1FZ0E

Methane monooxygenase hydroxylase, form ii mixed-valent grown anaerobically
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 58
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz0E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz0E02
1MHYG 1FZ6E 1MHZG 1FZHE 1FZ7E 1XMGE 1FZ0E 1MMOG 1FYZE 1MTYG 1XMFE 1FZ1E 1XU3E 1XVBE 1XVFE 1XVEE 1XU5E 1FZ9E 1XMHE 1FZ4E 1FZ5E 1FZIE 4GAMC 1FZ2E 1XVDE 1XVCE 1FZ3E 1XVGE 1FZ8E
chains in the Genus database with same CATH superfamily
4FJJA 1MHYG 4FJIA 4KHYA 1FZ6E 2LF3A 4DTSA 3QNNA 1FZHE 4FJKA 2E31A 2QXFA 3SUQA 3RMDA 4FK4A 4ADNA 2ATQA 4EPHA 3L8BA 3LZIA 4DTMA 2FW3A 3UO3A 3V7DB 1XMGE 4KHQA 3L1NA 1P22A 4DTNA 4M3XA 3SQ1A 1MMOG 4E3SA 3QETA 1MTYG 1XMFE 3QESA 1Q9XA 4J2EA 3C6OB 3K2OA 4DTPA 2DY4A 4ADOA 3OGMB 2OZMA 3QNOA 1FZ5E 3RMAA 4KHUA 2B1EA 4M45A 1IH7A 3C94A 4JS4A 3L2OB 2E32A 3N1BA 2PFTA 2OYQA 4ICGC 2LF6A 1XVGE 3KD1E 4RNGA 4B08A 3CFRA 4QNCA 3TJYA 3NDKA 3HL8A 1IG9A 2DEBA 3QEXA 4FJHA 4FK2A 4AKGA 1LDKE 2YB5A 3J2PA 4DTXA 1MHZG 4KHWA 4KHSA 4E4BA 4M3TA 4DTUA 1WAJA 4KI6A 3S9HA 1NEXB 2P1QB 4AKHA 1FZ7E 2P1MB 3LDSA 4J2AA 4HCCA 2RKHA 2MZWB 3BVOA 4M42A 2DTUA 2H4TA 1FPOA 2RCUA 2VJ5A 1XVFE 1WAFA 1XU5E 1FS1A 3HGLA 3LDBA 3TAEA 3CFOA 1FZ9E 4M3UA 4DU4A 5IREA 4EP9A 3SUPA 4FJ8A 1FZIE 4GAMC 4DU3A 2P1NB 3NAEA 2VIXA 3TAGA 3SPZA 2P5OA 1FZ3E 1JW2A 2HD0A 3J27A 2MMBA 2P1OB 4M41A 3NGIA 3QEPA 3E4YA 4DTOA 4FJNA 4M3WA 3HP9A 5IZ7A 4JRPA 4AI6A 3LD8A 3SQ4A 3RMCA 4FJLA 4M3YA 3NE6A 1FZ0E 4FJ7A 1FYZE 3TL8B 3KD5E 4QNDA 2JQTA 1FZ1E 3CFPA 2B7MA 3C95A 1XU3E 1XVEE 2B8IA 2PFVA 4DU1A 3TABA 3SUNA 2JHPA 2JHCA 3C6PB 3HGKE 4FVMA 3SQ0A 2P5GA 1FZ4E 4RL5A 2OZSA 3SJJA 4JS5A 3QEVA 4AKIA 4FJGA 4I9LA 3WSOA 3SPYA 2FYOA 1FZ2E 4FJMA 1XVDE 1Q9YA 4FJ9A 2K5SA 3TAFA 5H37A 3MKSB 4M3RA 4RG8A 3L0MA 4EYWA 4FK0A 4J2BA 3CQ8A 3N1EA 3E4WA 3SUOA 3NHGA 3SNNA 2JH8A 1XL3C 1FXXA 2OVQB 3SVIA 4FJXA 4IT5A 3UO2A 1CLQA 4M3ZA 5IBKB 3LZJA 4DTJA 2JPNA 4X5MA 1N1CA 1XVBE 3SQ2A 3RMBA 4HCBA 2OVRB 4DTRA 3SI6A 2JHAA 1XMHE 2MW2A 3C6NB 3OGKB 4I6JB 2JH9A 4JRQA 3RWUA 4J2DA 3QEWA 4KI4A 4FJ5A 3OGLB 2P1PB 3NCIA 2OVPB 2VJ4A 4I9QA 1XVCE 4X5NA 3QEIA 3QERA 3SCXA 1FZ8E 3UIQA 4KHNA
chains in the Genus database with same CATH topology
