2MZWB

Staphylococcus aureus fusb:ef-gc3 complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
213
Chain Sequence
MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/antibiotic resistance
molecule keywords Elongation factor G
publication title A target-protection mechanism of antibiotic resistance at atomic resolution: insights into FusB-type fusidic acid resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 59
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
B PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2mzwB01
2YB5A 4ADNA 4E4BA 4ADOA 2MZWB
chains in the Genus database with same CATH superfamily
2OVRB 4KHSA 4DTJA 1XL3C 3QNNA 3E4YA 1XVCE 3NGIA 3QNOA 4M41A 4FJGA 4KHWA 4M45A 4FVMA 4JS4A 3K2OA 2P5GA 1XMFE 4DU1A 3TAFA 3NAEA 1FS1A 1XVEE 1LDKE 3TL8B 2PFVA 4X5MA 4FK0A 4M3YA 3L8BA 4JRQA 2JPNA 3WSOA 1FYZE 3SUQA 1MMOG 3SUNA 3SNNA 1XVBE 3TABA 4I9QA 4FJ7A 4M3XA 3E4WA 1XU5E 4AKHA 4M3UA 1FZ0E 1P22A 3KD5E 3NE6A 4FJLA 3SI6A 3SPZA 4FJKA 1FZ5E 3OGMB 4KHUA 3RWUA 1N1CA 3MKSB 3HP9A 4M3RA 3SQ1A 1FZ9E 4E4BA 2RCUA 3L2OB 4DTRA 2P5OA 4FJNA 2RKHA 3TJYA 3J27A 1JW2A 3C6NB 3HGKE 3HL8A 2FW3A 2YB5A 4KHNA 4DTNA 3SQ0A 4RG8A 3QEPA 1FPOA 2B1EA 3OGLB 1NEXB 2LF3A 3CFRA 1XVGE 5IREA 2K5SA 2JH8A 4I6JB 3QERA 4FK4A 3C6PB 3CQ8A 3NCIA 2H4TA 3C94A 4FJHA 4FJXA 3NHGA 2VJ4A 1FZ6E 1FZIE 1FZ3E 2B7MA 3KD1E 4FJMA 4KI6A 3V7DB 4KI4A 3SUOA 2B8IA 1MHZG 1IG9A 3TAGA 4FK2A 2MMBA 2ATQA 2FYOA 2DEBA 3C6OB 4DU4A 4QNDA 3HGLA 2JH9A 2P1PB 3RMBA 1FXXA 4JS5A 3SJJA 2LF6A 1XVDE 1XMGE 1MHYG 1XMHE 2P1NB 3BVOA 4DTPA 5IBKB 3QEIA 4DTSA 4M3WA 2OVQB 1XVFE 4KHQA 2OVPB 4QNCA 3CFOA 1FZ4E 4M42A 3LDBA 4J2BA 3SVIA 1FZ1E 3SQ2A 4I9LA 2OZMA 3LZIA 2OYQA 2DTUA 4FJ8A 2JHAA 4DTOA 3SQ4A 3C95A 1IH7A 4E3SA 4ADNA 2JHPA 4M3TA 3CFPA 3RMDA 3QESA 2E32A 4AKIA 2PFTA 4M3ZA 2MW2A 3QEVA 2HD0A 2VJ5A 4DTXA 4AI6A 4AKGA 1Q9XA 5H37A 1FZ7E 2OZSA 3L0MA 4ICGC 3J2PA 3S9HA 1FZ2E 4J2EA 2QXFA 3LD8A 3QEXA 3UO3A 4FJIA 3LDSA 3NDKA 4X5NA 1XU3E 1WAJA 2JHCA 3L1NA 2JQTA 3OGKB 4HCCA 1MTYG 1WAFA 2E31A 4EP9A 4DTUA 2DY4A 3RMAA 4IT5A 2P1OB 3QETA 1FZHE 2MZWB 2P1MB 4RL5A 4EPHA 3SUPA 3SCXA 4B08A 4FJJA 4J2AA 1CLQA 4KHYA 1Q9YA 4FJ5A 4DTMA 3UIQA 4HCBA 4FJ9A 3QEWA 4EYWA 3N1EA 1FZ8E 3RMCA 3LZJA 2P1QB 4JRPA 3TAEA 4RNGA 5IZ7A 3SPYA 4GAMC 2VIXA 4ADOA 4J2DA 4DU3A 3UO2A 3N1BA
