2MZWB

Staphylococcus aureus fusb:ef-gc3 complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
213
Chain Sequence
MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor G
publication title A target-protection mechanism of antibiotic resistance at atomic resolution: insights into FusB-type fusidic acid resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Translation/antibiotic resistance
total genus 59
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
B PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2mzwB01
4E4BA 4ADOA 2MZWB 2YB5A 4ADNA
chains in the Genus database with same CATH superfamily
2JPNA 4FJMA 3E4YA 3E4WA 3LDSA 4DTJA 5IZ7A 1IH7A 1Q9YA 4J2AA 1JW2A 2OVPB 1MTYG 1XU5E 2OVQB 4DTMA 1FYZE 4FJLA 4AKHA 1FZ1E 3HP9A 2JH8A 2P1NB 2FW3A 4DU1A 1XVBE 4RNGA 4M3RA 4ADOA 2PFTA 4EPHA 4DTOA 3KD1E 2P1MB 3QERA 3HL8A 2LF6A 3QEIA 4M3TA 2B8IA 1FZ3E 1FZ0E 3J2PA 3SQ0A 1XU3E 4M45A 3RMCA 4JS5A 3SQ4A 2K5SA 2P1PB 4FJNA 3LD8A 3UO3A 4AI6A 4ICGC 3NGIA 2OZSA 4FK0A 2OZMA 1XVFE 3BVOA 4J2DA 4IT5A 2RKHA 4DU4A 3SPZA 4JRQA 2P5GA 3N1EA 4J2BA 1XVCE 2P1OB 3CFRA 4FJ7A 1CLQA 1XVEE 5H37A 1IG9A 4FJHA 3OGMB 3QEPA 3J27A 1XMHE 3QETA 3TAFA 3SUQA 2DY4A 2E32A 3CFOA 3C6NB 2OYQA 3SUOA 3L8BA 3HGKE 2RCUA 4GAMC 4X5MA 4DTRA 3OGLB 4M3XA 3SJJA 2VJ4A 3L0MA 2YB5A 3MKSB 3QNOA 4FJXA 4FJ9A 4I6JB 4DU3A 3SI6A 2DTUA 3TL8B 4KHYA 3WSOA 3SNNA 1XVDE 2B1EA 4KHUA 4AKGA 4M42A 2JH9A 2VIXA 2H4TA 3OGKB 3HGLA 3SCXA 2DEBA 1FS1A 1LDKE 4M3YA 3NDKA 4RL5A 1FZ7E 4KHWA 3NCIA 4FJJA 3LZJA 4DTXA 4FK2A 4B08A 3C95A 2JHCA 3QEWA 4HCCA 3QESA 4FJGA 4J2EA 4KHQA 3TABA 1FZIE 3SUPA 1MHYG 2MZWB 2MW2A 4E3SA 4KI6A 3CFPA 1FZ8E 4RG8A 4KHNA 1FZHE 2B7MA 1NEXB 3SUNA 2JQTA 1FZ6E 4DTPA 3S9HA 1WAJA 2JHPA 1WAFA 3LZIA 4DTUA 4HCBA 3TAEA 2QXFA 1P22A 4I9QA 5IBKB 3KD5E 1XVGE 1FZ4E 4FJ5A 4M41A 3UIQA 3UO2A 3C6PB 1FPOA 4FK4A 1XMFE 2HD0A 4I9LA 3NAEA 1FZ9E 1FXXA 3TAGA 2PFVA 3C6OB 3K2OA 2P1QB 3L2OB 2OVRB 3RMBA 1Q9XA 5IREA 4DTSA 4FJKA 2VJ5A 3QEXA 1N1CA 3NE6A 3L1NA 4AKIA 1FZ2E 3SVIA 3CQ8A 4KHSA 3TJYA 4E4BA 4QNCA 2P5OA 2FYOA 1FZ5E 4QNDA 4M3UA 1XL3C 1MHZG 3SQ2A 4FVMA 4FJIA 3LDBA 1XMGE 2E31A 4EYWA 4X5NA 4JS4A 2LF3A 3NHGA 4ADNA 4JRPA 3QNNA 4FJ8A 4KI4A 1MMOG 3SQ1A 3V7DB 3QEVA 4DTNA 2JHAA 4M3ZA 3RMDA 4EP9A 3N1BA 3SPYA 3RWUA 3C94A 2MMBA 3RMAA 4M3WA 2ATQA
