3L2OB

Structure-based mechanism of dimerization-dependent ubiquitination by the scffbx4 ubiquitin ligase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
308
structure length
274
Chain Sequence
b'AASTLTRLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVFFDYMAVYRMCCPYLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTTRRYSVIPQIQKVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-phase kinase-associated protein 1
publication title Structural basis of dimerization-dependent ubiquitination by the SCF(Fbx4) ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/cell cycle
total genus 69
structure length 274
sequence length 308
ec nomenclature
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00646 F-box F-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3l2oB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l2oB02
4DXAA 2GEUA 4KBGA 3D31A 4FCVA 1NBMA 2C9OA 3AUYA 4EAQA 3L0PA 3LXRA 5DO9A 1UM8A 3RNLA 2O8DB 1AM4D 1T5LA 2IS4A 3KJGA 2VH5R 1Z28A 4Q7JB 2FMXA 4M21A 4Q66C 4WOPA 2JLVA 4DKXA 3CX7A 2IUTA 1JEEA 2WOOA 4TMTA 1KOFA 1M7BA 2PLRA 1DS6A 2I1QA 2GBLC 3ADKA 3BH7A 1LS6A 3HU1A 1DADA 3LRPA 2JIZA 4DLUA 4Q4AB 2A2ZA 4OHXA 3NHAA 5F9HA 1AGRA 3LO5A 2ECKA 821PA 5DI3B 1OXVA 5JBQA 2UZ3A 1RYHA 2QAJA 1U0HC 2AXPA 3DOFA 4E09A 1MKYA 4LJ9A 1XFAA 3I5XA 3MFYA 4TL9A 5SZIA 4ILEA 2UVQA 1IBRA 3E1SA 3AF4A 4MITA 2EYQA 2VHTA 1W0JD 4MH0R 4MGZR 2YOHA 4D0LB 4JZKA 4TN1A 2EFEB 1EXMA 4LCBA 2QE7A 2NOAA 1XCPA 4E5UA 2JJ1D 2R6FA 3GLHB 2AKAB 4D81A 3K0SA 1Q22A 1SKQA 2B7BA 2XZLA 3MG9A 4D6PA 1K5DA 2IYUA 4PO9A 3ZJYA 4EPYA 3E70C 2D74A 3IKJA 3VQTA 1QHGA 2RHDA 4Q4HB 4A4DA 2ZQ5A 4Q19A 1HE1C 4ZCMA 3AVUA 1MO6A 1GTVA 1J7KA 2OFOA 4BASA 1W48A 1T0JB 3R9WA 1QVRA 1FP7A 4ABYA 5J4KA 1TF7A 2B6HA 3C6OB 1M74A 3CPEA 5CK5A 4NYIQ 5AJXA 3VR5A 4D2IA 5JSZA 5DIFA 5FL7D 4ASUA 1DOAA 4DLVA 1Z6TA 4DVGA 1RJ9A 1Q44A 2CK3D 2I4IA 1UEIA 2YINC 1UDWA 1Z3IX 4OQMA 4PZZA 1U9IA 3RWOA 2OLKA 1G1MA 2EWWA 1E0AA 2FSIA 1IXZA 1SKYE 2FWRA 4C0SA 3K09C 4LJAA 1UKZA 1IJEA 3GEIA 1C4OA 4TLBA 3CZQA 4ZCIA 1VCNA 2VEDA 4JLDA 3X1WA 4DHEA 2ZAMA 4AKGA 5C1BA 4XTCS 4L4UA 1RE0A 4IXMA 3QNUA 5DHFA 1AGPA 1T0HB 1OPXA 2V4ZA 4KBFA 8OHMA 2QP9X 4NP6A 4P4SB 5J40A 1EGAA 2HYDA 3MWYW 4A0FA 2EFCB 3KJIA 1KKLA 2ZVQX 3WP0A 4YMTA 3AVYA 4UXJA 1DVRA 2IYQA 2GA8A 2R9VA 2YWEA 2HEIA 3SJZA 1ZNZA 5CLQA 2NZ8A 3OEED 1V43A 3LX8A 3BAFA 4URVR 3QKSB 1JR3E 4G5SA 4EJSA 3F3YA 3CNNA 4DCNA 3CBQA 1RVDA 3FFBA 3U3OA 5CYPA 1Y63A 2O8DA 2O8FB 3BFKA 4ACBA 1ONBA 4Q1AA 4BLOA 1IN7A 4JLJA 4DSTA 1VCOA 3TUZC 4PQYA 4Z54A 2MMGA 1KI7A 2WIAA 3BC1A 2ORIA 4LJ4A 3UG6A 4ZCLA 2GCOB 5CJ2A 2R65A 5K8TA 4WIAA 1CJKC 3C6NB 3WRXC 3AVVA 4Q4AA 4DDTA 4M1TA 2OFXA 3TBKA 5AUOB 4XIGS 3O47A 3PJRA 2K5UA 5KPDA 1PZNA 3HR8A 1XCGB 5J4VA 1YE8A 3ONWA 3J81k 2XZOA 1A4RA 4IXNA 4BRWA 2CVFA 2JLZA 2VTKA 2G88A 5FUYA 2AHOA 1C9KA 3KQNA 2P65A 2ZI4A 4R7ZA 4KVGA 4B32A 3L8ZA 3C5HA 3NG1A 1A5TA 1W0JA 3R8FA 1II8A 3C14C 4HUTA 3R9IA 5M04A 2O8BB 4YC7A 3CLVA 3LQRA 2CMKA 2FG5A 2JJ1A 3NKVA 4XSHA 3CWQA 1OF1A 1N6OA 2KWIA 3SQWA 4CZ2A 1MO5A 3VTKA 2WSSD 3CRW1 2WPDA 4Q4HA 3ZD7A 3RRMA 1GNRA 2P1MB 1N2CE 4AKIA 4FCTA 2DWQA 3U7FB 1Y3AA 2Q9AA 4WBSA 4CF7A 2BWJA 3UPUA 2VSFA 2GWHA 4ZV4A 3HU2A 3K70C 2IF0A 1YR9A 5JWOA 1OIWA 4MQBA 1XMIA 5FPHA 1P2VA 2WAYA 1E2EA 3C15C 2GZHA 2CDNA 4UXIA 1GKYA 3WYGA 2V7QD 2ZSDA 4LC0A 2GVDC 2A3RA 1ZP6A 2OXRA 4W7SA 2A5GA 1H8HA 5FL7A 1CJTC 2CK3A 4BZXA 2RGNC 4OHZA 3THWA 2QEQA 5HCNA 2FA9A 2DWOA 2GESA 4GRAA 2HF9A 4BFVA 5GJWC 3T1TA 2CL6X 4Q7MB 1TQ6A 3VNVA 4QG7A 2O52A 3ADDA 2QY9A 4OL0A 4KFTA 2MMCA 1G5TA 3GJ6A 2QSYA 1R2QA 3A36A 4KFUA 4QGHA 2QP4A 1VYTA 5J47A 1SVWA 1GUAA 4O25A 1G64A 4ZI2A 3U3RA 1CJUC 2BEJA 2OUKA 2GAOA 1VCIA 5DYIA 4IOKA 2NQ2C 5B30A 1G8FA 4M4SA 4P4SA 5JRZA 3NEYA 2VHCA 2QT0A 1G7TA 2IYWA 1MABB 4DLRA 1N5JA 4M9XA 3PITA 4TMZA 2ZUBA 1X8KA 3HYRA 4C0KA 1VIYA 4HLUA 5H70A 4EIWA 1UADA 3GJ4A 4LOAA 4BZPA 4F7WA 1DBSA 2WZQA 3LLMA 3GLIB 1D5CA 3UKDA 3BFVA 2ONJA 4HDOB 1LY1A 4LV5B 3ZD6A 2IHYA 3OEEA 4RZUA 4PAQA 1W1WA 4P4TA 2ZPTX 4BFTA 4PPNA 1U9IC 2CCKA 1LW7A 2ZR0A 3T15A 4DZZA 2G77B 4E22A 4ZKDA 1T6NA 4A15A 1KY2A 4HB0A 3TJZA 1R8QA 1KSJA 1XEFA 2IS1A 1N0UA 2EYUA 2W2VA 4AYTA 4I1OA 4II7A 4N3NA 5FUXA 1SXJC 2IT1A 2DFLA 3PUWA 5KDLA 2F7SA 4P32A 4IKEA 3THYA 2OHFA 1AQYA 3R20A 4X8MA 2OVRB 1NMZA 1ODFA 2D2FA 4XTRA 2W6ID 1QG2A 1ZC4A 2F1HA 1GZSA 1E79D 2QP3A 2PZGA 2R6GA 3AVPA 4DLXA 3B1VA 3CPHA 2NO7A 4Q7LA 2YWGA 2J45A 4Q9KA 1R8SA 2OFWA 3P26A 3KTAA 3TW8B 3HJNA 3OF5A 1XPOA 2C95A 2DYKA 2FH5B 2O0JA 3SJBA 4RD1A 2GVZC 2R8RA 4UNQA 2OSBA 1W4CA 2HT6A 3AKCA 2H57A 5HZKA 5J4HA 5HE9A 3H84A 1BMFD 1KK1A 3UG7A 1E2IA 1X3SA 2XJ4A 4FMCB 4JJZA 5EZ6B 1KO7A 721PA 3EPHA 2GZDA 3AVXA 1P72A 2EFGA 4AWXA 2WSSA 1Z0IA 2FF7A 4D0GA 3I5YA 4LJ8A 3FMFA 1JQLB 5EE0A 2GXUA 1K8RA 4PHTA 4PSAA 4OK6A 1F48A 3PENA 1OE0A 2WAXA 4BFSA 1Z0FA 2ZREA 4KYUA 3PQCA 4B33A 1SQ5A 2FV8A 2ZTSA 1KI8A 1X8LA 1BOFA 2V9PA 1RFLA 2V7QA 4Q9JA 4Q1BA 1TAGA 5JJKA 3GJ0A 1W4AA 3QKRB 3T61A 4AYXA 5KSZA 2WJVA 1YHNA 1RRCA 3QI2A 5H1YA 1UBGA 1C1YA 2W0SA 4W9MC 1JR6A 1IHUA 3CNOA 1F2UB 1ZU4A 1OH6A 1NEXB 2ZRAA 2Z43A 1HY3A 3EWAA 3OAAD 4NZYA 4QNMA 3CR8A 3DMNA 