2MZWB

Staphylococcus aureus fusb:ef-gc3 complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
213
Chain Sequence
MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A target-protection mechanism of antibiotic resistance at atomic resolution: insights into FusB-type fusidic acid resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Translation/antibiotic resistance
molecule keywords Elongation factor G
total genus 59
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
B PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2mzwB01
4ADOA 4E4BA 2MZWB 2YB5A 4ADNA
chains in the Genus database with same CATH superfamily
3OGMB 3SQ4A 4KHQA 2MW2A 3TAEA 3LDSA 4DU4A 1MTYG 1FZ2E 3C6NB 3C95A 3SQ2A 4FJXA 4FJ8A 1XU3E 2JHPA 3LDBA 1FZ9E 2OVRB 4FK0A 3NDKA 2LF3A 3SNNA 4AKIA 4FVMA 4QNDA 3RMBA 3CQ8A 4FJJA 3OGLB 4M3RA 3CFOA 2OZSA 1Q9YA 1FS1A 2JPNA 2B1EA 3QEIA 3UO2A 2P1PB 5H37A 2DTUA 2PFVA 4HCCA 2MZWB 2VJ5A 3HL8A 3N1BA 2E31A 1XVBE 4DTOA 1MHYG 4FJMA 4M3XA 4AKHA 1FZ8E 3NHGA 3RMCA 1IG9A 3KD5E 3TABA 2PFTA 3QERA 4DTNA 3N1EA 1FZ0E 2H4TA 3NE6A 4JS5A 1FZ1E 2E32A 3QEWA 4KI6A 2VJ4A 3S9HA 4I9QA 4DTSA 2RKHA 4DTMA 3RMDA 1WAFA 3E4YA 3L0MA 4M3WA 2JH9A 3RWUA 1WAJA 3UO3A 3UIQA 4I6JB 2JHCA 3SQ0A 3NCIA 4M45A 4DTPA 4DTUA 3QESA 4J2EA 1FZ4E 3HP9A 2P1QB 4KHYA 2HD0A 5IZ7A 3RMAA 3TAGA 4FJ5A 2MMBA 3J27A 4DU1A 2OVPB 2VIXA 3SPZA 3SI6A 4RL5A 1NEXB 4FJIA 3KD1E 4JRQA 4ICGC 1FXXA 4E3SA 3TAFA 3SUNA 4IT5A 4FJNA 1FZ6E 1FZ7E 2K5SA 1FYZE 3LD8A 3L8BA 2QXFA 1P22A 1XMFE 1IH7A 3QNNA 3C94A 1XMGE 4JS4A 3BVOA 4FJLA 3TL8B 4FJHA 4RG8A 1Q9XA 4KI4A 1XVCE 3E4WA 4M41A 4FJGA 3C6OB 4ADNA 4M42A 3SUPA 2ATQA 1CLQA 4M3YA 2P1NB 1N1CA 1FZIE 4J2AA 3NAEA 4KHUA 3CFRA 3V7DB 4M3UA 3L2OB 4JRPA 3QEPA 2B8IA 4EPHA 3L1NA 4DU3A 2OVQB 3LZIA 3C6PB 2OYQA 4J2BA 4AKGA 3SJJA 4M3ZA 2FW3A 1MHZG 3QNOA 4HCBA 3MKSB 2B7MA 3HGLA 2OZMA 3QEVA 2JH8A 1MMOG 1XU5E 4RNGA 5IBKB 4DTJA 4FJKA 2LF6A 1FZ3E 1FZHE 3HGKE 3QETA 2YB5A 2JHAA 1LDKE 3SUOA 4KHNA 4FJ9A 4GAMC 3LZJA 1JW2A 4EP9A 2P5OA 4M3TA 1FZ5E 2P1OB 1XL3C 3SCXA 2DY4A 3CFPA 4KHSA 4DTXA 4J2DA 4FJ7A 4B08A 2P5GA 3OGKB 2FYOA 2P1MB 3SQ1A 1FPOA 4FK4A 4ADOA 3WSOA 4EYWA 2JQTA 3K2OA 4KHWA 3TJYA 4E4BA 4DTRA 2DEBA 3SVIA 1XVFE 3SUQA 4FK2A 1XVGE 3J2PA 3NGIA 3QEXA 3SPYA 1XMHE 1XVDE 1XVEE 4AI6A 2RCUA 4I9LA 5IREA 4QNCA 4X5NA 4X5MA
