 4AG4A 2JH8A 3L8BA 2ZXQA 1EUTA 1W9WA 3NE6A 1NAEA 2VCBA 3SI6A 3FL7A 3SQ1A 2W47A 1W9TA 3RWUA 3IAQA 3UESA 2E26A 3DECA 2W94A 2JHCA 1XMFE 5B4NA 3NJXA 4JKKA 3OGMB 4FK4A 3DYOA 2JKXA 3VDCA 4QB1A 2CDOA 4KI5M 1UX7A 4CUCA 2WN3A 2JDAA 2YC2A 1XVCE 3QNOA 1XNAA 1YQ2A 1JZ7A 1Q9XA 4M3YA 2BGOA 4XVHA 4W8JA 3UIQA 4A44A 3ECQA 4CUBA 1NX9A 4W50A 1DLCA 4M4RA 4P08A 4KHYA 3C6NB 1TVGA 2YB5A 2QQNA 2VJ4A 2OZMA 4FK2A 3ACFA 5G05L 1NEXB 3CQOA 2WN2A 3I2IA 1JZ5A 4JHZA 4E8DA 2Y6HA 1FZ4E 2YC4A 5IFPA 3C6OB 4JS5A 2FW3A 3SJJA 4FJMA 3I2GA 1FZ3E 3C94A 4KHNA 1UZ0A 4QX0A 3WEZA 4XUQA 2VMDA 3NAEA 3V7DB 5DPNA 3GXUA 3THCA 2QQMA 2QBXA 3WF1A 2ORZA 1MPXA 3WF4A 2DY4A 2ZEXA 4FK0A 2WO2A 4BXSV 3NDKA 1W8OA 3CIHA 3A23A 1XU5E 2KD7A 4FI9A 3NQHA 2W95A 4RN5A 1IG9A 1SG3A 2JD9A 2L9LA 4W4ZA 1XVDE 2C4XA 5EIYB 3C7OA 4AKGA 3MV11 1JZ4A 2BGPA 1JZ2A 3THDA 3I2KA 4MADA 1JU3A 3WNPA 1JZ8A 5DQ0A 2VJXA 4QX3A 1PMJX 1LNSA 4TXWA 2OVQB 3J2PA 1NUKA 2Y6KA 2VL4A 4DUVA 3I3EA 2WQ8A 3C7GA 4P02B 2B9VA 1XL3C 2XOMA 4FJ9A 4QDRA 4XURA 3ACHA 2VZQA 2VZ3A 4BK4A 2RVAA 4KHQA 3MV01 3NNGA 2C9KA 3MUZ1 1GOFA 1UMIA 4XZUG 3ACGA 3SPYA 3T2OA 1MHZG 3I97A 3SEEA 2DCKA 2LF6A 4LHSA 3LDBA 4DTRA 3QEPA 3C7HA 4JRQA 3RMCA 4BDVB 2J1TA 4M45A 4ZZ8A 5LA0A 3NCIA 4XUNA 2P1QB 4BJ0A 2PFTA 4DU4A 1FZ9E 3LZIA 3IIIA 1UY2A 1UYYA 4RYDA 4DXRA 3T0BA 3MKSB 3LQCA 1FZ7E 3L0MA 3P6BA 5JXJA 2Y6GA 4DUXA 3RMBA 4HG6B 2VC9A 1IH7A 1H6XA 3HNBM 2FYOA 5G04L 4A6OA 1US2A 1K12A 5DN2A 5JXHA 2EIEA 1FZ0E 2WABA 4CU8A 3LZJA 3OGSA 4GWIA 4PF1A 3WNKA 3T0AA 2JE8A 3K75B 4CU9A 2VQTA 1GU3A 3J27A 1XNTA 2R7EB 2JH9A 5IBKB 3QETA 2VMCA 4DTOA 3K77A 3WF0A 4ARXA 3QEIA 1JZ3A 2BBAA 4MGSA 1MHYG 2W3JA 3A22A 2WBKA 3OEAA 3WNNA 3SKVA 3SUPA 1BHGA 2QQLA 5CZKA 2P1NB 4M4PA 3MO4A 1UY1A 4KHWA 3CFRA 1SDDB 1RYYA 4QX2A 2OVRB 4TTGA 3HGKE 3W5NA 2V5DA 3CKHA 3SQ2A 2H4TA 4Z2AA 3NHGA 2W1WA 2XONA 4DTUA 3LPFA 1DP0A 3VD5A 1W99A 1SHWB 2X09A 1UYXA 1FS1A 3WSOA 2ATQA 4I9QA 4UOJA 3LD8A 4ZY9A 3QNNA 4MGQA 2LW8A 4DXSA 4DTPA 5C70A 2EICA 2W87A 4A42A 3JXSA 3CDZB 2B4KA 2ID4A 1GMMA 5C7GA 2J1UA 3SQ4A 3IAPA 3K4ZA 4LKSA 3VD3A 4M3TA 2PQSA 1JHJA 1L7RA 3CZJA 3HJRA 3QEWA 3PUHA 3CFOA 3C95A 4FJKA 1CZSA 1XU3E 4CU7A 3LDSA 2W46A 3NRUA 3OGKB 3DYPA 3T08A 4M3RA 5FUIA 1OH4A 2HLEA 3LE0A 3N1BA 3GDBA 2XHNA 1CX1A 3TJYA 4DTSA 3VDAA 2Y8KA 4M41A 3A21A 4A45A 5LA1A 2X05A 2DEBA 3CQ8A 3E4YA 2HD0A 2VO5A 1JYVA 3PUIA 2W9XA 2E32A 1W8NA 4UAPA 2VTFA 3LEGA 5A1AA 3SPZA 2QQJA 4AI6A 1ULOA 3UETA 5C71A 4EPHA 1Q9YA 1FZHE 2DDUA 1FZ6E 4ZZ5A 3HNMA 3A7QA 4J2BA 2Z4FA 4RG8A 3OGLB 1JI6A 2W1UA 4LQRA 1XC6A 3EYPA 3OB8A 1JYNA 1K42A 1GOHA 3T2PA 4JX0A 1GUIA 3N1EA 3J7HA 2QXFA 2LS6A 1UXXX 2VZUA 5J1XA 4HCBA 3WNMA 1PMHX 3WNOA 2B7MA 4YPJA 1T2XA 5CYYA 3VDBA 1DYOA 1CZVA 3SNNA 3K4AA 3I3BA 1FZ2E 3GM8A 1JZ6A 3MBWA 3BGAA 1IQDC 3HOBA 1W9SA 4DTXA 2V72A 2W1QA 4CVUA 4RL5A 1WKYA 3HL8A 3K4DA 4J2EA 2YFUA 3QERA 4GAMC 3DYMA 4PT6A 2VJ5A 4M3WA 4IUGA 3W5MA 1FXXA 4FJ7A 1JU4A 4DTMA 5B4XA 3TAEA 1UY3A 1FZ5E 4FJHA 2WZEA 4DXTA 2WZ8A 1CLQA 5EJZB 3P1IA 4E3SA 4M3ZA 3ETPA 4KHUA 1K45A 3HNYM 1PX4A 2JPNA 3OEBA 1TG7A 4DU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OG2 A;  2EID A;  2WAA A;  1UXZ A;  3ACI A;  4L0P A;  3WF2 A;  4MO3 M;  2Y6L A;  1US3 A;  2WO3 A;  1UMH A;  2VCA A;  1J84 A;  4PQQ A;  4KMQ A;  2OKX A;  5IFT A;  1CZT A;  1GNY A;  3UNP A;  1PX3 A;  2W92 A;  3IB3 A;  4MOA A;  2VOT A;  3C7E A;  1K3I A;  1ULP A;  1OT5 A;  3FN9 A;  5JUV A;  1OF4 A;  4KWU A;  2VME A;  4I6J B;  2YFZ A;  5JXI A;  1UWW A;  3LPG A;  4QAW A;  4OYU A;  1I5P A;  2WO1 A;  1KEX A;  1W0N A;  2VCC A;  3OBA A;  5JMO A;  1P22 A;  4JKM A;  2YB7 A;  1XPW A;  3SKJ E;  4XUO A;  1F4A A;  2WYS A;  3SEP A;  3LEI A;  1P8J A;  2W91 A;  2QQK A;  2ORX A;  4LPL A;  3NJV A;  3I2F A;  2VZO A;  2QQO A;  2J1V A;  2XQX A;  3C7F A;  4QX1 A;  3BN6 A;  3EB7 A;  3F2Z A;  5JR2 A;  2QQI A;  2OVP B;  3I3D A;  3IDA A;  2VZV A;  2J7M A;  1JYX A;  3K46 A;  4DEQ A;  1H6Y A;  3VD7 A;  3OGR A;  2RJ2 A;  3MUY 1;  3HN3 A;  3E1F 1;  2P1P B;  3CMG A;  3T09 A;  1O8S A;  3T0D A;  2W1S A;  3HPN A;  2DCJ A;  1OF3 A;  4ZXE A;  3WF3 A;  5JXG A;  1LDK E;  2YG0 A;  4OMC A;  4DEV A;  1O59 A;  1UY4 A;  2EIB A;  4AAX A;  4P00 B;  4UI9 L;  5EJ1 B;  3T2Q A;  5F7U A;  2VM9 A;  4BK5 A;  3VD4 A;  3CZU A;  2Y6J A;  3I2J A;  3C6P B;  5LA2 A;  4OZO A;  3WNL A;  3U37 A;  1J83 A;  4CUA A;  1L7Q A;  4GWJ A;  4QDS A;  2J22 A;  4D0Q A;  2E33 A;  1CIY A;  4XUT A;  2J1R A;  1NKG A;  3FHA A;  2J1S A;  2VZT A;  2C26 A;  2VZP A;  2WDB A;  5LCW L;  3ZM8 A;  3VD9 A;  2HYX A;  5HPO A;  1UYZ A;  2P1M B;  2J1A A;  4A4A A;  2V4V A;  4QB6 A;  2BER A;  2ZEZ A;  3WQB A;  2W5F A;  4QPW A;  4D8M A;  5HXM A;  2RV9 A;  2VZ1 A;  1O8P A;  1JYW A;  4GZ9 A;  4ET7 A;  3L2O B;  5IYY A;  2VZR A;  1R64 A;  2E31 A;  4DUW A;  2WAO A;  2Y64 A;  2ZEY A;  1D7P M;  1GOG A;  3LEK A;  4OUE A;  1GQP A;  5DMY A;  1UY0 A;  4QB2 A;  4XUP A;  2VR4 A;  4P5Y A;  4E8C A;  1F4H A;  1EUU A;  3HEI A;  2P1O B;  4A41 A;  4A3Z A;  2ZEW A;  2VZS A;  1HN1 A;  3AC0 A;  3I2H A;  3FHQ A;  1WCQ A;  4QDQ A;  3OGV A;  2J1E A;  3GGL A;  4OMD A;  2WUH A;  2VMF A;  5IJR A;  2VQU A;  4CU6 A;  2X10 A;  2BZD A;  4JKL A;  3D3A A;  5IHR A;  5I0D A;  4ARY A;  3C8X A;  1KGY A;  1OD3 A;  2CDP A;  3ABZ A;  4AG4 A;  2ZXQ A;  1EUT A;  1W9W A;  1NAE A;  2VCB A;  3FL7 A;  2W47 A;  1W9T A;  3IAQ A;  3UES A;  2E26 A;  3DEC A;  2W94 A;  5B4N A;  3NJX A;  4JKK A;  3OGM B;  3DYO A;  2JKX A;  3VDC A;  4QB1 A;  2CDO A;  4KI5 M;  1UX7 A;  4CUC A;  2WN3 A;  2JDA A;  2YC2 A;  1XNA A;  1YQ2 A;  1JZ7 A;  2BGO A;  4XVH A;  4W8J A;  4A44 A;  3ECQ A;  4CUB A;  1NX9 A;  4W50 A;  1DLC A;  4M4R A;  4P08 A;  3C6N B;  1TVG A;  2QQN A;  3ACF A;  5G05 L;  1NEX B;  3CQO A;  2WN2 A;  3I2I A;  1JZ5 A;  4JHZ A;  4E8D A;  2Y6H A;  2YC4 A;  5IFP A;  3C6O B;  3I2G A;  1UZ0 A;  4QX0 A;  3WEZ A;  4XUQ A;  2VMD A;  3V7D B;  5DPN A;  3GXU A;  3THC A;  2QQM A;  2QBX A;  3WF1 A;  2ORZ A;  1MPX A;  3WF4 A;  2ZEX A;  2WO2 A;  4BXS V;  1W8O A;  3CIH A;  3A23 A;  2KD7 A;  4FI9 A;  3NQH A;  2W95 A;  4RN5 A;  1SG3 A;  2JD9 A;  2L9L A;  4W4Z A;  2C4X A;  5EIY B;  3C7O A;  3MV1 1;  1JZ4 A;  2BGP A;  1JZ2 A;  3THD A;  3I2K A;  4MAD A;  1JU3 A;  3WNP A;  1JZ8 A;  5DQ0 A;  2VJX A;  4QX3 A;  1PMJ X;  1LNS A;  4TXW A;  2OVQ B;  1NUK A;  2Y6K A;  4DUV A;  2VL4 A;  3I3E A;  2WQ8 A;  3C7G A;  4P02 B;  2B9V A;  2XOM A;  4QDR A;  4XUR A;  3ACH A;  2VZQ A;  2VZ3 A;  4BK4 A;  2RVA A;  3MV0 1;  3NNG A;  2C9K A;  3MUZ 1;  1GOF A;  1UMI A;  4XZU G;  3ACG A;  3T2O A;  3I97 A;  3SEE A;  2DCK A;  4LHS A;  3C7H A;  4BDV B;  5LA0 A;  2J1T A;  4ZZ8 A;  4XUN A;  2P1Q B;  4BJ0 A;  3III A;  1UY2 A;  1UYY A;  4RYD A;  4DXR A;  3T0B A;  3MKS B;  3LQC A;  3P6B A;  5JXJ A;  2Y6G A;  4DUX A;  4HG6 B;  2VC9 A;  1H6X A;  3HNB M;  5G04 L;  4A6O A;  1US2 A;  1K12 A;  5DN2 A;  5JXH A;  2EIE A;  2WAB A;  4CU8 A;  3OGS A;  4GWI A;  4PF1 A;  3WNK A;  3T0A A;  2JE8 A;  3K75 B;  4CU9 A;  2VQT A;  1GU3 A;  1XNT A;  2R7E B;  5IBK B;  2VMC A;  3K77 A;  3WF0 A;  4ARX A;  1JZ3 A;  2BBA A;  4MGS A;  2W3J A;  3A22 A;  2WBK A;  3OEA A;  3WNN A;  3SKV A;  1BHG A;  2QQL A;  5CZK A;  2P1N B;  4M4P A;  3MO4 A;  1UY1 A;  1SDD B;  1RYY A;  4QX2 A;  2OVR B;  4TTG A;  3W5N A;  