1FZ0E

Methane monooxygenase hydroxylase, form ii mixed-valent grown anaerobically
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
total genus 58
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz0E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz0E02
1XU5E 1XVFE 1XMGE 4GAMC 1FZ0E 1XVCE 1FZIE 1XVDE 1FZ2E 1XMHE 1XVGE 1FZ6E 1XVEE 1MMOG 1XVBE 1FZ7E 1XMFE 1XU3E 1FZ3E 1FYZE 1MHZG 1MHYG 1FZ9E 1FZ1E 1FZ5E 1MTYG 1FZ4E 1FZ8E 1FZHE
chains in the Genus database with same CATH superfamily
3CQ8A 2JH9A 4RNGA 3QEPA 4JRPA 4FJNA 4FK0A 4J2BA 4KHWA 3SNNA 1XVCE 3HGKE 1XVDE 3QNOA 4FJ9A 2RKHA 3SUPA 2P5GA 3TAFA 4FJJA 4KHNA 3NAEA 2JPNA 1Q9YA 2HD0A 4DTJA 3SI6A 1XL3C 2RCUA 3SUOA 4AKGA 3NHGA 2LF6A 3N1EA 4FVMA 4ADOA 2DEBA 4FK4A 3SJJA 1FXXA 3OGKB 3SUNA 1JW2A 4ICGC 3L8BA 1FZ7E 4JS5A 1XMFE 3J27A 4HCCA 4FJXA 4KHSA 3TAGA 3S9HA 2JHPA 3SQ2A 2VJ4A 3J2PA 4M3TA 2PFTA 1FZ9E 3QEWA 4ADNA 4J2EA 1CLQA 1FZ5E 1MTYG 1FZ4E 3C6OB 5IREA 2JHAA 1FZ8E 3LZIA 3UO3A 1N1CA 3HGLA 3CFPA 3QNNA 3SCXA 3SPZA 4M3WA 3LDSA 1XVFE 2JHCA 3QEIA 4FJKA 4KHQA 1IH7A 2LF3A 3QETA 1WAJA 2P1PB 4DTUA 4EYWA 4E3SA 1XMHE 3RMCA 3TL8B 4JRQA 3L1NA 2OZSA 3SQ4A 4DU4A 2YB5A 1XVEE 1MMOG 3N1BA 2PFVA 4DTPA 4KHYA 1Q9XA 3SQ1A 2OYQA 4FJHA 3LD8A 3QERA 1XU3E 3RMAA 4FJ5A 4KI6A 3RMBA 1FZ3E 4J2AA 4AI6A 4QNCA 3QESA 1MHZG 1MHYG 3NDKA 4AKIA 4M3ZA 1FZ1E 2JQTA 3C6PB 3E4WA 4DU1A 2P1QB 2B1EA 4FK2A 4M3UA 1XU5E 2ATQA 2K5SA 3V7DB 3C95A 3UO2A 4RG8A 2VJ5A 4JS4A 1XMGE 2OZMA 4M3XA 3C94A 1FZ0E 2FW3A 3BVOA 2P5OA 4QNDA 3TAEA 4X5MA 3L0MA 4DTMA 2E31A 3NCIA 2OVQB 3KD5E 1FZ6E 4I9LA 3QEVA 1XVBE 4DTNA 3UIQA 4RL5A 4FJGA 4DTRA 4M42A 2MZWB 3MKSB 2QXFA 4I9QA 2VIXA 3L2OB 1FYZE 4DTSA 4AKHA 1IG9A 2B8IA 2MMBA 4FJ7A 3OGMB 5IZ7A 3LZJA 3C6NB 4I6JB 4M3RA 4EP9A 2OVRB 1FZHE 2DTUA 3CFOA 2P1OB 4IT5A 4GAMC 3TJYA 1WAFA 3NE6A 2B7MA 3RMDA 4B08A 1FZIE 4FJIA 4FJLA 4HCBA 4X5NA 1FZ2E 2DY4A 4EPHA 3WSOA 2OVPB 4M45A 3LDBA 4E4BA 3SVIA 4DU3A 1XVGE 4M3YA 4FJ8A 1NEXB 2E32A 3QEXA 3E4YA 2H4TA 3K2OA 2MW2A 1P22A 3KD1E 4KI4A 3SUQA 2P1MB 3OGLB 2P1NB 4DTOA 3CFRA 5IBKB 1FS1A 3HP9A 3TABA 3SPYA 3RWUA 2FYOA 4DTXA 5H37A 4KHUA 4FJMA 3HL8A 1FPOA 2JH8A 1LDKE 4J2DA 3NGIA 3SQ0A 4M41A
chains in the Genus database with same CATH topology