chains in the Genus database with same CATH topology
3OGMB 3SQ4A 4KHQA 3TAEA 3LDSA 4DU4A 1MTYG 1FZ2E 3C6NB 3C95A 3SQ2A 4FJXA 4FJ8A 1XU3E 2JHPA 3LDBA 1FZ9E 2OVRB 4FK0A 3NDKA 2LF3A 3SNNA 4AKIA 4FVMA 4QNDA 3RMBA 3CQ8A 4FJJA 3OGLB 4M3RA 3CFOA 2OZSA 1Q9YA 1FS1A 2JPNA 2B1EA 3QEIA 2P1PB 5H37A 2DTUA 2PFVA 4HCCA 2MZWB 2VJ5A 3HL8A 3N1BA 2E31A 1XVBE 4DTOA 1MHYG 4FJMA 4M3XA 4AKHA 1FZ8E 3NHGA 3RMCA 1IG9A 3KD5E 3TABA 2PFTA 3QERA 4DTNA 3N1EA 1FZ0E 2H4TA 3NE6A 4JS5A 1FZ1E 2E32A 3QEWA 4KI6A 2VJ4A 3S9HA 4I9QA 4DTSA 4DTMA 3RMDA 1WAFA 3E4YA 3L0MA 4M3WA 2JH9A 3RWUA 1WAJA 3UIQA 4I6JB 2JHCA 3SQ0A 3NCIA 4M45A 4DTPA 4DTUA 3QESA 4J2EA 1FZ4E 3HP9A 2P1QB 4KHYA 2HD0A 5IZ7A 3RMAA 3TAGA 4FJ5A 2MMBA 3J27A 4DU1A 2OVPB 2VIXA 3SPZA 3SI6A 4RL5A 1NEXB 4FJIA 3KD1E 4JRQA 1FXXA 4E3SA 3TAFA 3SUNA 4FJNA 1FZ6E 1FZ7E 1FYZE 3LD8A 3L8BA 2QXFA 1P22A 1XMFE 1IH7A 3QNNA 3C94A 1XMGE 4JS4A 4FJLA 3TL8B 4FJHA 4RG8A 1Q9XA 4KI4A 1XVCE 3E4WA 4M41A 4FJGA 3C6OB 4ADNA 4M42A 3SUPA 2ATQA 1CLQA 4M3YA 2P1NB 1FZIE 4J2AA 3NAEA 4KHUA 3CFRA 3V7DB 4M3UA 3L2OB 4JRPA 3QEPA 2B8IA 4EPHA 3L1NA 4DU3A 2OVQB 3LZIA 3C6PB 2OYQA 4J2BA 4AKGA 3SJJA 4M3ZA 2FW3A 1MHZG 3QNOA 4HCBA 3MKSB 2B7MA 3HGLA 2OZMA 3QEVA 2JH8A 1MMOG 1XU5E 4RNGA 5IBKB 4DTJA 4FJKA 2LF6A 1FZ3E 1FZHE 3HGKE 3QETA 2YB5A 2JHAA 1LDKE 3SUOA 4KHNA 4FJ9A 4GAMC 3LZJA 4EP9A 2P5OA 4M3TA 1FZ5E 2P1OB 1XL3C 3SCXA 2DY4A 3CFPA 4KHSA 4DTXA 4J2DA 4FJ7A 4B08A 2P5GA 3OGKB 2FYOA 2P1MB 3SQ1A 4FK4A 4ADOA 3WSOA 4EYWA 3K2OA 4KHWA 3TJYA 4E4BA 4DTRA 2DEBA 3SVIA 1XVFE 3SUQA 4FK2A 1XVGE 3J2PA 3NGIA 3QEXA 3SPYA 1XMHE 1XVDE 1XVEE 4AI6A 2RCUA 4I9LA 5IREA 4QNCA 4X5NA 4X5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ADO A;  4E4B A;  2MZW B;  2YB5 A;  4ADN A; 
#chains in the Genus database with same CATH topology
 3OGM B;  3SQ4 A;  4KHQ A;  2MW2 A;  3TAE A;  3LDS A;  4DU4 A;  1MTY G;  1FZ2 E;  3C6N B;  3C95 A;  3SQ2 A;  4FJX A;  4FJ8 A;  1XU3 E;  2JHP A;  3LDB A;  1FZ9 E;  2OVR B;  4FK0 A;  3NDK A;  2LF3 A;  3SNN A;  4AKI A;  4FVM A;  4QND A;  3RMB A;  3CQ8 A;  4FJJ A;  3OGL B;  4M3R A;  3CFO A;  2OZS A;  1Q9Y A;  1FS1 A;  2JPN A;  2B1E A;  3QEI A;  3UO2 A;  2P1P B;  5H37 A;  2DTU A;  2PFV A;  4HCC A;  2MZW