2V5D A;  3CKH A;  4Z2A A;  2W1W A;  2XON A;  3LPF A;  1DP0 A;  3VD5 A;  1W99 A;  1SHW B;  2X09 A;  1UYX A;  1FS1 A;  3WSO A;  4UOJ A;  4ZY9 A;  4MGQ A;  2LW8 A;  4DXS A;  5C70 A;  2EIC A;  2W87 A;  4A42 A;  3JXS A;  3CDZ B;  2B4K A;  2ID4 A;  1GMM A;  5C7G A;  2J1U A;  3IAP A;  3K4Z A;  4LKS A;  3VD3 A;  2PQS A;  3PUH A;  1JHJ A;  1L7R A;  3CZJ A;  3HJR A;  1CZS A;  4CU7 A;  2W46 A;  3NRU A;  3OGK B;  3DYP A;  3T08 A;  5FUI A;  1OH4 A;  2HLE A;  3LE0 A;  3GDB A;  2XHN A;  1CX1 A;  3VDA A;  4A45 A;  2Y8K A;  3A21 A;  5LA1 A;  2X05 A;  2VO5 A;  1JYV A;  3PUI A;  2W9X A;  2E32 A;  1W8N A;  4UAP A;  2VTF A;  3LEG A;  5A1A A;  2QQJ A;  1ULO A;  3UET A;  5C71 A;  2DDU A;  4ZZ5 A;  3HNM A;  3A7Q A;  2Z4F A;  3OGL B;  1JI6 A;  2W1U A;  4LQR A;  1XC6 A;  3EYP A;  3OB8 A;  1JYN A;  1K42 A;  1GOH A;  3T2P A;  4JX0 A;  1GUI A;  3J7H A;  2LS6 A;  2VZU A;  1UXX X;  5J1X A;  3WNM A;  1PMH X;  3WNO A;  4YPJ A;  1T2X A;  5CYY A;  3VDB A;  1DYO A;  1CZV A;  3K4A A;  3I3B A;  3GM8 A;  1JZ6 A;  3MBW A;  3BGA A;  1IQD C;  3HOB A;  1W9S A;  2V72 A;  2W1Q A;  4CVU A;  1WKY A;  3K4D A;  2YFU A;  3DYM A;  4PT6 A;  3W5M A;  4IUG A;  1JU4 A;  5B4X A;  1UY3 A;  2WZE A;  4DXT A;  2WZ8 A;  5EJZ B;  3P1I A;  3ETP A;  1K45 A;  3HNY M;  1PX4 A;  3OEB A;  1TG7 A; 
#chains in the Genus database with same CATH topology
 4ADO A;  1H9W A;  2N7G A;  3ZKU A;  2AAC A;  3WCR A;  4AOC A;  1V9U 1;  2P2K A;  4IV3 C;  5CKN A;  3TN9 3;  1JYC A;  3ACI A;  3ATG A;  4L0P A;  1W90 A;  1YQC A;  2ATF A;  4MO3 M;  1ULF A;  3A0K A;  1POV 1;  2Q8D A;  5AFB A;  1SFN A;  2OUJ A;  5I93 A;  1W05 A;  3KT4 A;  3RGB A;  2D7F A;  3WLU A;  1J84 A;  3UGF A;  2XUE A;  1OI6 A;  2UWB A;  5FO9 B;  2AGS A;  5IFT A;  1VBA 1;  2JG9 A;  3L2Y A;  1XE7 A;  1Z7S 1;  2DVB A;  3RI9 A;  4QHZ A;  4CP1 A;  3NVC A;  5FZF A;  4BQ1 A;  4MOA A;  2VIX A;  4LLO A;  3SQO A;  3NNJ A;  4AKI A;  3DKW A;  1CAX B;  4A7Y A;  1MS5 A;  3NJZ A;  1FNZ A;  5IT6 A;  3RYR A;  1OT5 A;  1U5I A;  4KWU A;  5LBB A;  1OKO A;  1PIV 2;  2HWE 1;  5HCF A;  4B4P A;  4BCU A;  4ORF A;  4L99 A;  4TSV A;  3KQ4 B;  2VME A;  3POB A;  4LO7 A;  1S0E A;  4RHV 3;  1W6N A;  3CJX A;  5FMD A;  1WLD A;  2DV9 A;  4JS4 A;  3JBG 1;  1UOB A;  1LOA A;  1UWW A;  5F6L B;  4MXW B;  4QAW A;  5F5C A;  4IGO A;  3WHT A;  2HKX A;  5D21 A;  5IK8 A;  2RS5 2;  2WO1 A;  2OT7 A;  3V0B A;  2RMU 3;  3ROU A;  5FPX A;  5FOJ B;  3AMP A;  4FPO B;  1F2N A;  4KG8 A;  3WG3 A;  2HWC 1;  2ZX0 A;  1MS8 A;  1BVP 1;  2WNE A;  3KT1 A;  3SKJ E;  1ENR A;  4XUO A;  1NXM A;  1S2B A;  2AEN A;  1XNC A;  1WA4 A;  3ES1 A;  4HFS A;  4MXW A;  3SEP A;  4HK8 A;  2VXJ A;  3KS7 A;  1P8J A;  3KV4 A;  2OPW A;  3DGT A;  4JC1 A;  2MZW B;  2W91 A;  4LPL A;  5FP4 A;  3NJV A;  2VZO A;  3WG2 A;  2XJS A;  2J1V A;  2XQX A;  3C7F A;  3CBN A;  4Q4Y 3;  5IVC A;  2ZX1 A;  4FJJ A;  4FJI A;  3DPR C;  4DU1 A;  2ZGN A;  3F2Z A;  3ALQ A;  1POQ A;  3AP9 A;  3RZK A;  3KGZ A;  4EWA A;  3AM2 A;  2ADE A;  2CAV A;  2VZV A;  4AQS A;  2J7M A;  3WX5 A;  1JYX A;  3K46 A;  4RS5 C;  1PZ9 A;  2A6Z A;  2DFC A;  2VQA A;  3IMM A;  4LE4 A;  1W9Y A;  3RMD A;  3VD7 A;  4ES8 A;  1H4G A;  5GZF A;  1G6N A;  3HN3 A;  1FMD 2;  1RUI 2;  2R6Q A;  1QJY 1;  2VUA A;  3E1F 1;  5FPB A;  1HQW A;  4CSW A;  3FX3 A;  2W1S A;  5H37 A;  4NHY A;  2XGX A;  1KDM A;  2Y38 A;  4FOQ A;  1OF3 A;  4ZXE A;  3WF3 A;  1V6J A;  4Y1X A;  3T4H B;  4K1Y A;  1YJL A;  1LDK E;  4OMC A;  3LA3 A;  4LKF A;  1W8W A;  1UY4 A;  3AZZ A;  1VRH 1;  2B8I A;  2ET7 A;  4FJG A;  5FLJ A;  4YAR A;  2NN8 A;  5A3L A;  1IPK A;  3VUO A;  2ARA A;  4YGE A;  4UW3 A;  4UI9 L;  4MXV A;  1X9T A;  4LE3 A;  3QES A;  5F7U A;  2JJ6 A;  4G9S B;  2XL9 A;  4J1W A;  2PN5 A;  3GJA A;  3POE A;  3E6C C;  1VRH 2;  2Y6J A;  2TUN A;  1LED A;  1IS3 A;  2FDG A;  3N9P A;  4Y1U A;  4Q27 A;  1MEC 3;  4LOT A;  1JXN A;  5FZE A;  2D44 A;  5LA2 A;  4CCL A;  1FPN 3;  4CZS A;  2MMB A;  4XCA A;  3JCI A;  2QQV A;  3VHN A;  1GLH A;  1IGO A;  4UBG A;  2XJR A;  5FXX A;  3GHN A;  5L9V A;  2FBE A;  4HN1 A;  4CUA A;  2P3J A;  1PO1 2;  2ZGO A;  1XRU A;  2E33 A;  3OPW A;  4CCK A;  4E4B A;  4EP9 A;  1IKQ A;  1NOV A;  2DUP A;  3IIA A;  4LKE A;  5L9R A;  2R1D A;  2D6L X;  3GZT B;  2J1R A;  3FHA A;  2DCZ A;  4LT5 A;  1OUS A;  3BOW A;  1SPP A;  2R07 2;  4K8F A;  3RG0 A;  5C3P A;  5LCW L;  1AR9 2;  2P4E A;  1TMF 3;  2VZP A;  1MVQ A;  1WGP A;  5JMC A;  1OD5 A;  1E5S A;  4JHT A;  1R09 3;  1UYZ A;  4FPG A;  4SLI A;  1V6K A;  2DVD A;  3ZVX A;  4AAP A;  4A4A A;  2D6P A;  2ZEZ A;  4WZC A;  3VBS C;  3BVO A;  1H1A A;  1RUD 1;  2A5Z A;  3AZY A;  4KI4 A;  2AR6 A;  4WVM B;  2I07 B;  1PIV 3;  3KHB A;  1O8P A;  5FYC A;  4GZ9 A;  3WHU A;  4ET7 A;  2HWB 1;  3ZO0 B;  1R64 A;  2GP3 A;  2RCU A;  2UYA A;  2GP5 A;  5FZA A;  4AQ2 A;  1LHO A;  4XHB A;  3RZM A;  3I49 A;  1D7P M;  4FPK A;  1GQP A;  4H7M A;  3TL8 B;  4P9L A;  4NIA A;  1R1Z A;  1UY0 A;  3NW4 A;  2XVK A;  2JIC A;  3MF9 A;  1Y7B A;  2BEO A;  2D6K A;  2R06 3;  4QNC A;  2VR4 A;  4QB2 A;  1F4H A;  4DRR A;  4M0H A;  4XXA A;  3HP9 A;  3ELN A;  2ZZJ A;  1U0A A;  3T2T A;  1IS4 A;  1J1T A;  1R08 3;  2P5G A;  2JIG A;  5JIU A;  4BH9 A;  3I3M A;  2CL2 A;  1NG0 A;  3BU0 A;  4I30 A;  1XVB E;  2HWE 2;  1R1A 3;  2BDR A;  2VZS A;  2K9Z A;  4M01 A;  3NV3 A;  3AP4 A;  2K0G A;  2K2S A;  3Q8A A;  3IBM A;  5I8S A;  4IEU A;  4TLF A;  4XDQ A;  2JQT A;  1O3T A;  1RUO A;  2FDH A;  4RHV 1;  2G9F A;  2J1E A;  1CD3 G;  4QX5 A;  4NVP A;  1IS5 A;  4KI6 A;  4OMD A;  2WUH A;  2ENR A;  4UFL A;  2HEW F;  1W3X A;  2VQU A;  3H8U A;  2X10 A;  3CHX A;  3N9O A;  1ND2 C;  2BNO A;  4P5H A;  5CBL A;  3AMQ A;  3TAG A;  4NRP A;  4ARY A;  4BMB A;  4IGQ A;  3U1X A;  1MZ5 A;  4YNI A;  3UL2 A;  2YPD A;  3H7J A;  1AUY A;  4UW4 A;  3VZM A;  1RMU 3;  1NA1 B;  4Q8K A;  4XQ4 A;  1AR7 2;  3VL8 A;  3TEW A;  3BIE A;  2R1B A;  5M0T A;  2JH8 A;  2TBV A;  2I74 A;  1EUT A;  4M3C E;  3LSD A;  4K21 A;  5E89 A;  1W9W A;  1NAE A;  1AYN 2;  2KR2 A;  5IVB A;  2F17 A;  5L7O A;  3ZSJ A;  3RWU A;  2HEY F;  3PMS A;  2B5H A;  1MS4 A;  2Z42 A;  3UGH A;  1H2M A;  2E26 A;  4P9I A;  2JHC A;  1GWL A;  1ZRI A;  4JKK A;  2DVA A;  4C90 A;  3IPV A;  1NZC A;  1OVP A;  1NLQ A;  4B8E A;  1WCD J;  1UX7 A;  4MSV A;  3O1R A;  2QDN A;  3RZZ A;  3LEM A;  1YUD A;  4OZX A;  4EJR A;  4QXH A;  2P34 A;  4P9X A;  5FYB A;  3JBG 3;  4V2W A;  4CEW C;  1XSQ A;  4FTE A;  3U11 A;  4ZU4 A;  2XH6 A;  4FSJ A;  4CCJ A;  1RED A;  1NX9 A;  2UY9 A;  5DAB A;  3QLQ A;  4Q4W 3;  1CAV B;  5BNN B;  5FPL A;  3ZR6 A;  2QQN A;  1BZW A;  1G8W A;  1YLL A;  3VBH B;  2WN2 A;  1JMU B;  1H4H A;  1VAL A;  1XOY A;  2D6M A;  4BQ5 A;  1GNH A;  2G19 A;  2ZAB A;  3VBU C;  4JS5 A;  2FW3 A;  4FJM A;  2YGL A;  4YW3 A;  1AYN 1;  1G9B A;  1UZ0 A;  1ZRF A;  1BEV 1;  1LHN A;  2RG4 A;  3NAE A;  1DU3 D;  2MEV 1;  3GXU A;  1PZ8 A;  2P5B A;  3THC A;  1AR7 1;  4HVQ A;  3WF1 A;  4LOS A;  1W2T A;  3ZXF A;  3BPZ A;  5IK4 A;  1W9F A;  3VHP A;  4BXS V;  5C4W C;  4EWE A;  5E1R A;  3KF3 A;  3NDK A;  3D5O A;  1W8O A;  3A23 A;  1XU5 E;  5A33 A;  1RVF 1;  4AZZ A;  1N3Q A;  4RN5 A;  1SG3 A;  1UD1 A;  3H7Y A;  4Q0U A;  4Q0P A;  1W04 A;  2Y0O A;  3IM0 A;  4GUL A;  