4FJJA 1MHYG 4FJIA 4KHYA 1FZ6E 2LF3A 4DTSA 3QNNA 1FZHE 4FJKA 2E31A 2QXFA 3SUQA 3RMDA 4FK4A 4ADNA 2ATQA 4EPHA 3L8BA 3LZIA 4DTMA 2FW3A 3V7DB 1XMGE 4KHQA 3L1NA 1P22A 4DTNA 4M3XA 3SQ1A 1MMOG 4E3SA 3QETA 1MTYG 1XMFE 3QESA 1Q9XA 4J2EA 3C6OB 3K2OA 4DTPA 2DY4A 4ADOA 3OGMB 2OZMA 3QNOA 1FZ5E 3RMAA 4KHUA 2B1EA 4M45A 1IH7A 3C94A 4JS4A 3L2OB 2E32A 3N1BA 2PFTA 2OYQA 2LF6A 1XVGE 3KD1E 4RNGA 4B08A 3CFRA 4QNCA 3TJYA 3NDKA 3HL8A 1IG9A 2DEBA 3QEXA 4FJHA 4FK2A 4AKGA 1LDKE 2YB5A 3J2PA 4DTXA 1MHZG 4KHWA 4KHSA 4E4BA 4M3TA 4DTUA 1WAJA 4KI6A 3S9HA 1NEXB 2P1QB 4AKHA 1FZ7E 2P1MB 3LDSA 4J2AA 4HCCA 2MZWB 4M42A 2DTUA 2H4TA 2RCUA 2VJ5A 1XVFE 1WAFA 1XU5E 1FS1A 3HGLA 3LDBA 3TAEA 3CFOA 1FZ9E 4M3UA 4DU4A 5IREA 4EP9A 3SUPA 4FJ8A 1FZIE 4GAMC 4DU3A 2P1NB 3NAEA 2VIXA 3TAGA 3SPZA 2P5OA 1FZ3E 2HD0A 3J27A 2MMBA 2P1OB 4M41A 3NGIA 3QEPA 3E4YA 4DTOA 4FJNA 4M3WA 3HP9A 5IZ7A 4JRPA 4AI6A 3LD8A 3SQ4A 3RMCA 4FJLA 4M3YA 3NE6A 1FZ0E 4FJ7A 1FYZE 3TL8B 3KD5E 4QNDA 1FZ1E 3CFPA 2B7MA 3C95A 1XU3E 1XVEE 2B8IA 2PFVA 4DU1A 3TABA 3SUNA 2JHPA 2JHCA 3C6PB 3HGKE 4FVMA 3SQ0A 2P5GA 1FZ4E 4RL5A 2OZSA 3SJJA 4JS5A 3QEVA 4AKIA 4FJGA 4I9LA 3WSOA 3SPYA 2FYOA 1FZ2E 4FJMA 1XVDE 1Q9YA 4FJ9A 3TAFA 5H37A 3MKSB 4M3RA 4RG8A 3L0MA 4EYWA 4FK0A 4J2BA 3CQ8A 3N1EA 3E4WA 3SUOA 3NHGA 3SNNA 2JH8A 1XL3C 1FXXA 2OVQB 3SVIA 4FJXA 1CLQA 4M3ZA 5IBKB 3LZJA 4DTJA 2JPNA 4X5MA 3SQ2A 1XVBE 3RMBA 4HCBA 2OVRB 4DTRA 3SI6A 2JHAA 1XMHE 3C6NB 3OGKB 4I6JB 4JRQA 2JH9A 3RWUA 4J2DA 4KI4A 3QEWA 4FJ5A 3OGLB 2P1PB 3NCIA 2OVPB 2VJ4A 4I9QA 1XVCE 4X5NA 3QEIA 3QERA 3SCXA 1FZ8E 3UIQA 4KHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHY G;  1FZ6 E;  1MHZ G;  1FZH E;  1FZ7 E;  1XMG E;  1FZ0 E;  1MMO G;  1FYZ E;  1MTY G;  1XMF E;  1FZ1 E;  1XU3 E;  1XVB E;  1XVF E;  1XVE E;  1XU5 E;  1FZ9 E;  1XMH E;  1FZ4 E;  1FZ5 E;  1FZI E;  4GAM C;  1FZ2 E;  1XVD E;  1XVC E;  1FZ3 E;  1XVG E;  1FZ8 E; 
#chains in the Genus database with same CATH topology
 4FJJ A;  1MHY G;  4FJI A;  4KHY A;  1FZ6 E;  2LF3 A;  4DTS A;  3QNN A;  1FZH E;  4FJK A;  2E31 A;  2QXF A;  3SUQ A;  3RMD A;  4FK4 A;  4ADN A;  2ATQ A;  4EPH A;  3L8B A;  3LZI A;  4DTM A;  2FW3 A;  3UO3 A;  3V7D B;  1XMG E;  4KHQ A;  3L1N A;  1P22 A;  4DTN A;  4M3X A;  3SQ1 A;  1MMO G;  4E3S A;  3QET A;  1MTY G;  1XMF E;  3QES A;  1Q9X A;  4J2E A;  3C6O B;  3K2O A;  