1FZ0E

Methane monooxygenase hydroxylase, form ii mixed-valent grown anaerobically
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 58
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz0E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz0E02
1FZ1E 1FZ5E 4GAMC 1FZ4E 1XVCE 1XVDE 1XVEE 1XVBE 1XVFE 1FZHE 1FZ0E 1FZ8E 1FZ3E 1FZ6E 1MHYG 1XU5E 1MMOG 1MHZG 1XMGE 1XMHE 1FZIE 1FYZE 1XVGE 1XMFE 1FZ7E 1MTYG 1FZ9E 1XU3E 1FZ2E
chains in the Genus database with same CATH superfamily
1FZ1E 4FVMA 3RMBA 2B8IA 3NE6A 2FW3A 2DEBA 3QEXA 1FZ4E 2OVPB 4DTUA 3CFRA 3K2OA 3SCXA 3C95A 1XVDE 4KHNA 3RMAA 4FK2A 4FJKA 4RNGA 3UO3A 1FZHE 1FZ0E 3L1NA 4DTXA 1Q9XA 1MHYG 3HGKE 1MMOG 2P1NB 2P5GA 3TAEA 1N1CA 3NHGA 3SUNA 1XMGE 4FJ5A 3L8BA 4DTMA 4DTJA 1CLQA 1IH7A 3TL8B 2QXFA 4AI6A 4DTOA 5IBKB 3QESA 4KI6A 4RL5A 2B1EA 3RWUA 3SJJA 2MMBA 4DU4A 2DY4A 4DU3A 3SQ0A 1FZ7E 1MTYG 2MZWB 4KHQA 2P1MB 4X5NA 1FZ9E 5IREA 4EYWA 3SUOA 4FJLA 4J2EA 2MW2A 4DTNA 3S9HA 3SUQA 2OYQA 1XU3E 3LDBA 1FZ5E 3TJYA 3QEIA 2ATQA 2E31A 4ADNA 3J2PA 3MKSB 4M41A 4FK0A 2PFVA 4M3WA 1XVCE 1XVEE 3N1BA 3QERA 4J2DA 4DTRA 3SNNA 1XVFE 1JW2A 1FZ3E 2JPNA 3LZJA 3N1EA 4IT5A 3CFOA 4FJJA 2FYOA 3KD1E 3E4YA 4DTPA 4KHWA 3NAEA 1WAFA 3RMDA 2P5OA 3QEVA 4FJGA 2JHAA 4M42A 1XMFE 3LZIA 4E3SA 3C6PB 4EPHA 2OZSA 4JRQA 4M3ZA 4E4BA 4FJIA 4JS5A 1NEXB 2YB5A 3L2OB 3SQ2A 2OVRB 3QEWA 2OZMA 4GAMC 3BVOA 3RMCA 3WSOA 3TABA 2VJ5A 4AKHA 2P1PB 3HGLA 3CQ8A 3TAGA 2JQTA 3E4WA 1XL3C 3C6NB 3HP9A 3UO2A 2JHPA 2RKHA 4KI4A 2E32A 3NCIA 1XU5E 3QNOA 3SVIA 1MHZG 2HD0A 4KHYA 4FJHA 4I9QA 2H4TA 3J27A 2VJ4A 2K5SA 5IZ7A 4DU1A 1FS1A 3CFPA 4J2AA 4KHSA 4EP9A 3QEPA 3KD5E 4HCBA 4AKIA 4I9LA 4KHUA 3OGMB 3C6OB 3UIQA 1FZ2E 4X5MA 1IG9A 4FJXA 4M3YA 2JH9A 2LF6A 4M3RA 2JH8A 4DTSA 4QNDA 3TAFA 3V7DB 3SPYA 4J2BA 3HL8A 4FJMA 4FJ8A 1FPOA 3QNNA 1XVBE 1P22A 2VIXA 4QNCA 3SQ4A 4RG8A 4FJ9A 2P1QB 4FJNA 2LF3A 1FZ8E 1FZ6E 4M45A 3L0MA 1Q9YA 5H37A 1XMHE 3SUPA 4AKGA 4B08A 2P1OB 4I6JB 4M3UA 4JRPA 1FZIE 1WAJA 4JS4A 3SI6A 4HCCA 1FYZE 3OGKB 4ADOA 2RCUA 2OVQB 3OGLB 4FJ7A 2JHCA 3NDKA 3C94A 2B7MA 3QETA 1XVGE 4ICGC 2DTUA 1FXXA 3NGIA 1LDKE 3LD8A 4M3XA 3SPZA 2PFTA 4FK4A 3SQ1A 4M3TA 3LDSA
chains in the Genus database with same CATH topology