2NPFA 1P73A 1US8A 3AF1A 3QG1A 3AP2A 3SYKA 3IQXA 1NVUQ 5GVRA 2H18A 3Q85A 3H86A 2B8WA 1QHSA 4FMCF 1GDDA 4JLAA 5LB4A 2WJHA 1JECA 1GRQA 4PO8A 1NL3A 4EPRA 3I32A 4G5OA 2V55B 5TXGA 2ZRMA 3HDTA 4W5HA 2ZRJA 3L2OB 3PCRB 1LF5A 2JAQA 1P3JA 1QF9A 1T3HA 1MABA 4AYWA 1AKEA 4RD2A 2J7PD 3W5JA 1VECA 4QGAA 3TAHA 4IEEA 1ESMA 1MRSA 3CKLA 3FHOA 4AK9A 4IFBA 2OG2A 1PVOA 4HYYA 2QPTA 2BMEA 1N6HA 1ZYUA 3TSWA 2ZETA 3CH4B 2I3BA 3RC3A 1G291 1HE8B 4PTLA 2QPAA 3OIVA 5AUNB 1T8UA 1S2MA 4IVPA 4NCNA 5DI9A 4QC2A 5EP1A 5GJVC 3ZZTA 5DISB 2PEYA 5J5CA 1Z83A 3EIEA 5D3MB 3K0FB 4X8OA 2D62A 4GP6A 1L4UA 1VCMA 4MKGA 3T06B 3WYFA 1S3GA 2H5EA 4B34A 4HEJA 1YR6A 2Y8EA 3Q5DA 3C4JA 4JMPA 1P2TA 1HUQA 3MWLA 4OK5A 4F93B 3ZYCA 2JEOA 2QUZA 2W6IA 3V4RA 3L0SA 5FL3A 4RJLA 1E79A 3DOEA 3ZVRA 1E2LA 2Z83A 2J0VA 2JA1A 4IRUB 3T12A 2B7CA 2GCNA 2ZI6A 2YC4C 1XMJA 4OQLA 3U5ZB 2E32A 1QHYA 4G5RA 1E2GA 4Q1FA 4CYMA 1G9XA 4KSCA 2NMVA 4OHVA 1S4QA 1SVLA 1Z0JA 4DLWA 3KL4A 4TLDA 1G20E 2ZYWX 2GTPA 1BMFA 2PMKA 4L5BA 4ZDJA 1NN5A 4RFVA 4M2LA 4PAOA 3W6OA 5BN3A 3TNFA 2Q3HA 5H68A 5JMTA 2RGDA 3PVSA 4G5QA 1ESNA 1TQ2A 2XSZD 3ECCA 4NDZA 2GK7A 1AK2A 1QHHA 4PXAA 5KDDA 1SVMA 2OZEA 2VIIA 2FFBA 3RS7A 3I62A 2VLIA 2F9LA 4LHZA 5FOSA 1KMHA 1N6KA 4C0JA 3KKPA 1YZKA 3TR0A 2A5YB 2IUUA 4F92B 3K9LA 2AD5A 3RVBA 5KNCA 4A8JB 1WDTA 4AY2A 3HYTA 1RKBA 1AN0A 2FZ4A 2FGJA 1XD9A 3CR7A 4LYJA 3TRFA 5JECA 1Q3TA 1U94A 1UKYA 3EC1A 2GBLA 5TB5A 1WXQA 4FXPA 2H92A 3OAAA 3VHLB 2XXAB 2WJYA 3FFAA 3QG5A 5JJLA 2GJAA 3PEWA 5BW8A 1GKUB 4JLKA 1FOEB 3UMFA 1X1SA 4PSVA 3Q8XB 5GADl 3G82C 2V6JA 3K9HA 2EW1A 3P4YA 4KFRA 5FBRB 1R5OA 5DE3A 5C46F 3GFPA 4K46A 2CXXA 2QSZA 3FMOB 4Q4JB 1XEXA 2N42A 1NN0A 5G3ZA 4JVLA 3T5DA 1FQJA 3GLFB 2G0TA 1YQTA 2C78A 2QMOA 1ELOA 1CJMA 5FOXA 3W8NA 4JKIA 4WAUA 3HPQA 3MJRA 2J7PA 2YJTD 5C4MA 1MO4A 4KITB 1GL9B 4B2LA 1LVGA 4TTQA 5BWMA 1Q12A 1G8GA 1ZNWA 2WWGA 3CX8A 4TT3D 2J5XA 5FPYA 3U61B 1NKSA 1KI3A 1UBCA 3CF6R 3T1QA 2QTHA 5L3QB 2FDCA 3K70D 1G5PA 3B60A 3U2QA 2ATXA 2F3TA 1N0VC 1EWRA 4TTRA 4QJ3A 3UATA 1NSTA 3VFDA 1AIPA 1UKEA 2QN6A 3DZ8A 4NYJQ 2JLYA 3HPRA 3D6TB 4V02A 4KV9A 2EVWX 4LHWA 1EG7A 2NIPA 3KKOA 4NYJR 1SVSA 3DVLA 1GL7A 1XTJA 2BCGY 3EG5A 4PFSA 3NIBA 3O8CA 3QIAA 4OK3A 3A1SA 3RABA 2P1OB 1L7VC 4CEHB 1GG2A 2ZRDA 3IPYA 3A1VA 2C5LA 4UNRA 5G40A 1D2MA 4PHFA 1XXHB 2CCJA 1KO5A 2VHQA 3SFZA 4A0RA 5JS8A 2O8CB 3I3SR 1NRJB 3UWKA 3QE0A 1A2KC 1ZCBA 2ANCA 2GHIA 3I4LA 1CR0A 3DPUA 5EE5B 4YDSA 2PT5A 4JLBA 5AJWA 1IXSB 2SHKA 3M1IA 1G6OA 2HT1A 4QHYA 5DSZA 1ZVQA 2ZI7A 4NCKA 2PL3A 1KDPA 4MYCA 1OIVA 1R0YA 5DNYB 5LPNA 1EFTA 1XD2A 2W00A 1JBKA 2OO7A 3MGCA 1O3YA 4I1VA 4FWIB 2XSZA 4IDHA 1AS2A 5JHGB 3ICEA 2FEMA 2BBTA 1I4TD 3G5UA 1L2TA 3U7GA 1ZCAA 2RB4A 4Q18A 1HA3A 1OYYA 4A6XA 1TF2A 2JLSA 4QL3A 5EP3A 3BJIC 2CJWB 2Q3MA 1NNEA 3KQKA 1ZMXA 2C04A 1NBME 1JNYA 4DCSA 4MRPA 4A9AA 4PQFA 4EFMA 2ZS9A 2HCJB 1SXJD 4ITRC 4A8JA 1YZQA 1VG1A 3HWSA 4GP7A 4O2LA 1M34E 1R0XA 3THXB 4TLCA 2J0UB 4H9GA 4GPTA 3RWMB 1XF9A 3IEUA 3LW8A 3LA6A 2XXAA 1H65A 1CBUA 4OI1A 1CULC 5AJVB 3NVAA 1JQJC 3AVOA 3SBEA 1VYUA 2BM0A 4HAZA 5CIWA 1DPFA 1TUIA 1S9DA 4URWR 4IDNA 5BYJA 4BWYA 1ZUNB 2GJ8A 4C0BA 4C4PA 4DCTA 1Q1ZA 4JLNA 2OCAA 4Q4JA 3NDPA 1E32A 2NO6A 4M53A 5L3SA 2AX4A 1GNPA 4NYMR 5GJCA 3I8SA 1TU3A 5GJBA 5AK0A 3WNCA 2AXNA 4EFLA 3V9PA 1XEWX 2ORVA 1CP2A 2ZE7A 2ZRNA 1M8PA 4RSGA 2JLWA 3K8YA 2HJVA 1J8MF 3FOZA 4A0HA 4PC7A 2DFTA 1GAJA 2BIFA 4ZI3A 4DIDA 1W7AA 2WMNB 4TT3A 4ZPXA 4A0GA 3CX6A 5SZKB 1LS1A 2QMHA 3DM9B 4TTPA 5A4JA 3FWYA 2C8VA 3CW2A 2J0QA 3B85A 1SKYB 4JLPA 4LRWA 3WRYC 4F4CA 2AWOA 5L3QA 2QBYB 3VNUA 4ZDIA 4WW0A 1P61B 3BB3A 1G6HA 2BBWA 3QKTA 2J41A 2QORA 2FPMA 3SN6A 4US0R 4A2PA 4CEJA 4LHVA 3IO3A 3OFND 1ZM3A 4JL5A 2QRNA 4KFSA 2ZS7A 1XJQA 4MUBA 2P1QB 4EQ6A 2RGNA 2R2AA 3I92A 2ZE6A 3L8YA 3R7WA 3U3MA 2ZUCA 3CF0A 2XTZA 4IOLA 4Q5IA 1IONA 5EXPA 2JGNA 2W2XA 4XWKA 2KBFA 3RRZA 4BFWA 3JVUA 1II9A 1E2MA 4Q47A 4QRHA 2P2LA 2YZ2A 1Q1EA 3RS3A 1AS3A 4BUJA 1OKKD 4PX9A 2IUSA 1Q57A 1N5IA 4LYAA 4MYTA 4URZR 4C2TA 1EX7A 2RAPA 1UKVY 4UQOA 5EXTA 3LFUA 5FBWB 2G6BA 1H8ED 4ERNA 3PFIA 2ZAOA 5C4GB 3OESA 5JEEA 4D25A 2ZRCA 2LKCA 5HR5A 4EPXA 3DM5A 1G17A 4PPFA 1IJFA 4M1YA 4D26A 1MOZA 2N46A 1E0KA 2IYRA 2PX3A 1Q0UA 2I1VB 1FTSA 1NG1A 1MH1A 1IAQA 2WSMA 3WMEA 2W0MA 3KDSE 4TLEA 1WQ1R 3HP1A 3VU9B 2J1LA 4B3FX 2ODEA 4LPSA 4U7DA 4NCJA 4B74A 2RKOA 2FJUA 5FI1B 2ZJZA 4Q4LA 5CITA 4G5GA 5TDHA 3W3ZB 4RCZA 2QTFA 2CJWA 1ZIOA 4NPHA 2J46A 2FGKA 5FR2A 4D4KA 3JZAA 1SXJA 1FUKA 1ZIPA 4C0AC 2ODWA 3IIMA 4Z8XA 3WY9A 1ZNXA 3KQUA 1QG4A 4N1AA 3TUIC 1OXUA 4F91B 4Q1DA 4GT1A 1S96A 5IK2D 3CWZA 5KPJA 1NKTA 4JYBA 2Z0MA 3GPLA 2WM9B 1BIFA 1MV5A 2Q0HA 4Q9IA 1BYIA 4M9QA 3NEJA 2G9NA 2OVPB 4D80A 4HLQB 1WBDA 4MA4A 5JI2E 5JWHA 5JEDA 1JAHA 1NLZA 2F43B 2ZROA 3CF2A 3L43A 1KO8A 3Q72A 2IEZA 1NIJA 4NCHA 1I2DA 1OFUX 4XWOA 1KAGA 2Z4SA 2MSEB 2PCLA 2PBRA 4GNKA 2QGZA 2IXFA 1YVDA 4URXR 4IDPA 2FE4A 3SEAA 4A8JC 1JI0A 1KNXA 1P9NA 4NTZA 3A1UA 3U6KA 3QENA 2REOA 1G41A 2XNSA 5FPKA 3ETLA 4GFDA 3NC0C 3VR3A 2F9MA 3FHTA 1TEXA 2HCBA 2PT7A 2X2EA 5DI3A 3ASZA 3K0EA 4YDHB 4FMBB 3RYTC 3OFNA 1LV7A 1U90A 4LBZA 1AZSC 5FTMA 3ND8A 2FSHA 2GXQA 4QBFA 3REFA 3T1OA 1EFRD 3EZFA 