chains in the Genus database with same CATH topology
2JPNA 4FJMA 3E4YA 3E4WA 3LDSA 4DTJA 5IZ7A 1IH7A 1Q9YA 4J2AA 2OVPB 1MTYG 1XU5E 2OVQB 4DTMA 1FYZE 4FJLA 4AKHA 1FZ1E 3HP9A 2JH8A 2P1NB 2FW3A 4DU1A 1XVBE 4RNGA 4M3RA 4ADOA 2PFTA 4EPHA 4DTOA 3KD1E 2P1MB 3QERA 3HL8A 2LF6A 3QEIA 4M3TA 2B8IA 1FZ3E 1FZ0E 3J2PA 3SQ0A 1XU3E 4M45A 3RMCA 4JS5A 3SQ4A 2P1PB 4FJNA 3LD8A 4AI6A 3NGIA 2OZSA 4FK0A 2OZMA 1XVFE 4J2DA 4DU4A 3SPZA 4JRQA 2P5GA 3N1EA 4J2BA 1XVCE 2P1OB 3CFRA 4FJ7A 1CLQA 1XVEE 5H37A 1IG9A 4FJHA 3OGMB 3QEPA 3J27A 1XMHE 3QETA 3TAFA 3SUQA 2DY4A 2E32A 3CFOA 3C6NB 2OYQA 3SUOA 3L8BA 3HGKE 2RCUA 4GAMC 4X5MA 4DTRA 3OGLB 4M3XA 3SJJA 2VJ4A 3L0MA 2YB5A 3MKSB 3QNOA 4FJXA 4FJ9A 4I6JB 4DU3A 3SI6A 2DTUA 3TL8B 4KHYA 3WSOA 3SNNA 1XVDE 2B1EA 4KHUA 4AKGA 4M42A 2JH9A 2VIXA 2H4TA 3OGKB 3HGLA 3SCXA 2DEBA 1FS1A 1LDKE 4M3YA 3NDKA 4RL5A 1FZ7E 4KHWA 3NCIA 4FJJA 3LZJA 4DTXA 4FK2A 4B08A 3C95A 2JHCA 3QEWA 4HCCA 3QESA 4FJGA 4J2EA 4KHQA 3TABA 1FZIE 3SUPA 1MHYG 2MZWB 4E3SA 4KI6A 3CFPA 1FZ8E 4RG8A 4KHNA 1FZHE 2B7MA 1NEXB 3SUNA 4DTPA 1FZ6E 3S9HA 1WAJA 2JHPA 1WAFA 3LZIA 4DTUA 4HCBA 3TAEA 2QXFA 1P22A 4I9QA 5IBKB 3KD5E 1XVGE 1FZ4E 4FJ5A 4M41A 3UIQA 3C6PB 4FK4A 1XMFE 2HD0A 4I9LA 3NAEA 1FZ9E 1FXXA 3TAGA 2PFVA 3C6OB 3K2OA 2P1QB 3L2OB 2OVRB 3RMBA 1Q9XA 5IREA 4DTSA 4FJKA 2VJ5A 3QEXA 3NE6A 4AKIA 3L1NA 1FZ2E 3SVIA 3CQ8A 4KHSA 3TJYA 4E4BA 4QNCA 2P5OA 2FYOA 1FZ5E 4QNDA 4M3UA 1XL3C 1MHZG 3SQ2A 4FVMA 4FJIA 3LDBA 1XMGE 2E31A 4EYWA 4X5NA 4JS4A 2LF3A 3NHGA 4ADNA 4JRPA 3QNNA 4FJ8A 4KI4A 1MMOG 3SQ1A 3V7DB 3QEVA 4DTNA 2JHAA 4M3ZA 3RMDA 4EP9A 3N1BA 3SPYA 3RWUA 3C94A 2MMBA 3RMAA 4M3WA 2ATQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E4B A;  4ADO A;  2MZW B;  2YB5 A;  4ADN A; 
#chains in the Genus database with same CATH topology
 2JPN A;  4FJM A;  3E4Y A;  3E4W A;  3LDS A;  4DTJ A;  5IZ7 A;  1IH7 A;  1Q9Y A;  4J2A A;  1JW2 A;  2OVP B;  1MTY G;  1XU5 E;  2OVQ B;  4DTM A;  1FYZ E;  4FJL A;  4AKH A;  1FZ1 E;  3HP9 A;  2JH8 A;  2P1N B;  2FW3 A;  4DU1 A;  1XVB E;  4RNG A;  4M3R A;  4ADO A;  2PFT A;  4EPH A;  4DTO A;  3KD1 E;  2P1M B;  3QER A;  3HL8 A;  2LF6 A;  3QEI A;  4M3T A;  2B8I A;  1FZ3 E;  1FZ0 E;  3J2P A;  3SQ0 A;  1XU3 E;  4M45 