3O0W A;  2H6C A;  5A7N A;  5ACA 3;  1Q8S A;  4BQ2 A;  3MV1 1;  1AJO A;  1XE0 A;  3HQX A;  5CKM A;  3AMH A;  1YNA A;  2OQ6 A;  2VGD A;  4K40 A;  4E4D X;  4MAD A;  5K0U B;  4WZF A;  1Z0H A;  2WNV A;  4YM2 A;  1JZ8 A;  3ZPO A;  2GC1 A;  3HN1 A;  4UFK A;  5CVR A;  5FK7 A;  5T5O A;  1W28 A;  2UU8 A;  1PMJ X;  1LNS A;  2KM2 A;  4CTE A;  3J2P A;  1EAH 3;  1JHN A;  1NUK A;  4P14 A;  2H6B A;  3F95 A;  4GD4 A;  5KHJ A;  1XL3 C;  2BVB A;  4PDW C;  1QIQ A;  2GME A;  3SNM A;  5JSR A;  3H3U A;  2RVA A;  1RUG 3;  1W8H A;  1ZBA 2;  2VPV A;  2CY6 A;  3MV0 1;  2QCS B;  3MUZ 1;  3ZSM A;  2HWB 2;  4CXX A;  1E5H A;  5A7W B;  5FMO S;  3ACG A;  3BTY A;  1N47 A;  4YW4 A;  2UUR A;  5BNO C;  2NP0 A;  4JV4 A;  1XND A;  2HJI A;  1FV3 A;  3POJ A;  1VBB 2;  4QKD A;  2PHT A;  3SEE A;  5EPA A;  3LDB A;  3QEP A;  4JTN A;  3IWZ A;  4L9B A;  3VKM A;  2J1T A;  1AYN 3;  2HWD 1;  2EIG A;  1PM4 A;  4XFA A;  3WNX A;  3ZR5 A;  1AR9 1;  1C8M 1;  4IW3 A;  1FZ9 E;  2R07 1;  2A3Y A;  3NO8 A;  5FJH A;  3WVJ A;  2WIN B;  4RYD A;  4JGY B;  3ENR A;  5FP7 A;  2VE1 A;  1EP0 A;  3NL1 A;  1RJ8 A;  1BMV 2;  3L0M A;  1VBC 3;  5DUW A;  5A3U A;  3RDI A;  5KXE A;  4A6O A;  4QXB A;  1PO1 1;  2VC9 A;  1H30 A;  2BRT A;  4TLG A;  5A3O A;  5JAX A;  5EFU A;  2WL1 A;  4Q4X 1;  2CAU A;  2G1M A;  1ZBE 1;  1FZ0 E;  4CU8 A;  3R4U A;  5LZ6 A;  4AK3 A;  4PF1 A;  5FZ9 A;  2VBB A;  1WW5 A;  1YHF A;  4GAZ A;  3WDY A;  3K75 B;  4PJY A;  4RQP B;  1FI2 A;  5CNA A;  1V6I A;  2ZGT A;  3ACL A;  2VMC A;  2WC2 A;  3K3N A;  4UWD A;  1EYB A;  1HRI 3;  2VMG A;  1LOB A;  2VD7 A;  1TEI A;  1X50 A;  2VOV A;  3J9S A;  1U5Z A;  1JZ3 A;  3JZV A;  1ST8 A;  1OQ1 A;  2AEY A;  4EZ4 A;  2ZTN A;  4FQZ A;  3CNA A;  3WOG A;  2B45 X;  1IPS A;  1YFU A;  2EAA A;  4A3X A;  2PLV 3;  4CEY A;  1QXR A;  1RUJ 1;  3AVS A;  1X8E A;  2HBT A;  3GZA A;  3ILR A;  4HOO A;  4DY5 A;  4D94 A;  3O1U A;  4H14 A;  5DDJ 1;  1RYY A;  3N9N A;  4TTG A;  3BTX A;  2Y34 A;  4Q1R A;  1GV9 A;  1RIT A;  4Z2A A;  2W1W A;  2PHU A;  2ARX A;  3PJQ A;  4Z82 A;  1X36 A;  1SHW B;  5BY5 A;  1POV 3;  3V64 A;  1FS1 A;  1OUX A;  4HLT A;  4PI0 A;  4GWM A;  2QZ3 A;  3IDC B;  3OGJ A;  3S0M A;  4DY3 A;  2ATQ A;  4XF4 A;  4AEM A;  5LY2 A;  2XVL A;  3GCX A;  4F8A A;  5KHK A;  1DG6 A;  3LD8 A;  2VVE A;  3OJB A;  4UFH A;  4RA0 A;  2DTY A;  1MQT C;  3FLT A;  1HB3 A;  5I8T A;  3ZFG C;  5FDB A;  2JG9 B;  3T4V A;  5FZ1 A;  5K9Y A;  3MIC A;  2FCT A;  4Q4V 1;  2V09 A;  4QPG A;  3VD3 A;  1L7R A;  3HJR A;  3QEW A;  3BI3 A;  3AXD A;  4K8R B;  1VB4 A;  1CZS A;  1TNF A;  2WNU A;  2ZGK A;  2ZAA A;  3AP6 A;  3J8F 3;  4XFG A;  3MI8 A;  3LDS A;  1JTZ X;  2X5I B;  1KFX L;  5FP9 A;  1PVC 3;  4AGG A;  3OGK B;  1UNB A;  1J3R A;  1DDL A;  5EHD A;  2LUW A;  1LB2 A;  3N1B A;  3HWJ A;  3LKJ A;  2XHN A;  1OQD A;  4COY A;  2IFW A;  4OQ9 A;  2DTW A;  1QH7 A;  4M41 A;  3A21 A;  3DCQ A;  1LUL A;  5LEJ A;  1FOD 2;  3FWE A;  4XF9 A;  5A3N A;  3RS6 A;  2HD0 A;  2VO5 A;  1OOP B;  1HLC A;  5AC9 2;  3SH4 A;  2W9X A;  1RB8 G;  4LBQ D;  2P6H A;  3VDD B;  3OUH A;  3IT8 A;  1Z7S 3;  3HQU A;  3LEG A;  5A1A A;  3SPZ A;  1R1A 1;  2QQJ A;  1DQ0 A;  4AI6 A;  1U5X A;  4LA2 A;  5FPZ A;  3U4X A;  1SEF A;  4WM8 A;  2OZJ A;  2WZP P;  4OQ8 A;  1O3S A;  4DS0 A;  1AR9 3;  1NA1 C;  1LOD A;  1LR5 A;  1PK6 C;  4XJ9 A;  4ZZ5 A;  3HNM A;  3GZU C;  1PNF A;  1ND2 B;  2VVD A;  3IZO A;  2E53 A;  2Z4F A;  4JGY A;  3OGL B;  1JI6 A;  2R04 1;  3DV8 A;  3IMN A;  1VMJ A;  3LFI A;  3N7L A;  3S7I A;  5C8C A;  1GOH A;  1S2K A;  2WSU A;  4MHR A;  3ZMN A;  3ETQ A;  2Q30 A;  4EN9 B;  2PAM A;  4XDP A;  1S0C A;  4QQP A;  3TAY A;  2XJT A;  3ZFE C;  4MV2 A;  5F3I A;  3LSE A;  2FZ1 A;  1KQR A;  4W6W A;  4AHZ A;  4QGN A;  1WLT A;  2RDN A;  3O1S A;  4XET A;  1UZW A;  2LAL A;  5DUX A;  3I3B A;  3PVE A;  3GM8 A;  5D2A A;  3ZFG B;  1YJK A;  3N35 A;  4C0H A;  1UCX A;  3BGA A;  4JZR A;  1ASJ 2;  2Q5T A;  4QX7 A;  4CDW B;  5C3S A;  1AF9 A;  1JUH A;  5A1L A;  4HXC A;  4SBV A;  2R06 1;  2V72 A;  3ITQ A;  3HL8 A;  3K4D A;  2YFU A;  3QER A;  1R1A 2;  4GAM C;  3ASI A;  3MGU A;  4YWA A;  1JN2 P;  5DAX A;  5A3M A;  1K5J A;  1ULG A;  5JOZ A;  4V1P A;  1JU4 A;  4DTM A;  2ZML A;  1PO2 3;  5DAQ A;  2ZJC A;  3ZFF C;  1B09 A;  2Q4S A;  1W6O B;  3VV1 A;  5C5T A;  5C5U A;  5EJZ B;  3P1I A;  2DU0 A;  4Q4X 2;  4DFS A;  1B35 C;  4PDW A;  2RM2 3;  2BWA A;  5CFD B;  5KHH A;  5BXX A;  1LCL A;  4MGK E;  3ZN6 A;  5JZG C;  5JZG A;  4DU3 A;  1FPN 1;  1O4Y A;  1QWR A;  4P9Y A;  3R4D B;  4ZHN A;  3VDD A;  2PHR A;  5FP3 A;  1UZZ A;  4E4Z A;  2OX0 A;  1WAJ A;  2RDR A;  4MH0 E;  1BYH A;  4AHW A;  2IXJ A;  2QKD A;  2WO3 A;  2Y6L A;  4H7L A;  4ISQ A;  2W08 A;  3JB8 A;  4FJX A;  4PQQ A;  2VQ0 A;  4IV1 C;  3FUO A;  5APA A;  3H8R A;  2DFB A;  4M3C B;  1XMH E;  1KS4 A;  3IB3 A;  3Q9O A;  2JDM A;  3ZYB A;  3SCX A;  1ZRR A;  2LF3 A;  2ERF A;  3C7E A;  4Y33 A;  5FK8 A;  1K3I A;  2EA7 A;  4RS5 A;  4Q4Y 1;  5FRE A;  3FMG A;  3MFA A;  2FDF A;  4UBH A;  1OLQ A;  2VNO A;  1NE6 A;  4I6J B;  4CP2 A;  5JXI A;  3GCW A;  3JD7 1;  3LPG A;  4Y1Y A;  3NNL A;  4BE3 A;  5LBC A;  1BCX A;  4K1Z A;  2OZS A;  3B9I A;  2UYB A;  3QEX A;  2BW8 A;  5FZC A;  3PDQ A;  1OA3 A;  3VBU A;  3LAG A;  3OPZ A;  4O65 A;  3SQ0 A;  1HQL A;  3ZXE A;  1QJF A;  2EXH A;  4LK7 A;  1DZT A;  3RQ0 A;  4QPY A;  1YYN A;  1VAM A;  1HRV 2;  3AL5 A;  5H9P A;  3TAF A;  3FE5 A;  5IAV A;  2QQO A;  4QPG B;  4H2A A;  4LUL A;  2D3R A;  4C91 A;  4LOR A;  1LGN A;  2FMD A;  4L97 A;  1ZZ8 A;  3FC0 A;  1L7L A;  4IE4 A;  3ZYG A;  2B42 B;  2E7A A;  3OBZ A;  1OPM A;  4Q5O A;  1H6Y A;  1LHV A;  4L2N A;  1ZBE 3;  1N1Y A;  4QPI B;  1WCS A;  2MNG A;  3OGR A;  2RJ2 A;  3B3Q E;  1CPM A;  1XSR A;  3MUY 1;  1VB2 A;  4IE7 A;  5KWR A;  1O8S A;  2GAU A;  3WCS A;  3BKZ A;  3USU A;  3EXU A;  2DTU A;  3I59 B;  5FXW A;  2GDF A;  4FJL A;  3KD1 E;  1H2N A;  2BFU L;  2D97 A;  2YG0 A;  2ZOE B;  4S2G A;  5FY4 A;  3SUQ A;  3N9Q A;  4FTS A;  2Y33 A;  3KMH A;  3WQ7 A;  3PTY A;  1I1E A;  3WW3 A;  2VMI A;  5CIR A;  5FZO A;  3B00 A;  4PI2 A;  1UZY A;  4GWN A;  3KD5 E;  3THT A;  4KH9 A;  5DZG A;  3ME2 A;  4B3N A;  3CZU A;  4YZ4 A;  4PQ9 A;  5T54 A;  2NMO A;  3RWK X;  1QEX A;  2VXR A;  2WLQ A;  2DUR A;  4NRQ A;  1URX A;  4LIT A;  1EAH 2;  4OZO A;  4QKB A;  4AW7 A;  2Z69 A;  2ZHM A;  1J83 A;  1GQG A;  2BOJ A;  4CDW A;  3CFP A;  1L7Q A;  3KVA A;  4CDX B;  2Y0I A;  3ZYR A;  3QEV A;  3H1Y A;  2J22 A;  5DZF A;  4D0Q A;  4DTN A;  4XUT A;  5HCA A;  4ZS2 A;  5JZG B;  1XVG E;  1FYU A;  2VBP A;  3LDK A;  1I9R A;  2ZGQ A;  4BQ4 A;  5GLU A;  1LGB A;  2R0F A;  1CPN A;  5IVY A;  5BNP A;  5J7M A;  5E6H A;  3RFR A;  5KBF A;  2J1S A;  3BUC A;  2WDB A;  4NE9 A;  5I91 A;  1NLS A;  1IHM A;  2QVS B;  4MVT A;  5IUQ A;  3X29 B;  2X8K A;  5IRE A;  3M2M A;  2J1A A;  5K0U A;  1QU0 A;  2BER A;  4UW6 A;  1VBC 1;  1V00 A;  5FRA A;  4JCK A;  4S2H A;  2GN7 A;  3AL6 A;  4I0A A;  4LBJ A;  4Q0Q A;  4D8M A;  3PHM A;  1VBC 2;  2VZ1 A;  3GF6 A;  4DIQ A;  1VBE 3;  1WZX A;  5FWE A;  5CIS A;  2G4I A;  1UL9 A;  5J3U A;  4QHO A;  1DQ5 A;  5CAD A;  1YCI A;  5T55 A;  1NQJ A;  2WAO A;  4AR2 A;  1Q5O A;  4NWW A;  3LEK A;  5FZ3 A;  2ZKN A;  4OUE A;  