B;  2VJ5 A;  3HL8 A;  3N1B A;  2E31 A;  1XVB E;  4DTO A;  1MHY G;  4FJM A;  4M3X A;  4AKH A;  1FZ8 E;  3NHG A;  3RMC A;  1IG9 A;  3KD5 E;  3TAB A;  2PFT A;  3QER A;  4DTN A;  3N1E A;  1FZ0 E;  2H4T A;  3NE6 A;  4JS5 A;  1FZ1 E;  2E32 A;  3QEW A;  4KI6 A;  2VJ4 A;  3S9H A;  4I9Q A;  4DTS A;  2RKH A;  4DTM A;  3RMD A;  1WAF A;  3E4Y A;  3L0M A;  4M3W A;  2JH9 A;  3RWU A;  1WAJ A;  3UO3 A;  3UIQ A;  4I6J B;  2JHC A;  3SQ0 A;  3NCI A;  4M45 A;  4DTP A;  4DTU A;  3QES A;  4J2E A;  1FZ4 E;  3HP9 A;  2P1Q B;  4KHY A;  2HD0 A;  5IZ7 A;  3RMA A;  3TAG A;  4FJ5 A;  2MMB A;  3J27 A;  4DU1 A;  2OVP B;  2VIX A;  3SPZ A;  3SI6 A;  4RL5 A;  1NEX B;  4FJI A;  3KD1 E;  4JRQ A;  4ICG C;  1FXX A;  4E3S A;  3TAF A;  3SUN A;  4IT5 A;  4FJN A;  1FZ6 E;  1FZ7 E;  2K5S A;  1FYZ E;  3LD8 A;  3L8B A;  2QXF A;  1P22 A;  1XMF E;  1IH7 A;  3QNN A;  3C94 A;  1XMG E;  4JS4 A;  3BVO A;  4FJL A;  3TL8 B;  4FJH A;  4RG8 A;  1Q9X A;  4KI4 A;  1XVC E;  3E4W A;  4M41 A;  4FJG A;  3C6O B;  4ADN A;  4M42 A;  3SUP A;  2ATQ A;  1CLQ A;  4M3Y A;  2P1N B;  1N1C A;  1FZI E;  4J2A A;  3NAE A;  4KHU A;  3CFR A;  3V7D B;  4M3U A;  3L2O B;  4JRP A;  3QEP A;  2B8I A;  4EPH A;  3L1N A;  4DU3 A;  2OVQ B;  3LZI A;  3C6P B;  2OYQ A;  4J2B A;  4AKG A;  3SJJ A;  4M3Z A;  2FW3 A;  1MHZ G;  3QNO A;  4HCB A;  3MKS B;  2B7M A;  3HGL A;  2OZM A;  3QEV A;  2JH8 A;  1MMO G;  1XU5 E;  4RNG A;  5IBK B;  4DTJ A;  4FJK A;  2LF6 A;  1FZ3 E;  1FZH E;  3HGK E;  3QET A;  2YB5 A;  2JHA A;  1LDK E;  3SUO A;  4KHN A;  4FJ9 A;  4GAM C;  3LZJ A;  1JW2 A;  4EP9 A;  2P5O A;  4M3T A;  1FZ5 E;  2P1O B;  1XL3 C;  3SCX A;  2DY4 A;  3CFP A;  4KHS A;  4DTX A;  4J2D A;  4FJ7 A;  4B08 A;  2P5G A;  3OGK B;  2FYO A;  2P1M B;  3SQ1 A;  1FPO A;  4FK4 A;  4ADO A;  3WSO A;  4EYW A;  2JQT A;  3K2O A;  4KHW A;  3TJY A;  4E4B A;  4DTR A;  2DEB A;  3SVI A;  1XVF E;  3SUQ A;  4FK2 A;  1XVG E;  3J2P A;  3NGI A;  3QEX A;  3SPY A;  1XMH E;  1XVD E;  1XVE E;  4AI6 A;  2RCU A;  4I9L A;  5IRE A;  4QNC A;  4X5N A;  4X5M A; 
#chains in the Genus database with same CATH homology
