1FZ0E

Methane monooxygenase hydroxylase, form ii mixed-valent grown anaerobically
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 58
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz0E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz0E02
1XVCE 1MTYG 1FZ9E 1XVDE 1XU3E 1FZ6E 4GAMC 1FZ7E 1MHYG 1FZ1E 1XMFE 1XMHE 1MHZG 1FZIE 1XVEE 1FZ5E 1FZHE 1XVBE 1FZ0E 1FYZE 1FZ8E 1XU5E 1XMGE 1FZ3E 1MMOG 1XVFE 1FZ4E 1XVGE 1FZ2E
chains in the Genus database with same CATH superfamily
4FVMA 1MTYG 2H4TA 1P22A 3N1EA 1FZ9E 4KHNA 4KHQA 2MZWB 4ADOA 3LDSA 3C6PB 4FK4A 4JS5A 4FJNA 1XL3C 1JW2A 3BVOA 2PFTA 4DTSA 4X5NA 1MHZG 4KI6A 2P1MB 4I6JB 3RMCA 2P1QB 4ICGC 4FJ8A 4M3TA 2FYOA 4AKIA 5IREA 1XVBE 3K2OA 4HCBA 1CLQA 1FXXA 4FJ7A 4IT5A 4FJKA 2LF3A 3RMDA 3QNOA 4FJ5A 4M3UA 4KHSA 4DTMA 1MMOG 4DTXA 2DTUA 4J2DA 3SQ0A 1FZ4E 3OGLB 4DU4A 4EP9A 3QETA 3KD5E 2RCUA 3UIQA 2JPNA 3SUPA 4DTOA 3N1BA 4M3XA 4FJJA 1FZ6E 1FZ7E 4JS4A 2OZSA 2VJ5A 3QEVA 3NCIA 2JH8A 3NAEA 1WAFA 4DTPA 3NHGA 4I9LA 2PFVA 2JHCA 1FZ5E 4FJLA 3E4WA 2ATQA 2RKHA 4AKHA 2P1NB 2HD0A 5IBKB 2K5SA 3CFPA 1IG9A 5IZ7A 2P5GA 2YB5A 3SCXA 1Q9YA 3L1NA 4E4BA 3CQ8A 4DTJA 4FK0A 1XMGE 4M45A 2OZMA 2OVRB 2B8IA 3CFOA 3SQ2A 2JQTA 1XVGE 3TL8B 4DU1A 3C6NB 1XVCE 3HL8A 4X5MA 2LF6A 2B1EA 3UO2A 1XVDE 4FJMA 4M3YA 3L8BA 4FJXA 2QXFA 4RG8A 4FJ9A 2DY4A 1FZ1E 2P1OB 3NDKA 1Q9XA 3QEXA 3QNNA 3SI6A 4DU3A 2VJ4A 4M42A 1LDKE 2MW2A 3HGLA 3C6OB 4FK2A 2OVQB 3OGMB 4FJIA 2B7MA 2DEBA 2P1PB 1FZHE 3E4YA 4EPHA 3NE6A 4I9QA 4FJHA 4M3ZA 4FJGA 5H37A 3WSOA 1FZ0E 4M41A 3TABA 3UO3A 1FZ8E 2VIXA 4JRPA 3KD1E 4B08A 3LD8A 3SNNA 4KHWA 2JHAA 3SPYA 4M3WA 3RMBA 4J2AA 1FZ3E 3CFRA 3RMAA 4J2EA 3J2PA 3L2OB 3SUOA 2E31A 1FPOA 3OGKB 3QEIA 4GAMC 4QNCA 3RWUA 3LZIA 1IH7A 3S9HA 4J2BA 4KHUA 2OYQA 3J27A 3LZJA 2FW3A 1XU3E 1N1CA 3SQ4A 1MHYG 2JHPA 3TAEA 4KHYA 1XMFE 3HGKE 1WAJA 2JH9A 2OVPB 1XMHE 3HP9A 3QERA 3SVIA 1FZIE 3NGIA 1XVEE 3C94A 4RL5A 4DTRA 3SPZA 4DTNA 4E3SA 4JRQA 2E32A 4KI4A 4AKGA 3SUNA 3L0MA 3V7DB 4DTUA 1FYZE 1XU5E 3MKSB 4QNDA 4M3RA 1FS1A 2MMBA 3TAGA 4AI6A 3LDBA 4RNGA 4ADNA 3QEPA 3C95A 2P5OA 3TAFA 1NEXB 3TJYA 3QESA 3QEWA 4EYWA 3SJJA 3SQ1A 1XVFE 3SUQA 4HCCA 1FZ2E
chains in the Genus database with same CATH topology
4FVMA 1MTYG 2H4TA 1P22A 3N1EA 1FZ9E 4KHNA 4KHQA 2MZWB 4ADOA 3LDSA 3C6PB 4FK4A 4JS5A 4FJNA 1XL3C 4DTSA 2PFTA 4X5NA 1MHZG 4KI6A 2P1MB 4I6JB 3RMCA 2P1QB 4FJ8A 4M3TA 2FYOA 4AKIA 5IREA 1XVBE 3K2OA 4HCBA 1CLQA 1FXXA 4FJ7A 4FJKA 2LF3A 3RMDA 3QNOA 4FJ5A 4M3UA 4KHSA 4DTMA 1MMOG 4DTXA 2DTUA 4J2DA 3SQ0A 1FZ4E 3OGLB 4DU4A 4EP9A 3QETA 3KD5E 2RCUA 3UIQA 2JPNA 3SUPA 4DTOA 3N1BA 4M3XA 4FJJA 1FZ6E 1FZ7E 4JS4A 2OZSA 2VJ5A 3QEVA 3NCIA 2JH8A 3NAEA 1WAFA 4DTPA 3NHGA 4I9LA 2PFVA 2JHCA 1FZ5E 4FJLA 3E4WA 2ATQA 4AKHA 2P1NB 2HD0A 5IBKB 3CFPA 1IG9A 5IZ7A 2P5GA 2YB5A 3SCXA 1Q9YA 3L1NA 4E4BA 3CQ8A 4DTJA 4FK0A 1XMGE 4M45A 2OZMA 2OVRB 2B8IA 3CFOA 3SQ2A 1XVGE 3TL8B 4DU1A 3C6NB 1XVCE 3HL8A 4X5MA 2LF6A 2B1EA 1XVDE 4FJMA 4M3YA 3L8BA 4FJXA 2QXFA 4RG8A 4FJ9A 2DY4A 1FZ1E 2P1OB 3NDKA 1Q9XA 3QEXA 3QNNA 3SI6A 4DU3A 2VJ4A 4M42A 1LDKE 3HGLA 3C6OB 4FK2A 2OVQB 3OGMB 4FJIA 2B7MA 2DEBA 2P1PB 1FZHE 3E4YA 4EPHA 3NE6A 4I9QA 4FJHA 4M3ZA 4FJGA 5H37A 3WSOA 1FZ0E 4M41A 3TABA 1FZ8E 2VIXA 4JRPA 3KD1E 4B08A 3LD8A 3SNNA 4KHWA 2JHAA 3SPYA 4M3WA 3RMBA 4J2AA 1FZ3E 3CFRA 3RMAA 4J2EA 3J2PA 3L2OB 3SUOA 2E31A 3OGKB 3QEIA 4GAMC 4QNCA 3RWUA 3LZIA 1IH7A 3S9HA 4J2BA 4KHUA 2OYQA 3J27A 3LZJA 2FW3A 1XU3E 3SQ4A 1MHYG 2JHPA 3TAEA 4KHYA 1XMFE 3HGKE 1WAJA 2JH9A 2OVPB 1XMHE 3HP9A 3QERA 3SVIA 1FZIE 3NGIA 1XVEE 3C94A 1XVFE 4RL5A 4DTRA 3SPZA 4DTNA 4E3SA 4JRQA 2E32A 4KI4A 4AKGA 3SUNA 3L0MA 3V7DB 4DTUA 1FYZE 1XU5E 3MKSB 4QNDA 4M3RA 1FS1A 2MMBA 3TAGA 4AI6A 3LDBA 4RNGA 4ADNA 3QEPA 2P5OA 3TAFA 1NEXB 3TJYA 3QESA 3QEWA 4EYWA 3SJJA 3SQ1A 3C95A 3SUQA 4HCCA 1FZ2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVC E;  1MTY G;  1FZ9 E;  1XVD E;  1XU3 E;  1FZ6 E;  4GAM C;  1FZ7 E;  1MHY G;  1FZ1 E;  1XMF E;  1XMH E;  1MHZ G;  1FZI E;  1XVE E;  1FZ5 E;  1FZH E;  1XVB E;  1FZ0 E;  1FYZ E;  1FZ8 E;  1XU5 E;  1XMG E;  1FZ3 E;  1MMO G;  1XVF E;  1FZ4 E;  1XVG E;  1FZ2 E; 
#chains in the Genus database with same CATH topology
 4FVM A;  1MTY G;  2H4T A;  1P22 A;  3N1E A;  1FZ9 E;  4KHN A;  4KHQ A;  2MZW B;  4ADO A;  3LDS A;  3C6P B;  4FK4 A;  4JS5 A;  4FJN A;  1XL3 C;  1JW2 A;  3BVO A;  2PFT A;  4DTS A;  4X5N A;  1MHZ G;  4KI6 A;  2P1M B;  4I6J B;  3RMC A;  2P1Q B;  4ICG C;  4FJ8 A;  4M3T A;  2FYO A;  4AKI A;  5IRE A;  1XVB E;  3K2O A;  4HCB A;  1CLQ A;  1FXX A;  4FJ7 A;  4IT5 A;  4FJK A;  