3N1BA

C-terminal domain of vps54 subunit of the garp complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
131
structure length
131
Chain Sequence
DHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSPCFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Vacuolar protein sorting-associated protein 54
publication title Structural basis for the wobbler mouse neurodegenerative disorder caused by mutation in the Vps54 subunit of the GARP complex.
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.130 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3n1bA02
3N1EA 3N1BA
chains in the Genus database with same CATH superfamily
1FPOA 3LZIA 3C94A 4I6JB 3OGLB 3TAEA 4M41A 4E4BA 4J2EA 2JHPA 4JRPA 4EPHA 2P1OB 3L1NA 4M3ZA 4FK2A 4HCBA 4FJ9A 4KI4A 3C6NB 4M3TA 4FJMA 3CFRA 1FZ7E 3CFOA 2VJ5A 4RNGA 4DU4A 3QEWA 4HCCA 1WAFA 4ICGC 3E4YA 3V7DB 2JH9A 4DTPA 3SQ2A 4FJ5A 4FJ8A 2B8IA 1P22A 3TAFA 4KHWA 1CLQA 4IT5A 2OVQB 4ADNA 4M3YA 4AKGA 3SUQA 3MKSB 4E3SA 3LD8A 3L8BA 2JH8A 4B08A 4M45A 4GAMC 3TL8B 3QERA 1FS1A 1NEXB 2FW3A 2JQTA 3SQ4A 4J2DA 3TABA 3TAGA 2VJ4A 4AI6A 3UIQA 2OVPB 4KHQA 4DTXA 2P1NB 3TJYA 4DU3A 4J2AA 5IBKB 2QXFA 3NDKA 1XMHE 3OGMB 4I9LA 4FJ7A 3QEIA 3RMCA 2VIXA 2E31A 1FZ9E 2RCUA 4QNDA 4DTMA 1IH7A 3SUNA 4FJJA 1FZ5E 4X5NA 3QNNA 2LF6A 3HGKE 1FZ2E 4FVMA 2JPNA 3RMAA 4M3WA 3NCIA 2MZWB 1MHYG 1FYZE 3N1BA 3CQ8A 3SJJA 1XVBE 4AKIA 2MW2A 4FJHA 4ADOA 4FJKA 3SI6A 4FJNA 4KHSA 2DY4A 1XVCE 2P1PB 3WSOA 2YB5A 3RMBA 2B7MA 4JS4A 2P1QB 3C6OB 3QEPA 4FK0A 1XL3C 4RL5A 2OZSA 5IREA 4DTJA 3HP9A 1XMFE 3J2PA 4J2BA 3C95A 1JW2A 3SQ0A 2JHCA 2OVRB 3LZJA 2RKHA 3NE6A 3C6PB 3NAEA 4DTUA 3KD5E 4DU1A 1N1CA 3SVIA 3HGLA 1XVGE 1WAJA 3OGKB 4DTOA 1MMOG 3QEXA 1FZ6E 3SQ1A 1XU5E 3HL8A 4KHUA 5IZ7A 4M3UA 4QNCA 3QEVA 4KI6A 4DTNA 4M3XA 1FZ4E 1Q9XA 3SUPA 4KHNA 4RG8A 1LDKE 3NGIA 2DTUA 2HD0A 3SUOA 2JHAA 5H37A 2LF3A 1XVDE 3QESA 3N1EA 2PFTA 3KD1E 2P5OA 3J27A 4DTSA 3UO3A 2OYQA 4JRQA 4FJLA 1MHZG 4FJIA 1XVFE 3RWUA 1FZIE 3UO2A 3SPZA 3L2OB 4EP9A 3RMDA 2P5GA 4DTRA 3LDSA 3QNOA 1IG9A 4FJGA 4EYWA 2DEBA 2FYOA 4JS5A 4X5MA 4I9QA 2E32A 2OZMA 1Q9YA 4M42A 4KHYA 2ATQA 4M3RA 3S9HA 3L0MA 1XMGE 4FJXA 3E4WA 1FZ3E 3SNNA 3QETA 4AKHA 3BVOA 2H4TA 2K5SA 2P1MB 3SCXA 4FK4A 1XU3E 3K2OA 3LDBA 3NHGA 1FZHE 3CFPA 1FZ0E 1FXXA 1XVEE 1FZ1E 1MTYG 2MMBA 2PFVA 3SPYA 1FZ8E 2B1EA