3CQ8A 2JH9A 4RNGA 3QEPA 4JRPA 4FJNA 4FK0A 4J2BA 4KHWA 3SNNA 1XVCE 3HGKE 1XVDE 3QNOA 4FJ9A 3SUPA 2P5GA 3TAFA 4FJJA 4KHNA 3NAEA 2JPNA 1Q9YA 2HD0A 4DTJA 3SI6A 1XL3C 2RCUA 3SUOA 4AKGA 3NHGA 2LF6A 3N1EA 4FVMA 4ADOA 2DEBA 4FK4A 3SJJA 1FXXA 3OGKB 3SUNA 3L8BA 4JS5A 1FZ7E 4FJXA 1XMFE 3J27A 4HCCA 4KHSA 3TAGA 3S9HA 2JHPA 3SQ2A 2VJ4A 3J2PA 4M3TA 2PFTA 1FZ9E 3QEWA 4ADNA 4J2EA 1CLQA 3C6OB 1FZ5E 1MTYG 1FZ4E 5IREA 2JHAA 1FZ8E 3LZIA 3QNNA 3CFPA 3HGLA 3SCXA 3SPZA 4FJ7A 4M3WA 3LDSA 1XVFE 2JHCA 3QEIA 4FJKA 4KHQA 1IH7A 2LF3A 3QETA 1WAJA 2P1PB 4DTUA 4EYWA 4E3SA 1XMHE 3RMCA 3TL8B 4JRQA 3L1NA 2OZSA 3SQ4A 4DU4A 2YB5A 1XVEE 1MMOG 3N1BA 2PFVA 4DTPA 4KHYA 1Q9XA 3SQ1A 2OYQA 4FJHA 3LD8A 3QERA 1XU3E 3RMAA 4FJ5A 4KI6A 3RMBA 1FZ3E 4J2AA 4AI6A 4QNCA 3QESA 1MHZG 1MHYG 3NDKA 4AKIA 4M3ZA 1FZ1E 3C6PB 3E4WA 4DU1A 2P1QB 2B1EA 4FK2A 4M3UA 1XU5E 2ATQA 3V7DB 3C95A 4JS4A 4RG8A 2VJ5A 4M3XA 1XMGE 2OZMA 3C94A 1FZ0E 2FW3A 2P5OA 4QNDA 3TAEA 4X5MA 3L0MA 4DTMA 2E31A 3NCIA 2OVQB 3KD5E 1FZ6E 4I9LA 3QEVA 1XVBE 4DTNA 3UIQA 4RL5A 4FJGA 4DTRA 4M42A 2MZWB 3MKSB 2QXFA 4I9QA 2VIXA 3L2OB 1FYZE 4DTSA 4AKHA 1IG9A 2B8IA 2MMBA 3OGMB 5IZ7A 3LZJA 3C6NB 4I6JB 4M3RA 4EP9A 2OVRB 1FZHE 2DTUA 3CFOA 2P1OB 4GAMC 3TJYA 1WAFA 3NE6A 2B7MA 3RMDA 4B08A 1FZIE 4FJIA 4FJLA 4HCBA 4X5NA 1FZ2E 2DY4A 4EPHA 3WSOA 2OVPB 4M45A 3LDBA 4E4BA 3SVIA 4DU3A 1XVGE 4M3YA 4FJ8A 1NEXB 2E32A 3QEXA 3E4YA 2H4TA 3K2OA 1P22A 3KD1E 4KI4A 3SUQA 2P1MB 3OGLB 2P1NB 4DTOA 3CFRA 5IBKB 1FS1A 3HP9A 3TABA 3SPYA 3RWUA 2FYOA 4DTXA 5H37A 4KHUA 4FJMA 3HL8A 2JH8A 1LDKE 4J2DA 3NGIA 3SQ0A 4M41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XU5 E;  1XVF E;  1XMG E;  4GAM C;  1FZ0 E;  1XVC E;  1FZI E;  1XVD E;  1FZ2 E;  1XMH E;  1XVG E;  1FZ6 E;  1XVE E;  1MMO G;  1XVB E;  1FZ7 E;  1XMF E;  1XU3 E;  1FZ3 E;  1FYZ E;  1MHZ G;  1MHY G;  1FZ9 E;  1FZ1 E;  1FZ5 E;  1MTY G;  1FZ4 E;  1FZ8 E;  1FZH E; 
#chains in the Genus database with same CATH topology
 3CQ8 A;  2JH9 A;  4RNG A;  3QEP A;  4JRP A;  4FJN A;  4FK0 A;  4J2B A;  4KHW A;  3SNN A;  1XVC E;  3HGK E;  1XVD E;  3QNO A;  4FJ9 A;  2RKH A;  3SUP A;  2P5G A;  3TAF A;  4FJJ A;  4KHN A;  3NAE A;  2JPN A;  1Q9Y A;  2HD0 A;  4DTJ A;  3SI6 A;  1XL3 C;  2RCU A;  3SUO A;  4AKG A;  3NHG A;  2LF6 A;  3N1E A;  4FVM A;  4ADO A;  2DEB A;  4FK4 A;  3SJJ A;  1FXX A;  3OGK