1FZ1E 4FVMA 3RMBA 2B8IA 3NE6A 2FW3A 2DEBA 3QEXA 1FZ4E 2OVPB 4DTUA 3CFRA 3K2OA 3SCXA 3C95A 1XVDE 4KHNA 3RMAA 4FK2A 4FJKA 4RNGA 1FZHE 1FZ0E 3L1NA 4DTXA 1Q9XA 1MHYG 3HGKE 1MMOG 2P1NB 2P5GA 3TAEA 3NHGA 3SUNA 1XMGE 4FJ5A 3L8BA 4DTMA 4DTJA 1CLQA 1IH7A 3TL8B 2QXFA 4AI6A 4DTOA 5IBKB 3QESA 4KI6A 4RL5A 2B1EA 3RWUA 3SJJA 2MMBA 4DU4A 2DY4A 4DU3A 3SQ0A 1FZ7E 1MTYG 2MZWB 4KHQA 2P1MB 4X5NA 1FZ9E 5IREA 4EYWA 3SUOA 4FJLA 4J2EA 4DTNA 3S9HA 3SUQA 2OYQA 1XU3E 3LDBA 1FZ5E 3TJYA 3QEIA 2ATQA 2E31A 4ADNA 3J2PA 3MKSB 4M41A 4FK0A 2PFVA 4M3WA 1XVCE 1XVEE 3N1BA 3QERA 4J2DA 4DTRA 3SNNA 1XVFE 1FZ3E 2JPNA 3LZJA 3N1EA 3CFOA 4FJJA 2FYOA 3KD1E 3E4YA 4DTPA 4KHWA 3NAEA 1WAFA 3RMDA 2P5OA 3QEVA 4FJGA 2JHAA 4M42A 1XMFE 3LZIA 4E3SA 3C6PB 4EPHA 2OZSA 4JRQA 4M3ZA 4E4BA 4FJIA 4JS5A 1NEXB 2YB5A 3L2OB 3SQ2A 2OVRB 3QEWA 2OZMA 4GAMC 3RMCA 3WSOA 3TABA 2VJ5A 4AKHA 2P1PB 3HGLA 3CQ8A 3TAGA 3E4WA 1XL3C 3C6NB 3HP9A 2JHPA 4KI4A 2E32A 3NCIA 1XU5E 3QNOA 3SVIA 1MHZG 2HD0A 4KHYA 4FJHA 4I9QA 2H4TA 3J27A 2VJ4A 5IZ7A 4DU1A 1FS1A 3CFPA 4J2AA 4KHSA 4EP9A 3QEPA 3KD5E 4HCBA 4AKIA 4I9LA 4KHUA 3OGMB 3C6OB 3UIQA 1FZ2E 4X5MA 1IG9A 4FJXA 4M3YA 2JH9A 2LF6A 4M3RA 2JH8A 4DTSA 4QNDA 3TAFA 3V7DB 3SPYA 4J2BA 3HL8A 4FJMA 4FJ8A 3QNNA 1XVBE 1P22A 2VIXA 4QNCA 3SQ4A 4RG8A 4FJ9A 2P1QB 4FJNA 2LF3A 1FZ8E 1FZ6E 4M45A 3L0MA 1Q9YA 5H37A 1XMHE 3SUPA 4AKGA 4B08A 2P1OB 4I6JB 4M3UA 4JRPA 1FZIE 1WAJA 4JS4A 3SI6A 4HCCA 1FYZE 3OGKB 4ADOA 2RCUA 2OVQB 3OGLB 4FJ7A 2JHCA 3NDKA 3C94A 2B7MA 3QETA 1XVGE 2DTUA 1FXXA 3NGIA 1LDKE 3LD8A 4M3XA 3SPZA 2PFTA 4FK4A 3SQ1A 4M3TA 3LDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ1 E;  1FZ5 E;  4GAM C;  1FZ4 E;  1XVC E;  1XVD E;  1XVE E;  1XVB E;  1XVF E;  1FZH E;  1FZ0 E;  1FZ8 E;  1FZ3 E;  1FZ6 E;  1MHY G;  1XU5 E;  1MMO G;  1MHZ G;  1XMG E;  1XMH E;  1FZI E;  1FYZ E;  1XVG E;  1XMF E;  1FZ7 E;  1MTY G;  1FZ9 E;  1XU3 E;  1FZ2 E; 
#chains in the Genus database with same CATH topology
 1FZ1 E;  4FVM A;  3RMB A;  2B8I A;  3NE6 A;  2FW3 A;  2DEB A;  3QEX A;  1FZ4 E;  2OVP B;  4DTU A;  3CFR A;  3K2O A;  3SCX A;  3C95 A;  1XVD E;  4KHN A;  3RMA A;  4FK2 A;  4FJK A;  4RNG A;  3UO3 A;  1FZH E;  1FZ0 E;  3L1N A;  4DTX A;  1Q9X A;  1MHY G;  3HGK E;  1MMO G;  2P1N B;  2P5G A;  3TAE A;  1N1C A;  3NHG A;  3SUN A;  1XMG E;  4FJ5 A;  3L8B A;  4DTM A;  4DTJ A;  