5FY8 A;  5HXV A;  5A33 B;  1WBF A;  4P9J A;  4M3U A;  4E8C A;  2R32 A;  1EUU A;  4YLZ A;  4XFC A;  4FJN A;  4MHU A;  3OUJ A;  4NPM A;  4PCR A;  2P1O B;  1YRZ A;  4X6Q B;  1DYP A;  1YIF A;  3TBD A;  1AXY A;  1VAV A;  2ZEW A;  2Q1Z B;  2BOI A;  3QCW A;  3HMY A;  4N53 C;  1HRV 3;  5C8C B;  1VIW B;  3EJK A;  5F5Q A;  3BAL A;  5LAS A;  2A1X A;  2XKP A;  4B1M A;  1G9D A;  3K51 A;  4GAL A;  4BK4 A;  2WFF 3;  1DFQ A;  1EAH 1;  3GGL A;  4CEW A;  2OYQ A;  1J3Q A;  1FYZ E;  2WS9 2;  4QM9 A;  3VBO B;  2VMF A;  5IJR A;  1H2K A;  3FBM A;  3L2H A;  1N1V A;  2BZD A;  4JKL A;  2G9G A;  3RNS A;  5I0D A;  2YU2 A;  4YG3 A;  2K5S A;  3C8X A;  3VBU B;  2HWC 3;  2PXJ A;  2Y6F A;  4EN7 B;  1X8M A;  4AE2 A;  2E9Q A;  3WY6 A;  3ABZ A;  2A6V A;  4AG4 A;  1F31 A;  4BQW A;  2ZXQ A;  1NCQ C;  5KC5 A;  3NE6 A;  2VCB A;  4MGY E;  2PMW B;  2RJL A;  4AI2 A;  3FL7 A;  1V0A A;  1TZO A;  3LB9 A;  2PAK A;  4PBP A;  4U36 A;  5FLI A;  4BIO A;  3SQ1 A;  1QXP A;  5EZW A;  3AKQ A;  3KF5 A;  4OUL A;  3AZV A;  3DEC A;  3UES A;  2W94 A;  1XMF E;  4R9D A;  1UYP A;  4LTA A;  4RS5 B;  5LK5 A;  4CYD A;  5B4N A;  5GZC A;  1ZZ7 A;  3NJX A;  2ETE A;  3OGM B;  3DYO A;  1XBF A;  4I09 A;  5FPV A;  5GLW A;  3W59 A;  2WZR 1;  3VDC A;  4CEY C;  5J09 A;  3APB A;  4CUC A;  2WN3 A;  2WJS A;  1Y9G A;  2YC2 A;  5A7Q A;  1XVC E;  4GKX A;  4OUS A;  3N7J A;  4LBK A;  2VNV A;  5FMO L;  1Q9X A;  4BQ3 A;  3PVN A;  2BGO A;  3WR0 A;  2B9U A;  4W8J A;  3UIQ A;  4P9W A;  2BUK A;  3WXP A;  2TNF A;  1QMJ A;  5K4L A;  1FOD 3;  3MID A;  5DG1 A;  1MEC 2;  3CU7 A;  4M3C F;  3UV9 A;  4M4R A;  4GJY A;  1ULE A;  3C6N B;  1TVG A;  5F2W A;  3LFM A;  3POG A;  1LOE A;  2V73 A;  4FOW A;  2A71 A;  1TME 1;  3D6E A;  3ACF A;  1ZNP A;  1NEX B;  4XTM A;  4HKL A;  2NMN A;  4AVC A;  2VTX J;  3BOD A;  3I2I A;  4JHZ A;  3MDP A;  1CGP A;  1VJ2 A;  3OY8 B;  2Y6H A;  4QGL A;  1FZ4 E;  3MYX A;  2IC1 A;  3PLQ A;  5IFP A;  3DN7 A;  1GNZ A;  4QD2 A;  2GC2 A;  1FZ3 E;  4HVR A;  5FZM A;  4KBB A;  4KHN A;  3KM5 A;  2TEP A;  1LEM A;  1WUV A;  2WNU C;  4GIQ A;  4Q0V A;  1SFP A;  3M7A A;  5KHG A;  1TMF 2;  3H9A A;  4S2D A;  5DPN A;  5FUP A;  2QBX A;  2JDY A;  2D43 A;  5F3G A;  3WF4 A;  3HQR A;  3WT3 A;  2ZEX A;  5CU1 A;  3B94 A;  2WO2 A;  3O0V A;  4FOV A;  1GWK A;  2Z5W A;  1NLR A;  4AVT A;  1O3R A;  5LAT A;  5I8Y A;  3NQH A;  4ASM B;  1IG9 A;  3ZN6 B;  1QJE A;  1ASJ 3;  2JD9 A;  3DF0 A;  4DXZ A;  5IVF A;  2DUQ A;  3LF7 A;  1CVN A;  4W4Z A;  4IV1 A;  1J58 A;  2C4X A;  2GMM A;  1APN A;  4N43 C;  2VVF A;  4FPC A;  4XW3 A;  3J7N A;  4AKG A;  2HWD 3;  3AKR A;  2BGP A;  2UWC A;  5FZO B;  2ZHK A;  3RSJ A;  5LBF A;  4XMA A;  1PO2 2;  1GP6 A;  2WNO A;  5FYZ A;  3ZLI A;  2H0V A;  5F32 A;  4COV A;  2VJX A;  1SQ4 A;  1S0D A;  2XHK A;  2F4L A;  3WIN E;  3SIT A;  3USU B;  2WQ8 A;  1QY4 A;  4FJ9 A;  1TE1 B;  2A6W A;  4IET A;  2G9Z A;  3MLJ A;  3ACH A;  4PLO A;  3FJS A;  3V65 A;  4LO8 A;  1LES A;  3PUA A;  4PIZ A;  5FFO C;  2VZ3 A;  5FKB A;  5FZI A;  2A3X A;  2WLP A;  3I7D A;  1W6Q B;  4KHQ A;  4QU1 A;  4OLL A;  1D2S A;  1XYN A;  1QXJ A;  5BNP C;  5FZ4 A;  4ICG C;  1GOF A;  1N3O A;  5A7S A;  1GZ9 A;  5J98 B;  4XZU G;  2PLV 2;  1O4Z A;  4XIK A;  1Q8O A;  1AYM 2;  5FO8 B;  1DQ6 A;  3M3C A;  5FPU A;  1CWP A;  3I97 A;  1NT0 A;  2FDJ A;  5I0T A;  2DCK A;  2I45 A;  4B4Q A;  1BBT 3;  4IT5 A;  4XIL A;  4LHS A;  1YC6 1;  3NST A;  4QKN A;  4QWN A;  5LA0 A;  4ZZ8 A;  1V6O A;  3E5X A;  4XUN A;  1ND2 A;  2P1Q B;  1SLL A;  4YZ1 A;  3WG4 A;  1Q56 A;  3LZI A;  1BJQ A;  1CIW A;  2JXA A;  3III A;  4B1L A;  1UY2 A;  3ZXL A;  1SFY A;  4FT8 A;  2E6V A;  1FMD 1;  1W2U A;  2YPJ A;  5F5I A;  4X6R B;  1BK1 A;  2OA2 A;  1RUD 3;  2JDU A;  3URF A;  5JXJ A;  5FLH A;  3OUI A;  4DUX A;  3RMB A;  2VW1 A;  3SCH A;  2FYO A;  4AFA A;  4HKW A;  1JUI A;  2P37 A;  2EIE A;  4V2V A;  4WM7 C;  2GNM A;  4MX3 A;  4RR3 B;  3WZ1 A;  4N43 B;  2WAB A;  2VH9 A;  3J8F 2;  3WDV A;  4WVZ A;  1MS9 A;  4NPL A;  1YFY A;  2JE8 A;  5EJ3 A;  2VQT A;  4AVV A;  2R30 A;  3R6S A;  5CFC A;  1KRI A;  2ZZQ A;  4BME A;  2JH9 A;  4NIG A;  1AR8 2;  1UF2 C;  4DTO A;  3K77 A;  4YW1 A;  3WF0 A;  4KWJ A;  2ARC A;  4O7X A;  2PHX A;  3HR9 A;  4GB3 2;  3SH3 A;  1HV0 A;  1X7N A;  3QEI A;  5BNQ A;  2YRO A;  1OH3 A;  1UU5 A;  2ZGR A;  4QQO A;  2YYO A;  2PEL A;  1JOP A;  1ZX5 A;  3SUP A;  1BHG A;  3AYE A;  1SLB A;  2QQL A;  4HZF A;  5FZB A;  1MZE A;  3AMN A;  3ZYF A;  2P1N B;  5L19 A;  3O1P A;  3MO4 A;  1CON A;  4RQP C;  1UU6 A;  2DU1 A;  2GU9 A;  3OD0 A;  1VBD 2;  4E2Q A;  1GQH A;  1SDD B;  1C1F A;  1Y4W A;  1FPO A;  4ZS3 A;  5FO7 B;  4MGT A;  3CKH A;  2H4T A;  3NHG A;  4LNV A;  1I3H A;  1HB2 A;  4DTU A;  2XON A;  3LPF A;  3MIB A;  3DEM A;  4R4X A;  2X09 A;  5ISL A;  1NCQ A;  2HBU A;  3K48 A;  5L73 A;  5JIA A;  3MPB A;  3RRD A;  2DYC A;  2VBD A;  4E2S A;  2E7T A;  4I9Q A;  4ISR A;  1W8U A;  4XF0 A;  1N1S A;  1ASJ 1;  3WW1 A;  3QNN A;  5FZ7 A;  2MW2 A;  4DTP A;  3AVR A;  1D0G A;  1NCR C;  1AHS A;  1BXH A;  3JXS A;  4JGZ A;  5FZ0 A;  4BQY A;  4CCM A;  5FMC A;  3DXT A;  4CDQ A;  4NRM A;  2CYF A;  2ID4 A;  4EQV A;  1LOF A;  3S57 A;  4IEX A;  2J1U A;  2EXI A;  1CES A;  4WBB A;  1C5H A;  4LKS A;  4W65 A;  4IV1 B;  4M3T A;  1SDW A;  3PUH A;  3RMY A;  3RYP A;  5J96 B;  2ZGL A;  3C95 A;  1IQA A;  1H8V A;  1REF A;  2QE3 A;  3BYW A;  3D82 A;  4UFI A;  4XBN A;  5C9A A;  4CU7 A;  5T52 A;  3HD8 B;  3NRU A;  1SCS A;  1XB9 A;  3HBK A;  3T08 A;  2QZ2 A;  1N1C A;  1QNY A;  2XBO 3;  2JE9 A;  2Q1F A;  1OH4 A;  5DDJ 3;  3GDB A;  2JG9 C;  3PNA A;  1NA1 A;  4LUM A;  4A45 A;  2Y8K A;  1AYM 1;  2RS3 3;  1XXN A;  2YGM A;  5L36 A;  5LA1 A;  1H2L A;  3SXW A;  1MAC A;  2DEB A;  1ZA7 A;  3E4Y A;  5FYM A;  3VHR A;  1FV2 A;  4Q4W 1;  4G3Y C;  4URT A;  2RS5 3;  2ZHL A;  1K5M C;  2BJS A;  5FY5 A;  5FYT A;  1HDK A;  5A32 A;  4IV3 A;  1ULO A;  4MET A;  4EPH A;  4FXG B;  1Q9Y A;  1HN0 A;  1W6P B;  3DL3 A;  3ZFE A;  3E5Q A;  3LOB A;  3OY8 A;  5A3W A;  1UKG A;  1VBA 3;  4BXF A;  1BBT 2;  4RG8 A;  1YO8 A;  1ZA4 A;  1F5F A;  2W1U A;  3EYP A;  3OB8 A;  4JDO A;  4LQR A;  4WM8 B;  4BPZ A;  1JYN A;  5GLT A;  2O14 A;  2YDE A;  4JX0 A;  3T2P A;  3KGL A;  2AC1 A;  3J7H A;  2QXF A;  2VZU A;  5J1X A;  1BQP A;  1AVB A;  2KXL A;  2WZR 3;  2XJV A;  4LBO A;  4B7E A;  4QU2 A;  2B7M A;  1T2X A;  4MGZ E;  1AR8 1;  1ENX A;  1RGS A;  4YRD A;  2A75 A;  4K20 A;  1DQ4 A;  4QX8 A;  4R9B A;  2IUW A;  4IE0 A;  4JAA A;  1D4M 3;  1SMV A;  3R05 A;  5GLZ A;  1FZ2 E;  1NCR B;  2CWM A;  5C8W A;  2RS1 3;  3MBW A;  3O1T A;  3AX4 A;  3RJ2 X;  1IQD C;  1QGL A;  2VNG A;  3HOB A;  1W9S A;  2XJQ A;  4LO6 B;  4R9C A;  3RI8 A;  1DF0 A;  4HBN A;  1BK0 A;  1RUI 3;  2HYK A;  4RL5 A;  2JDK A;  4QKF A;  4AI0 A;  1ND3 C;  1OFN A;  1R08 1;  3POF A;  4YZ3 A;  3TB0 A;  1S2E A;  4PT6 A;  4M3W A;  1TMF 1;  2KA3 A;  1FXX A;  4FJ7 A;  5F8P A;  3S5A A;  2BNN A;  1OKQ A;  4LBM A;  3TAE A;  1UQX A;  3KT7 A;  2WRA A;  5AVP A;  5FZG A;  3HNY M;  1K5M B;  1SAC A;  1PX4 A;  2JPN A;  1UAI A;  4OHV A;  4MLO A;  2PAE A;  4CUG A;  1PGL 1;  5BUV A;  1BVV A;  1FZ7 E;  2XG3 A;  2Z79 A;  4KGQ A;  4YVS A;  2ZGS A;  1HXS 3;  1DQ2 A;  2XBO 1;  1VBD 3;  