2MZWB

Staphylococcus aureus fusb:ef-gc3 complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
213
Chain Sequence
MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor G
publication title A target-protection mechanism of antibiotic resistance at atomic resolution: insights into FusB-type fusidic acid resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Translation/antibiotic resistance
total genus 59
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
B PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2mzwB01
4ADOA 4ADNA 4E4BA 2MZWB 2YB5A
chains in the Genus database with same CATH superfamily
3LZIA 3QEPA 3RMCA 1FZ9E 3SUOA 4M3XA 3QEVA 3NHGA 4M3WA 4J2EA 1Q9YA 4ADOA 2MW2A 4FJMA 2JHAA 3E4YA 4GAMC 4B08A 1FYZE 3N1BA 2P1QB 1XVBE 3SUNA 2P5GA 3V7DB 1WAFA 4FJJA 3C6NB 3NAEA 4FK0A 3J27A 2E32A 3L0MA 3SQ2A 3KD5E 2HD0A 3QEIA 4M3ZA 2JHCA 1XL3C 3KD1E 4JS4A 1FXXA 3TAEA 5IREA 3LZJA 1FZ3E 3BVOA 3MKSB 3RWUA 4E4BA 4DTRA 2OYQA 3UO2A 3SJJA 2VJ4A 4HCBA 4DTPA 3SUQA 5H37A 4EPHA 4JS5A 1XU5E 3SPYA 3RMBA 1MTYG 4DTUA 1FZ2E 4J2DA 2MMBA 4KI4A 2VIXA 4KI6A 3QETA 3SVIA 1XMHE 3QESA 4M41A 3CFOA 2PFTA 3SUPA 4DTSA 4X5MA 1XVFE 3L2OB 3QERA 4QNCA 1FZ6E 4I6JB 4RG8A 4IT5A 4DU4A 1NEXB 2MZWB 4FJNA 3NDKA 3SCXA 3CFPA 1XMFE 4RL5A 2DY4A 3OGKB 3SQ0A 3QNOA 1FZHE 2PFVA 3TAFA 4KHQA 1N1CA 3C6OB 3HGKE 3LDSA 4AKGA 3RMAA 2FW3A 4M3YA 4M3RA 2JH9A 4AKHA 1MMOG 4FJ8A 1XVDE 1FZ0E 2YB5A 2QXFA 1XVEE 3HP9A 2OVQB 1FZ7E 4HCCA 2P1NB 1FPOA 4FJGA 2JHPA 3WSOA 5IBKB 4KHYA 3C95A 4KHWA 3SPZA 4RNGA 3C94A 4FJ5A 3TABA 4FJKA 1FZ1E 1Q9XA 4FJ9A 4JRPA 4DU1A 2B8IA 1XVCE 2P5OA 1P22A 1IG9A 3NE6A 2H4TA 2LF3A 4I9QA 3SI6A 4DTJA 4FK4A 1FZ4E 3TAGA 4DU3A 2OZSA 4AKIA 1FZ8E 3L8BA 4FJHA 2VJ5A 1WAJA 4E3SA 3QNNA 3LDBA 2OVPB 3HGLA 2P1PB 4DTNA 4FJ7A 1FS1A 2JQTA 4FK2A 2B7MA 4DTOA 4KHUA 4AI6A 1JW2A 2RCUA 4QNDA 3NCIA 2DEBA 1XMGE 1FZIE 1LDKE 4M45A 1CLQA 3NGIA 2ATQA 4J2BA 4KHSA 3TL8B 1XU3E 2DTUA 3L1NA 3C6PB 2JPNA 4JRQA 3E4WA 3OGMB 3QEXA 4FJLA 4M3UA 3CFRA 2FYOA 3TJYA 4DTMA 1FZ5E 2RKHA 3SQ4A 4ADNA 2OZMA 3N1EA 3QEWA 4I9LA 1XVGE 3UO3A 3CQ8A 3K2OA 3UIQA 2JH8A 4FJXA 3S9HA 3RMDA 2B1EA 1IH7A 1MHYG 4EP9A 2LF6A 4FJIA 4KHNA 4FVMA 4X5NA 4J2AA 2E31A 4ICGC 1MHZG 2OVRB 2K5SA 3OGLB 3HL8A 5IZ7A 4DTXA 4M42A 2P1OB 3LD8A 4M3TA 3J2PA 4EYWA 2P1MB 3SNNA 3SQ1A