 3OGM B;  3SQ4 A;  4KHQ A;  3TAE A;  3LDS A;  4DU4 A;  1MTY G;  1FZ2 E;  3C6N B;  3C95 A;  3SQ2 A;  4FJX A;  4FJ8 A;  1XU3 E;  2JHP A;  3LDB A;  1FZ9 E;  2OVR B;  4FK0 A;  3NDK A;  2LF3 A;  3SNN A;  4AKI A;  4FVM A;  4QND A;  3RMB A;  3CQ8 A;  4FJJ A;  3OGL B;  4M3R A;  3CFO A;  2OZS A;  1Q9Y A;  1FS1 A;  2JPN A;  2B1E A;  3QEI A;  2P1P B;  5H37 A;  2DTU A;  2PFV A;  4HCC A;  2MZW B;  2VJ5 A;  3HL8 A;  3N1B A;  2E31 A;  1XVB E;  4DTO A;  1MHY G;  4FJM A;  4M3X A;  4AKH A;  1FZ8 E;  3NHG A;  3RMC A;  1IG9 A;  3KD5 E;  3TAB A;  2PFT A;  3QER A;  4DTN A;  3N1E A;  1FZ0 E;  2H4T A;  3NE6 A;  4JS5 A;  1FZ1 E;  2E32 A;  3QEW A;  4KI6 A;  2VJ4 A;  3S9H A;  4I9Q A;  4DTS A;  4DTM A;  3RMD A;  1WAF A;  3E4Y A;  3L0M A;  4M3W A;  2JH9 A;  3RWU A;  1WAJ A;  3UIQ A;  4I6J B;  2JHC A;  3SQ0 A;  3NCI A;  4M45 A;  4DTP A;  4DTU A;  3QES A;  4J2E A;  1FZ4 E;  3HP9 A;  2P1Q B;  4KHY A;  2HD0 A;  5IZ7 A;  3RMA A;  3TAG A;  4FJ5 A;  2MMB A;  3J27 A;  4DU1 A;  2OVP B;  2VIX A;  3SPZ A;  3SI6 A;  4RL5 A;  1NEX B;  4FJI A;  3KD1 E;  4JRQ A;  1FXX A;  4E3S A;  3TAF A;  3SUN A;  4FJN A;  1FZ6 E;  1FZ7 E;  1FYZ E;  3LD8 A;  3L8B A;  2QXF A;  1P22 A;  1XMF E;  1IH7 A;  3QNN A;  3C94 A;  1XMG E;  4JS4 A;  4FJL A;  3TL8 B;  4FJH A;  4RG8 A;  1Q9X A;  4KI4 A;  1XVC E;  3E4W A;  4M41 A;  4FJG A;  3C6O B;  4ADN A;  4M42 A;  3SUP A;  2ATQ A;  1CLQ A;  4M3Y A;  2P1N B;  1FZI E;  4J2A A;  3NAE A;  4KHU A;  3CFR A;  3V7D B;  4M3U A;  3L2O B;  4JRP A;  3QEP A;  2B8I A;  4EPH A;  3L1N A;  4DU3 A;  2OVQ B;  3LZI A;  3C6P B;  2OYQ A;  4J2B A;  4AKG A;  3SJJ A;  4M3Z A;  2FW3 A;  1MHZ G;  3QNO A;  4HCB A;  3MKS B;  2B7M A;  3HGL A;  2OZM A;  3QEV A;  2JH8 A;  1MMO G;  1XU5 E;  4RNG A;  5IBK B;  4DTJ A;  4FJK A;  2LF6 A;  1FZ3 E;  1FZH E;  3HGK E;  3QET A;  2YB5 A;  2JHA A;  1LDK E;  3SUO A;  4KHN A;  4FJ9 A;  4GAM C;  3LZJ A;  4EP9 A;  2P5O A;  4M3T A;  1FZ5 E;  2P1O B;  1XL3 C;  3SCX A;  2DY4 A;  3CFP A;  4KHS A;  4DTX A;  4J2D A;  4FJ7 A;  4B08 A;  2P5G A;  3OGK B;  2FYO A;  2P1M B;  3SQ1 A;  4FK4 A;  4ADO A;  3WSO A;  4EYW A;  3K2O A;  4KHW A;  3TJY A;  4E4B A;  4DTR A;  2DEB A;  3SVI A;  1XVF E;  3SUQ A;  4FK2 A;  1XVG E;  3J2P A;  3NGI A;  3QEX A;  3SPY A;  1XMH E;  1XVD E;  1XVE E;  4AI6 A;  2RCU A;  4I9L A;  5IRE A;  4QNC A;  4X5N A;  4X5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...