chains in the Genus database with same CATH topology
2OVRB 4KHSA 4DTJA 1XL3C 3QNNA 3E4YA 1XVCE 3NGIA 3QNOA 4M41A 4FJGA 4KHWA 4M45A 4FVMA 4JS4A 3K2OA 2P5GA 1XMFE 4DU1A 3TAFA 3NAEA 1FS1A 1XVEE 1LDKE 3TL8B 2PFVA 4X5MA 4FK0A 3L8BA 4JRQA 2JPNA 3WSOA 1FYZE 3SUQA 1MMOG 3SUNA 3SNNA 1XVBE 3TABA 4I9QA 4FJ7A 4M3XA 3E4WA 1XU5E 4AKHA 4M3UA 1FZ0E 1P22A 3KD5E 3NE6A 4FJLA 3SI6A 3SPZA 4FJKA 1FZ5E 3OGMB 4KHUA 3RWUA 3MKSB 3HP9A 4M3RA 3SQ1A 1FZ9E 4E4BA 2RCUA 3L2OB 4DTRA 2P5OA 4FJNA 3TJYA 3J27A 3C6NB 3HGKE 3HL8A 2FW3A 2YB5A 4KHNA 4DTNA 3SQ0A 4RG8A 3QEPA 3CFRA 2B1EA 3OGLB 1NEXB 2LF3A 4DU4A 1XVGE 5IREA 3QERA 2JH8A 4I6JB 4FK4A 3C6PB 3CQ8A 3NCIA 2H4TA 3C94A 4FJHA 4FJXA 3NHGA 2VJ4A 1FZ6E 1FZIE 1FZ3E 2B7MA 3KD1E 4FJMA 4KI6A 3V7DB 4KI4A 3SUOA 2B8IA 1MHZG 1IG9A 3TAGA 4FK2A 2MMBA 2ATQA 2FYOA 2DEBA 3C6OB 4QNDA 3HGLA 2JH9A 2P1PB 3RMBA 1FXXA 4JS5A 3SJJA 2LF6A 1XVDE 1XMGE 1MHYG 1XMHE 2P1NB 3QEIA 4DTPA 5IBKB 4M3WA 4DTSA 4M3YA 2OVQB 1XVFE 4KHQA 2OVPB 4QNCA 3CFOA 1FZ4E 4M42A 3LDBA 4J2BA 3SVIA 1FZ1E 3SQ2A 4I9LA 2OZMA 3LZIA 2OYQA 2DTUA 4FJ8A 2JHAA 4DTOA 3SQ4A 3C95A 1IH7A 4E3SA 4ADNA 2JHPA 4M3TA 3CFPA 3RMDA 3QESA 2E32A 4AKIA 2PFTA 4M3ZA 3QEVA 2HD0A 2VJ5A 4DTXA 4AI6A 4AKGA 1Q9XA 5H37A 1FZ7E 2OZSA 3L0MA 3J2PA 3S9HA 1FZ2E 4J2EA 2QXFA 3LD8A 3QEXA 4FJIA 3LDSA 3NDKA 4X5NA 1XU3E 1WAJA 2JHCA 3L1NA 3OGKB 4HCCA 1MTYG 1WAFA 2E31A 4EP9A 4DTUA 2DY4A 3RMAA 2P1OB 3QETA 1FZHE 2MZWB 2P1MB 4RL5A 4EPHA 3SUPA 3SCXA 4B08A 4FJJA 4J2AA 1CLQA 4KHYA 1Q9YA 4FJ5A 4DTMA 3UIQA 4HCBA 4FJ9A 3QEWA 4EYWA 3N1EA 1FZ8E 3RMCA 3LZJA 2P1QB 4JRPA 3TAEA 4RNGA 5IZ7A 3SPYA 4GAMC 2VIXA 4ADOA 4J2DA 4DU3A 3N1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YB5 A;  4ADN A;  4E4B A;  4ADO A;  2MZW B; 
#chains in the Genus database with same CATH topology
 2OVR B;  4KHS A;  4DTJ A;  1XL3 C;  3QNN A;  3E4Y A;  1XVC E;  3NGI A;  3QNO A;  4M41 A;  4FJG A;  4KHW A;  4M45 A;  4FVM A;  4JS4 A;  3K2O A;  2P5G A;  1XMF E;  4DU1 A;  3TAF A;  3NAE A;  1FS1 A;  1XVE E;  1LDK E;  3TL8 B;  2PFV A;  4X5M A;  4FK0 A;  4M3Y A;  3L8B A;  4JRQ A;  2JPN A;  3WSO A;  1FYZ E;  3SUQ A;  1MMO G;  3SUN A;  3SNN A;  1XVB E;  3TAB A;  4I9Q A;  4FJ7 A;  4M3X A;  3E4W A;  1XU5 E;  