A;  3RMC A;  4JS5 A;  3SQ4 A;  2K5S A;  2P1P B;  4FJN A;  3LD8 A;  3UO3 A;  4AI6 A;  4ICG C;  3NGI A;  2OZS A;  4FK0 A;  2OZM A;  1XVF E;  3BVO A;  4J2D A;  4IT5 A;  2RKH A;  4DU4 A;  3SPZ A;  4JRQ A;  2P5G A;  3N1E A;  4J2B A;  1XVC E;  2P1O B;  3CFR A;  4FJ7 A;  1CLQ A;  1XVE E;  5H37 A;  1IG9 A;  4FJH A;  3OGM B;  3QEP A;  3J27 A;  1XMH E;  3QET A;  3TAF A;  3SUQ A;  2DY4 A;  2E32 A;  3CFO A;  3C6N B;  2OYQ A;  3SUO A;  3L8B A;  3HGK E;  2RCU A;  4GAM C;  4X5M A;  4DTR A;  3OGL B;  4M3X A;  3SJJ A;  2VJ4 A;  3L0M A;  2YB5 A;  3MKS B;  3QNO A;  4FJX A;  4FJ9 A;  4I6J B;  4DU3 A;  3SI6 A;  2DTU A;  3TL8 B;  4KHY A;  3WSO A;  3SNN A;  1XVD E;  2B1E A;  4KHU A;  4AKG A;  4M42 A;  2JH9 A;  2VIX A;  2H4T A;  3OGK B;  3HGL A;  3SCX A;  2DEB A;  1FS1 A;  1LDK E;  4M3Y A;  3NDK A;  4RL5 A;  1FZ7 E;  4KHW A;  3NCI A;  4FJJ A;  3LZJ A;  4DTX A;  4FK2 A;  4B08 A;  3C95 A;  2JHC A;  3QEW A;  4HCC A;  3QES A;  4FJG A;  4J2E A;  4KHQ A;  3TAB A;  1FZI E;  3SUP A;  1MHY G;  2MZW B;  2MW2 A;  4E3S A;  4KI6 A;  3CFP A;  1FZ8 E;  4RG8 A;  4KHN A;  1FZH E;  2B7M A;  1NEX B;  3SUN A;  2JQT A;  1FZ6 E;  4DTP A;  3S9H A;  1WAJ A;  2JHP A;  1WAF A;  3LZI A;  4DTU A;  4HCB A;  3TAE A;  2QXF A;  1P22 A;  4I9Q A;  5IBK B;  3KD5 E;  1XVG E;  1FZ4 E;  4FJ5 A;  4M41 A;  3UIQ A;  3UO2 A;  3C6P B;  1FPO A;  4FK4 A;  1XMF E;  2HD0 A;  4I9L A;  3NAE A;  1FZ9 E;  1FXX A;  3TAG A;  2PFV A;  3C6O B;  3K2O A;  2P1Q B;  3L2O B;  2OVR B;  3RMB A;  1Q9X A;  5IRE A;  4DTS A;  4FJK A;  2VJ5 A;  3QEX A;  1N1C A;  3NE6 A;  3L1N A;  4AKI A;  1FZ2 E;  3SVI A;  3CQ8 A;  4KHS A;  3TJY A;  4E4B A;  4QNC A;  2P5O A;  2FYO A;  1FZ5 E;  4QND A;  4M3U A;  1XL3 C;  1MHZ G;  3SQ2 A;  4FVM A;  4FJI A;  3LDB A;  1XMG E;  2E31 A;  4EYW A;  4X5N A;  4JS4 A;  2LF3 A;  3NHG A;  4ADN A;  4JRP A;  3QNN A;  4FJ8 A;  4KI4 A;  1MMO G;  3SQ1 A;  3V7D B;  3QEV A;  4DTN A;  2JHA A;  4M3Z A;  3RMD A;  4EP9 A;  3N1B A;  3SPY A;  3RWU A;  3C94 A;  2MMB A;  3RMA A;  4M3W A;  2ATQ A; 
#chains in the Genus database with same CATH homology