4DTP A;  2DY4 A;  4ADO A;  3OGM B;  2OZM A;  3QNO A;  1FZ5 E;  3RMA A;  4KHU A;  2B1E A;  4M45 A;  1IH7 A;  3C94 A;  4JS4 A;  3L2O B;  2E32 A;  3N1B A;  2PFT A;  2OYQ A;  4ICG C;  2LF6 A;  1XVG E;  3KD1 E;  4RNG A;  4B08 A;  3CFR A;  4QNC A;  3TJY A;  3NDK A;  3HL8 A;  1IG9 A;  2DEB A;  3QEX A;  4FJH A;  4FK2 A;  4AKG A;  1LDK E;  2YB5 A;  3J2P A;  4DTX A;  1MHZ G;  4KHW A;  4KHS A;  4E4B A;  4M3T A;  4DTU A;  1WAJ A;  4KI6 A;  3S9H A;  1NEX B;  2P1Q B;  4AKH A;  1FZ7 E;  2P1M B;  3LDS A;  4J2A A;  4HCC A;  2RKH A;  2MZW B;  3BVO A;  4M42 A;  2DTU A;  2H4T A;  1FPO A;  2RCU A;  2VJ5 A;  1XVF E;  1WAF A;  1XU5 E;  1FS1 A;  3HGL A;  3LDB A;  3TAE A;  3CFO A;  1FZ9 E;  4M3U A;  4DU4 A;  5IRE A;  4EP9 A;  3SUP A;  4FJ8 A;  1FZI E;  4GAM C;  4DU3 A;  2P1N B;  3NAE A;  2VIX A;  3TAG A;  3SPZ A;  2P5O A;  1FZ3 E;  1JW2 A;  2HD0 A;  3J27 A;  2MMB A;  2P1O B;  4M41 A;  3NGI A;  3QEP A;  3E4Y A;  4DTO A;  4FJN A;  4M3W A;  3HP9 A;  5IZ7 A;  4JRP A;  4AI6 A;  3LD8 A;  3SQ4 A;  3RMC A;  4FJL A;  4M3Y A;  3NE6 A;  1FZ0 E;  4FJ7 A;  1FYZ E;  3TL8 B;  3KD5 E;  4QND A;  2JQT A;  1FZ1 E;  3CFP A;  2B7M A;  3C95 A;  1XU3 E;  1XVE E;  2B8I A;  2PFV A;  4DU1 A;  3TAB A;  3SUN A;  2JHP A;  2JHC A;  3C6P B;  3HGK E;  4FVM A;  3SQ0 A;  2P5G A;  1FZ4 E;  4RL5 A;  2OZS A;  3SJJ A;  4JS5 A;  3QEV A;  4AKI A;  4FJG A;  4I9L A;  3WSO A;  3SPY A;  2FYO A;  1FZ2 E;  4FJM A;  1XVD E;  1Q9Y A;  4FJ9 A;  2K5S A;  3TAF A;  5H37 A;  3MKS B;  4M3R A;  4RG8 A;  3L0M A;  4EYW A;  4FK0 A;  4J2B A;  3CQ8 A;  3N1E A;  3E4W A;  3SUO A;  3NHG A;  3SNN A;  2JH8 A;  1XL3 C;  1FXX A;  2OVQ B;  3SVI A;  4FJX A;  4IT5 A;  3UO2 A;  1CLQ A;  4M3Z A;  5IBK B;  3LZJ A;  4DTJ A;  2JPN A;  4X5M A;  1N1C A;  1XVB E;  3SQ2 A;  3RMB A;  4HCB A;  2OVR B;  4DTR A;  3SI6 A;  2JHA A;  1XMH E;  2MW2 A;  3C6N B;  3OGK B;  4I6J B;  2JH9 A;  4JRQ A;  3RWU A;  4J2D A;  3QEW A;  4KI4 A;  4FJ5 A;  3OGL B;  2P1P B;  3NCI A;  2OVP B;  2VJ4 A;  4I9Q A;  1XVC E;  4X5N A;  3QEI A;  3QER A;  3SCX A;  1FZ8 E;  3UIQ A;  4KHN A; 
#chains in the Genus database with same CATH homology