4AKH A;  4M3U A;  1FZ0 E;  1P22 A;  3KD5 E;  3NE6 A;  4FJL A;  3SI6 A;  3SPZ A;  4FJK A;  1FZ5 E;  3OGM B;  4KHU A;  3RWU A;  1N1C A;  3MKS B;  3HP9 A;  4M3R A;  3SQ1 A;  1FZ9 E;  4E4B A;  2RCU A;  3L2O B;  4DTR A;  2P5O A;  4FJN A;  2RKH A;  3TJY A;  3J27 A;  1JW2 A;  3C6N B;  3HGK E;  3HL8 A;  2FW3 A;  2YB5 A;  4KHN A;  4DTN A;  3SQ0 A;  4RG8 A;  3QEP A;  1FPO A;  2B1E A;  3OGL B;  1NEX B;  2LF3 A;  3CFR A;  1XVG E;  5IRE A;  2K5S A;  2JH8 A;  4I6J B;  3QER A;  4FK4 A;  3C6P B;  3CQ8 A;  3NCI A;  2H4T A;  3C94 A;  4FJH A;  4FJX A;  3NHG A;  2VJ4 A;  1FZ6 E;  1FZI E;  1FZ3 E;  2B7M A;  3KD1 E;  4FJM A;  4KI6 A;  3V7D B;  4KI4 A;  3SUO A;  2B8I A;  1MHZ G;  1IG9 A;  3TAG A;  4FK2 A;  2MMB A;  2ATQ A;  2FYO A;  2DEB A;  3C6O B;  4DU4 A;  4QND A;  3HGL A;  2JH9 A;  2P1P B;  3RMB A;  1FXX A;  4JS5 A;  3SJJ A;  2LF6 A;  1XVD E;  1XMG E;  1MHY G;  1XMH E;  2P1N B;  3BVO A;  4DTP A;  5IBK B;  3QEI A;  4DTS A;  4M3W A;  2OVQ B;  1XVF E;  4KHQ A;  2OVP B;  4QNC A;  3CFO A;  1FZ4 E;  4M42 A;  3LDB A;  4J2B A;  3SVI A;  1FZ1 E;  3SQ2 A;  4I9L A;  2OZM A;  3LZI A;  2OYQ A;  2DTU A;  4FJ8 A;  2JHA A;  4DTO A;  3SQ4 A;  3C95 A;  1IH7 A;  4E3S A;  4ADN A;  2JHP A;  4M3T A;  3CFP A;  3RMD A;  3QES A;  2E32 A;  4AKI A;  2PFT A;  4M3Z A;  2MW2 A;  3QEV A;  2HD0 A;  2VJ5 A;  4DTX A;  4AI6 A;  4AKG A;  1Q9X A;  5H37 A;  1FZ7 E;  2OZS A;  3L0M A;  4ICG C;  3J2P A;  3S9H A;  1FZ2 E;  4J2E A;  2QXF A;  3LD8 A;  3QEX A;  3UO3 A;  4FJI A;  3LDS A;  3NDK A;  4X5N A;  1XU3 E;  1WAJ A;  2JHC A;  3L1N A;  2JQT A;  3OGK B;  4HCC A;  1MTY G;  1WAF A;  2E31 A;  4EP9 A;  4DTU A;  2DY4 A;  3RMA A;  4IT5 A;  2P1O B;  3QET A;  1FZH E;  2MZW B;  2P1M B;  4RL5 A;  4EPH A;  3SUP A;  3SCX A;  4B08 A;  4FJJ A;  4J2A A;  1CLQ A;  4KHY A;  1Q9Y A;  4FJ5 A;  4DTM A;  3UIQ A;  4HCB A;  4FJ9 A;  3QEW A;  4EYW A;  3N1E A;  1FZ8 E;  3RMC A;  3LZJ A;  2P1Q B;  4JRP A;  3TAE A;  4RNG A;  5IZ7 A;  3SPY A;  4GAM C;  2VIX A;  4ADO A;  4J2D A;  4DU3 A;  3UO2 A;  3N1B A; 
#chains in the Genus database with same CATH homology