1CLQ A;  1IH7 A;  3TL8 B;  2QXF A;  4AI6 A;  4DTO A;  5IBK B;  3QES A;  4KI6 A;  4RL5 A;  2B1E A;  3RWU A;  3SJJ A;  2MMB A;  4DU4 A;  2DY4 A;  4DU3 A;  3SQ0 A;  1FZ7 E;  1MTY G;  2MZW B;  4KHQ A;  2P1M B;  4X5N A;  1FZ9 E;  5IRE A;  4EYW A;  3SUO A;  4FJL A;  4J2E A;  2MW2 A;  4DTN A;  3S9H A;  3SUQ A;  2OYQ A;  1XU3 E;  3LDB A;  1FZ5 E;  3TJY A;  3QEI A;  2ATQ A;  2E31 A;  4ADN A;  3J2P A;  3MKS B;  4M41 A;  4FK0 A;  2PFV A;  4M3W A;  1XVC E;  1XVE E;  3N1B A;  3QER A;  4J2D A;  4DTR A;  3SNN A;  1XVF E;  1JW2 A;  1FZ3 E;  2JPN A;  3LZJ A;  3N1E A;  4IT5 A;  3CFO A;  4FJJ A;  2FYO A;  3KD1 E;  3E4Y A;  4DTP A;  4KHW A;  3NAE A;  1WAF A;  3RMD A;  2P5O A;  3QEV A;  4FJG A;  2JHA A;  4M42 A;  1XMF E;  3LZI A;  4E3S A;  3C6P B;  4EPH A;  2OZS A;  4JRQ A;  4M3Z A;  4E4B A;  4FJI A;  4JS5 A;  1NEX B;  2YB5 A;  3L2O B;  3SQ2 A;  2OVR B;  3QEW A;  2OZM A;  4GAM C;  3BVO A;  3RMC A;  3WSO A;  3TAB A;  2VJ5 A;  4AKH A;  2P1P B;  3HGL A;  3CQ8 A;  3TAG A;  2JQT A;  3E4W A;  1XL3 C;  3C6N B;  3HP9 A;  3UO2 A;  2JHP A;  2RKH A;  4KI4 A;  2E32 A;  3NCI A;  1XU5 E;  3QNO A;  3SVI A;  1MHZ G;  2HD0 A;  4KHY A;  4FJH A;  4I9Q A;  2H4T A;  3J27 A;  2VJ4 A;  2K5S A;  5IZ7 A;  4DU1 A;  1FS1 A;  3CFP A;  4J2A A;  4KHS A;  4EP9 A;  3QEP A;  3KD5 E;  4HCB A;  4AKI A;  4I9L A;  4KHU A;  3OGM B;  3C6O B;  3UIQ A;  1FZ2 E;  4X5M A;  1IG9 A;  4FJX A;  4M3Y A;  2JH9 A;  2LF6 A;  4M3R A;  2JH8 A;  4DTS A;  4QND A;  3TAF A;  3V7D B;  3SPY A;  4J2B A;  3HL8 A;  4FJM A;  4FJ8 A;  1FPO A;  3QNN A;  1XVB E;  1P22 A;  2VIX A;  4QNC A;  3SQ4 A;  4RG8 A;  4FJ9 A;  2P1Q B;  4FJN A;  2LF3 A;  1FZ8 E;  1FZ6 E;  4M45 A;  3L0M A;  1Q9Y A;  5H37 A;  1XMH E;  3SUP A;  4AKG A;  4B08 A;  2P1O B;  4I6J B;  4M3U A;  4JRP A;  1FZI E;  1WAJ A;  4JS4 A;  3SI6 A;  4HCC A;  1FYZ E;  3OGK B;  4ADO A;  2RCU A;  2OVQ B;  3OGL B;  4FJ7 A;  2JHC A;  3NDK A;  3C94 A;  2B7M A;  3QET A;  1XVG E;  4ICG C;  2DTU A;  1FXX A;  3NGI A;  1LDK E;  3LD8 A;  4M3X A;  3SPZ A;  2PFT A;  4FK4 A;  3SQ1 A;  4M3T A;  3LDS A; 
#chains in the Genus database with same CATH homology