chains in the Genus database with same CATH topology
3LZIA 3C94A 4I6JB 3OGLB 3TAEA 4M41A 4E4BA 4J2EA 2JHPA 4JRPA 4EPHA 2P1OB 3L1NA 4M3ZA 4FK2A 4HCBA 4FJ9A 4KI4A 3C6NB 4M3TA 4FJMA 3CFRA 1FZ7E 3CFOA 2VJ5A 4RNGA 4DU4A 3QEWA 4HCCA 1WAFA 3V7DB 3E4YA 4DTPA 2JH9A 3SQ2A 4FJ5A 4FJ8A 2B8IA 1P22A 3TAFA 4KHWA 1CLQA 2OVQB 4ADNA 4M3YA 4AKGA 3SUQA 3MKSB 4E3SA 3LD8A 3L8BA 2JH8A 4B08A 4M45A 4GAMC 3TL8B 3QERA 1FS1A 1NEXB 2FW3A 3SQ4A 4J2DA 3TABA 3TAGA 2VJ4A 4AI6A 3UIQA 2OVPB 4KHQA 4DTXA 2P1NB 3TJYA 4DU3A 4J2AA 5IBKB 2QXFA 3NDKA 1XMHE 3OGMB 4I9LA 4FJ7A 3QEIA 3RMCA 2VIXA 2E31A 1FZ9E 2RCUA 4QNDA 4DTMA 1IH7A 3SUNA 4FJJA 1FZ5E 4X5NA 3QNNA 2LF6A 3HGKE 1FZ2E 4FVMA 2JPNA 3RMAA 4M3WA 3NCIA 2MZWB 1MHYG 1FYZE 3N1BA 3CQ8A 3SJJA 1XVBE 4AKIA 4FJHA 4ADOA 4FJKA 3SI6A 4FJNA 4KHSA 2DY4A 1XVCE 2P1PB 3WSOA 2YB5A 3RMBA 2B7MA 4JS4A 2P1QB 3C6OB 3QEPA 4FK0A 1XL3C 4RL5A 2OZSA 5IREA 4DTJA 3HP9A 1XMFE 3J2PA 4J2BA 3C95A 3SQ0A 2JHCA 2OVRB 3LZJA 3NE6A 3C6PB 3NAEA 4DTUA 3KD5E 4DU1A 3SVIA 3HGLA 1XVGE 1WAJA 3OGKB 4DTOA 1MMOG 3QEXA 1FZ6E 3SQ1A 1XU5E 3HL8A 4KHUA 5IZ7A 4M3UA 4QNCA 3QEVA 4KI6A 4DTNA 4M3XA 1FZ4E 1Q9XA 3SUPA 4KHNA 4RG8A 1LDKE 3NGIA 2DTUA 2HD0A 3SUOA 2JHAA 5H37A 2LF3A 1XVDE 3QESA 3N1EA 2PFTA 3KD1E 2P5OA 3J27A 4DTSA 2OYQA 4JRQA 4FJLA 1MHZG 4FJIA 1XVFE 3RWUA 1FZIE 3SPZA 3L2OB 4EP9A 3RMDA 2P5GA 4DTRA 3LDSA 3QNOA 1IG9A 4FJGA 4EYWA 2DEBA 2FYOA 4JS5A 4X5MA 4I9QA 2E32A 2OZMA 1Q9YA 4M42A 4KHYA 2ATQA 4M3RA 3S9HA 3L0MA 1XMGE 4FJXA 3E4WA 1FZ3E 3SNNA 3QETA 4AKHA 2H4TA 2P1MB 3SCXA 4FK4A 1XU3E 3K2OA 3LDBA 3NHGA 1FZHE 3CFPA 1FZ0E 1FXXA 1XVEE 1FZ1E 1MTYG 2MMBA 2PFVA 3SPYA 1FZ8E 2B1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1E A;  3N1B A; 
#chains in the Genus database with same CATH topology
 1FPO A;  3LZI A;  3C94 A;  4I6J B;  3OGL B;  3TAE A;  4M41 A;  4E4B A;  4J2E A;  2JHP A;  4JRP A;  4EPH A;  2P1O B;  3L1N A;  4M3Z A;  4FK2 A;  4HCB A;  4FJ9 A;  4KI4 A;  3C6N B;  4M3T A;  4FJM A;  3CFR A;  1FZ7 E;  3CFO A;  2VJ5 A;  4RNG A;  4DU4 A;  3QEW A;  4HCC A;  1WAF A;  4ICG C;  3E4Y A;  3V7D B;  2JH9 A;  4DTP A;  3SQ2 A;  4FJ5 A;  4FJ8 A;  2B8I A;  1P22 A;  3TAF A;  4KHW A;  1CLQ A;  4IT5 A;  2OVQ B;  4ADN A;  4M3Y A;  4AKG A;  3SUQ A;  3MKS B;  4E3S A;  3LD8 A;  3L8B A;  2JH8 A;  4B08 A;  4M45 A;  4GAM C;  3TL8 B;  3QER A;  1FS1 A;  1NEX B;  2FW3 A;  2JQT A;  3SQ4 A;  4J2D A;  3TAB A;  3TAG A;  2VJ4 A;  4AI6 A;  3UIQ A;  2OVP B;  4KHQ A;  4DTX A;  2P1N B;  3TJY A;  4DU3 A;  4J2A A;  5IBK B;  2QXF A;  3NDK A;  1XMH E;  3OGM B;  4I9L A;  4FJ7 A;  3QEI A;  3RMC A;  2VIX A;  2E31 A;  1FZ9 E;  2RCU A;  4QND A;  4DTM A;  1IH7 A;  3SUN A;  4FJJ A;  1FZ5 E;  4X5N A;  3QNN A;  2LF6 A;  3HGK E;  1FZ2 E;  4FVM A;  2JPN A;  3RMA A;  4M3W A;  3NCI A;  2MZW B;  1MHY G;  1FYZ E;  3N1B A;  3CQ8 A;  3SJJ A;  1XVB E;  4AKI A;  2MW2 A;  4FJH A;  4ADO A;  4FJK A;  3SI6 A;  4FJN A;  4KHS A;  2DY4 A;  1XVC E;  2P1P B;  3WSO A;  2YB5 A;  3RMB A;  2B7M A;  4JS4 A;  2P1Q B;  3C6O B;  3QEP A;  4FK0 A;  1XL3 C;  4RL5 A;  2OZS A;  5IRE A;  4DTJ A;  3HP9 A;  1XMF E;  3J2P A;  4J2B A;  3C95 A;  1JW2 A;  3SQ0 A;  2JHC A;  2OVR B;  3LZJ A;  2RKH A;  3NE6 A;  3C6P B;  3NAE A;  4DTU A;  3KD5 E;  4DU1 A;  1N1C A;  3SVI A;  3HGL A;  1XVG E;  1WAJ A;  3OGK B;  4DTO A;  1MMO G;  3QEX A;  1FZ6 E;  3SQ1 A;  1XU5 E;  3HL8 A;  4KHU A;  5IZ7 A;  4M3U A;  4QNC A;  3QEV A;  4KI6 A;  4DTN A;  4M3X A;  1FZ4 E;  1Q9X A;  3SUP A;  4KHN A;  4RG8 A;  1LDK E;  3NGI A;  2DTU A;  2HD0 A;  3SUO A;  2JHA A;  5H37 A;  2LF3 A;  1XVD E;  3QES A;  3N1E A;  2PFT A;  3KD1 E;  2P5O A;  3J27 A;  4DTS A;  3UO3 A;  2OYQ A;  4JRQ A;  4FJL A;  1MHZ G;  4FJI A;  1XVF E;  3RWU A;  1FZI E;  3UO2 A;  3SPZ A;  3L2O B;  4EP9 A;  3RMD A;  2P5G A;  4DTR A;  3LDS A;  3QNO A;  1IG9 A;  4FJG A;  4EYW A;  2DEB A;  2FYO A;  4JS5 A;  4X5M A;  4I9Q A;  2E32 A;  2OZM A;  1Q9Y A;  4M42 A;  4KHY A;  2ATQ A;  4M3R A;  3S9H A;  3L0M A;  1XMG E;  4FJX A;  3E4W A;  1FZ3 E;  3SNN A;  3QET A;  4AKH A;  3BVO A;  2H4T A;  2K5S A;  2P1M B;  3SCX A;  4FK4 A;  1XU3 E;  3K2O A;  3LDB A;  3NHG A;  1FZH E;  3CFP A;  1FZ0 E;  1FXX A;  1XVE E;  1FZ1 E;  1MTY G;  2MMB A;  2PFV A;  3SPY A;  1FZ8 E;  2B1E A; 
#chains in the Genus database with same CATH homology