 2OVR B;  4KHS A;  4DTJ A;  1XL3 C;  3QNN A;  3E4Y A;  1XVC E;  3NGI A;  3QNO A;  4M41 A;  4FJG A;  4KHW A;  4M45 A;  4FVM A;  4JS4 A;  3K2O A;  2P5G A;  1XMF E;  4DU1 A;  3TAF A;  3NAE A;  1FS1 A;  1XVE E;  1LDK E;  3TL8 B;  2PFV A;  4X5M A;  4FK0 A;  3L8B A;  4JRQ A;  2JPN A;  3WSO A;  1FYZ E;  3SUQ A;  1MMO G;  3SUN A;  3SNN A;  1XVB E;  3TAB A;  4I9Q A;  4FJ7 A;  4M3X A;  3E4W A;  1XU5 E;  4AKH A;  4M3U A;  1FZ0 E;  1P22 A;  3KD5 E;  3NE6 A;  4FJL A;  3SI6 A;  3SPZ A;  4FJK A;  1FZ5 E;  3OGM B;  4KHU A;  3RWU A;  3MKS B;  3HP9 A;  4M3R A;  3SQ1 A;  1FZ9 E;  4E4B A;  2RCU A;  3L2O B;  4DTR A;  2P5O A;  4FJN A;  3TJY A;  3J27 A;  3C6N B;  3HGK E;  3HL8 A;  2FW3 A;  2YB5 A;  4KHN A;  4DTN A;  3SQ0 A;  4RG8 A;  3QEP A;  3CFR A;  2B1E A;  3OGL B;  1NEX B;  2LF3 A;  4DU4 A;  1XVG E;  5IRE A;  3QER A;  2JH8 A;  4I6J B;  4FK4 A;  3C6P B;  3CQ8 A;  3NCI A;  2H4T A;  3C94 A;  4FJH A;  4FJX A;  3NHG A;  2VJ4 A;  1FZ6 E;  1FZI E;  1FZ3 E;  2B7M A;  3KD1 E;  4FJM A;  4KI6 A;  3V7D B;  4KI4 A;  3SUO A;  2B8I A;  1MHZ G;  1IG9 A;  3TAG A;  4FK2 A;  2MMB A;  2ATQ A;  2FYO A;  2DEB A;  3C6O B;  4QND A;  3HGL A;  2JH9 A;  2P1P B;  3RMB A;  1FXX A;  4JS5 A;  3SJJ A;  2LF6 A;  1XVD E;  1XMG E;  1MHY G;  1XMH E;  2P1N B;  3QEI A;  4DTP A;  5IBK B;  4M3W A;  4DTS A;  4M3Y A;  2OVQ B;  1XVF E;  4KHQ A;  2OVP B;  4QNC A;  3CFO A;  1FZ4 E;  4M42 A;  3LDB A;  4J2B A;  3SVI A;  1FZ1 E;  3SQ2 A;  4I9L A;  2OZM A;  3LZI A;  2OYQ A;  2DTU A;  4FJ8 A;  2JHA A;  4DTO A;  3SQ4 A;  3C95 A;  1IH7 A;  4E3S A;  4ADN A;  2JHP A;  4M3T A;  3CFP A;  3RMD A;  3QES A;  2E32 A;  4AKI A;  2PFT A;  4M3Z A;  3QEV A;  2HD0 A;  2VJ5 A;  4DTX A;  4AI6 A;  4AKG A;  1Q9X A;  5H37 A;  1FZ7 E;  2OZS A;  3L0M A;  3J2P A;  3S9H A;  1FZ2 E;  4J2E A;  2QXF A;  3LD8 A;  3QEX A;  4FJI A;  3LDS A;  3NDK A;  4X5N A;  1XU3 E;  1WAJ A;  2JHC A;  3L1N A;  3OGK B;  4HCC A;  1MTY G;  1WAF A;  2E31 A;  4EP9 A;  4DTU A;  2DY4 A;  3RMA A;  2P1O B;  3QET A;  1FZH E;  2MZW B;  2P1M B;  4RL5 A;  4EPH A;  3SUP A;  3SCX A;  4B08 A;  4FJJ A;  4J2A A;  1CLQ A;  4KHY A;  1Q9Y A;  4FJ5 A;  4DTM A;  3UIQ A;  4HCB A;  4FJ9 A;  3QEW A;  4EYW A;  3N1E A;  1FZ8 E;  3RMC A;  3LZJ A;  2P1Q B;  4JRP A;  3TAE A;  4RNG A;  5IZ7 A;  3SPY A;  4GAM C;  2VIX A;  4ADO A;  4J2D A;  4DU3 A;  3N1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...