B;  3SUN A;  1JW2 A;  4ICG C;  3L8B A;  1FZ7 E;  4JS5 A;  1XMF E;  3J27 A;  4HCC A;  4FJX A;  4KHS A;  3TAG A;  3S9H A;  2JHP A;  3SQ2 A;  2VJ4 A;  3J2P A;  4M3T A;  2PFT A;  1FZ9 E;  3QEW A;  4ADN A;  4J2E A;  1CLQ A;  1FZ5 E;  1MTY G;  1FZ4 E;  3C6O B;  5IRE A;  2JHA A;  1FZ8 E;  3LZI A;  3UO3 A;  1N1C A;  3HGL A;  3CFP A;  3QNN A;  3SCX A;  3SPZ A;  4M3W A;  3LDS A;  1XVF E;  2JHC A;  3QEI A;  4FJK A;  4KHQ A;  1IH7 A;  2LF3 A;  3QET A;  1WAJ A;  2P1P B;  4DTU A;  4EYW A;  4E3S A;  1XMH E;  3RMC A;  3TL8 B;  4JRQ A;  3L1N A;  2OZS A;  3SQ4 A;  4DU4 A;  2YB5 A;  1XVE E;  1MMO G;  3N1B A;  2PFV A;  4DTP A;  4KHY A;  1Q9X A;  3SQ1 A;  2OYQ A;  4FJH A;  3LD8 A;  3QER A;  1XU3 E;  3RMA A;  4FJ5 A;  4KI6 A;  3RMB A;  1FZ3 E;  4J2A A;  4AI6 A;  4QNC A;  3QES A;  1MHZ G;  1MHY G;  3NDK A;  4AKI A;  4M3Z A;  1FZ1 E;  2JQT A;  3C6P B;  3E4W A;  4DU1 A;  2P1Q B;  2B1E A;  4FK2 A;  4M3U A;  1XU5 E;  2ATQ A;  2K5S A;  3V7D B;  3C95 A;  3UO2 A;  4RG8 A;  2VJ5 A;  4JS4 A;  1XMG E;  2OZM A;  4M3X A;  3C94 A;  1FZ0 E;  2FW3 A;  3BVO A;  2P5O A;  4QND A;  3TAE A;  4X5M A;  3L0M A;  4DTM A;  2E31 A;  3NCI A;  2OVQ B;  3KD5 E;  1FZ6 E;  4I9L A;  3QEV A;  1XVB E;  4DTN A;  3UIQ A;  4RL5 A;  4FJG A;  4DTR A;  4M42 A;  2MZW B;  3MKS B;  2QXF A;  4I9Q A;  2VIX A;  3L2O B;  1FYZ E;  4DTS A;  4AKH A;  1IG9 A;  2B8I A;  2MMB A;  4FJ7 A;  3OGM B;  5IZ7 A;  3LZJ A;  3C6N B;  4I6J B;  4M3R A;  4EP9 A;  2OVR B;  1FZH E;  2DTU A;  3CFO A;  2P1O B;  4IT5 A;  4GAM C;  3TJY A;  1WAF A;  3NE6 A;  2B7M A;  3RMD A;  4B08 A;  1FZI E;  4FJI A;  4FJL A;  4HCB A;  4X5N A;  1FZ2 E;  2DY4 A;  4EPH A;  3WSO A;  2OVP B;  4M45 A;  3LDB A;  4E4B A;  3SVI A;  4DU3 A;  1XVG E;  4M3Y A;  4FJ8 A;  1NEX B;  2E32 A;  3QEX A;  3E4Y A;  2H4T A;  3K2O A;  2MW2 A;  1P22 A;  3KD1 E;  4KI4 A;  3SUQ A;  2P1M B;  3OGL B;  2P1N B;  4DTO A;  3CFR A;  5IBK B;  1FS1 A;  3HP9 A;  3TAB A;  3SPY A;  3RWU A;  2FYO A;  4DTX A;  5H37 A;  4KHU A;  4FJM A;  3HL8 A;  1FPO A;  2JH8 A;  1LDK E;  4J2D A;  3NGI A;  3SQ0 A;  4M41 A; 
#chains in the Genus database with same CATH homology