3G7D A;  4IND A;  4LEJ A;  3H50 A;  4ITC A;  1V6L A;  2SBA A;  1EPW A;  2OXB A;  3EQE A;  3LZZ A;  4PIX A;  4PLN A;  3ZOI A;  4YM0 A;  4BB3 A;  1ZRD A;  4GB3 3;  1Q8Q A;  4JDN A;  4R8H A;  2VCA A;  1Q43 A;  3M1H A;  4I0W B;  4DMI A;  3WP6 A;  2W52 A;  1XYO A;  2JHA A;  4XPV A;  4Z07 A;  1JOB A;  1ONA A;  2AYH A;  3HT1 A;  1GNY A;  1O5U A;  2HEV F;  4CCC A;  1PX3 A;  3FZ3 A;  1F15 A;  1ZBE 2;  1IG0 A;  2W92 A;  1OA4 A;  2XWB B;  2A3W A;  2ZAC A;  3R0R A;  4X5M A;  2VOT A;  4I9L A;  4YYO A;  2Q0A A;  1VRH 3;  3EMR A;  3ZMO A;  3FN9 A;  5F37 A;  1QOT A;  1OF4 A;  4Q29 A;  5FBJ A;  4YVW A;  4CDU A;  1XVF E;  3JQX A;  2C9A A;  2GH2 A;  2MPF A;  4LHL A;  4Y26 A;  5T50 A;  4GKY A;  4OHZ A;  2WT2 A;  1WW7 A;  3GAL A;  4RD7 A;  3I54 A;  2YFZ A;  2ZX4 A;  1ULC A;  5T3N A;  5L9B A;  5BV6 A;  1M4W A;  1X33 A;  4DZG A;  4TZD A;  1A8D A;  4AVA A;  1I5P A;  1PK6 B;  2JDH A;  1KEX A;  2OII A;  1JW6 A;  2VU9 A;  3AXE A;  4YW2 A;  1PGS A;  5A3T A;  4NN0 A;  2VCC A;  3OBA A;  4NR1 A;  5FJK A;  1P22 A;  1FX5 A;  1H8T B;  1ND3 B;  1RUG 1;  1VBB 1;  2RS3 2;  4JKM A;  1WLW A;  4WV8 A;  4AF9 A;  3SUO A;  3POY A;  1PGW 1;  1F4A A;  3NV2 A;  3OPT A;  2WWU A;  4NO4 A;  1W2N A;  1UO9 A;  2ZGM A;  2JD4 A;  3U4S A;  3LEI A;  3M4F A;  1W8Z A;  4XFI A;  1F35 A;  3MF6 A;  3ZYP A;  2ORX A;  1W6N B;  3KSC A;  2FQP A;  1ZBA 1;  3WDX A;  1ULD A;  1HB1 A;  2P6C A;  4AFD A;  1SCR A;  3I4I A;  4QX1 A;  5LWB A;  3EB7 A;  4RQP A;  4X5N A;  3U10 A;  2CSG A;  1ZZC A;  3N3H A;  5JR2 A;  1W0O A;  4YGC A;  2QQI A;  1YFW A;  3OBT A;  4BU2 A;  1MS0 A;  5C4W A;  3PIJ A;  2B8M A;  5IW0 A;  3VBF C;  5C9A C;  3RYK A;  2JDZ A;  3FFZ A;  4DEQ A;  5CFC B;  4HVO A;  4KU7 A;  3LA2 A;  4E4H A;  5KXD A;  3OYW A;  1I5Z A;  4WM8 C;  1GZW A;  2GAL A;  1AXK A;  3KWV A;  3VBS A;  3ZIX A;  3IDB B;  1YWK A;  2A6X A;  4FVM A;  3GBF A;  2P1P B;  1ZZ6 A;  4HK9 A;  2Q8O A;  3T09 A;  3OCP A;  3T0D A;  5IZ7 A;  2BNM A;  1LRH A;  2QQU A;  3SUN A;  1UPS A;  1W6O A;  2DCJ A;  3BVC A;  4D6Q A;  4K6B A;  2FCU A;  2RJK A;  1RUC 2;  1CR7 A;  5A6X A;  4X8P A;  3S30 A;  1WD3 A;  5EQU A;  4XAB A;  4XFF A;  2EIB A;  3AMM A;  3BPS A;  4AAX A;  3TNP B;  1T6G C;  4WM7 B;  2AH2 A;  4JRP A;  5EJ1 B;  2VM9 A;  4H55 A;  1YFX A;  2WZR 2;  4J2D A;  1SLA A;  4XE9 A;  3VD4 A;  1S4C A;  3H0O A;  1SLT A;  2VCM A;  1WCK A;  4I3P A;  4Q4V 3;  1W8T A;  5LB6 A;  3C6P B;  3TN9 2;  3TEZ A;  4RHV 2;  5A7W A;  3V56 A;  1S55 A;  5JPM B;  3VKF C;  1Q3E A;  4DRV A;  1XU1 A;  3U37 A;  5A6Z A;  3KHC A;  5IVJ A;  2SLI A;  5LRS A;  4GWJ A;  1ACC A;  2CTV A;  3M3I A;  3MEP A;  4QDS A;  3Q8C A;  4AKH A;  4YFZ A;  5BNO A;  4FJ8 A;  2QQW A;  1CIY A;  4LMF A;  4U2A A;  4HPK B;  3B7M A;  2WFF 2;  4FPH A;  5AVA A;  2D40 A;  5F2S A;  1JOD A;  4CP0 A;  5C33 A;  2FDK A;  2QTW B;  4ADN A;  1AR6 2;  4N7I A;  1VPH A;  3PU3 A;  1FAT A;  5F39 A;  4HSJ A;  4Y5Z 0;  2VZT A;  3D0J A;  4NII A;  3T3Y A;  3D4K A;  2C26 A;  4BA6 A;  3INA A;  5F3C A;  4XZP A;  3ZM8 A;  2HYX A;  4OUM A;  4CE8 A;  2P1M B;  5BPX A;  4QB6 A;  1YQ8 A;  4Y24 A;  3VHO A;  2WT1 A;  3WQB A;  2PA7 A;  2XVG A;  2RMU 2;  1RUD 2;  2RV9 A;  4PIY A;  3VZJ A;  3KV6 A;  4YGD A;  4CDQ C;  3L2O B;  1UW8 A;  5IYY A;  1AYM 3;  2RS3 1;  2VZR A;  4IEO A;  4L8Q A;  2E31 A;  1F9K A;  5BNP B;  1S0J A;  3UJO A;  1A3K A;  2OPK A;  3RPQ A;  1CJD A;  3AJY A;  3CLP A;  3AZW A;  4BQX A;  1RMU 1;  1LAJ A;  4I2O A;  4XUP A;  4P5Y A;  2QDR A;  5D8A C;  4M0N A;  3VLB B;  1UN1 A;  3HEI A;  5BYN A;  3N36 A;  4M3X A;  4A41 A;  3Q8E A;  1RTV A;  2WA4 A;  3RMA A;  4A3Z A;  5KR7 A;  4XXP A;  1O4T A;  1HN1 A;  3AC0 A;  4FCA A;  1COV 1;  1XNK A;  4N90 A;  3FHQ A;  3ZXA C;  1QF3 A;  1WCQ A;  5L7O B;  1BLZ A;  2PYT A;  3OTF A;  3OGV A;  2K46 A;  1MMO G;  4Y20 A;  2E7Q A;  4URA A;  4JRL A;  1G9C A;  3W58 A;  5A32 B;  1W6M B;  3J7M A;  4DNY A;  5IK5 A;  1FMD 3;  4EE2 A;  3WQ0 A;  1OUR A;  4K3U A;  3V0A B;  1H8T C;  1QJX 1;  4BYY A;  3D3A A;  2OYZ A;  5IHR A;  2BP6 A;  3ZYI B;  1FZ1 E;  5JDB A;  1RUE 3;  5C8C C;  4HCC A;  5J36 A;  4FQ4 A;  4CCN A;  3JB4 C;  4FAG A;  1WAF A;  3ZN4 A;  4I02 A;  1MQT A;  4BM8 A;  4GJZ A;  2C0Z A;  2ZMN A;  3OGG A;  5ACA 2;  4RGK A;  3L8B A;  1EPZ A;  5JOW A;  4NAO A;  2XL7 A;  1ZBA 3;  4I01 A;  4A7K A;  1A8M A;  5GLV A;  1QQP 2;  1RUH 1;  3IAQ A;  1LHU A;  1OLM E;  3MLL A;  2R07 3;  4ZON A;  4AYU A;  1PVX A;  3DKQ A;  5CG8 A;  1GZC A;  1WW6 A;  1HIX A;  3B02 A;  5F5A A;  2E51 A;  3BTZ A;  4FK4 A;  3ES4 A;  4BIF A;  3P3N A;  2JKX A;  2B46 X;  2CDO A;  3H3L A;  1GP4 A;  3AYA A;  5D8A B;  4NID A;  1OXC A;  3NNM A;  2JDA A;  5F9T A;  3QNO A;  3ZSK A;  1XNA A;  2MEV 3;  1YQ2 A;  1JZ7 A;  4ONU A;  4XCB A;  2WNV C;  3UKN A;  4DQA A;  4XVH A;  4K7J A;  1DGR A;  1DGW A;  1F5J A;  3NNF A;  4XJA A;  3ECQ A;  3MPP G;  4N43 A;  4W50 A;  5T5J A;  3SMH A;  4CUB A;  3MZH A;  1DLC A;  4LXL A;  4P08 A;  3SIS A;  1O91 A;  3RZH A;  2YB5 A;  3ILN A;  2OUH A;  1NXD 1;  4KWL A;  1QJU 2;  2VJ4 A;  2OZM A;  4FK2 A;  1A6C A;  3NKT A;  4OHX A;  1AR6 3;  4Y20 B;  4CRQ A;  4E8D A;  4EN8 B;  4MG2 A;  4WVW A;  1OA2 A;  4CEW B;  4BHP A;  1D0H A;  1FXZ A;  1UZV A;  2YC4 A;  4IEZ A;  4XTP A;  4LKD A;  1QQP 1;  1OLM A;  3C6O B;  4O61 A;  1NQD A;  3I2G A;  4F7Z A;  4IEQ A;  4QX0 A;  3WEZ A;  4N9H A;  4XUQ A;  2VMD A;  2YZ4 A;  5DAV A;  5FTT C;  4XC9 A;  1LU1 A;  4UF0 B;  4LO5 B;  2IVJ A;  2QQM A;  1Y43 B;  2LRP A;  2YBK A;  5ANN A;  1MPX A;  4YW6 A;  2DY4 A;  1STM A;  3FFQ A;  2QFE A;  4IE6 A;  4W6Y A;  4FK0 A;  3AB0 A;  2R06 2;  4XJW A;  4L92 A;  4R52 A;  1XNB A;  1Y9Q A;  3UT0 A;  1IG3 A;  2EF6 A;  3QBQ A;  1QJX 2;  4YW7 A;  4AGV A;  2KD7 A;  3D0S A;  1VBA 2;  1O5L A;  2W95 A;  4QXK A;  1LHW A;  1ZRC A;  2OZ6 A;  4FPY A;  5HBA A;  1TME 3;  2UWA A;  3B93 A;  4Z8B A;  2WNU B;  3N9L A;  2BGC A;  1G7Y A;  2L9L A;  2C24 A;  2VUJ A;  1MZ6 A;  2ZAH A;  4WVM A;  4XQW A;  2XPJ A;  1XVD E;  1REE A;  3I8T A;  4Q8L A;  3NAP B;  3C7O A;  3U78 A;  5ABJ A;  1GR3 A;  1RUI 1;  5CFD A;  1PHM A;  4Y1V A;  3THD A;  1DGL A;  2P1B A;  5FY7 A;  5JPN B;  1JU3 A;  3WDU A;  2RDS A;  3AFG A;  1YQ5 A;  2R04 2;  2OVU A;  2IZW A;  4TXW A;  3BB6 A;  2OVQ B;  2Y6K A;  3ZYH A;  2VL4 A;  5BNO B;  1RMU 2;  4AHX A;  3QOP A;  3FLP A;  4P02 B;  2B9V A;  2XOM A;  4HPK A;  1BKZ A;  4BOW A;  2DVG A;  2ARB A;  2XDV A;  5F6K A;  4XUR A;  5GKA C;  5L7O C;  1S0B A;  2VNR A;  2VZQ A;  4CA9 A;  1T6B X;  2WKK A;  5K7P A;  3ZFG A;  1PVC 2;  3NNG A;  1UU4 A;  3PU8 A;  3A4U A;  2P3Y A;  1RXF A;  1E57 A;  1UMI A;  1E5R A;  2WQ4 A;  5DUU A;  2PHD A;  2D6O X;  2IWG B;  2RMU 1;  1FOD 1;  4AGR A;  3SPY A;  4CEY B;  5I0S A;  1OQE A;  3IPV B;  1Z78 A;  3T2O A;  1MHZ G;  2A70 A;  4UFJ A;  2HWC 2;  3B5L B;  3USS A;  2C6S A;  5A70 A;  1W03 A;  4DTR A;  3ZXD A;  4CDX C;  4JRQ A;  2C5D A;  2FCV A;  4M45 A;  1UMZ A;  2DVF A;  3BU7 A;  3IKW A;  4IER A;  2WO7 A;  4QXC A;  4F3J A;  4BJ0 A;  2PFT A;  4E27 A;  1HKD A;  3LA7 A;  1HXS 2;  4HKO A;  4NOT A;  3T0B A;  2PHF A;  3MKS B;  2OW4 A;  5K8S A;  1JW2 A;  5JSP A;  3S6P A;  2Y6G A;  2WFF 1;  4FVV A;  4IDZ A;  1GZW B;  1PIV 1;  1OLR A;  4XHX A;  1IH7 A;  1H6X A;  3HNB