 3LZI A;  3C94 A;  4I6J B;  3OGL B;  3TAE A;  4M41 A;  4E4B A;  4J2E A;  2JHP A;  4JRP A;  4EPH A;  2P1O B;  3L1N A;  4M3Z A;  4FK2 A;  4HCB A;  4FJ9 A;  4KI4 A;  3C6N B;  4M3T A;  4FJM A;  3CFR A;  1FZ7 E;  3CFO A;  2VJ5 A;  4RNG A;  4DU4 A;  3QEW A;  4HCC A;  1WAF A;  3V7D B;  3E4Y A;  4DTP A;  2JH9 A;  3SQ2 A;  4FJ5 A;  4FJ8 A;  2B8I A;  1P22 A;  3TAF A;  4KHW A;  1CLQ A;  2OVQ B;  4ADN A;  4M3Y A;  4AKG A;  3SUQ A;  3MKS B;  4E3S A;  3LD8 A;  3L8B A;  2JH8 A;  4B08 A;  4M45 A;  4GAM C;  3TL8 B;  3QER A;  1FS1 A;  1NEX B;  2FW3 A;  3SQ4 A;  4J2D A;  3TAB A;  3TAG A;  2VJ4 A;  4AI6 A;  3UIQ A;  2OVP B;  4KHQ A;  4DTX A;  2P1N B;  3TJY A;  4DU3 A;  4J2A A;  5IBK B;  2QXF A;  3NDK A;  1XMH E;  3OGM B;  4I9L A;  4FJ7 A;  3QEI A;  3RMC A;  2VIX A;  2E31 A;  1FZ9 E;  2RCU A;  4QND A;  4DTM A;  1IH7 A;  3SUN A;  4FJJ A;  1FZ5 E;  4X5N A;  3QNN A;  2LF6 A;  3HGK E;  1FZ2 E;  4FVM A;  2JPN A;  3RMA A;  4M3W A;  3NCI A;  2MZW B;  1MHY G;  1FYZ E;  3N1B A;  3CQ8 A;  3SJJ A;  1XVB E;  4AKI A;  4FJH A;  4ADO A;  4FJK A;  3SI6 A;  4FJN A;  4KHS A;  2DY4 A;  1XVC E;  2P1P B;  3WSO A;  2YB5 A;  3RMB A;  2B7M A;  4JS4 A;  2P1Q B;  3C6O B;  3QEP A;  4FK0 A;  1XL3 C;  4RL5 A;  2OZS A;  5IRE A;  4DTJ A;  3HP9 A;  1XMF E;  3J2P A;  4J2B A;  3C95 A;  3SQ0 A;  2JHC A;  2OVR B;  3LZJ A;  3NE6 A;  3C6P B;  3NAE A;  4DTU A;  3KD5 E;  4DU1 A;  3SVI A;  3HGL A;  1XVG E;  1WAJ A;  3OGK B;  4DTO A;  1MMO G;  3QEX A;  1FZ6 E;  3SQ1 A;  1XU5 E;  3HL8 A;  4KHU A;  5IZ7 A;  4M3U A;  4QNC A;  3QEV A;  4KI6 A;  4DTN A;  4M3X A;  1FZ4 E;  1Q9X A;  3SUP A;  4KHN A;  4RG8 A;  1LDK E;  3NGI A;  2DTU A;  2HD0 A;  3SUO A;  2JHA A;  5H37 A;  2LF3 A;  1XVD E;  3QES A;  3N1E A;  2PFT A;  3KD1 E;  2P5O A;  3J27 A;  4DTS A;  2OYQ A;  4JRQ A;  4FJL A;  1MHZ G;  4FJI A;  1XVF E;  3RWU A;  1FZI E;  3SPZ A;  3L2O B;  4EP9 A;  3RMD A;  2P5G A;  4DTR A;  3LDS A;  3QNO A;  1IG9 A;  4FJG A;  4EYW A;  2DEB A;  2FYO A;  4JS5 A;  4X5M A;  4I9Q A;  2E32 A;  2OZM A;  1Q9Y A;  4M42 A;  4KHY A;  2ATQ A;  4M3R A;  3S9H A;  3L0M A;  1XMG E;  4FJX A;  3E4W A;  1FZ3 E;  3SNN A;  3QET A;  4AKH A;  2H4T A;  2P1M B;  3SCX A;  4FK4 A;  1XU3 E;  3K2O A;  3LDB A;  3NHG A;  1FZH E;  3CFP A;  1FZ0 E;  1FXX A;  1XVE E;  1FZ1 E;  1MTY G;  2MMB A;  2PFV A;  3SPY A;  1FZ8 E;  2B1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...