2GETA 3LX5A 4RVCA 5CIQA 1P9WA 5EJEA 3MKSB 4ZDWA 2ZRIA 3BFXA 5DLQC 3GLHA 1ZW6A 1GIAA 3AQ4A 2QU8A 2KJQA 5FH9A 1NJFA 5BN4A 4MDEA 1OKKA 1VPLA 3MSXA 5E7JA 4LSGA 4LJ5A 4BLTA 4GMDA 2R44A 3KKQA 1H8EA 2J7KA 4XVRA 3S1AB 3B78A 3IIKA 2A7QA 2G0NA 3EXAA 5KYKA 2JJ8A 2QMUA 2KI5A 2OAP1 4FD2A 4C9BA 3R8CA 1XZPA 1VG9B 2OM2A 2RGCA 2OT3B 3RDPA 1NN1A 1P6XA 1E2FA 1DARA 4TMVA 3KB2A 3IHLA 3VU9A 1VDZA 4PZLA 2VP4A 1OW3B 2VP2A 3F5FA 3LVRE 2A9KA 2ZRHA 1KK2A 4Z8YA 3SHWA 1EESA 5C2JB 2XTMA 4YONB 4OQNA 3EW9A 1ETUA 1N3BA 2C96A 1IXRC 3BB4A 3RLFA 4QHSA 2ZJAA 1OH8A 2YWHA 2QZ4A 3FTQA 3MLEA 1JJVA 2ZU6A 2CNWD 2ATVA 3IUYA 4C2UA 4GSYA 1A82A 1FP6A 5IHPA 2ZYUX 3IBGA 5IK2A 5C18A 1IN5A 5CM9C 3ADCA 4JBXA 3VX3A 1TF5A 2W6JD 3NBYC 5JWRA 2HDNB 1HEIA 4IEIA 4OQXA 3IPXA 1KDRA 2ZRKA 1XPUA 4K81B 3AP3A 3QXSA 2ZI5A 1G3QA 2ORWA 4BFZA 2B21A 3MWKA 2B8TA 2F43A 2NG1A 3KXKA 1Z22A 3Q3JB 1ZJ6A 4KU4A 4EPVA 3T35A 1E9AA 2C99A 3QKSA 3B9QA 2BMDA 3QJYA 4H1UA 2FFQA 5LB2A 3ADBA 2JLUA 4Q02A 2OXCA 2JLXA 4RD3A 1HURA 2O8FA 1QHIA 1T3LA 2C03A 5DYGA 4XSGA 1KSGA 1UFQA 2FEOA 1Z0AA 3TIFA 5G3YA 1YR7A 3V4FA 2GCOA 4YQFA 4TYNA 1TMKA 1KGDA 3EIQA 1OHHD 3Q9LA 5HPYB 1KSHA 1FX0B 3AVTA 1Z6GA 3CRQA 1VIAA 3FKSD 4DWJA 4XOIA 3TSZA 4R2IA 1QRAA 2GNOA 4L15A 3SOPA 1LFDB 1DO0A 4KSBA 5SZHB 3A37A 2QMEA 1WB9A 2BBSA 1WF3A 1KIMA 4U02A 4O3MA 2FFHA 2IYLD 5FOTA 4BLRA 1RRFA 1YRBA 1WP9A 5FTJA 1ZAKA 1ZRHA 1EFRA 1G16A 4LC1A 2PCJA 3VR6A 2ZUDA 4M9ZA 421PA 4LDJA 5IT5A 1JXOA 4LJ6A 1CR2A 3ZZ0A 2O8BA 2HLDD 1E2QA 3QEOA 2LWIA 5E7IA 3N70A 3CRRA 1YRAA 5EE1A 4EDHA 3D7MA 4JKYA 1G8HA 3UIEA 2FN4A 1PLKA 2ONKA 5BQ5A 2OILA 4M8NE 3WNDA 3ZIAD 1E2JA 3SE0A 4ESVA 3RS2A 3T34A 1RIFA 3CRMA 1NF3A 1P60A 1ZNYA 3S1AA 1UBEA 2YNMA 3AB3A 1L8QA 4HAXA 1WBBA 4URYR 4TYPA 1RRGA 4AG5A 5DN6D 4PAMA 4JLMA 4J0QA 5B64A 1X1RA 2VO1A 3BXZA 2RHMA 4POAA 2YOFA 4RCYA 4B2PA 2HXSA 4QXAA 1G3UA 1KJZA 2XOKD 4PHHA 5FBVB 2JJ2D 3KQHA 2FPLA 1HT1E 1OFIA 5FOVA 1XCMA 1G4UR 1L4YA 4P3YA 4N0EA 1DG3A 1XZQA 5DGXA 4WVFA 2OE2A 3RC8A 1KJYA 3PR1A 3GLGB 2OAQ1 3RS4A 4KJZA 3C7KA 3EZ9A 2ZR9A 5JFGA 4BLSA 1D2NA 2CNWA 5G41A 3Q7QA 1EK0A 4I81A 4HZIA 4M1SA 3UMSA 4CGZA 5F9FA 2BV3A 1KSFX 1OFTA 2F6RA 5KNDA 3U6BA 2ZI9A 4K8OA 4P33A 3QF4B 4WXRA 4DBLC 5JLJA 2WWFA 3MRSA 1OXSC 3QPWA 4BE7B 2RMKA 2W6JA 2E31A 4MKFA 4Y0VA 5CDFA 1XTKA 4B73A 1VYVA 3SDZA 1QHNA 3NHBA 4JBWA 1TQ4A 2E1RA 4EKDA 5HE8A 3GLIA 4TZ0A 2ZJYA 3ZVLA 2ANBA 3P4XA 4TQUS 1P75A 4RZ3A 3EWSA 1FW6A 5CK4A 3L0OA 1Z6XA 3O8DA 3QVVA 3QQ5A 1DAIA 1QDEA 1A7JA 1IM2A 1KK0A 4A2WA 4WZBE 2FX3A 3AKEA 3MAAC 4HUQB 4WZ6A 3B2EA 1IN8A 4CW7A 4DRZA 2QNRA 1E9BA 2J0SA 2KBEA 3A1TA 4LUCA 4QBGB 3CRVA 4XJXA 3AV0B 3BERA 3EA0A 2Z5FA 1Z6AA 4IW3B 1OHHA 3UWOA 1FX0A 4GOXA 5HTKA 4NKRA 4LWZA 4ARZB 3FKSA 3EARA 2R6DA 1ZD8A 2DCUA 3AF2A 1W0KD 2PZFA 3AGPA 1CTQA 3PUXA 3KQLA 4G3XA 2ZRBA 1GP2A 3GJ3A 4A82A 3P32A 4FMDB 4HZUB 4BECA 4A92A 3OGLB 2FNAA 5JCPA 2IXEA 3C41J 1E98A 4JS0A 2P6NA 1OB5A 3TH5A 2HLDA 2IK8A 4GMXA 4YXWD 1E2NA 3G0HA 1GRNA 4JL8A 2GJKA 2EWVA 2A5DA 4LZZA 4O0MA 4BEJA 3QXHA 4KVAA 2EFDB 2WJIA 1CRQA 3CONA 3LDAA 5KHOC 1HTWA 4HB2A 3ZIAA 5KDOA 5H8WA 2VHUA 3ZGXA 1DTSA 3ZVNA 3A4NA 4RY2A 3EZ7A 2WJGA 3RS0A 1ZM2A 2ASEA 3AKDA 4DLYA 2XITA 1E1RD 4TMXA 2GILA 2ZSFA 2N1BA 3NH6A 5DN6A 5E3HA 2ZR7A 2ODBA 3BORA 1T5IA 3QKRA 4D4JA 2FSGA 3DEFA 3LBIA 3BBPA 3BRWD 1CR1A 1P9RA 4U00A 3L0IB 1F2UA 1G18A 2HUPA 1P2UA 3ASYA 1A1VA 4FMDF 3TVDA 4BGDA 3CZPA 2XOKA 3KXLA 1LTQA 2JJ2A 3RRYA 1U98A 4W5JA 4QBIA 4IDQA 1VHTA 3KKMA 4JLVA 4LPKA 2PLFA 4DLSA 1XX6A 4R2HA 3LXXA 2CVHA 3P20A 5AUQA 2IHBA 2YWFA 3GLGA 5KUTA 2EFHB 3P27A 3AVWA 1I2MA 2GAAA 2ZSBA 2V54A 1DELA 3JVVA 1XTSA 1EFUA 3LW7A 4US1R 3SYLA 3WP1B 5GVSA 2YC2C 4OBEA 4RFSB 4PR0A 1OIXA 2BMFA 1T9HA 3OZXA 1UPTA 2H7VA 3QF4A 2JLQA 4LBWA 1GM5A 1NLFA 3EPJA 3KB1A 5F3WB 2J9RA 3CIOA 5HKKD 1DAMA 4CDGA 1JJ7A 1W5SA 4G1UC 4E07A 2CCGA 1X6VA 3GJXC 2D7CA 1RRPA 4B2IA 2Q3FA 1FTNA 3SFVA 1S1CA 1N0WA 1XEWY 3U4QB 4YMSA 4L9WA 1HH4A 2QG6A 4MUAA 4X8HA 2IL1A 3QOFA 1KAOA 2XZPA 2IW3A 3H4MA 3KUDA 3NC1C 4RKEA 3RHFA 3BOSA 4HI0E 4V0OA 4YLGA 5D3MA 1VG8A 2NO9A 3K0FA 4JL6A 2QI9C 1ZBDA 1GL6A 4CT5A 2IYVA 4V0MA 2IA5A 1NVVQ 1OJLA 2BJVA 5EZ5A 1PLJA 3HR7A 4I1UA 1KZGB 1N5KA 1OSNA 3QUSA 4B48A 2FOLA 1JAIA 2QT1A 1N6RA 2HF8A 4CIDA 2P67A 1NVVR 2FZLA 2V8OA 1N6LA 5JZVA 4JT4A 2QGNA 1OLOA 3DL0A 1PLLA 1W0KA 4CVNA 4L8GA 1KDTA 4UNNA 1GVNB 3NBXX 4IDOA 3K0CC 1J70A 3SQXA 1OYWA 2IC5A 1D9ZA 1S3SA 1N6PA 2AD1A 4P4UA 3V7DB 4M1MA 1OXXK 5KTYA 5L8VA 2WHXA 1DG1G 4GZLA 1V5WA 1KKMA 2VBCA 1MO3A 4FN5A 3GFOA 2QENA 3ZS9A 1Z0KA 1N6IA 1FMLA 1TEVA 2FU5C 3WMFA 4DDUA 4YXWA 3FVQA 1O87A 5AR1A 1M7HA 4ESHA 3GFTA 1HV8A 4GBMA 2V6IA 1QBKC 4S35A 3X2SA 2NZJA 1CR4A 2H16A 2P1NB 1EX6A 1Z6YA 2QM8A 1Z0DA 4M0LA 1IN6A 3IEVA 1CEEA 5TVKA 1NMXA 3M0EA 2PH1A 4US2R 3NBZC 2AK3A 1UEJA 4B6EA 1SVIA 1XPRA 2IF2A 1E9EA 3LVQE 3WBJA 1G3RA 2ZSEA 3RSLA 1E1RA 5EUQB 3R9XA 2QA5A 2WWWA 3U60B 2E9SA 1TL7C 1XMSA 5BYKA 1W46A 4C30A 4MKIA 2XNDD 2OEPA 4NCIA 1S8FA 4LYFA 4M9SA 3EA5A 2OBLA 3U7HB 2F1JA 2IYSA 3I72A 2WWYA 2QL6A 1E1QD 1W5TA 1K6MA 1RJ9B 1Z8FA 2PX0A 3QPUA 4A6PA 4HSEA 5L3VA 2WIBA 5KNBA 4OI0A 4FINA 2JDID 1Z29A 1N25A 1AS0A 4LX0A 3VMFA 5K8UA 1N6NA 3TVTA 