2LF3 A;  3RMD A;  3QNO A;  4FJ5 A;  4M3U A;  4KHS A;  4DTM A;  1MMO G;  4DTX A;  2DTU A;  4J2D A;  3SQ0 A;  1FZ4 E;  3OGL B;  4DU4 A;  4EP9 A;  3QET A;  3KD5 E;  2RCU A;  3UIQ A;  2JPN A;  3SUP A;  4DTO A;  3N1B A;  4M3X A;  4FJJ A;  1FZ6 E;  1FZ7 E;  4JS4 A;  2OZS A;  2VJ5 A;  3QEV A;  3NCI A;  2JH8 A;  3NAE A;  1WAF A;  4DTP A;  3NHG A;  4I9L A;  2PFV A;  2JHC A;  1FZ5 E;  4FJL A;  3E4W A;  2ATQ A;  2RKH A;  4AKH A;  2P1N B;  2HD0 A;  5IBK B;  2K5S A;  3CFP A;  1IG9 A;  5IZ7 A;  2P5G A;  2YB5 A;  3SCX A;  1Q9Y A;  3L1N A;  4E4B A;  3CQ8 A;  4DTJ A;  4FK0 A;  1XMG E;  4M45 A;  2OZM A;  2OVR B;  2B8I A;  3CFO A;  3SQ2 A;  2JQT A;  1XVG E;  3TL8 B;  4DU1 A;  3C6N B;  1XVC E;  3HL8 A;  4X5M A;  2LF6 A;  2B1E A;  3UO2 A;  1XVD E;  4FJM A;  4M3Y A;  3L8B A;  4FJX A;  2QXF A;  4RG8 A;  4FJ9 A;  2DY4 A;  1FZ1 E;  2P1O B;  3NDK A;  1Q9X A;  3QEX A;  3QNN A;  3SI6 A;  4DU3 A;  2VJ4 A;  4M42 A;  1LDK E;  2MW2 A;  3HGL A;  3C6O B;  4FK2 A;  2OVQ B;  3OGM B;  4FJI A;  2B7M A;  2DEB A;  2P1P B;  1FZH E;  3E4Y A;  4EPH A;  3NE6 A;  4I9Q A;  4FJH A;  4M3Z A;  4FJG A;  5H37 A;  3WSO A;  1FZ0 E;  4M41 A;  3TAB A;  3UO3 A;  1FZ8 E;  2VIX A;  4JRP A;  3KD1 E;  4B08 A;  3LD8 A;  3SNN A;  4KHW A;  2JHA A;  3SPY A;  4M3W A;  3RMB A;  4J2A A;  1FZ3 E;  3CFR A;  3RMA A;  4J2E A;  3J2P A;  3L2O B;  3SUO A;  2E31 A;  1FPO A;  3OGK B;  3QEI A;  4GAM C;  4QNC A;  3RWU A;  3LZI A;  1IH7 A;  3S9H A;  4J2B A;  4KHU A;  2OYQ A;  3J27 A;  3LZJ A;  2FW3 A;  1XU3 E;  1N1C A;  3SQ4 A;  1MHY G;  2JHP A;  3TAE A;  4KHY A;  1XMF E;  3HGK E;  1WAJ A;  2JH9 A;  2OVP B;  1XMH E;  3HP9 A;  3QER A;  3SVI A;  1FZI E;  3NGI A;  1XVE E;  3C94 A;  4RL5 A;  4DTR A;  3SPZ A;  4DTN A;  4E3S A;  4JRQ A;  2E32 A;  4KI4 A;  4AKG A;  3SUN A;  3L0M A;  3V7D B;  4DTU A;  1FYZ E;  1XU5 E;  3MKS B;  4QND A;  4M3R A;  1FS1 A;  2MMB A;  3TAG A;  4AI6 A;  3LDB A;  4RNG A;  4ADN A;  3QEP A;  3C95 A;  2P5O A;  3TAF A;  1NEX B;  3TJY A;  3QES A;  3QEW A;  4EYW A;  3SJJ A;  3SQ1 A;  1XVF E;  3SUQ A;  4HCC A;  1FZ2 E; 
#chains in the Genus database with same CATH homology