chains in the Genus database with same CATH topology
3LZIA 3QEPA 3RMCA 1FZ9E 3SUOA 4M3XA 3QEVA 3NHGA 4M3WA 4J2EA 1Q9YA 4ADOA 4FJMA 2JHAA 3E4YA 4GAMC 4B08A 1FYZE 3N1BA 2P1QB 1XVBE 3SUNA 2P5GA 3V7DB 1WAFA 4FJJA 3C6NB 3NAEA 4FK0A 3J27A 2E32A 3L0MA 3SQ2A 3KD5E 2HD0A 3QEIA 4M3ZA 2JHCA 1XL3C 3KD1E 4JS4A 1FXXA 3TAEA 5IREA 3LZJA 1FZ3E 3MKSB 3RWUA 4E4BA 4DTRA 2OYQA 3SJJA 2VJ4A 4HCBA 4DTPA 3SUQA 5H37A 4EPHA 4JS5A 1XU5E 3SPYA 3RMBA 1MTYG 4DTUA 1FZ2E 4J2DA 2MMBA 4KI4A 2VIXA 4KI6A 3QETA 3SVIA 1XMHE 3QESA 4M41A 3CFOA 2PFTA 3SUPA 4DTSA 4X5MA 1XVFE 3L2OB 3QERA 4QNCA 1FZ6E 4I6JB 4RG8A 4DU4A 4FJNA 1NEXB 2MZWB 3NDKA 3SCXA 3CFPA 1XMFE 4RL5A 2DY4A 3OGKB 3SQ0A 3QNOA 1FZHE 2PFVA 3TAFA 4KHQA 3C6OB 3HGKE 3LDSA 4AKGA 3RMAA 2FW3A 4M3YA 4M3RA 2JH9A 4AKHA 1MMOG 4FJ8A 1XVDE 1FZ0E 2YB5A 2QXFA 1XVEE 3HP9A 2OVQB 1FZ7E 4HCCA 2P1NB 4FJGA 2JHPA 3WSOA 5IBKB 4KHYA 3C95A 4KHWA 3SPZA 4RNGA 3C94A 4FJ5A 3TABA 4FJKA 1FZ1E 1Q9XA 4FJ9A 4JRPA 4DU1A 2B8IA 1XVCE 2P5OA 1P22A 1IG9A 3NE6A 2H4TA 2LF3A 4I9QA 3SI6A 4DTJA 4FK4A 1FZ4E 3TAGA 4DU3A 2OZSA 4AKIA 1FZ8E 3L8BA 4FJHA 2VJ5A 1WAJA 4E3SA 3QNNA 3LDBA 2OVPB 3HGLA 2P1PB 4DTNA 4FJ7A 1FS1A 4FK2A 4KHUA 2B7MA 4DTOA 4AI6A 2RCUA 4QNDA 3NCIA 2DEBA 1XMGE 1FZIE 1LDKE 4M45A 1CLQA 3NGIA 2ATQA 4J2BA 4KHSA 3TL8B 1XU3E 2DTUA 3L1NA 3C6PB 2JPNA 4JRQA 3E4WA 3OGMB 3QEXA 4FJLA 4M3UA 3CFRA 2FYOA 3TJYA 4DTMA 1FZ5E 3SQ4A 4ADNA 2OZMA 3N1EA 3QEWA 4I9LA 1XVGE 3CQ8A 3K2OA 3UIQA 2JH8A 4FJXA 3S9HA 3RMDA 2B1EA 1IH7A 1MHYG 4EP9A 2LF6A 4FJIA 4KHNA 4FVMA 4X5NA 4J2AA 2E31A 1MHZG 2OVRB 3OGLB 4DTXA 3HL8A 5IZ7A 4M42A 2P1OB 3LD8A 4M3TA 3J2PA 4EYWA 2P1MB 3SNNA 3SQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ADO A;  4ADN A;  4E4B A;  2MZW B;  2YB5 A; 
#chains in the Genus database with same CATH topology
 3LZI A;  3QEP A;  3RMC A;  1FZ9 E;  3SUO A;  4M3X A;  3QEV A;  3NHG A;  4M3W A;  4J2E A;  1Q9Y A;  4ADO A;  2MW2 A;  4FJM A;  2JHA A;  3E4Y A;  4GAM C;  4B08 A;  1FYZ E;  3N1B A;  2P1Q B;  1XVB E;  3SUN A;  2P5G A;  3V7D B;  1WAF A;  4FJJ A;  3C6N B;  3NAE A;  4FK0 A;  3J27 A;  2E32 A;  3L0M A;  3SQ2 A;  3KD5 E;  2HD0 A;  3QEI A;  4M3Z A;  2JHC A;  1XL3 C;  3KD1 E;  4JS4 A;  1FXX A;  3TAE A;  5IRE A;  3LZJ A;  1FZ3 E;  3BVO A;  3MKS B;  3RWU A;  4E4B A;  4DTR A;  2OYQ A;  3UO2 A;  3SJJ A;  2VJ4 A;  4HCB A;  4DTP A;  3SUQ A;  5H37 A;  4EPH A;  4JS5 A;  1XU5 E;  3SPY A;  3RMB A;  1MTY G;  4DTU A;  1FZ2 E;  4J2D A;  2MMB A;  4KI4 A;  2VIX A;  4KI6 A;  3QET A;  3SVI A;  1XMH E;  3QES A;  4M41 A;  3CFO A;  2PFT A;  3SUP A;  4DTS A;  4X5M A;  1XVF E;  3L2O B;  3QER A;  4QNC A;  1FZ6 E;  4I6J B;  4RG8 A;  4IT5 A;  4DU4 A;  1NEX B;  2MZW B;  4FJN A;  3NDK A;  3SCX A;  3CFP A;  1XMF E;  4RL5 A;  2DY4 A;  3OGK B;  3SQ0 A;  3QNO A;  1FZH E;  2PFV A;  3TAF A;  4KHQ A;  1N1C A;  3C6O B;  3HGK E;  3LDS A;  4AKG A;  3RMA A;  2FW3 A;  4M3Y A;  4M3R A;  2JH9 A;  4AKH A;  1MMO G;  4FJ8 A;  1XVD E;  1FZ0 E;  2YB5 A;  2QXF A;  1XVE E;  3HP9 A;  2OVQ B;  1FZ7 E;  4HCC A;  2P1N B;  1FPO A;  4FJG A;  2JHP A;  3WSO A;  5IBK B;  4KHY A;  3C95 A;  4KHW A;  3SPZ A;  4RNG A;  3C94 A;  4FJ5 A;  3TAB A;  4FJK A;  1FZ1 E;  1Q9X A;  4FJ9 A;  4JRP A;  4DU1 A;  2B8I A;  1XVC E;  2P5O A;  1P22 A;  1IG9 A;  3NE6 A;  2H4T A;  2LF3 A;  4I9Q A;  3SI6 A;  4DTJ A;  4FK4 A;  1FZ4 E;  3TAG A;  4DU3 A;  2OZS A;  4AKI A;  1FZ8 E;  3L8B A;  4FJH A;  2VJ5 A;  1WAJ A;  4E3S A;  3QNN A;  3LDB A;  2OVP B;  3HGL A;  2P1P B;  4DTN A;  4FJ7 A;  1FS1 A;  2JQT A;  4FK2 A;  2B7M A;  4DTO A;  4KHU A;  4AI6 A;  1JW2 A;  2RCU A;  4QND A;  3NCI A;  2DEB A;  1XMG E;  1FZI E;  1LDK E;  4M45 A;  1CLQ A;  3NGI A;  2ATQ A;  4J2B A;  4KHS A;  3TL8 B;  1XU3 E;  2DTU A;  3L1N A;  3C6P B;  2JPN A;  4JRQ A;  3E4W A;  3OGM B;  3QEX A;  4FJL A;  4M3U A;  3CFR A;  2FYO A;  3TJY A;  4DTM A;  1FZ5 E;  2RKH A;  3SQ4 A;  4ADN A;  2OZM A;  3N1E A;  3QEW A;  4I9L A;  1XVG E;  3UO3 A;  3CQ8 A;  3K2O A;  3UIQ A;  2JH8 A;  4FJX A;  3S9H A;  3RMD A;  2B1E A;  1IH7 A;  1MHY G;  4EP9 A;  2LF6 A;  4FJI A;  4KHN A;  4FVM A;  4X5N A;  4J2A A;  2E31 A;  4ICG C;  1MHZ G;  2OVR B;  2K5S A;  3OGL B;  3HL8 A;  5IZ7 A;  4DTX A;  4M42 A;  2P1O B;  3LD8 A;  4M3T A;  3J2P A;  4EYW A;  2P1M B;  3SNN A;  3SQ1 A; 
#chains in the Genus database with same CATH homology