 3CQ8 A;  2JH9 A;  4RNG A;  3QEP A;  4JRP A;  4FJN A;  4FK0 A;  4J2B A;  4KHW A;  3SNN A;  1XVC E;  3HGK E;  1XVD E;  3QNO A;  4FJ9 A;  3SUP A;  2P5G A;  3TAF A;  4FJJ A;  4KHN A;  3NAE A;  2JPN A;  1Q9Y A;  2HD0 A;  4DTJ A;  3SI6 A;  1XL3 C;  2RCU A;  3SUO A;  4AKG A;  3NHG A;  2LF6 A;  3N1E A;  4FVM A;  4ADO A;  2DEB A;  4FK4 A;  3SJJ A;  1FXX A;  3OGK B;  3SUN A;  3L8B A;  4JS5 A;  1FZ7 E;  4FJX A;  1XMF E;  3J27 A;  4HCC A;  4KHS A;  3TAG A;  3S9H A;  2JHP A;  3SQ2 A;  2VJ4 A;  3J2P A;  4M3T A;  2PFT A;  1FZ9 E;  3QEW A;  4ADN A;  4J2E A;  1CLQ A;  3C6O B;  1FZ5 E;  1MTY G;  1FZ4 E;  5IRE A;  2JHA A;  1FZ8 E;  3LZI A;  3QNN A;  3CFP A;  3HGL A;  3SCX A;  3SPZ A;  4FJ7 A;  4M3W A;  3LDS A;  1XVF E;  2JHC A;  3QEI A;  4FJK A;  4KHQ A;  1IH7 A;  2LF3 A;  3QET A;  1WAJ A;  2P1P B;  4DTU A;  4EYW A;  4E3S A;  1XMH E;  3RMC A;  3TL8 B;  4JRQ A;  3L1N A;  2OZS A;  3SQ4 A;  4DU4 A;  2YB5 A;  1XVE E;  1MMO G;  3N1B A;  2PFV A;  4DTP A;  4KHY A;  1Q9X A;  3SQ1 A;  2OYQ A;  4FJH A;  3LD8 A;  3QER A;  1XU3 E;  3RMA A;  4FJ5 A;  4KI6 A;  3RMB A;  1FZ3 E;  4J2A A;  4AI6 A;  4QNC A;  3QES A;  1MHZ G;  1MHY G;  3NDK A;  4AKI A;  4M3Z A;  1FZ1 E;  3C6P B;  3E4W A;  4DU1 A;  2P1Q B;  2B1E A;  4FK2 A;  4M3U A;  1XU5 E;  2ATQ A;  3V7D B;  3C95 A;  4JS4 A;  4RG8 A;  2VJ5 A;  4M3X A;  1XMG E;  2OZM A;  3C94 A;  1FZ0 E;  2FW3 A;  2P5O A;  4QND A;  3TAE A;  4X5M A;  3L0M A;  4DTM A;  2E31 A;  3NCI A;  2OVQ B;  3KD5 E;  1FZ6 E;  4I9L A;  3QEV A;  1XVB E;  4DTN A;  3UIQ A;  4RL5 A;  4FJG A;  4DTR A;  4M42 A;  2MZW B;  3MKS B;  2QXF A;  4I9Q A;  2VIX A;  3L2O B;  1FYZ E;  4DTS A;  4AKH A;  1IG9 A;  2B8I A;  2MMB A;  3OGM B;  5IZ7 A;  3LZJ A;  3C6N B;  4I6J B;  4M3R A;  4EP9 A;  2OVR B;  1FZH E;  2DTU A;  3CFO A;  2P1O B;  4GAM C;  3TJY A;  1WAF A;  3NE6 A;  2B7M A;  3RMD A;  4B08 A;  1FZI E;  4FJI A;  4FJL A;  4HCB A;  4X5N A;  1FZ2 E;  2DY4 A;  4EPH A;  3WSO A;  2OVP B;  4M45 A;  3LDB A;  4E4B A;  3SVI A;  4DU3 A;  1XVG E;  4M3Y A;  4FJ8 A;  1NEX B;  2E32 A;  3QEX A;  3E4Y A;  2H4T A;  3K2O A;  1P22 A;  3KD1 E;  4KI4 A;  3SUQ A;  2P1M B;  3OGL B;  2P1N B;  4DTO A;  3CFR A;  5IBK B;  1FS1 A;  3HP9 A;  3TAB A;  3SPY A;  3RWU A;  2FYO A;  4DTX A;  5H37 A;  4KHU A;  4FJM A;  3HL8 A;  2JH8 A;  1LDK E;  4J2D A;  3NGI A;  3SQ0 A;  4M41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...