3W6NA 5A5GA 2CEAA 2D4HA 4I99A 3OGMB 2GJ9A 2X2FA 3N2IA 5TV2A 4GL2A 2IYXA 1TPZA 3AF3A 3SU8A 1GKIA 3WHKA 4TLAA 4UNPA 4NYMQ 4OI2A 4V0NA 1R5BA 3DKVA 2CL7X 1T91A 5HCIA 1P2SA 4F4IA 4D82A 4PPQA 1P22A 3GLFA 4BPBA 1Q1BA 3FYHA 3DHWC 4M1WA 2J3EA 4NL4H 4C0HA 4PQRA 1E3MA 5AJZA 4BEBA 1Z07A 3C8UA 5EQTA 4Z1MD 4OYHA 4IHQA 3AGQA 2DB3A 5HKKA 3BH0A 1I4LD 3WYAA 2JCSA 3U3KA 4DEXA 1WA5A 4BZQA 3AH8A 4I1SA 3QXCA 4IVQA 3B6EA 3KJEA 4C0QC 3GP8A 1N5LA 3MCAA 1A2BA 4FI3C 3PEYA 1TU4A 2ZSAA 4R71A 3I73A 4XD7D 3W8RA 1FFHA 2CL0X 3LLUA 3SHFA 4JLOA 5TMPA 4LHYA 2WWIA 3UXMA 4AG6A 4DLTA 4EJSB 1KK3A 1ZUHA 2PMDA 2RH5A 2WWXA 2YYZA 3ZLJA 4TL7A 4JIMA 4B6FA 4GOJA 5EP4A 3FHCB 4IFEA 3BS4A 1XD8A 4QJ4A 3VKGA 1KI1A 2F3RA 3EC2A 3PV0A 3TK1A 3TSOA 4JVMA 2GDJA 1GRRA 3DDCA 3E2IA 4DB4A 1X86B 3ND9A 1NN3A 2CBZA 3AP1A 3LWNA 1GFIA 1TX4B 4KXFB 1XB2A 4JSTA 1XNJA 4AKEA 2WWHA 3BB1A 4R9UC 3K0AB 1NMYA 1Z06A 2IYYA 2GF0A 3SJCA 1NI3A 1S0UA 3KUCA 1DAHA 2DR3A 4CEHA 2QQ0A 2JATA 3KKNA 1G7RA 1SXJE 4I4LA 5E4FA 1XXHA 2NPIA 2OBMA 2O8CA 4NU0A 1JR3D 1XRJA 3TKLA 2QM7A 1T3SA 3P1JA 3NTUA 1II8B 4MRNA 1U2RA 4F4JA 4LJ7A 2WKPA 4OJQA 1Z08A 4Q7KA 4EUNA 3U3JA 4ZO4A 1XMVA 1VG0B 1RZ3A 4AKHA 4HDQB 4PANA 2A5JA 2DBYA 1SHKA 3BGWA 3OHMA 2WPDD 4OI4A 5CLLA 3B5JA 2QTVB 3FGNA 2VHJA 1PUIA 1Q1QA 3RS5A 4HAWA 2VP9A 1HQYE 3REGA 3TAUA 2WV9A 4DDWA 1W4RA 1G8PA 3K53A 4TQ9A 1CU1A 2P0EA 2P5TB 3LAWA 3M6AA 4A2QA 4GDFA 4O2RA 3I1FA 2AR7A 4DLZA 1FPMA 1FNNA 1OT3A 4B44A 4Q1CA 2XNDA 2ZITA 2V3CC 4KAXA 2IWHA 4G0NA 1TUEA 3THXA 5FPSA 1DAKA 1IQPA 1JALA 2P6RA 4RD6A 1WRBA 2J0UA 4NH0A 1H8HD 3SNHA 1E1QA 3FKQA 1KI2A 4NYIR 2X77A 3AM1A 3ICQB 3THWB 1G5RA 2JDIA 3IBYA 1WE2A 3IQWA 2QROA 1E9DA 2BOVA 3PUYA 4GI7A 4PSKA 4R98A 3FMIA 5FR1A 3DO6A 5LD2B 1KYIA 1D9XA 1MT0A 2YOGA 3RRNA 5KU1A 4MGYR 4DEYA 1VTKA 3SI7A 2W83A 4HLDA 2OCBA 3BWDD 4P31A 2DWPA 4JBYA 3FE2A 3IIJA 4UJ3A 4JVNA 2AFHE 1BO6A 3KX2A 4DUGD 4XVUA 1E9SA 4UNSA 4Q48A 3IILA 3ZS8A 3VX4A 2QQEA 2D06A 2IXGA 4ON9A 3DZDA 1R5NA 4MGIR 4X8LA 4YMUA 5FBQB 1UAAA 1PJRA 1M1YE 3VR1A 4Z1MA 3E5HA 5EE3A 2VP0A 2Q9CA 2IS6A 3GLHE 4I6JB 1M6NA 621PA 4OHWA 4QOSA 3NBFA 4TSFD 3LBNA 1AQUA 2DHRA 1KJWA 1KO4A 4XD7A 3AF0A 3QBTA 2KSQA 2WMOB 3WXMA 4AIIA 1T8TA 3LH5A 4A1FA 2CHVA 4MKHA 2QBYA 1K5GA 2JASA 4AI6A 4B3CA 3VR4A 2BKEA 3OE7D 1YZLA 1GWNA 5UKDA 2RGBA 2Z4RA 1DO2A 4M1KA 2BM1A 4IVRA 1FUUA 1XBTA 1Z5ZA 2ZXUA 3ZH9B 121PA 3BK7A 3THYB 2J87A 1OXTA 3SZRA 1E96A 2AN9A 3MMPA 3CPJB 5L3RA 5JRJA 1NVWQ 3EPKA 1PV4A 1UDXA 1YZTA 3A4MA 2X19A 4QHTA 1E4VA 5E7MA 2ZJ8A 3K0AA 1IN4A 1U99A 2BVNA 2XGJA 2ZVPX 1OFHA 4Z51A 4B3GA 3HU3A 4CRWB 1R7RA 3K9NA 2F55A 3OEHD 4W5WA 1GNQA 4IOJA 4PO1A 5KSPA 3THOA 1E0JA 2AKYA 3KTAB 1JR3A 1W44A 3GQBA 2IEYA 2ZRGA 1P7CA 2P5SA 1XJCA 2G1KA 2E87A 2ZEJA 2C9CA 3CUEF 1KTVA 1RYFA 2IX3A 5JJIA 2UKDA 3F0TA 2CLSA 4DSOA 3QEJA 1GOTA 2ZM5A 4KLNA 3SYNA 4CEIB 1WCV1 3N2EA 1AZTA 1M7GA 4URUR 3B1XA 4LBVA 4HLCA 1E6CA 3QPVA 2O0KA 1E94E 5KSOA 2ZJ5A 3QKUA 5IDVA 2DFNA 3B7GA 4Q01A 1F6BA 2RGAA 2ZRPA 3H2YA 3TGPA 5KSYA 1SGWA 4LHXA 1W36D 2REXB 4WXPA 1W36B 5B2ZA 3CO5A 1Q20A 4B35A 4KHZA 3GMTA 4BFUA 2Q21A 3VKHA 2NO1A 1US8B 1VKJA 2BDTA 4B3BA 3N5CA 4JT2A 2ZJ2A 1FS1A 2V1XA 3UMRA 1JB1A 1SHZA 4S2EA 2XEXA 3H0KA 4WA7A 1MR3F 2ERYA 4B3XA 1J8YF 3PUZA 1W49A 4P0TA 2AFIE 4IOMA 4Y0AA 2NGRA 1LB1B 4DUGA 1NSFA 2OCYC 1U8ZA 3KXIA 4H1VA 5F2EA 2P3SA 4YMVA 2BBOA 3PG5A 2DY1A 4FIDA 4HAYA 4RZXA 4IJMA 6Q21A 2X1VA 4BQSA 2VSOA 3AKYA 5FOUA 2XB2A 5JS7A 2CLDX 4QM7A 1DE0A 1XP8A 4MGKR 1VHLA 4NONA 1NJGA 3IDQA 1NP6A 2L0XA 4KCGA 1QVAA 1DEKA 4C7OB 1IY0A 1KO1A 2O5VA 4TSFA 1G8YA 2ZRLA 5EUMA 4DIEA 1NG9A 3TW4A 1HYQA 1CIPA 1CJVC 2BCJQ 3MJHA 1COWD 2F1RA 2VQSA 3SBDA 3PIRA 4KODA 3TUJC 5IF9A 4TMKA 5F98A 3PUVA 4LI0A 4OKSA 5FUVA 5FTNA 3OE7A 2LKDA 3QBVA 1MRNA 3TE6A 5DH9A 1YKSA 2XAUA 3F8TA 3RSOA 2QAGB 3H1TA 4PHGA 4F38A 1P5ZB 1AJEA 1X8JA 1YJ5A 2OBNA 1GILA 1R6BX 1U8AA 4Q9LA 5K8IA 4QBHA 1W4BA 2ZYVX 3GEEA 3PEUA 4XVQA 2GZAA 2ZU0C 3A4LA 1BYUA 4V03A 3KZ1E 3FMPB 1G7CA 4XWAA 2O8EB 4Q1EA 5SZJA 4AURA 4C0LA 3B1WA 4QNRA 5JHHB 1E9RA 1XWIA 1XU4A 2XJ9A 3QXXA 1ZD1A 4DDVA 2GF9A 2WVJA 2ZANA 4ZIRB 3OEHA 2OV2A 4UJ5A 2F1IA 4DSUA 4UXHA 1G3IA 2AL7A 1M2OB 4OJKA 2G1JA 2VPPA 5FPTA 1EFCA 1D2EA 3QY0A 3PEVA 1Z63A 5EXXA 3W90A 1LDKE 2MSDB 3LD9A 1KI4A 3LQQA 4EJSC 3MD0A 2GCPA 4PZYA 4QGFA 5EP2A 4B75A 1D8TA 4UKDA 4LYHA 2NTYC 1G7SA 1DAEA 5CDFE 1UF9A 1JXMA 5LBIA 1XTQA 2CHQA 4CEIA 1KI9A 5ELXA 4RD0A 1W2GA 5FBLB 1FL9A 4BLPA 2YKGA 3ZQ6A 2NO0A 5IBKB 1KZ7B 3GLIE 3NH9A 1QHHB 5CB8A 5BXQC 1R0ZA 1G4AE 4C3ZA 1KMQA 1P4SA 1QHXA 1VMAA 2C2HA 1SVOA 1WMSA 2Q9BA 3NXSA 2VF7A 4Q00A 3W9YA 1S1MA 2WBLC 1KMHB 1RW4A 1S9HA 1YZGA 1ZU5A 3OIYA 2VL7A 3IHWA 2W2TA 3KFVA 3TMKA 1E2KA 2WKRA 1G21E 1R0WA 1ANKA 1U81A 3AEZA 2C77A 2YHSA 2RCNA 3LNCA 4OHYA 1DAGA 3PXGA 2D3WA 4FCWA 2OVQB 3IGFA 1B23P 1G3MA 3K0CA 4E03A 2MSCB 5JCZA 2A78A 3U7EB 5IRCD 5CJPA 1XDBA 3BIFA 3DKPA 4M1OA 2VA8A 3W5IA 3VKWA 4DC9A 2IBMA 4GOKA 3VR2A 4KLZA 4Q03A 4B47A 4G01B 2ZE8A 4PC2A 4DB2A 3ZDQA 1XEXB 3U44B 3L82B 5B58C 5P21A 4NHOA 2J59A 521PA 3NDBB 1F60A 2BKUA 1I4DD 4QM6A 2R6AA 5AUPB 3OIWA 3FDIA 1E9CA 4C7OA 4BFYA 4TL6A 5FUWA 1QZXA 5FTLA 4RD4A 3GD7A 1ZINA 2A30A 1IY1A 3T1VA 