M;  2HH9 A;  2VW0 A;  1US2 A;  2NQY A;  1DGR N;  1PK6 A;  3GBG A;  3I59 A;  1K12 A;  3LCP A;  4FFG A;  4O9G A;  2VY0 A;  5DN2 A;  3VKL A;  5AC9 3;  3PUR A;  5D8A A;  3WUD A;  2ARE A;  5GJ6 A;  5C4W B;  1Z7S 2;  2D5F A;  3IDE A;  4IES A;  5A1F A;  3TN9 1;  1LEC A;  2GMP A;  4LBN A;  3WNK A;  1QNW A;  3T0A A;  4XBQ A;  4CU9 A;  4IQP A;  3JQW A;  1GU3 A;  4HL0 A;  1PNG A;  3J27 A;  2JEM A;  2R7E B;  1SBD A;  3FBY A;  1VLN A;  3QET A;  1WWY A;  3ZN5 A;  2V5Y A;  4GH4 A;  3B69 A;  2JE7 A;  2FDI A;  3UJQ A;  4AVS A;  1EV1 1;  1NY7 2;  3LIH A;  1W39 A;  4Y4R A;  5JVV A;  5CB7 A;  3VGI A;  2BBA A;  2VTX A;  2O1Q A;  4MGS A;  4EWD A;  1RUJ 2;  1HRI 1;  2RR1 2;  3CEW A;  3QD6 A;  4QPI C;  1XJA A;  3ZKY A;  1TNR A;  2ZGP A;  3OOX A;  4XFB A;  3SKV A;  4EN0 A;  1Y9M A;  1RUC 1;  1KDK A;  1VBE 1;  4JQT A;  4QQ2 A;  5CZK A;  4E9K A;  3N4M A;  1H8T A;  2JB8 A;  2JX9 A;  3I2D A;  1O3Q A;  2D93 A;  4E2G A;  4X8N A;  4KHW A;  4FP3 A;  1LEN A;  3GHM A;  2DCT A;  3CFR A;  4RSU A;  5FIX A;  3RZG A;  4QX2 A;  3PUQ A;  3W5N A;  1C8N A;  3U0Z A;  5FYH A;  4Y3O A;  1DP0 A;  1W99 A;  4PDW B;  1CAW B;  2YUE A;  3GNE A;  3WSO A;  5FZH A;  3ZSE A;  1UIK A;  1G86 A;  1B35 B;  1C57 A;  2HWF 2;  4UOJ A;  1FNY A;  1WLC A;  4N9I A;  2JB4 A;  4ZY9 A;  5BNN C;  4MGQ A;  2LW8 A;  4DXS A;  5C70 A;  1SLI A;  4LJH A;  2XJP A;  4QQL A;  5DAW A;  2EIC A;  4OI0 A;  1PO2 1;  1QOS A;  2B4K A;  1UX6 A;  1AL0 G;  5A6Y A;  1GMM A;  1EV1 3;  3FUQ A;  3ZPY A;  4YFW A;  4BLJ A;  5C3Q A;  3IAP A;  3UO3 A;  2Y26 A;  5FXZ A;  2FZ2 A;  4Q0S A;  2CNA A;  3SH5 A;  3CZJ A;  1DIW A;  5FQ0 A;  1WMD A;  1DCS A;  3CFO A;  1V6N A;  4UYB A;  1UPI A;  1C8M 2;  1JH5 A;  4Q4V 2;  4M3C A;  2HWD 2;  2W46 A;  3ZIW A;  1RUG 2;  3P5B A;  4AEJ A;  1NYW A;  1QJX 3;  3DYP A;  3VBF A;  2CV6 A;  4M3R A;  2RE9 A;  3J4U H;  3PUS A;  5FUI A;  2GNT A;  4N7U A;  4W6X A;  4O9E A;  4LR4 A;  3TJY A;  1CAU A;  3UYJ A;  3VDA A;  1ODM A;  4GQ7 A;  2WWJ A;  2RS1 1;  5SV5 A;  4DO0 A;  3CQ8 A;  4NAM A;  4TWT A;  5FPA A;  3PUI A;  1JYV A;  1W8N A;  2LM3 A;  2I2S A;  4UAP A;  2ILM A;  4CPB A;  1RC6 A;  1KS5 A;  4HSL A;  3H8X A;  3MHZ A;  4XMI A;  5HCB A;  3A0N A;  4FOY A;  3KCY A;  2Q8C A;  2R0H A;  3UET A;  3EBR A;  1FZH E;  4J6G A;  2R04 3;  2D3P A;  2W0X A;  1FZ6 E;  4FPL A;  3A7Q A;  1RJ7 A;  4J2B A;  3H3Z A;  2LTN A;  3SHR A;  1AL2 1;  1WBL A;  1K42 A;  3ILF A;  3ZDV A;  1XC6 A;  1AJK A;  2PHW A;  3T1L A;  5LEK A;  2JEC A;  4YVS C;  3QH6 A;  4AQT A;  3D8C A;  3N1E A;  2LS6 A;  3KVB A;  3GZE A;  3N7K A;  1MZF A;  1Y3T A;  1U12 A;  2AZ5 A;  4FFI A;  3I3Q A;  4OCT A;  5EYY A;  3WNM A;  4Z1V A;  5HI0 A;  1LOG A;  3ZYJ B;  4XBL A;  4D7T A;  4GA9 A;  1YI9 A;  4ATF A;  4MYE A;  1DQ1 A;  3TEX A;  5CYY A;  3VDB A;  3J26 N;  1GFF 2;  4HAN A;  5DXD A;  3SNN A;  1PGL 2;  1A78 A;  4XFH A;  2GN3 A;  1HRI 2;  4LBQ A;  3H42 B;  1AL2 2;  1DGW X;  2CU5 A;  1RVF 2;  3HIF A;  3MW4 A;  3SCF A;  4XAE A;  4AED C;  4OI4 A;  5CFD C;  4DTX A;  2VMH A;  3AZX A;  2EAK A;  2W1Q A;  4CVU A;  3AP7 A;  4AHY A;  2BU9 A;  1WKY A;  2XXZ A;  3LGR A;  3RJR A;  4J2E A;  3DPR B;  4JRA A;  4UW5 A;  3DYM A;  1Q8V A;  2BVV A;  3MIH A;  4FPF A;  2B39 A;  3W5M A;  4IV3 B;  4NMI A;  5FZ8 A;  3SC7 X;  1GAN A;  1VAK A;  5B4X A;  1BMV 1;  1S0F A;  1BEV 2;  2UY8 A;  5TSW A;  1JYT A;  4PHZ A;  1W6P A;  3RVH A;  3ZFE B;  1FZ5 E;  2WZE A;  4IGP A;  1Q8P A;  3GYD A;  5F3E A;  2WZ8 A;  1CLQ A;  5CG9 A;  1XU2 A;  4OI2 A;  3CJI B;  3ETP A;  1PO1 3;  4KHU A;  4AED B;  2WR9 A;  3UKV A;  1E5I A;  1RHI 1;  2QUO A;  1H9P A;  2O8O A;  1TG7 A;  3OEB A;  2JG8 A;  4P00 B;  5ANQ A;  4XQD A;  3OYW B;  2XJU A;  4KHS A;  3O5S A;  3O12 A;  4XJ8 A;  1HW5 A;  3OG2 A;  4MUV A;  2EID A;  2WAA A;  1UXZ A;  2DBI A;  2R16 A;  2IXH A;  3LIG A;  3HT2 A;  5C9A B;  3UGG A;  3WF2 A;  1RIN A;  1US3 A;  2EVX A;  4C8D A;  5I0U A;  1UMH A;  3MW2 A;  1ZZB A;  2QJV A;  1C1L A;  3S7E A;  4AFC A;  4QND A;  4CCO A;  4KMQ A;  5FMB A;  2OKX A;  5FYS A;  2GZW A;  1L3J A;  1GBG A;  1OFS A;  1CZT A;  1PZ7 A;  3UNP A;  4UF0 A;  4Y5T A;  4B7K A;  1F8V A;  3NKG A;  1QQP 3;  1CAX A;  3NJY A;  5GZE A;  5A6Q A;  1ZYB A;  3CL1 A;  2XLF A;  1KIT A;  5DG2 A;  3RZL A;  2BWC A;  4J2A A;  4F83 A;  4RNG A;  1ULP A;  1VRB A;  4LBL A;  5IWF A;  5JUV A;  2B7Y A;  1C4R A;  2JIJ A;  2IXC A;  4KU8 A;  4PBO A;  5E8A A;  1J3P A;  3MIE A;  1IOA A;  2A73 B;  1ENS A;  5GAL A;  2GND A;  1LJ7 A;  3BTA A;  3PIG A;  4AXO A;  2AEZ A;  2PFV A;  3MFC A;  4LK6 A;  1OOP C;  4TYS A;  5LW9 A;  4B08 A;  4OYU A;  3V0A A;  2B1E A;  4HT1 T;  4IEV A;  2FD8 A;  1V70 A;  2YMZ A;  3JD7 3;  3I2O A;  5D1I A;  4C0B A;  2R49 A;  4FPJ A;  1W0N A;  1VBE 2;  4EV0 A;  4NIH A;  4NPR A;  4XF1 A;  3VB9 A;  5JMO A;  3N7M A;  3GJB A;  1RUE 1;  1JYI A;  3HGL A;  2YB7 A;  4COZ A;  1XPW A;  1MTY G;  3KD4 A;  3AK0 A;  1WA6 X;  4XDO A;  4L11 A;  3U75 A;  5J48 A;  2WYS A;  1A34 A;  1EV1 2;  1NY7 1;  2WA3 A;  4CDW C;  2XB6 C;  4XJU A;  5EWS A;  3CO2 A;  1FZ8 E;  1RUN A;  2QQK A;  4Y1Z A;  2X29 A;  3I2F A;  1C8M 3;  1XE8 A;  1HQN A;  1SZB A;  2J42 A;  2MEV 2;  4J25 A;  1HJF A;  3BN6 A;  5JI9 A;  1VE0 A;  4AVB A;  4Y4Y A;  2GC0 A;  4D3W A;  1W2A X;  2P3K A;  1EY2 A;  5A7O A;  2OVP B;  3I3D A;  4NJ4 A;  5T5P A;  3VZL A;  3IDA A;  1AR7 3;  5LA9 A;  1OBN A;  3AYD A;  1VMF A;  4Q4X 3;  2RM2 2;  3SVI A;  1W6Q A;  3JUU A;  1XQN A;  5JOX A;  1AX1 A;  5K0U C;  2CGN A;  1C28 A;  3ZFF A;  4DTJ A;  2WS9 3;  3MW3 A;  3P3P A;  2JHP A;  3EHK A;  3CMG A;  2JEN A;  1VBD 1;  4QM8 A;  3M3O A;  2IVI B;  4XF3 A;  2DUO A;  5IK7 A;  3VN4 A;  3HPN A;  5JXG A;  2YBS A;  4XIO A;  3VBO C;  5C3O A;  1D4V B;  5EP9 A;  2YHJ A;  1HB4 A;  4DEV A;  5T5L A;  2WYF A;  4M42 A;  1O59 A;  4HON A;  5FZL A;  3VDD C;  2P3I A;  5ABJ B;  3BIW E;  2WSV A;  5FXV A;  5IVE A;  2LRO A;  1R09 1;  2WWS A;  5FZD A;  4WM7 A;  1LOC A;  4Z2W A;  2FMY A;  5FZK A;  3T2Q A;  4Z92 B;  4BK5 A;  4A6S A;  5FY1 A;  2BTV C;  1FT9 A;  1PVC 1;  3TAB A;  2JDP A;  3I2J A;  1O6U A;  3DPR A;  1GP5 A;  3J8F 1;  4AL9 A;  3PJY A;  1WD4 A;  1HX6 A;  5LY1 A;  1N3P A;  1QDC A;  5LRR A;  3WNL A;  1RVF 3;  5HCH A;  3ZXJ A;  2VUD A;  4JVA A;  4OHW A;  4NWV A;  3AKS A;  1ZZ9 A;  4XOG A;  4CDX A;  4JQR A;  1PMI A;  3NGI A;  2EXK A;  2IXI A;  5E16 A;  5IVV A;  3VBR A;  2W68 A;  3WUC A;  4AI3 A;  4AI8 A;  1RUH 2;  4RFR B;  5FAX A;  4A2U A;  5FYU A;  1NKG A;  1DZR A;  1WCU A;  4ZKT B;  4GH4 C;  5KHI A;  3OD4 A;  4YW5 A;  3E97 A;  3M3E A;  1MS3 A;  2MHF A;  3POS A;  3AYC A;  1GSL A;  4QQH A;  1QH6 A;  5ACA 1;  2V4A A;  3VD9 A;  4FTB A;  2WFP A;  1AX0 A;  3LWC A;  4OFG A;  5HPO A;  1YEW A;  2P17 A;  2V4V A;  1ZRE A;  4AI9 A;  2YC0 A;  4ASK A;  2YBP A;  4FJ5 A;  1JS9 A;  2W5F A;  4CP9 B;  1SLC A;  4QPW A;  5H9S A;  5HXM A;  5JOY A;  2PLV 1;  1QHD A;  4R4Z A;  1ODN A;  2XLG A;  3SCG A;  3VBR B;  4ZU7 A;  1JYW A;  2BFU S;  5F1R A;  1XVE E;  4LBQ B;  5CA6 A;  4DUW A;  1RHI 3;  1JOJ A;  4N53 B;  4ZXK A;  2Y64 A;  2ZEY A;  3W9A A;  1GOG A;  3AKP A;  4J1X A;  5CFC C;  4OHY A;  3VL9 A;  4BIS A;  1S1A A;  5EXO A;  5DMY A;  3JD7 2;  2IXL A;  1QJY 2;  4FAH A;  1IS6 A;  1COV 2;  2PTM