 1FZ1 E;  4FVM A;  3RMB A;  2B8I A;  3NE6 A;  2FW3 A;  2DEB A;  3QEX A;  1FZ4 E;  2OVP B;  4DTU A;  3CFR A;  3K2O A;  3SCX A;  3C95 A;  1XVD E;  4KHN A;  3RMA A;  4FK2 A;  4FJK A;  4RNG A;  1FZH E;  1FZ0 E;  3L1N A;  4DTX A;  1Q9X A;  1MHY G;  3HGK E;  1MMO G;  2P1N B;  2P5G A;  3TAE A;  3NHG A;  3SUN A;  1XMG E;  4FJ5 A;  3L8B A;  4DTM A;  4DTJ A;  1CLQ A;  1IH7 A;  3TL8 B;  2QXF A;  4AI6 A;  4DTO A;  5IBK B;  3QES A;  4KI6 A;  4RL5 A;  2B1E A;  3RWU A;  3SJJ A;  2MMB A;  4DU4 A;  2DY4 A;  4DU3 A;  3SQ0 A;  1FZ7 E;  1MTY G;  2MZW B;  4KHQ A;  2P1M B;  4X5N A;  1FZ9 E;  5IRE A;  4EYW A;  3SUO A;  4FJL A;  4J2E A;  4DTN A;  3S9H A;  3SUQ A;  2OYQ A;  1XU3 E;  3LDB A;  1FZ5 E;  3TJY A;  3QEI A;  2ATQ A;  2E31 A;  4ADN A;  3J2P A;  3MKS B;  4M41 A;  4FK0 A;  2PFV A;  4M3W A;  1XVC E;  1XVE E;  3N1B A;  3QER A;  4J2D A;  4DTR A;  3SNN A;  1XVF E;  1FZ3 E;  2JPN A;  3LZJ A;  3N1E A;  3CFO A;  4FJJ A;  2FYO A;  3KD1 E;  3E4Y A;  4DTP A;  4KHW A;  3NAE A;  1WAF A;  3RMD A;  2P5O A;  3QEV A;  4FJG A;  2JHA A;  4M42 A;  1XMF E;  3LZI A;  4E3S A;  3C6P B;  4EPH A;  2OZS A;  4JRQ A;  4M3Z A;  4E4B A;  4FJI A;  4JS5 A;  1NEX B;  2YB5 A;  3L2O B;  3SQ2 A;  2OVR B;  3QEW A;  2OZM A;  4GAM C;  3RMC A;  3WSO A;  3TAB A;  2VJ5 A;  4AKH A;  2P1P B;  3HGL A;  3CQ8 A;  3TAG A;  3E4W A;  1XL3 C;  3C6N B;  3HP9 A;  2JHP A;  4KI4 A;  2E32 A;  3NCI A;  1XU5 E;  3QNO A;  3SVI A;  1MHZ G;  2HD0 A;  4KHY A;  4FJH A;  4I9Q A;  2H4T A;  3J27 A;  2VJ4 A;  5IZ7 A;  4DU1 A;  1FS1 A;  3CFP A;  4J2A A;  4KHS A;  4EP9 A;  3QEP A;  3KD5 E;  4HCB A;  4AKI A;  4I9L A;  4KHU A;  3OGM B;  3C6O B;  3UIQ A;  1FZ2 E;  4X5M A;  1IG9 A;  4FJX A;  4M3Y A;  2JH9 A;  2LF6 A;  4M3R A;  2JH8 A;  4DTS A;  4QND A;  3TAF A;  3V7D B;  3SPY A;  4J2B A;  3HL8 A;  4FJM A;  4FJ8 A;  3QNN A;  1XVB E;  1P22 A;  2VIX A;  4QNC A;  3SQ4 A;  4RG8 A;  4FJ9 A;  2P1Q B;  4FJN A;  2LF3 A;  1FZ8 E;  1FZ6 E;  4M45 A;  3L0M A;  1Q9Y A;  5H37 A;  1XMH E;  3SUP A;  4AKG A;  4B08 A;  2P1O B;  4I6J B;  4M3U A;  4JRP A;  1FZI E;  1WAJ A;  4JS4 A;  3SI6 A;  4HCC A;  1FYZ E;  3OGK B;  4ADO A;  2RCU A;  2OVQ B;  3OGL B;  4FJ7 A;  2JHC A;  3NDK A;  3C94 A;  2B7M A;  3QET A;  1XVG E;  2DTU A;  1FXX A;  3NGI A;  1LDK E;  3LD8 A;  4M3X A;  3SPZ A;  2PFT A;  4FK4 A;  3SQ1 A;  4M3T A;  3LDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...