 4FJJ A;  1MHY G;  4FJI A;  4KHY A;  1FZ6 E;  2LF3 A;  4DTS A;  3QNN A;  1FZH E;  4FJK A;  2E31 A;  2QXF A;  3SUQ A;  3RMD A;  4FK4 A;  4ADN A;  2ATQ A;  4EPH A;  3L8B A;  3LZI A;  4DTM A;  2FW3 A;  3V7D B;  1XMG E;  4KHQ A;  3L1N A;  1P22 A;  4DTN A;  4M3X A;  3SQ1 A;  1MMO G;  4E3S A;  3QET A;  1MTY G;  1XMF E;  3QES A;  1Q9X A;  4J2E A;  3C6O B;  3K2O A;  4DTP A;  2DY4 A;  4ADO A;  3OGM B;  2OZM A;  3QNO A;  1FZ5 E;  3RMA A;  4KHU A;  2B1E A;  4M45 A;  1IH7 A;  3C94 A;  4JS4 A;  3L2O B;  2E32 A;  3N1B A;  2PFT A;  2OYQ A;  2LF6 A;  1XVG E;  3KD1 E;  4RNG A;  4B08 A;  3CFR A;  4QNC A;  3TJY A;  3NDK A;  3HL8 A;  1IG9 A;  2DEB A;  3QEX A;  4FJH A;  4FK2 A;  4AKG A;  1LDK E;  2YB5 A;  3J2P A;  4DTX A;  1MHZ G;  4KHW A;  4KHS A;  4E4B A;  4M3T A;  4DTU A;  1WAJ A;  4KI6 A;  3S9H A;  1NEX B;  2P1Q B;  4AKH A;  1FZ7 E;  2P1M B;  3LDS A;  4J2A A;  4HCC A;  2MZW B;  4M42 A;  2DTU A;  2H4T A;  2RCU A;  2VJ5 A;  1XVF E;  1WAF A;  1XU5 E;  1FS1 A;  3HGL A;  3LDB A;  3TAE A;  3CFO A;  1FZ9 E;  4M3U A;  4DU4 A;  5IRE A;  4EP9 A;  3SUP A;  4FJ8 A;  1FZI E;  4GAM C;  4DU3 A;  2P1N B;  3NAE A;  2VIX A;  3TAG A;  3SPZ A;  2P5O A;  1FZ3 E;  2HD0 A;  3J27 A;  2MMB A;  2P1O B;  4M41 A;  3NGI A;  3QEP A;  3E4Y A;  4DTO A;  4FJN A;  4M3W A;  3HP9 A;  5IZ7 A;  4JRP A;  4AI6 A;  3LD8 A;  3SQ4 A;  3RMC A;  4FJL A;  4M3Y A;  3NE6 A;  1FZ0 E;  4FJ7 A;  1FYZ E;  3TL8 B;  3KD5 E;  4QND A;  1FZ1 E;  3CFP A;  2B7M A;  3C95 A;  1XU3 E;  1XVE E;  2B8I A;  2PFV A;  4DU1 A;  3TAB A;  3SUN A;  2JHP A;  2JHC A;  3C6P B;  3HGK E;  4FVM A;  3SQ0 A;  2P5G A;  1FZ4 E;  4RL5 A;  2OZS A;  3SJJ A;  4JS5 A;  3QEV A;  4AKI A;  4FJG A;  4I9L A;  3WSO A;  3SPY A;  2FYO A;  1FZ2 E;  4FJM A;  1XVD E;  1Q9Y A;  4FJ9 A;  3TAF A;  5H37 A;  3MKS B;  4M3R A;  4RG8 A;  3L0M A;  4EYW A;  4FK0 A;  4J2B A;  3CQ8 A;  3N1E A;  3E4W A;  3SUO A;  3NHG A;  3SNN A;  2JH8 A;  1XL3 C;  1FXX A;  2OVQ B;  3SVI A;  4FJX A;  1CLQ A;  4M3Z A;  5IBK B;  3LZJ A;  4DTJ A;  2JPN A;  4X5M A;  3SQ2 A;  1XVB E;  3RMB A;  4HCB A;  2OVR B;  4DTR A;  3SI6 A;  2JHA A;  1XMH E;  3C6N B;  3OGK B;  4I6J B;  4JRQ A;  2JH9 A;  3RWU A;  4J2D A;  4KI4 A;  3QEW A;  4FJ5 A;  3OGL B;  2P1P B;  3NCI A;  2OVP B;  2VJ4 A;  4I9Q A;  1XVC E;  4X5N A;  3QEI A;  3QER A;  3SCX A;  1FZ8 E;  3UIQ A;  4KHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...