A;  1FZI E;  2Q8E A;  5JSO A;  2CGO A;  3S9H A;  2D5H A;  4FP2 A;  4D6S A;  3CF6 E;  5CEH A;  1PM7 A;  1NZI A;  2VUC A;  3ZSL A;  5A7P A;  4ES9 A;  4FPE A;  5KXB A;  1S0G A;  1QJU 1;  1OC1 A;  2BBV A;  3KLS A;  3I2H A;  3VZO A;  5FQ0 B;  4LA3 A;  3T30 A;  4QDQ A;  3ZDS A;  1RUJ 3;  3ORJ A;  4PLM A;  1XMG E;  4C1X A;  3KCC A;  3NAP C;  2VUL A;  4S2F A;  3NAP A;  1CJP A;  3PME A;  1MQT B;  5EV7 A;  1X82 A;  3PTR B;  2HWB 3;  1NCQ B;  3WDW A;  1CX4 A;  3MLK A;  4FO9 A;  5FY0 A;  5A3P A;  3BCW A;  3V0B B;  4EYW A;  3E4W A;  1MVE A;  1OHF A;  2A7A A;  5JI7 A;  4CU6 A;  3S5Q A;  4RR3 C;  3L1N A;  4AEK A;  5I0R A;  1VBB 3;  1QKQ A;  1KGY A;  3K2O A;  1OD3 A;  1R09 2;  2ADD A;  3AKT A;  3HVD A;  4NHL A;  1CAW A;  3KV9 A;  2E63 A;  2Z2S B;  3E5U A;  3NMB A;  2CDP A;  4D6R A;  1G9F A;  1V9U 3;  2F6B A;  4N8M A;  5FUN A;  2P5O A;  4QGM A;  4COW A;  3VBF B;  2HWF 3;  1ZVF A;  4UT5 A;  5FR3 A;  2RS5 1;  4I0B A;  4PF5 A;  3SI6 A;  2EAL A;  4A7Z A;  3VKN A;  1QOO A;  2W47 A;  1W9T A;  3O0X A;  1H1M A;  1AR6 1;  3QH7 A;  5LK7 B;  4CCD A;  4HET A;  4KNC A;  2NPI A;  3RZJ A;  2RM2 1;  1TME 2;  2VOK A;  5JWP A;  4TN7 A;  3PL0 A;  4QB1 A;  3VBH A;  4KI5 M;  4Q1P A;  2ES3 A;  2BQP A;  4LUK A;  3ZXG A;  1KXG A;  1MEC 1;  5GZD A;  1O7F A;  3MIG A;  1J59 A;  1YI7 A;  4M3Y A;  2C1F A;  2IFR A;  4JTO A;  2OS2 A;  4AFB A;  1WME A;  4A44 A;  3QAC A;  1K5M A;  2X53 S;  2XR4 A;  2NM1 A;  1FAY A;  3POI A;  2XQR A;  4E4S A;  3E6B A;  5ABJ C;  4KHY A;  1I6X A;  3DXU A;  3RMX A;  3T1M A;  4AED A;  1LTE A;  3RWN A;  3CJI A;  2JG8 B;  3POW A;  1W8F A;  5G05 L;  3CJI C;  4KG0 A;  1POV 0;  3UKT A;  3CQO A;  3GBW A;  2W39 A;  5JCT A;  1JZ5 A;  2D98 A;  3FHI B;  4EZH A;  3AFK A;  1WMF A;  2NZ9 A;  4B29 A;  2GC3 A;  2RKH A;  4ZU5 A;  2DWR A;  5DAP A;  4G4F A;  4YVW B;  4CDU B;  3SJJ A;  2ET1 A;  1RUF 3;  3C94 A;  3AJZ A;  1LGC A;  3J7L A;  4GH4 B;  2RHP A;  3FLR A;  4QT6 A;  1QDO A;  4B4R A;  1WW4 A;  2NLR A;  3V7D B;  3KQR A;  2ZCW A;  4H3W A;  2DBN A;  5GZG A;  5CKQ A;  5KXC A;  4LO4 B;  4N53 A;  2ORZ A;  4ERO A;  5AC9 1;  2GNB A;  2F4P A;  2BYV E;  3CIH A;  3B9C A;  4AI1 A;  4R9A A;  4IEP A;  4D69 A;  4K9S A;  4FI9 A;  5E88 A;  3G6J B;  4FFH A;  4RFT 0;  2WS9 1;  4BWO A;  4CDQ B;  2AUY A;  1UOJ A;  4NHX A;  3TYJ A;  1DZQ A;  3Q8B A;  2ZBJ A;  2ZS6 B;  4IXL A;  4LLF A;  2DCY A;  1W6M A;  2Y60 A;  5EIY B;  1COV 3;  4MZU A;  1JZ4 A;  2GH8 A;  1KJL A;  4IL7 A;  1HV1 A;  2VOW A;  1AXZ A;  5FP8 A;  3JBG 2;  3R4S A;  4GMP 0;  4MGI E;  4NRO A;  3U14 A;  1JZ2 A;  3I2K A;  3O1V A;  2VW2 A;  3PVO A;  3VZK A;  1BEV 3;  3C3V A;  3WNP A;  5DQ0 A;  1YXW A;  4DB5 A;  1RHI 2;  4I3G A;  4QX3 A;  4WVV A;  1SBF A;  3KZ4 C;  4DUV A;  2EXJ A;  2ZKL A;  3VKO A;  1SPP B;  3VBS B;  3I3E A;  1OOP A;  5HV4 A;  3C7G A;  3O7O A;  1J1L A;  1GWM A;  2ZMK A;  4Q26 A;  4COU A;  1TQ5 A;  4QDR A;  1QJY 3;  1C3H A;  1XYP A;  2ZPX A;  3HAG A;  5FKC A;  5B2G B;  1CAU B;  2CGP A;  4D7Y A;  4M00 A;  3O1O A;  1OPO A;  1HJG A;  1LOF C;  1S0I A;  2RR1 3;  2XWJ B;  1WMX A;  2VG9 A;  3O14 A;  2C9K A;  3TOJ A;  3E6D A;  3U07 A;  4KGG A;  5DDJ 2;  2X5I A;  2X5I C;  2YV8 A;  2YXS A;  1D2Q A;  2OQ7 A;  1V9U 2;  1VMH A;  1CN1 A;  1RUE 2;  4YZ2 A;  4JGZ B;  2LF6 A;  3UO2 A;  3H1M A;  1UOG A;  3WQ1 A;  2XML A;  3C7H A;  1RXG A;  4KL1 A;  3Q8F A;  3RMC A;  4YG6 A;  5H9Q A;  4BDV B;  3NCI A;  1GKB A;  4BZ4 A;  5AFE A;  4UFM A;  1AX2 A;  4DU4 A;  1VR3 A;  1M06 G;  4QMA A;  2XKO A;  3HBZ A;  1UYY A;  2JKB A;  4DXR A;  1G9A A;  1UOF A;  3LQC A;  3WP4 A;  1ZM1 A;  4CCE A;  2XBO 2;  4FBF A;  4EN6 B;  4UXA A;  3TWI A;  2HWE 3;  2FHR A;  3P6B A;  2BPA 2;  5EYX A;  3M8L A;  3ZFF B;  1KD7 A;  4HG6 B;  2ZX3 A;  3WDT A;  2Q1M A;  4LIV A;  5G04 L;  1NE4 A;  3NV4 A;  3PVB B;  1ALY A;  2ZGU A;  3WP3 A;  4ZPI A;  1CAV A;  1KFU L;  1N1T A;  4IEY A;  5BNN A;  5JXH A;  3H1W A;  4OI1 A;  5FWJ A;  4KWK A;  4QPI A;  5LBE A;  3LZJ A;  3KV5 A;  3OGS A;  4GWI A;  1ENQ A;  3WG1 A;  3VBO A;  5CAZ A;  5FYI A;  1W2O A;  4KQ7 A;  1R08 2;  1XNT A;  5IBK B;  1D4M 2;  4CXW A;  4ARX A;  2DF7 A;  2RS1 2;  3OSD A;  1PGW 2;  5SV8 A;  4AQ6 A;  1MHY G;  2W3J A;  3A22 A;  2ZHN A;  4FFF A;  2WBK A;  1IKP A;  3NV1 A;  5FYV A;  3OEA A;  3WNN A;  1QJU 3;  5C3R A;  2ZA9 A;  5IAT A;  4M4P A;  1UY1 A;  4RR3 A;  1RUF 2;  5JR7 B;  2O0O A;  1B35 A;  2BV4 A;  4AWD A;  2ZX2 A;  4DIN B;  2OVR B;  1YQ6 A;  3HGK E;  2O8Q A;  3LOI A;  5DZE A;  4YVS B;  3SLI A;  2V5D A;  3M3Q A;  4EYU A;  3SQ2 A;  3H8O A;  1ND3 A;  3VD5 A;  5FY9 A;  1YIP A;  3W21 A;  4C1W A;  2VAU A;  1UYX A;  5IAX A;  1CQ9 A;  3B01 A;  4AFM A;  3VBR C;  3DUI A;  3ZXK A;  2WQZ C;  1DBN A;  4RGA A;  4BLI A;  1LU2 A;  1UKR A;  5FYY A;  1VP6 A;  1H1I A;  4IE5 A;  2VOX A;  2W87 A;  4A42 A;  1DLL A;  3CDZ B;  4LHK A;  3ST7 A;  3TRS B;  5FCC A;  2PFW A;  3WW2 A;  4Q4W 2;  5C6C A;  3AP5 A;  1AZD A;  2RDQ A;  1JBC A;  2JDN A;  5C7G A;  3SQ4 A;  2IXK A;  2NYY A;  3K4Z A;  2WT0 A;  1HRV 1;  5J37 A;  2WII B;  1MR5 A;  2PQS A;  1JHJ A;  1AL2 3;  4DPN A;  4YG0 A;  2A6Y A;  4NHM A;  4FJK A;  3UK9 A;  3TEY A;  1QJZ A;  4KBZ A;  3ZX7 A;  1XU3 E;  4IEW A;  4CXY A;  4RGG A;  1GYK A;  2HLE A;  3LE0 A;  4HMZ A;  2RR1 1;  4YGB A;  1CX1 A;  3MIF A;  3THP A;  1W0P A;  3N9M A;  2GSY A;  4DTS A;  3BOP A;  4P9G A;  4XEZ A;  4D7S A;  2PHL A;  4QPG C;  2X05 A;  5FOB B;  4CP9 A;  1GIC A;  2PQQ A;  4YM3 A;  5FBZ A;  1RL3 A;  2E32 A;  1RIR A;  2QQP A;  2XUM A;  4XAC A;  1DHK B;  1KJR A;  2VTF A;  1RUH 3;  4Y22 A;  4Y5S A;  3WV6 A;  4XJZ A;  4Q4Y 2;  2VEC A;  5A80 A;  1OMI A;  5C71 A;  3O1M A;  3C2U A;  2DDU A;  1UIJ A;  2CHH A;  5FZ6 A;  1RUF 1;  4Y22 B;  2WNV B;  3LDR A;  2CWS A;  4YM1 A;  2YU1 A;  4XYX A;  2JG8 C;  1GUI A;  2H0B A;  1UXX X;  1MS1 A;  3L9J T;  5GM0 A;  1U5Y A;  4NUB A;  4HCB A;  3KCX A;  1DYK A;  2QNK A;  4GMP 3;  1PMH X;  3KB5 A;  1HXS 1;  3NWK A;  3WNO A;  4DOU A;  4YPJ A;  2W2I A;  5JLV A;  3JU9 A;  1D4M 1;  2D6N A;  2XLA A;  1W3V A;  4YVW C;  4GMP 1;  4CDU C;  4HN0 A;  1V6M A;  1DYO A;  3ON7 A;  5DUV A;  1CZV A;  1FPN 2;  1NCR A;  1IPJ A;  3M70 A;  4JDM A;  3IN9 A;  1AR8 3;  3K4A A;  3W20 A;  4YSF A;  4JGZ C;  1SBE A;  1JZ6 A;  4LIU A;  4CPB D;  3OF1 A;  1BBT 1;  3OBR A;  4XAA A;  4GB3 1;  4ASL A;  4RL7 A;  2HWF 1;  2YY1 A;  1OVS A;  1C5I A;  4GXL A;  2VJ5 A;  4IUG A;  1OSG A;  4QHB A;  5FV3 A;  1RUC 3;  4LHN A;  1X9P A;  3VZN A;  1UY3 A;  4FJH A;  2JWP A;  3WD5 A;  4DXT A;  5HV0 A;  1H0B A;  4YZ5 A;  1GZT A;  5ERL A;  4ATE A;  5KC6 A;  3WW4 A;  4E3S A;  4M3Z A;  3VBH C;  1IZ3 A;  4OVE A;  3WP5 A;  1K45 A;  3TNQ A;  1W06 A;  4JGY C;  1LKN A;  4Q2F A;  4FXK B;  2D3S A;  4NHK A;  3K3O A;  5H9R A;  3EO6 A; 
#chains in the Genus database with same CATH homology