 2JPN A;  4FJM A;  3E4Y A;  3E4W A;  3LDS A;  4DTJ A;  5IZ7 A;  1IH7 A;  1Q9Y A;  4J2A A;  2OVP B;  1MTY G;  1XU5 E;  2OVQ B;  4DTM A;  1FYZ E;  4FJL A;  4AKH A;  1FZ1 E;  3HP9 A;  2JH8 A;  2P1N B;  2FW3 A;  4DU1 A;  1XVB E;  4RNG A;  4M3R A;  4ADO A;  2PFT A;  4EPH A;  4DTO A;  3KD1 E;  2P1M B;  3QER A;  3HL8 A;  2LF6 A;  3QEI A;  4M3T A;  2B8I A;  1FZ3 E;  1FZ0 E;  3J2P A;  3SQ0 A;  1XU3 E;  4M45 A;  3RMC A;  4JS5 A;  3SQ4 A;  2P1P B;  4FJN A;  3LD8 A;  4AI6 A;  3NGI A;  2OZS A;  4FK0 A;  2OZM A;  1XVF E;  4J2D A;  4DU4 A;  3SPZ A;  4JRQ A;  2P5G A;  3N1E A;  4J2B A;  1XVC E;  2P1O B;  3CFR A;  4FJ7 A;  1CLQ A;  1XVE E;  5H37 A;  1IG9 A;  4FJH A;  3OGM B;  3QEP A;  3J27 A;  1XMH E;  3QET A;  3TAF A;  3SUQ A;  2DY4 A;  2E32 A;  3CFO A;  3C6N B;  2OYQ A;  3SUO A;  3L8B A;  3HGK E;  2RCU A;  4GAM C;  4X5M A;  4DTR A;  3OGL B;  4M3X A;  3SJJ A;  2VJ4 A;  3L0M A;  2YB5 A;  3MKS B;  3QNO A;  4FJX A;  4FJ9 A;  4I6J B;  4DU3 A;  3SI6 A;  2DTU A;  3TL8 B;  4KHY A;  3WSO A;  3SNN A;  1XVD E;  2B1E A;  4KHU A;  4AKG A;  4M42 A;  2JH9 A;  2VIX A;  2H4T A;  3OGK B;  3HGL A;  3SCX A;  2DEB A;  1FS1 A;  1LDK E;  4M3Y A;  3NDK A;  4RL5 A;  1FZ7 E;  4KHW A;  3NCI A;  4FJJ A;  3LZJ A;  4DTX A;  4FK2 A;  4B08 A;  3C95 A;  2JHC A;  3QEW A;  4HCC A;  3QES A;  4FJG A;  4J2E A;  4KHQ A;  3TAB A;  1FZI E;  3SUP A;  1MHY G;  2MZW B;  4E3S A;  4KI6 A;  3CFP A;  1FZ8 E;  4RG8 A;  4KHN A;  1FZH E;  2B7M A;  1NEX B;  3SUN A;  4DTP A;  1FZ6 E;  3S9H A;  1WAJ A;  2JHP A;  1WAF A;  3LZI A;  4DTU A;  4HCB A;  3TAE A;  2QXF A;  1P22 A;  4I9Q A;  5IBK B;  3KD5 E;  1XVG E;  1FZ4 E;  4FJ5 A;  4M41 A;  3UIQ A;  3C6P B;  4FK4 A;  1XMF E;  2HD0 A;  4I9L A;  3NAE A;  1FZ9 E;  1FXX A;  3TAG A;  2PFV A;  3C6O B;  3K2O A;  2P1Q B;  3L2O B;  2OVR B;  3RMB A;  1Q9X A;  5IRE A;  4DTS A;  4FJK A;  2VJ5 A;  3QEX A;  3NE6 A;  4AKI A;  3L1N A;  1FZ2 E;  3SVI A;  3CQ8 A;  4KHS A;  3TJY A;  4E4B A;  4QNC A;  2P5O A;  2FYO A;  1FZ5 E;  4QND A;  4M3U A;  1XL3 C;  1MHZ G;  3SQ2 A;  4FVM A;  4FJI A;  3LDB A;  1XMG E;  2E31 A;  4EYW A;  4X5N A;  4JS4 A;  2LF3 A;  3NHG A;  4ADN A;  4JRP A;  3QNN A;  4FJ8 A;  4KI4 A;  1MMO G;  3SQ1 A;  3V7D B;  3QEV A;  4DTN A;  2JHA A;  4M3Z A;  3RMD A;  4EP9 A;  3N1B A;  3SPY A;  3RWU A;  3C94 A;  2MMB A;  3RMA A;  4M3W A;  2ATQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...