 4FVM A;  1MTY G;  2H4T A;  1P22 A;  3N1E A;  1FZ9 E;  4KHN A;  4KHQ A;  2MZW B;  4ADO A;  3LDS A;  3C6P B;  4FK4 A;  4JS5 A;  4FJN A;  1XL3 C;  4DTS A;  2PFT A;  4X5N A;  1MHZ G;  4KI6 A;  2P1M B;  4I6J B;  3RMC A;  2P1Q B;  4FJ8 A;  4M3T A;  2FYO A;  4AKI A;  5IRE A;  1XVB E;  3K2O A;  4HCB A;  1CLQ A;  1FXX A;  4FJ7 A;  4FJK A;  2LF3 A;  3RMD A;  3QNO A;  4FJ5 A;  4M3U A;  4KHS A;  4DTM A;  1MMO G;  4DTX A;  2DTU A;  4J2D A;  3SQ0 A;  1FZ4 E;  3OGL B;  4DU4 A;  4EP9 A;  3QET A;  3KD5 E;  2RCU A;  3UIQ A;  2JPN A;  3SUP A;  4DTO A;  3N1B A;  4M3X A;  4FJJ A;  1FZ6 E;  1FZ7 E;  4JS4 A;  2OZS A;  2VJ5 A;  3QEV A;  3NCI A;  2JH8 A;  3NAE A;  1WAF A;  4DTP A;  3NHG A;  4I9L A;  2PFV A;  2JHC A;  1FZ5 E;  4FJL A;  3E4W A;  2ATQ A;  4AKH A;  2P1N B;  2HD0 A;  5IBK B;  3CFP A;  1IG9 A;  5IZ7 A;  2P5G A;  2YB5 A;  3SCX A;  1Q9Y A;  3L1N A;  4E4B A;  3CQ8 A;  4DTJ A;  4FK0 A;  1XMG E;  4M45 A;  2OZM A;  2OVR B;  2B8I A;  3CFO A;  3SQ2 A;  1XVG E;  3TL8 B;  4DU1 A;  3C6N B;  1XVC E;  3HL8 A;  4X5M A;  2LF6 A;  2B1E A;  1XVD E;  4FJM A;  4M3Y A;  3L8B A;  4FJX A;  2QXF A;  4RG8 A;  4FJ9 A;  2DY4 A;  1FZ1 E;  2P1O B;  3NDK A;  1Q9X A;  3QEX A;  3QNN A;  3SI6 A;  4DU3 A;  2VJ4 A;  4M42 A;  1LDK E;  3HGL A;  3C6O B;  4FK2 A;  2OVQ B;  3OGM B;  4FJI A;  2B7M A;  2DEB A;  2P1P B;  1FZH E;  3E4Y A;  4EPH A;  3NE6 A;  4I9Q A;  4FJH A;  4M3Z A;  4FJG A;  5H37 A;  3WSO A;  1FZ0 E;  4M41 A;  3TAB A;  1FZ8 E;  2VIX A;  4JRP A;  3KD1 E;  4B08 A;  3LD8 A;  3SNN A;  4KHW A;  2JHA A;  3SPY A;  4M3W A;  3RMB A;  4J2A A;  1FZ3 E;  3CFR A;  3RMA A;  4J2E A;  3J2P A;  3L2O B;  3SUO A;  2E31 A;  3OGK B;  3QEI A;  4GAM C;  4QNC A;  3RWU A;  3LZI A;  1IH7 A;  3S9H A;  4J2B A;  4KHU A;  2OYQ A;  3J27 A;  3LZJ A;  2FW3 A;  1XU3 E;  3SQ4 A;  1MHY G;  2JHP A;  3TAE A;  4KHY A;  1XMF E;  3HGK E;  1WAJ A;  2JH9 A;  2OVP B;  1XMH E;  3HP9 A;  3QER A;  3SVI A;  1FZI E;  3NGI A;  1XVE E;  3C94 A;  1XVF E;  4RL5 A;  4DTR A;  3SPZ A;  4DTN A;  4E3S A;  4JRQ A;  2E32 A;  4KI4 A;  4AKG A;  3SUN A;  3L0M A;  3V7D B;  4DTU A;  1FYZ E;  1XU5 E;  3MKS B;  4QND A;  4M3R A;  1FS1 A;  2MMB A;  3TAG A;  4AI6 A;  3LDB A;  4RNG A;  4ADN A;  3QEP A;  2P5O A;  3TAF A;  1NEX B;  3TJY A;  3QES A;  3QEW A;  4EYW A;  3SJJ A;  3SQ1 A;  3C95 A;  3SUQ A;  4HCC A;  1FZ2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...