2BC9A 3W34A 1F2TB 3B8HA 4MYHA 1U0JA 2VRWA 4PC3A 1COWA 2C9YA 2DFKB 2GXAA 2HXYA 1YZUA 2ZI3A 2OLJA 5LD2C 1KI6B 3W3AA 2XB4A 4EPTA 4L16A 1R10A 2YVUA 5EE9A 1AKYA 3B1ZA 2QAGA 4B43A 3SS8A 5J4LA 1W47A 2LCFA 1E0SA 2WJJA 3BH6A 4QKQA 3QVUA 2TMKA 1NY5A 4DT1B 4HB3A 5DHAA 2WKQA 2BHRA 2HV8A 3OGKB 2XTNA 1E2HA 4LK2A 3V00A 5A0FA 2O8EA 3WSOA 1XTRA 2Q6TA 2RGGA 1NIPA 1EWQA 5J4YA 1TADA 4TL8A 5TY0A 1CXZA 2H8KA 3B13B 4ZIRA 4TYYA 3EZ2A 5FFMA 3X1XA 4QJ5A 4HLUC 2RGXA 1BH2A 2ZRFA 3GLGE 3B9PA 1TTTA 5FI0B 5KO2A 3MWJA 3CB4A 2PJZA 1D6JA 2EQBA 3W6PA 2GEDA 2Z6VA 2H17A 4BFXA 2IWRA 3EPLA 4D4LA 4ZKEA 3WBKA 1SULA 2ERXA 3WMGA 1J2JA 1E9FA 3T5GA 5AJYA 3C16C 1E2DA 3X1YA 4YMWA 2DPXA 1OB2A 1XD2B 4Q21A 2GKSA 3BE4A 2CE2X 2AWNA 2IYZA 4BRUA 2P6UA 1F3OA 2GRJA 1CRPA 1YU9A 4MRVA 1W2HA 4TMWA 3X1ZA 4NBSA 4RZ2A 4FWTA 1J90A 3VHXA 2G3YA 1YR8A 1GSIA 2KE5A 3LBHA 2FFAA 1CS4C 2H1LA 2VF8A 4HATA 4N0DA 4MRSA 3EZ6A 3A1WA 1Z47A 3GJ7A 2GEVA 2OESA 1KDOA 2KB0A 3KFXA 2PZEA 4V0ME 3LY5A 1UJ2A 1ZUIA 4WZAE 4DCUA 4KYIB 2GK6A 3K9GA 3ZZUA 2ZJBA 3GEHA 5FOWA 4LV6A 1U0LA 4TQAA 3OIUA 1II0A 2C98A 2JLRA 4FW9A 1AA9A 2D7DA 4B71A 3CH5A 5CB6A 3QXJA 1R4AA 2EU8A 3QF7A 3X1DA 2CLCX 3I61A 4A36A 1SVKA 1E4YA 4HB4A 4QGGA 1FQKA 1JEDA 5L3SB 3KJHA 3U44A 1CF4A 4LV8B 4EFNA 1TNDA 1NBMD 3WHLA 1KY3A 2HYIC 1Q21A 3EASA 1B0UA 4MYUA 4HUQA 3TR5A 3AVQA 3B1YA 5AWFC 3K1JA 1G19A 4TYQA 1LNZA 4M22A 2VP5A 4TZ6A 3LV8A 1W36C 2RGEA 1ZM7A 4LY6A 4DJTA 1LF0A 4HDCA 5EXSA 3TQFA 1CLUA 1BKDR 1T4GA 2PJRA 1F2TA 4V0LA 4PC6A 4MDFA 4ARZA 2P1PB 2JIZD 1FZQA 3A8TA 1Z2AA 221PA 3K70B 4PC1A 1KI6A 1NVXQ 2XX3A 3TLXA 4BLQA 3EIHA 4RKFA 4DSNA 1P62B 1XTIA 1ZM9A 4Q9HA 2FSFA 3QSYA 4CEJB 3B82A 1OV4A 1ZM4A 2ODNA 4HZUA 1TQDA 1KHTA 3RAPR 2WICA 3TQCA 3VAAA 4EQ6B 4JSYA 2W58A 5K8LA 3JZMA 1CKEA 4DCVA 3R7WB 2FPKA 1FNMA 4DT1A 2VYFA 3UANA 4AD8A 4JJKA 4TYWA 1E69A 2QE7D 3K09A 2G83A 1IY2A 5E95A 4HAUA 2OCPA 4NMMA 3ZVMA 5G53C 3FB4A 3RANA 3Q5EA 2ZE5A 3NWJA 2WOJA 3O8BA 1KNQA 3C5CA 5JI3E 2ZS8A 3CM0A 4D4MA 4KI0A 3MUFA 4ZDKA 3SJAA 2CE7A 3A6PC 3IO5A 1JPNA 3A58B 5TARA 3GLFE 3AUXA 1Q3HA 3D8BA 2X8AA 3EAQA 3GJ8A 4MRRA 5ANRB 1U8YA 1FMJA 1HQCA 5CM8B 2HJGA 1XJ0A 2QAGC 4LJYA 4CT4B 4U5XA 4B76A 5B57C 3C6PB 1GITA 5JSZB 4L9SA 5LDDC 1OH7A 4ASUD 1F5NA 1J99A 1IOZA 1YZNA 1DAFA 2REBA 3FPAA 3ZQJA 2V1UA 2BJWA 2PEZA 4LBYA 4XH9B 1OH5A 1EFHA 2B92A 3BD9A 2WTUA 1BS1A 4LGMA 1E2PA 2GXSA 2O0HA 3O8RA 2ZYTX 3DMDA 5CYOA 5BN5A 2R62A 1SXJB 2ZIAA 4QFMA 4NE2A 3SR0A 3WNBA 2QPOA 4GZMA 4D0NA 1RC8A 4B3DA 1RPZA 4RFSA 5D3QA 5FTKA 2VSXA 3GJ5A 4HAVA 1Z2CA 5HZHA 4EPWA 2D2EA 4ACAA 2AK2A 3M4YA 2YV5A 1HT2E 1ZD9A 3CNLA 2QRZA 4V0KA 2UZIR 3SC3A 1SZPA 5KOYA 1ZC3A 2BMJA 4TWZA 4PPGA 1NY6A 3I8XA 4OQFA 1JPJA 2CHGA 2A5FA 3UK6A 3D3QA 2BEKA 2R6CA 4KO8A 2ZJOA 3U4QA 2IYTA 4JYCA 2IS2A 1E99A 1NLYA 3EX7C 3Q7PA 2GJSA 2VP6A 3GCGA 4JVSB 4AC9A 1PUJA 1XXHE 1UBFA
chains in the Genus database with same CATH superfamily
2HBRA 2GEUA 1B6GA 4Y2QA 1TIKA 1NBMA 2C9OA 2YWRA 5H81A 3T7RA 1X8XA 1NYTA 1KEPA 1TT5A 2H6EA 3VVCA 1N5OX 3S2FA 1GQQA 4JFRA 4CM8B 2G0AA 2AQKA 4G2NA 1T5LA 1XDGA 3BUSA 4C43A 3PNVA 3QWBA 4N7MA 3UB3A 4Q7JB 2QTMA 4BLVA 2JLVA 3WK8A 2FB9A 2PFGA 2PK3A 1YUBA 1IZ0A 5T41A 4DKXA 1O4VA 2WOOA 3WGMA 2QL5A 2R87A 1KOFA 1DS6A 1MAAA 2B69A 3ADKA 1LS6A 1HDYA 1JF8A 3LLVA 4OHXA 1X13A 2P9CA 3M7IA 2NUBA 2M1ZA 5DI3B 1OXVA 2GN6A 4CFZA 3R3WA 4BAUA 2VQ3A 1RYHA 2B82A 3E7DA 5L6MB 1NFRA 3AL0C 2QAJA 5DN9A 5FLKA 2AXPA 3G3EA 3JATB 1MKYA 2YY6A 1FDOA 2P69A 4LJ9A 1U80A 4MJLA 1FFDA 4ZGGA 2A33A 2Y1KA 3O1HB 3M6IA 3OQBA 1LGYA 4NQZA 3V8QA 5B2EA 2UVQA 1XT6A 2QD5A 5IKOA 3AF4A 2VHTA 4HX5A 4JJ7A 4FSHA 3BWMA 3QU9A 1BH6A 2XMZA 4K28A 4W9NC 2PKQO 3EXHB 1XQ6A 4JZKA 1ZR2A 4LCBA 3OT1A 1M5UA 1I3MA 2QE7A 3DYBA 2Q62A 1L7DA 3GLHB 3FPFA 3K0SA 3IT1A 3SBOA 4YRSA 3B48A 1CFJA 4NDNE 2XZLA 3WB1A 2B78A 1CQJB 1UP7A 2WY2D 5EZYF 4EPYA 1RP7A 3PWZA 3MS2A 4HDRB 3COPA 3IKJA 2RHDA 2QX8A 2ZQ5A 4KHSA 5U4XA 3UYLA 5F2NA 1C9MA 4YAOA 4ZCMA 4GR4A 4L0CA 4NJOA 1E4EB 2Y1XA 4YWJA 4KR6A 3HJTA 4X93A 4QG3A 3ESYA 1PT8A 5BNZA 2GD2A 2GEJA 2M2IA 4DGSA 3I2GA 4Z3KA 4U5QA 1PZFA 4KGXA 2XZTA 1FFXB 1NUTA 3C3AA 2VK1A 5JSZA 4EUEA 5DIFA 1YJCA 4B6GA 4DLVA 2OKCA 3AJ8A 4P35A 4RY0A 1PYOA 3UJ6A 5JS1A 4OQMA 1FBTA 1LSJA 1T9KA 3D8NA 5FJJA 3DT8A 5G4KB 3P97A 1DFGA 4NAUA 4UUMA 5U1PA 3DGEC 3BKXA 3RYHB 3U9LA 2EWWA 3W6NA 5B57C 3G2LA 3MWFA 4PLTA 4QVIA 2FSIA 5AKXA 4MARA 4UAJA 4C0SA 3ZGYA 4LJAA 2VDVE 1JG1A 4LYEA 4MVJI 2VIXA 2GLTA 4MLZA 1ZK4A 2RHRA 3DW3X 4NULA 3UYKA 5JD6A 4W5NA 1VCNA 1W25A 4Q15A 5C1BA 2CJFA 1N1MA 3BHNA 2ZCJA 3NP7A 3L7IA 3GUVA 2CZQA 1V1MA 3QNUA 2C3PA 1CZRA 1TT7A 2AJDA 3JALB 2VH2A 2G8LA 3DV9A 2I6QA 3UNXA 1AGPA 3EY9A 2V4ZA 3JQDA 3OE5A 2QP9X 3OD5A 4KP7A 1L5KA 1BCSB 1KFKB 3OLYA 2PUGA 3T52A 1IG9A 2JFPA 1V35A 3DXXA 4BJ5A 3T7KA 3MWYW 5J1SB 1N2OA 4R1PA 1Y9AA 3WP0A 2H2HA 3RO7A 2AI1A 1P7ZA 1DVRA 3NAEA 1LBQA 2ZWMA 1HE2A 4D3SA 5L51A 5BWLA 3OEED 3V1KA 1V43A 5IARA 3BAFA 3NWBA 2I6SA 3A9VA 3OLXA 2VJDA 4G5SA 3I01M 1M0TA 1NW5A 3GRAA 4KUEA 4XD2A 3T3PB 2CLFB 3CNNA 3WWOA 2CKDA 1KFJB 2AEMA 5F76A 1YRLA 3FFBA 4O4HB 5K4HA 1KORA 3ZHZA 4ZAZA 4C3UA 5JAUA 4YASA 2Q7DA 4PW0A 2CMHA 1ZGHA 1YOVA 2F9FA 4KE6A 2Q0SA 1ES9A 