 3LZI A;  3QEP A;  3RMC A;  1FZ9 E;  3SUO A;  4M3X A;  3QEV A;  3NHG A;  4M3W A;  4J2E A;  1Q9Y A;  4ADO A;  4FJM A;  2JHA A;  3E4Y A;  4GAM C;  4B08 A;  1FYZ E;  3N1B A;  2P1Q B;  1XVB E;  3SUN A;  2P5G A;  3V7D B;  1WAF A;  4FJJ A;  3C6N B;  3NAE A;  4FK0 A;  3J27 A;  2E32 A;  3L0M A;  3SQ2 A;  3KD5 E;  2HD0 A;  3QEI A;  4M3Z A;  2JHC A;  1XL3 C;  3KD1 E;  4JS4 A;  1FXX A;  3TAE A;  5IRE A;  3LZJ A;  1FZ3 E;  3MKS B;  3RWU A;  4E4B A;  4DTR A;  2OYQ A;  3SJJ A;  2VJ4 A;  4HCB A;  4DTP A;  3SUQ A;  5H37 A;  4EPH A;  4JS5 A;  1XU5 E;  3SPY A;  3RMB A;  1MTY G;  4DTU A;  1FZ2 E;  4J2D A;  2MMB A;  4KI4 A;  2VIX A;  4KI6 A;  3QET A;  3SVI A;  1XMH E;  3QES A;  4M41 A;  3CFO A;  2PFT A;  3SUP A;  4DTS A;  4X5M A;  1XVF E;  3L2O B;  3QER A;  4QNC A;  1FZ6 E;  4I6J B;  4RG8 A;  4DU4 A;  4FJN A;  1NEX B;  2MZW B;  3NDK A;  3SCX A;  3CFP A;  1XMF E;  4RL5 A;  2DY4 A;  3OGK B;  3SQ0 A;  3QNO A;  1FZH E;  2PFV A;  3TAF A;  4KHQ A;  3C6O B;  3HGK E;  3LDS A;  4AKG A;  3RMA A;  2FW3 A;  4M3Y A;  4M3R A;  2JH9 A;  4AKH A;  1MMO G;  4FJ8 A;  1XVD E;  1FZ0 E;  2YB5 A;  2QXF A;  1XVE E;  3HP9 A;  2OVQ B;  1FZ7 E;  4HCC A;  2P1N B;  4FJG A;  2JHP A;  3WSO A;  5IBK B;  4KHY A;  3C95 A;  4KHW A;  3SPZ A;  4RNG A;  3C94 A;  4FJ5 A;  3TAB A;  4FJK A;  1FZ1 E;  1Q9X A;  4FJ9 A;  4JRP A;  4DU1 A;  2B8I A;  1XVC E;  2P5O A;  1P22 A;  1IG9 A;  3NE6 A;  2H4T A;  2LF3 A;  4I9Q A;  3SI6 A;  4DTJ A;  4FK4 A;  1FZ4 E;  3TAG A;  4DU3 A;  2OZS A;  4AKI A;  1FZ8 E;  3L8B A;  4FJH A;  2VJ5 A;  1WAJ A;  4E3S A;  3QNN A;  3LDB A;  2OVP B;  3HGL A;  2P1P B;  4DTN A;  4FJ7 A;  1FS1 A;  4FK2 A;  4KHU A;  2B7M A;  4DTO A;  4AI6 A;  2RCU A;  4QND A;  3NCI A;  2DEB A;  1XMG E;  1FZI E;  1LDK E;  4M45 A;  1CLQ A;  3NGI A;  2ATQ A;  4J2B A;  4KHS A;  3TL8 B;  1XU3 E;  2DTU A;  3L1N A;  3C6P B;  2JPN A;  4JRQ A;  3E4W A;  3OGM B;  3QEX A;  4FJL A;  4M3U A;  3CFR A;  2FYO A;  3TJY A;  4DTM A;  1FZ5 E;  3SQ4 A;  4ADN A;  2OZM A;  3N1E A;  3QEW A;  4I9L A;  1XVG E;  3CQ8 A;  3K2O A;  3UIQ A;  2JH8 A;  4FJX A;  3S9H A;  3RMD A;  2B1E A;  1IH7 A;  1MHY G;  4EP9 A;  2LF6 A;  4FJI A;  4KHN A;  4FVM A;  4X5N A;  4J2A A;  2E31 A;  1MHZ G;  2OVR B;  3OGL B;  4DTX A;  3HL8 A;  5IZ7 A;  4M42 A;  2P1O B;  3LD8 A;  4M3T A;  3J2P A;  4EYW A;  2P1M B;  3SNN A;  3SQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...