 4KHS A;  4ADO A;  3OG2 A;  2EID A;  2WAA A;  1UXZ A;  3ACI A;  4L0P A;  1WAJ A;  3WF2 A;  4MO3 M;  2Y6L A;  1US3 A;  2WO3 A;  1UMH A;  2VCA A;  4FJX A;  1J84 A;  4QND A;  4PQQ A;  4KMQ A;  2OKX A;  2JHA A;  5IFT A;  1CZT A;  1GNY A;  3UNP A;  1PX3 A;  1XMH E;  2W92 A;  3IB3 A;  2VIX A;  4MOA A;  4X5M A;  3SCX A;  2VOT A;  4I9L A;  4AKI A;  2LF3 A;  3C7E A;  4J2A A;  1K3I A;  4RNG A;  1ULP A;  1OT5 A;  3FN9 A;  5JUV A;  1OF4 A;  4KWU A;  1XVF E;  2VME A;  4I6J B;  4JS4 A;  2YFZ A;  2PFV A;  5JXI A;  1UWW A;  3LPG A;  4B08 A;  4QAW A;  4OYU A;  2B1E A;  1I5P A;  2WO1 A;  1KEX A;  2OZS A;  1W0N A;  3QEX A;  2VCC A;  3OBA A;  5JMO A;  1P22 A;  4JKM A;  3HGL A;  2YB7 A;  1XPW A;  1MTY G;  3SKJ E;  3SUO A;  3SQ0 A;  4XUO A;  1F4A A;  2WYS A;  3SEP A;  3LEI A;  1P8J A;  1FZ8 E;  2MZW B;  3TAF A;  2ORX A;  2QQK A;  2W91 A;  2VZO A;  3I2F A;  2QQO A;  3NJV A;  4LPL A;  2J1V A;  2XQX A;  3C7F A;  4FJJ A;  4QX1 A;  4FJI A;  3BN6 A;  3EB7 A;  4DU1 A;  4X5N A;  3F2Z A;  5JR2 A;  2QQI A;  2OVP B;  3I3D A;  3IDA A;  2VZV A;  2J7M A;  1JYX A;  3K46 A;  4DEQ A;  3SVI A;  1H6Y A;  3RMD A;  3VD7 A;  4DTJ A;  3OGR A;  2RJ2 A;  3MUY 1;  3HN3 A;  2JHP A;  4FVM A;  3E1F 1;  2P1P B;  3CMG A;  3T09 A;  1O8S A;  3T0D A;  5IZ7 A;  2W1S A;  5H37 A;  3HPN A;  3SUN A;  2DCJ A;  2DTU A;  1OF3 A;  4ZXE A;  3WF3 A;  5JXG A;  4FJL A;  3KD1 E;  1LDK E;  2YG0 A;  4OMC A;  4DEV A;  3SUQ A;  4M42 A;  1O59 A;  1UY4 A;  2B8I A;  2EIB A;  4FJG A;  4AAX A;  4P00 B;  4UI9 L;  4JRP A;  5EJ1 B;  3T2Q A;  3KD5 E;  3QES A;  2VM9 A;  5F7U A;  4BK5 A;  4J2D A;  3VD4 A;  3CZU A;  2Y6J A;  3TAB A;  3I2J A;  3C6P B;  5LA2 A;  4OZO A;  2MMB A;  3WNL A;  3U37 A;  1J83 A;  4CUA A;  3CFP A;  1L7Q A;  4GWJ A;  4QDS A;  3QEV A;  4AKH A;  4FJ8 A;  2J22 A;  4D0Q A;  1CIY A;  2E33 A;  4DTN A;  4XUT A;  4E4B A;  4EP9 A;  3NGI A;  1XVG E;  4ADN A;  2J1R A;  1NKG A;  3FHA A;  2J1S A;  2VZT A;  2C26 A;  2VZP A;  2WDB A;  5LCW L;  3ZM8 A;  3VD9 A;  2HYX A;  5HPO A;  5IRE A;  1UYZ A;  2P1M B;  2J1A A;  4A4A A;  2V4V A;  4QB6 A;  2BER A;  2ZEZ A;  3WQB A;  4FJ5 A;  2W5F A;  4QPW A;  4D8M A;  5HXM A;  4KI4 A;  2RV9 A;  2VZ1 A;  1O8P A;  1JYW A;  4GZ9 A;  4ET7 A;  3L2O B;  5IYY A;  2VZR A;  1XVE E;  1R64 A;  2RCU A;  2E31 A;  4DUW A;  2WAO A;  2Y64 A;  2ZEY A;  1D7P M;  1GOG A;  3LEK A;  4OUE A;  1GQP A;  3TL8 B;  5DMY A;  1UY0 A;  4QB2 A;  4M3U A;  4XUP A;  2VR4 A;  4QNC A;  4P5Y A;  4E8C A;  1F4H A;  1EUU A;  1FZI E;  3HP9 A;  3HEI A;  4FJN A;  3S9H A;  2P5G A;  2P1O B;  4M3X A;  4A41 A;  1XVB E;  3RMA A;  4A3Z A;  2ZEW A;  2VZS A;  1HN1 A;  3AC0 A;  3I2H A;  3FHQ A;  1WCQ A;  4QDQ A;  3OGV A;  1XMG E;  1MMO G;  2J1E A;  3GGL A;  4KI6 A;  2OYQ A;  4OMD A;  2WUH A;  1FYZ E;  2VMF A;  5IJR A;  4EYW A;  3E4W A;  2VQU A;  4CU6 A;  2X10 A;  2BZD A;  4JKL A;  3D3A A;  3L1N A;  5IHR A;  5I0D A;  4ARY A;  3TAG A;  1FZ1 E;  3C8X A;  4HCC A;  3K2O A;  1KGY A;  1OD3 A;  1WAF A;  2CDP A;  3ABZ A;  2P5O A;  4AG4 A;  2JH8 A;  3L8B A;  2ZXQ A;  1EUT A;  1W9W A;  3NE6 A;  1NAE A;  2VCB A;  3SI6 A;  3FL7 A;  3SQ1 A;  2W47 A;  1W9T A;  3RWU A;  3IAQ A;  3UES A;  2E26 A;  3DEC A;  2W94 A;  2JHC A;  1XMF E;  5B4N A;  3NJX A;  4JKK A;  3OGM B;  4FK4 A;  3DYO A;  2JKX A;  3VDC A;  4QB1 A;  2CDO A;  4KI5 M;  1UX7 A;  4CUC A;  2WN3 A;  2JDA A;  2YC2 A;  1XVC E;  3QNO A;  1XNA A;  1YQ2 A;  1JZ7 A;  1Q9X A;  4M3Y A;  2BGO A;  4XVH A;  4W8J A;  3UIQ A;  4A44 A;  3ECQ A;  4CUB A;  1NX9 A;  4W50 A;  1DLC A;  4M4R A;  4P08 A;  4KHY A;  3C6N B;  1TVG A;  2YB5 A;  2QQN A;  2VJ4 A;  2OZM A;  4FK2 A;  3ACF A;  5G05 L;  1NEX B;  3CQO A;  2WN2 A;  3I2I A;  1JZ5 A;  4JHZ A;  4E8D A;  2Y6H A;  1FZ4 E;  2YC4 A;  5IFP A;  3C6O B;  4JS5 A;  2FW3 A;  3SJJ A;  4FJM A;  3I2G A;  1FZ3 E;  3C94 A;  4KHN A;  1UZ0 A;  4QX0 A;  3WEZ A;  4XUQ A;  2VMD A;  3NAE A;  3V7D B;  5DPN A;  3GXU A;  3THC A;  2QQM A;  2QBX A;  3WF1 A;  2ORZ A;  1MPX A;  3WF4 A;  2DY4 A;  2ZEX A;  4FK0 A;  2WO2 A;  4BXS V;  3NDK A;  1W8O A;  3CIH A;  3A23 A;  1XU5 E;  2KD7 A;  4FI9 A;  3NQH A;  2W95 A;  4RN5 A;  1IG9 A;  1SG3 A;  2JD9 A;  2L9L A;  4W4Z A;  1XVD E;  2C4X A;  5EIY B;  3C7O A;  4AKG A;  3MV1 1;  1JZ4 A;  2BGP A;  1JZ2 A;  3THD A;  3I2K A;  4MAD A;  1JU3 A;  3WNP A;  1JZ8 A;  5DQ0 A;  2VJX A;  4QX3 A;  1PMJ X;  1LNS A;  4TXW A;  2OVQ B;  3J2P A;  1NUK A;  2Y6K A;  2VL4 A;  4DUV A;  3I3E A;  2WQ8 A;  3C7G A;  4P02 B;  2B9V A;  1XL3 C;  2XOM A;  4FJ9 A;  4QDR A;  4XUR A;  3ACH A;  2VZQ A;  2VZ3 A;  4BK4 A;  2RVA A;  4KHQ A;  3MV0 1;  3NNG A;  2C9K A;  3MUZ 1;  1GOF A;  1UMI A;  4XZU G;  3ACG A;  3SPY A;  3T2O A;  1MHZ G;  3I97 A;  3SEE A;  2DCK A;  2LF6 A;  4LHS A;  3LDB A;  4DTR A;  3QEP A;  3C7H A;  4JRQ A;  3RMC A;  4BDV B;  2J1T A;  4M45 A;  4ZZ8 A;  5LA0 A;  3NCI A;  4XUN A;  2P1Q B;  4BJ0 A;  2PFT A;  4DU4 A;  1FZ9 E;  3LZI A;  3III A;  1UY2 A;  1UYY A;  4RYD A;  4DXR A;  3T0B A;  3MKS B;  3LQC A;  1FZ7 E;  3L0M A;  3P6B A;  5JXJ A;  2Y6G A;  4DUX A;  3RMB A;  4HG6 B;  2VC9 A;  1IH7 A;  1H6X A;  3HNB M;  2FYO A;  5G04 L;  4A6O A;  1US2 A;  1K12 A;  5DN2 A;  5JXH A;  2EIE A;  1FZ0 E;  2WAB A;  4CU8 A;  3LZJ A;  3OGS A;  4GWI A;  4PF1 A;  3WNK A;  3T0A A;  2JE8 A;  3K75 B;  4CU9 A;  2VQT A;  1GU3 A;  3J27 A;  1XNT A;  2R7E B;  2JH9 A;  5IBK B;  3QET A;  2VMC A;  4DTO A;  3K77 A;  3WF0 A;  4ARX A;  3QEI A;  1JZ3 A;  2BBA A;  4MGS A;  1MHY G;  2W3J A;  3A22 A;  2WBK A;  3OEA A;  3WNN A;  3SKV A;  3SUP A;  1BHG A;  2QQL A;  5CZK A;  2P1N B;  4M4P A;  3MO4 A;  1UY1 A;  4KHW A;  3CFR A;  1SDD B;  1RYY A;  4QX2 A;  2OVR B;  4TTG A;  3HGK E;  3W5N A;  2V5D A;  3CKH A;  3SQ2 A;  2H4T A;  4Z2A A;  3NHG A;  2W1W A;  2XON A;  4DTU A;  3LPF A;  1DP0 A;  3VD5 A;  1W99 A;  1SHW B;  2X09 A;  1UYX A;  1FS1 A;  3WSO A;  2ATQ A;  4I9Q A;  4UOJ A;  3LD8 A;  4ZY9 A;  3QNN A;  4MGQ A;  2LW8 A;  4DXS A;  4DTP A;  5C70 A;  2EIC A;  2W87 A;  4A42 A;  3JXS A;  3CDZ B;  2B4K A;  2ID4 A;  1GMM A;  5C7G A;  2J1U A;  3SQ4 A;  3IAP A;  3K4Z A;  4LKS A;  3VD3 A;  4M3T A;  2PQS A;  1JHJ A;  1L7R A;  3CZJ A;  3HJR A;  3QEW A;  3PUH A;  3CFO A;  3C95 A;  4FJK A;  1CZS A;  1XU3 E;  4CU7 A;  3LDS A;  2W46 A;  3NRU A;  3OGK B;  3DYP A;  3T08 A;  4M3R A;  5FUI A;  1OH4 A;  2HLE A;  3LE0 A;  3N1B A;  3GDB A;  2XHN A;  1CX1 A;  3TJY A;  4DTS A;  3VDA A;  2Y8K A;  4M41 A;  3A21 A;  4A45 A;  5LA1 A;  2X05 A;  2DEB A;  3CQ8 A;  3E4Y A;  2HD0 A;  2VO5 A;  1JYV A;  3PUI A;  2W9X A;  2E32 A;  1W8N A;  4UAP A;  2VTF A;  3LEG A;  5A1A A;  3SPZ A;  2QQJ A;  4AI6 A;  1ULO A;  3UET A;  5C71 A;  4EPH A;  1Q9Y A;  1FZH E;  2DDU A;  1FZ6 E;  4ZZ5 A;  3HNM A;  3A7Q A;  4J2B A;  2Z4F A;  4RG8 A;  3OGL B;  1JI6 A;  2W1U A;  4LQR A;  1XC6 A;  3EYP A;  3OB8 A;  1JYN A;  1K42 A;  1GOH A;  3T2P A;  4JX0 A;  1GUI A;  3N1E A;  3J7H A;  2QXF A;  2LS6 A;  1UXX X;  2VZU A;  5J1X A;  4HCB A;  3WNM A;  1PMH X;  3WNO A;  2B7M A;  4YPJ A;  1T2X A;  5CYY A;  3VDB A;  1DYO A;  1CZV A;  3SNN A;  3K4A A;  3I3B A;  1FZ2 E;  3GM8 A;  1JZ6 A;  3MBW A;  3BGA A;  1IQD C;  3HOB A;  1W9S A;  4DTX A;  2V72 A;  2W1Q A;  4CVU A;  4RL5 A;  1WKY A;  3HL8 A;  3K4D A;  4J2E A;  2YFU A;  3QER A;  4GAM C;  3DYM A;  4PT6 A;  2VJ5 A;  4M3W A;  4IUG A;  3W5M A;  1FXX A;  4FJ7 A;  1JU4 A;  4DTM A;  5B4X A;  3TAE A;  1UY3 A;  1FZ5 E;  4FJH A;  2WZE A;  4DXT A;  2WZ8 A;  1CLQ A;  5EJZ B;  3P1I A;  4E3S A;  4M3Z A;  3ETP A;  4KHU A;  1K45 A;  3HNY M;  1PX4 A;  2JPN A;  3OEB A;  1TG7 A;  4DU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...