4GOMD 2C3YA 4JLJA 4OYYA 3TRDA 4DSTA 3CEPB 4IT5A 4TWJA 3BC1A 4HMQA 4HN9A 5ALXA 2PZLA 4DOMA 2HJSA 1QLJA 3Q88A 1XROA 1KTIA 1CJKC 3C6NB 3FCCA 3AVVA 1J0AA 3N0WA 4DCCA 5AUOB 4JN6B 2B25A 1FMCA 4M0UA 4OO3A 3PJRA 1UBUS 1V5EA 2TRSB 3AWDA 4AMGA 4PBRA 6YASA 1PZNA 2EJCA 4F3TA 1A4RA 2O1EA 2CVFA 2IUFA 1NV9A 2VTKA 2AFIB 4RJJA 1TJYA 5FUYA 4DQXA 4DSAA 3ME5A 1WCIA 3KQNA 2V97A 3G2KA 4GU5A 3ISJA 4KVGA 4AN4A 2VQEB 1S02A 4Q16A 3UJ7A 5DTIA 1EKXA 4ALMA 1W0JA 1GG8A 1RQRA 3L05A 3NHPA 2BH2A 3R8FA 1PZXA 4QXMA 4ME6A 1TM3E 1A8QA 4K9KA 3HWRA 1LQ2A 1NF8A 4YC7A 3RU3A 4DMKA 2FG5A 1DKMA 2O2DA 1PFKA 1KF0A 3MQ4A 1OILA 4LNUA 4NBTA 1XZ8A 3OQJA 2K87A 2Q46A 3JVDA 3TF5A 1X2EA 5K1ZA 3AHCA 4OU5A 4KEAA 3V8PA 2F8SA 3L79A 3UA3A 3RUPA 1IPEA 3TEJA 4EMUA 1GNRA 2FY8A 3DMYA 1WUIS 4X1KB 5JO9A 1PR6A 1ZOIA 4FCTA 4IJWA 5KYVA 4H6WA 4CTNA 4Z4EA 3AESB 5KS2A 1QS0A 4CMKA 3LVBA 4ZVVA 3K6KA 2BWJA 3B9BA 3RC7A 4ER6A 5IJ9A 1XZFA 1I5RA 1E7SA 5KNLA 4ICGC 1OIWA 2C3MA 3LG2A 1P2VA 1QF6A 2GZHA 1VIDA 2CDNA 1GKYA 4FC6A 2V7QD 4BC1A 2P30A 1JSXA 2RI0A 2ZSDA 4LC0A 2XECA 3C4QA 3I9MA 1ZP6A 2OCLA 1ZJJA 2Q5QA 3UPTA 4F11A 5IU6A 2JIMA 2X0FA 4OHZA 2XMSA 5HCNA 3WGJA 3AEKB 3WGVA 3NJRA 1EK5A 4BFVA 4ETMA 4X5MA 4RKRA 1P5RA 1GZ7A 4ROSA 3UXHA 4D4GA 4QODA 4G85A 1GPKA 1O77A 3PKJA 2MHCA 1WV0A 3C8MA 5F52A 3TI9A 4QT4A 5BRJA 5JJ5A 2O3QA 3VNVA 3AV3A 4GXNA 2QY9A 4X6UA 4EBBA 1YO6A 3MCUA 1XTUA 3FZQA 1R2QA 2BH9A 2IUEA 4QGHA 1J8FA 2HDHA 4J76A 2P4QA 1NUPA 1VYTA 1RWMA 4AC9A 1NULA 1YMQA 2V0CA 3BHJA 1XZCA 3C97A 5J47A 2YB5A 1G64A 5FNVB 3IAEA 4XZ3A 2C1XA 2CXUA 4OU4A 1CJUC 3CQ8A 2GAOA 4Q9DA 4IOKA 1U7UA 2NQ2C 4UNIA 1G8FA 3B5IA 5AI0A 3SS7X 3N8HA 4MXDA 5CDTA 4M4SA 5CJJA 2F4VB 2C2YA 2XCTB 2VHCA 2ID9A 4DLRA 1O4WA 1W9MA 1QJCA 4J2BA 4CFYA 4BMNA 1FNBA 4C0KA 1VKZA 1GQFA 1J8QA 2ABWA 1LLUA 1E1YA 2WDPA 4ZEMA 4I66A 1GGNA 3LLMA 4CI0B 5IZCA 3BFVA 3ZD6A 1LY1A 2OCXA 3OMWA 3M70A 4AUEA 4BFTA 2IOQA 2XXJA 2ZR0A 4PPNA 4DZZA 4FFVA 2Z2ZA 2Q5OA 3N07A 1KY2A 2C0CA 4FVTA 3A32A 3IUBA 4ABTA 4XQGA 2AVDA 2P40A 3UJ9A 1MX9A 2IS1A 2Q1XA 2W2VA 5B3JA 4CF4A 4AYTA 1KETA 3CG4A 3P2EA 4X7BA 5T3YA 4H0NA 4NCAA 2WTNA 3T7TA 2Z08A 4ANFA 1EUDA 2BDUA 1J00A 3U40A 1SXJC 2IT1A 2PFSA 3Q3GE 4PSCA 2H1VA 5IH7A 3T3NA 1E7MA 1JPVA 2FPPB 3ISVA 4TMYA 4EW3A 5K4GA 2R4QA 4QPPA 3LQFA 1WQ4A 3OJ0A 4YRCA 3ZHTA 5C7LO 4KHYA 4HWPA 1RRMA 1XZJA 3L1KA 2HBYA 4KPUB 2O0MA 3COZA 4HWGA 4DY4A 1PZMA 2ZRQA 5CFZA 2MMBA 1GZSA 1W76A 2G72A 4YWHA 2QN3A 2X6RA 2DLNA 5ARBA 3FN4A 3AVPA 3ND7A 4UVDA 4Y9TA 1GZVA 5JXHA 3CPHA 3S81A 2TMYA 4HR7A 4Q7LA 4X1IB 2Y0EA 4MS1A 2QT9A 1PKEA 5C8YF 3CFYA 4GWLA 4TKUB 4XFJA 2OFWA 1W35A 1LFAA 1U28C 2ET6A 3P26A 1CEXA 1L7MA 5CNMA 3WRVA 4EHDA 4JXZA 4RHYA 2FH5B 2O8NA 3S9HA 4CIBA 2X9NA 1O8BA 1E1KA 4PLPA 2GVZC 2XVXA 3LHFA 3BCSA 4J29A 4UNQA 1W4CA 2HT6A 2IOHA 2H57A 3ROTA 3BX1A 2AMJA 5J4HA 1OZAA 1BMFD 1BGXT 4BX2A 3UG7A 1X3SA 2PUHA 1N34B 5EZ6B 3AVXA 1KO7A 3QMWA 3E27A 3EFOA 3HN2A 5F1KA 4A10A 4A5SA 1P72A 1ZVKA 3DC2A 4QTTB 4DJFC 1IQRA 3TB4A 4DCGA 3RMCA 5JAIA 2LE0A 1J4AA 1ESEA 3GU3A 1NA5A 4I1RA 3I5YA 4L9AA 4DR7B 4ZODA 2OFFA 4GVLA 1NUUA 1I0ZA 3GVHA 4JNCA 4OK6A 3EIUA 4JI3B 2WAXA 2IEAA 1QQAA 3AXSA 4GKBA 3G7UA 3GWZA 5AJTA 5BO5A 3UC5A 3FFWA 2ZJ4A 1X8LA 1SRRA 1BOFA 3MT9A 2V9PA 4Q9JA 2N1MA 3ACBA 2HRQA 1W4AA 3IQDB 5C53B 1NXWA 1G5HA 4AYXA 1TYEB 4LECA 1C7ZA 1YHNA 4FFBA 2LR0A 3M8KA 1UBGA 2QM3A 1JHOA 4W5QA 4P83A 5AM5A 3VC3A 4P7KA 2M6LA 2OCGA 1NVGA 3CR8A 2YV4A 3EA4A 4HGPA 5SYNA 4D9JA 1US8A 2J6HA 2JD0A 4KIGA 2XUHA 3W5BA 4QU8A 1T2CA 1Y5NA 3AP2A 3VYVA 1NWHA 2WM3A 3IQXA 3VZPA 4RDIA 1T1JA 5ETJA 2L42A 4GLFA 3TLGB 1VYHA 4F46A 3LUFA 2BHNA 3NJ4A 2XCQA 2YASA 1MF7A 3ILXA 4QDKA 1GDDA 2VLBA 1K8YB 4BKQA 4D6YA 4LS3A 2YDYA 5LQRA 1O0SA 3OJLA 1OBFO 2P3QA 1JIKA 2WJHA 1F17A 5CLIA 1DXQA 2K7ZA 1R37A 2PG3A 2VUTA 1DAPA 3GAZA 3PNBA 4TSRA 4UOQA 1NL3A 3IAM1 1SNYA 3OZDA 2ST1A 2XUDA 3DPIA 4G5OA 4R5HA 2Y71A 4ZHSA 3DZBA 3HDTA 2D1YA 1NDHA 3D9QX 4JJFA 4O2AB 1EBBA 2JFOA 1YQUA 1OREA 1O94D 2J7PD 4N8DA 3ZHCA 5IREA 2Y0CA 1LRJA 4QGAA 3TAHA 1ESMA 1FNSA 1YONA 3CKLA 4AK9A 2OG2A 4KQIA 3U4GA 5LUAA 1DPGA 3DBOB 1L4HA 3G02A 1ZYUA 2RONA 3ORRA 2IHKA 2V8BA 1KOLA 3CH4B 3E5NA 4EG8A 1TCBA 4PTLA 1XVDE 1BCRB 2QPAA 3MCWA 4HNTA 2VK4A 1T8UA 1YE5A 4BTVA 4IVPA 2XMRA 1NRXA 3RC2A 3ZZTA 2YUIA 3K35A 2FP4A 5J5CA 1LDGA 2Q5JA 3EIEA 4J49A 3W77A 2A94A 4X8OA 2WFAA 4JI2B 4O2BA 3A1FA 3R3JA 1L4UA 3VPBA 1XL3C 4UPVA 1LCIA 3A1EA 3DNPA 3JYPA 3Q5DA 2WA2A 4JMPA 3PR2B 3WKEA 4EK9A 4B85A 1WCYA 2INGX 2JA2A 2PIAA 1HUQA 4LZNA 3R4VA 4N8SA 4F93B 3K6JA 1FLNA 4C7VA 3ZYCA 4H1WA 4UATA 2B8NA 1MHYG 3KV1A 2JFWA 1MOQA 3WQRA 5ICMA 1E79A 3FVWA 3RFXA 5GZ3A 3IIIA 4P58A 1R88A 5EJ8A 4IRUB 3T12A 2B7CA 2VRNA 2GCNA 5JQGA 1Q17A 4JXJA 3PJEA 3IMKA 4KYTA 3JQPA 1Z5UA 2X4DA 4E6EA 1PK8A 4ZQEA 4EL0A 2GQ0A 1SY7A 3KJQA 3H11B 1J0DA 1E2GA 3OCCA 1D7OA 1G9XA 2WSLA 4G5FA 4DR5B 1H23A 1T2VA 4OHVA 2WJZB 3RAGA 1IPHA 1Z0JA 1SAYA 3Q41A 5EC8A 3KL4A 4TLDA 4UULA 1XKLA 3KIPA 3KZOA 2RIPA 2ZYWX 2GTPA 3BL6A 1UL1X 2NU8B 4IIHA 4OLBA 1DDIA 3LF1A 3W6ZA 4ZCRA 2VJNA 1Z17A 3BSWA 5K0ZA 1TM5E 3FBGA 2X0DA 4A7PA 2R6ZA 1E3WA 2OENG 5HGJA 5G0WA 5JMTA 2RGDA 4G5QA 1UDBA 3ECCA 2XSZD 3RSGA 1EUYA 2X58A 1D1SA 2OZEA 4C20A 3SX0A 3IQHX 3JQBA 1KE1A 2VLIA 3KQMA 3UPDA 3LHIA 3W5SA 1EE9A 1UAGA 2AE2A 3GDHA 1ZRMA 3AT1A 1N6KA 2AOWA 2QQFA 3V7WA 3QFSA 3OEYA 4C0JA 1RXSA 2TS1A 2WB2A 1AE1A 2EP5A 5CXSA 3GLQA 4MW9A 1E1LA 3B6JA 1N7IA 4EHHA 3JZIA 3RVBA 4YACA 2WA1A 3ECAA 4KO1S 1Q92A 3RW9A 4IUDS 1XD9A 2P5OA 1Y4DE 4LYJA 3BK1A 1Q3TA 1UKYA 2G08A 2FEWB 3ZBTA 1HGXA 1WXQA 2H92A 3OAAA 1T8SA 2QVCA 2XXAB 3R23A 1DC6A 3P19A 5KNBD 1N4AA 1YR1A 2WJYA 2D5LA 3FFAA 1P7PA 3PFKA 1RJGA 3LP5A 4R05A 5EEGA 3NT2A 3PGLA 4FHDA 2DR2A 3PIIA 2CLLB 2JCBA 3UMFA 1X1SA 1E8NA 3Q8XB 2V6JA 4P80A 2EW1A 2Z9BA 1R5OA 1X14A 1YS2X 2XQFA 3PYXA 2BDEA 1DP4A 2BFDB 3FMOB 3EZYA 4X1OA 4NWIA 4DUYB 3DP7A 4U7HA 4QYSA 4FJNA 3M6VA 3UTDA 2ACVA 2ISSD 3T5AA 1TLTA 1YQTA 2WABA 1RHMA 2RGUA 2W2LD 1CJMA 1E7YA 1D2AA 5FOXA 3IV7A 3H3FA 4JKIA 5KYYB 2XB8A 3MJRA 5C4MA 3H42B 2X5JO 2K7FA 1OMOA 2C00A 1Z37A 4N40A 3DAPA 2YN4A 2WJ4A 2PKWA 2WHRA 3V7NA 3CX8A 4F3YA 1MENA 4FYIA 1ZJYA 5L3QB 4XGQA 1KR2A 2BEVB 3M49A 2H1FA 4JLWA 3BG5A 3FVTA 2P7HA 2PUFA 4DA4A 1GYQA 1BSVA 4YN3A 3UN1A 1PW5A 1JSLA 3UATA 4CU2A 1T4BA 3NVKI 4E2XA 1ID1A 2E82A 4V38A 2VATA 5CAEA 4EMSA 1ZK1A 1H2EA 1Q77A 1YD7A 4GBGA 1P8AA 4JOBA 5DYTA 1EEHA 4ZAXA 5GY7A 2C2GA 3L49A 4ZOCA 1U1GA 1YI0A 2NIPA 4NYJR 3VPXA 2P8JA 3CE9A 1SVSA 1X1QA 1C1XB 3DR5A 4MPPA 3PXAA 3NCTA 1UANA 3FNQA 4IMPA 1D07A 2JGDA 3EG5A 3HCFA 4GQAA 3VYSB 2FYOA 3PWKA 2J5BA 3C7CB 1L7VC 2H48A 1D1TA 3P45A 1GG2A 2ZRDA 3QY9A 1J1ZA 1IY9A 2WIKA 3V8VA 2A0XA 1N9GA 3O21A 4P22A 4UHFA 4LIPD 3L8EA 5ALJA 2WYHA 3L7YA 4IWNA 2EJUA 2W6CX 3SFZA 2RGRA 3SBXA 3RKRA 1TYDE 3SVLA 4E2WA 1ZNQO 3QPDA 1ZCBA 1WQ3A 5LJLA 2I1WA 3KQWA 5K0FA 2JARA 5EE5B 3ACDA 3FPCA 2PT5A 3CT4A 4ZCPA 1WPXA 2GD0A 3M1IA 1FP4B 1PHRA 3AFNA 1KEZA 3K0HA 4JB3A 3G5TA 4NCKA 1KYWA 2X0RA 4GM0A 5LPNA 1FP1D 4UPEA 1DWPA 2X15A 1E3JA 2ZATA 4CIYA 4KNVA 2FEMA 2BBTA 4MTLA 2BGKA 2P3OA 1UR5A 1L1RA 3I9FA 4Q18A 1HA3A 1NPDA 1LDYA 1OYYA 4NFLA 3QYJA 3Q2IA 3BJIC 2XHEA 3FNFA 1FQOA 2CJWB 3AHFA 3DCIA 3S4YA 5CA1F 4PNHA 1KEEA 1JQEA 2WU0A 5ER9A 4E5DA 1Y8QB 5BR4A 3SJUA 4O2LA 5FLXA 2HLHA 4Y2YA 1FIUA 1CS0B 1BG6A 3T54A 1FYFA 3GZNB 5JDIA 3THXB 5ER6A 5CMLA 1RADA 1IFXA 4L0QA 3ILHA 1DBWA 5AT1A 3RYIA 3RWMB 3IEUA 4MUXA 3MW8A 3WLQA 1JMVA 1OGYA 2CVZA 2EBHX 2FW9A 3CIFA 4R7TA 5GM1A 1Q7RA 4OI1A 4EI9A 2VTVA 2B1QA 4FFPA 4UBNA 1VYUA 3U7QA 4Y2PA 4FEEA 1DJPA 4BKMA 4HAZA 4CM4A 1Z88A 3VPAA 5CB0A 2BSQA 1TUIA 1S9DA 3KTOA 3PICA 4IDNA 4C4PA 1ZUNB 4WHMA 2A4MA 1PDOA 1XUOA 3HFRA 4GWGA 1WZIA 4TRMA 3OTOB 3FOFC 4M53A 5JDCA 3NYQA 1NRWA 1JG6A 1N2EA 1WZNA 3I8SA 2FHSA 3OZGA 4U2BA 1UIRA 3EG9B 1TU3A 4JYAB 3D3EA 3ZEIA 4H77A 4L6AA 4R1UA 4FGUA 3D59A 4FGKA 4G81A 1CVIA 4LRTB 3RBZA 5EZYB 4EG7A 5F3DA 1QP0A 3KM0A 4BO5A 1KWKA 2OQIA 2WAOA 4YK7A 2ZUWA 3O9MA 3FOZA 1ORIA 1XLTC 2BIFA 2SBTA 1XQ9A 5MN5A 2NTEA 1D2GA 5IN5A 2JJQA 4ZI3A 2DCMA 1W7AA 1ML4A 2WMNB 5KYXA 2G70A 1LS1A 3DM9B 3SMVA 2PYDA 1NC3A 3HYLA 1L5HB 3F71A 1RJEA 3FWYA 3QW2A 2J0QA 1LLCA 4Y9SA 4ZCQA 3WRYC 1EQAA 1RD4A 1L7AA 4PG5A 3ETGA 3K1YA 1GVHA 4WW0A 2J41A 3F8WA 3JZDA 3SN6A 4LF9B 1WULS 4JL5A 1Z25A 3HRKA 1Z38A 3HY4A 1AXRA 4MP8A 2ZS7A 2P1QB 5FBHA 1QONA 1YS4A 1Z15A 4AJEA 2XCSB 2CEKA 4YUXA 1C2YA 1MHPA 1R5JA 1C8LA 3AYZB 3LIIA 3HV2A 3L0ZA 1N3IA 2JCGA 4OSPA 4D3DA 4DF3A 1OLSA 1DQPA 2AOTA 2XTZA 3H1GA 4PRZA 2ZBRA 2HIAA 4E32A 2Q45A 2W2XA 3RRZA 2OHIA 1II9A 2B83A 5DM70 1Z4LA 3KV3O 2XMQA 2YZ2A 1KEKA 4DTOA 3RS3A 1AS3A 2YDXA 4BO1A 4C05A 1OWMA 1O6FA 2DH6A 2JGKA 2IUSA 3AUKA 2XT9A 2OC4A 5KTNA 2P11A 4EITA 2GRUA 1AQ6A 4MYTA 1KJNA 2AKEA 3QU5A 1IZ7A 4G26A 4PZUA 4UQOA 3A9RA 3NEAA 5FBWB 1XDZA 3ANTA 2Q6LA 1YDMA 3SNKA 3D5TA 4XIFA 4L1KA 2LKCA 1NZJA 3F6CA 4YX9A 4QYIA 2CFSA 5DM0A 3DM5A 4UFOA 3F6SA 2NVUA 1T3TA 4I3HA 3TL8B 1NG1A 2G5TA 2YVAA 4ZI5A 1WHTA 2OQ2A 2VJCA 1IAQA 4KO4S 2RJ3A 2X4GA 2W0MA 3WMEA 2DULA 1WQ1R 3HP1A 4JA0A 3ZTYA 4CMIA 4B3FX 4D46A 4LPSA 4QAQA 4WMLA 4RA9A 4RQUA 5BMVB 2FJUA 5FI1B 2ON6A 3MT7A 3AI2A 4P7BA 3U62A 4G4SO 1A96A 2YTZA 1JEYB 4LOHA 2H07A 5CT5A 2ZWVA 1QGYA 2QTFA 3KR0A 2B3DA 5FI3A 3KKEA 4HCJA 3C3WA 4NPHA 1VLQA 4U9HS 3JQ8A 1H1TA 1ZIPA 1OQAA 3QELB 4CDNA 3PF9A 4CTJA 3VV3A 4W5TA 4CJXA 1ZNXA 4EY3A 2WFLB 5CBPA 4M1EA 1GA1A 3U3DA 3LZ6A 1QQBA 2O8VA 4N7BA 2X5KO 1YHYA 4MVJG 3NO4A 1OXUA 3GQVA 3HGTA 2Q3LA 4BNUA 4E11A 4Q1DA 3O83A 2ETVA 2X4LA 4GPD1 1XVAA 4JH0A 2EIHA 5A02A 4JI6B 4LN1A 4ILKA 4ZV9A 4O4JF 2Z5LA 1R8XA 1K0FA 2VDQB 5FHQA 4B7CA 3PCTA 2OXIA 4YJ2B 5JI2E 5B6PA 2R8XA 3H1BA 1NLZA 4GOLD 4NS1A 1KERA 1HLGA 3RK4A 1X9GA 4ZAVA 3INYA 5H3LA 4U4AA 3ANLA 3PTZA 3HU5A 1GSHA 2L18A 4UU8A 1I2DA 1OFUX 2VNAA 1KAGA 3D1JA 4XWOA 4NCBA 3T5CA 2MSEB 2PCLA 4OJTA 1S2IA 2I4OA 2QGZA 2XF2A 1QJ4A 1RNLA 2IXFA 3PI6A 4BBAA 5JNUA 1Z26A 1FBNA 1T35A 1X42A 4CLHA 2FE4A 3BVPA 3SEAA 4A8JC 1EFDN 1JH8A 1KNXA 2FSSA 4NTZA 2Q2NA 3QENA 1G41A 3EVGA 3PR3A 4UUBA 5FPKA 1UBTS 4QDZA 3PRKE 4G4GA 1V4NA 3VR3A 3HB5X 1SKMA 1RQXA 2RHGB 2HDWA 2R3SA 3LUBA 3FHTA 1TEXA 3H5WA 5DI3A 3RARA 2VDWA 3K0EA 1JIXA 1HI9A 2AA3A 1X7ZB 4YDHB 3RVOA 2XHZA 1XIVA 5LKRA 5JW6A 1C80A 1URPA 3JATA 2AFHA 2ZT5A 4ISCA 4I1IA 2DAPA 1YRWA 1AZSC 5K0TA 3EGDB 2Y4OA 2NUAB 3ND8A 4DMGA 3WLHA 1XO1A 4QBFA 3PJFA 3REFA 4RHXA 5F12A 1IJBA 5ALHA 5I7VA 1WVMA 5LXTB 2OZMA 5KYGA 4EKIA 1G2QA 2YCLA 4ZYWA 3FWNA 2VWQA 2ZP1A 3R3SA 5DLQC 3GLHA 4EG3A 1ZOSA 4GC9A 3KC2A 1GIAA 3B9RA 3ZZ1A 2QU8A 1CQZA 1CQJA 3DSRA 3AHHA 3W05A 4MDEA 3ROQA 1VPLA 4H3KB 4RK0A 4X5OA 3K1ZA 3CA8A 1YS7A 3FR8A 1WS6A 2G5GX 2XD4A 1PR0A 1NR5A 3JD1A 5CFPA 1X94A 2WUDA 1QFYA 2QUBA 2FQ1A 2R44A 4WK6A 1Y82A 2A86A 1Y3CE 2J7KA 4EGCB 3CLTC 3B78A 4G1EB 3O4IA 2G0NA 3NRCA 1EDOA 2C4VA 3BWBA 2ZTLA 2KI5A 1P45A 1MO2A 2OAP1 3Q87B 4QTZA 4L78A 3FYUB 3R8CA 3W7BA 6AT1A 1XZPA 1VRCA 2ZBVA 2OT3B 1NN1A 1P6XA 4U9UA 1KDVA 1DARA 5DF1A 3CJRA 3RGWS 3FNIA 1G2IA 3KB2A 2EW2A 2RHCA 3M82A 4IMRA 3ET4A 4KW7A 4KQMA 5B3AA 3VU9A 3IMEA 5DYYA 4EH1A 1X19A 2POCA 2VP2A 3LVRE 3QUTA 1SC9A 1X9HA 3AUAA 1KK2A 2FCRA 1XMHE 3LP6A 1WDKA 3AILA 4YI5A 3WSTA 5G4KA 1CUIA 4B46A 1FS6A 3ZJUA 2PO7A 1EESA 1MLDA 2XTMA 4YA6A 4EZIA 4WL0A 4XYEA 3C95A 1E1DA 1ZRSA 3AZPA 2WG2A 4RFLA 1ETUA 1N3BA 2C96A 3QX7A 2B1EA 2NVOA 1A4IA 3EOAI 4RA6B 5D2CA 1LI5A 2ZJAA 2DBVO 1IYZA 2W43A 2JHPA 1VE6A 4V3CA 1G8KA 2QZ4A 4EO7A 1NJ1A 3SVTA 2H4HA 5ALRA 3CW8X 3OCUA 1VLZA 5COAA 1LI4A 1V5FA 1V6CA 2ATVA 2V7PA 3FNBA 3IUYA 3JALA 1A82A 2JGRA 5H7XA 2CV0A 2RGYA 4IYRA 2CHEA 4ZGBA 3HRIA 2ZYUX 4TS3A 5EVJA 1I7SB 1F8XA 1VSBA 5C18A 4UTXA 1IQ0A 2IKSA 4RORA 2XH8A 5TSDA 1BCSA 4CKCA 4ENWA 1VP9A 2HEGA 3UJ3X 2PBFA 1Z74A 1EGHA 4JBXA 4J9VA 1TF5A 2W6JD 1LVHA 2PX4A 1XU5E 5C8YB 1HEIA 2P2DA 1VL8A 3C3MA 4EECA 4EO9A 3GRFA 1WXEA 2DG2A 4MV6A 5KCMA 3LWZA 2B34A 2B21A 2TSYB 3MWKA 3B3AA 1KYVA 4EY6A 3CHYA 1HYHA 4DPKA 4JBHA 2P5GA 1OTYA 1SA0A 4MVJF 3Q3JB 4WVLA 4BB0A 4EPVA 5BUSA 2COKA 5E9AA 3T35A 1E9AA 3ZKWB 4YT2A 5LB2A 4ETWA 3QE9Y 1PT5A 2FFQA 2YXEA 2ALJA 2OXCA 4RD3A 1M8KA 2VZ9A 4GLLA 3VZBA 5EZSA 2FPOA 2WYWA 2ZLBA 5DHSA 4X91A 1E61A 1L1QA 2QN9A 5H4GA 1T3LA 3RTEA 2C03A 1D1PA 3DMTC 3LOQA 4LRUA 4PYMA 2QI9F 4XCVA 4WK2B 2DHCA 3H1FA 3ML1A 3V4FA 3WK9A 4YQFA 3K3PA 3ZD9A 1Y8RB 1M73E 2VUUA 1TMKA 4MWEA 1LNQA 2P41A 1LU9A 3Q9LA 1QBGA 3L7CA 2VYCA 1CZOA 4IKPA 1Z82A 4PWYA 3L0DA 4DWJA 1LJLA 3OU7A 4WEOA 3FDFA 4PRYA 3A4TA 3TNLA 2JFUA 1YB6A 1DO0A 4PFJA 2CUTA 3DWIA 2O23A 4I8IA 2BBSA 2VK2A 1KIMA 2AMLA 2Z56A 3BWEA 3LYAA 4OATA 1DV2A 2FK7A 4OYLA 3TL3A 1T25A 4ENTA 4JI8B 1GT6A 4RHCA 2RH8A 4PIVA 1YRBA 3VJMA 3LLSA 1P4HA 2JIRA 3E4CA 5FTJA 3ROMA 2XKKA 2PPLA 4M9ZA 5M3BA 2V6BA 3GRKA 3NANA 5DYNA 3AQIA 3V4LA 5IT5A 3EN0A 4FEAA 1HMYA 4LJ6A 4GHWA 1VE9A 3HHEA 3U9TA 1RM4A 4UBLA 2Z9DA 3QJGA 1AC5A 4NBUA 2GHTA 4AKSA 1KPHA 3FI0A 1IZ9A 4UU0A 4R54A 3F3SA 5D8DA 4CN8A 1QGED 5BQ5A 1X7XB 4E1AA 1PJAA 2Q4DA 5JXWA 2W2MA 4X1KA 3IUSA 1ZXLA 1RIFA 3TTUA 3EEBA 3ZBUA 4DANA 1IM8A 5IJZA 1NF3A 1ZNYA 2QJOA 3HB0A 2HXGA 1FDTA 1L7PA 4XM1A 5ECWA 2YNMA 3AB3A 2XMCA 2D7JA 1L8QA 2J30A 2C61A 1T8YA 2QL7A 3C8HA 4JJ4A 2FXVA 1G55A 3DDOA 4MP3A 4MR7B 4O6VA 5HF8A 4B80A 3JQQA 5DN6D 2FCAA 2H7CA 1JZSA 4GOND 4U7PB 5E0OA 3ZK7A 5B64A 2ILVA 1X1RA 1D2CA 3E3OA 3UGQA 2Q5EA 1BROA 4RCYA 1T3ZA 5JATA 1I0LA 4GI1A 4UBKA 3ZE9A 4AKTA 2ZYHA 2A1TR 2XOKD 3AEKA 5FBVB 2DHDA 2E4AA 5ERGB 2DZDA 2XWQA 4LGCA 2PLWA 4JEMA 1HQDA 1HDXA 3F1KA 2UVPB 4PY2A 1DX6A 1Y1PA 4P3YA 4N0EA 3CU5A 1XZQA 3GGPA 3BQMB 2NU7B 3HM2A 1QFMA 2AUMA 3NHJA 3PR1A 1FJXA 1TK3A 1QTNA 1C5KA 2CJYA 3VU1A 4UHHA 4RANA 3LCRA 4KJZA 1FS5A 5KREA 2OZLA 2ZBQA 4BO0A 3DBHB 3GI1A 3P9SA 4YQEA 1QIHA 1MJHA 2RHTA 3UMSA 4D74A 2P9JA 4CGZA 1FFGA 1SHUX 5LMNB 1KSFX 1EP3B 4QE3A 3WLJA 5KNDA 3U6BA 2WMYA 4M45A 2QL9A 3M34A 3T8YA 4BX8A 3WMWA 4DBLC 3G1WA 3H8SA 3QPWA 4L3VA 4BE7B 5JLJA 3A2MA 4ZU1X 3BXPA 2YX1A 3F67A 4OD0A 1Q6ZA 4MKFA 5I7EA 1OUMA 5DULA 3WSWA 2BR4A 2VAVA 4LCEA 3KS9A 2HA7A 1VYVA 5DM1A 1E1CB 2YRWA 1QHNA 2I62A 3NHBA 1TQ4A 2HH9A 1Y6ZA 2ZJYA 2GUGA 3FAKA 3ZVLA 3LIPA 1AH2A 4RZ3A 4Q0MA 3S1LA 1E3DA 4BMCA 4KMMA 1FW6A 2EXXA 4QTYA 2XMBA 2OORA 5KOJB 1MJ5A 1P0MA 3U19A 3H5LA 3C3CA 3E22B 1ZMRA 4WZBE 1JFTA 4M3TA 4WZ6A 1G6Q1 1QPBA 5CGQB 3ZG6A 2BKVA 3D0QA 5TGZA 4LF8B 2BW0A 4O4IB 1C8VB 4B5KA 3KWLA 4IDCA 4E3SA 2HBZA 2JLZA 1SKUA 3ER8A 2Z5FA 4XSVA 5EJFA 4M38A 5A5DA 4IW3B 4KPUA 4X54A 3UAWA 4GOXA 3A3PA 1N5MA 2WYOA 3R6WA 3DEKA 2XPCA 1V3VA 3LUPA 3GIWA 3C6BA 2PZFA 3P2JA 3WJ2A 4U6NA 2ZJ1A 1JDJA 2ZRBA 4QPJC 4X1IA 1FVXA 1LLFA 4FHZA 5CLHA 1HFJA 3FUWA 3PQ8A 4FMDB 4R01A 5I7RA 4HZUB 2XOXA 3F7TA 2FNAA 4FJMA 1M0EA 3LC1O 4FDVA 1LA2A 2O54A 1P0FA 2WM8A 1U2TA 4PYJA 1DHTA 3TH5A 2IK8A 3AK4A 3Q0IA 3G0HA 4HEA1 2XV1A 4RL5A 1K5PA 4O0MA 3QXHA 4LFCB 1L5NA 3PNLA 5A9RA 2HPZA 4FLEA 4G0UA 5JSFA 1LRLA 2B98A 3FOEC 3M89A 3CUTA 1CRQA 4FE4A 4ZT3A 4BMPB 1HTWA 2UUCB 1U3WA 1XGKA 2VHUA 1YRHA 3ZGXA 4W5RA 1Z34A 4FD3A 3T4XA 4KN9S 2GZ1A 3UQYS 3LU1A 1U0FA 4PZ9A 1T1GA 3VBCA 1E1RD 3R41A 4GPEA 4TMXA 2I2XB 1IHYA 2XCIA 3J7TA 1P7YA 3EVBA 4GKJB 4REOA 4TXNA 1ZUWA 2IZ6A 3F8SA 3G88A 4NCXA 4NXNB 1SJ9A 4BVGA 1RZUA 1RLJA 2VJAA 1NXOA 3VZQA 4F3RA 3BRWD 4B4UA 4M7PA 2O6LA 2IHNA 3R0JA 3IURA 1CUFA 4IJUA 5I8WA 1Q11A 3W5HA 4WCFB 3KD3A 2XBMA 3OX3A 4LRQA 3KXLA 2CF6A 4MCAA 1G42A 4DLLA 1U98A 3NE6A 1V37A 2PUWA 3FETA 4GWKA 3GVIA 4JLVA 2PLFA 4Z9YA 1LX7A 1XX6A 3G2QA 2CVHA 3HL0A 3TLGA 4RL4A 2AIRA 3KHSA 3GLGA 3TJYA 1AOXA 3P27A 4EA9A 1HNZB 4FZ3A 3AVWA 1DTEA 4X7RA 1I2MA 2R7KA 2ZSBA 4AJLA 4US1R 1EFUA 3SYLA 1GUBA 2HF7A 3OU6A 4TV8F 3DJYA 3ZH2A 3RWBA