3L2OB

Structure-based mechanism of dimerization-dependent ubiquitination by the scffbx4 ubiquitin ligase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
308
structure length
274
Chain Sequence
AASTLTRLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVFFDYMAVYRMCCPYLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTTRRYSVIPQIQKVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/cell cycle
molecule keywords S-phase kinase-associated protein 1
publication title Structural basis of dimerization-dependent ubiquitination by the SCF(Fbx4) ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 274
sequence length 308
ec nomenclature
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00646 F-box F-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3l2oB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l2oB02
5DISB 4A8JC 3IO5A 3AVWA 1P72A 3BS4A 4C4PA 4ZDIA 4F7WA 1J99A 2QI9C 4S2EA 1W5TA 2ERXA 1QHHB 2WJIA 3TVDA 4AG5A 5EE3A 2CBZA 3OEED 4DZZA 4WZBE 4CT4B 2FZLA 2H92A 3VR5A 2LKDA 4WA7A 2R6DA 2ZI9A 4IKEA 4G5OA 4XD7A 1RKBA 4BLTA 4MGKR 5HR5A 4C0LA 3AF2A 1E2QA 2WAXA 2WMNB 2YWEA 3C14C 1G6HA 1U99A 4NYIQ 3BERA 2IUTA 2KI5A 4Q7MB 3CX6A 3IKJA 1AKEA 2W6JD 4OQNA 1XTSA 3KQLA 1WB9A 2K5UA 3VFDA 4HLUA 5LD2B 4OYHA 5KSPA 4Q1EA 2BDTA 1LS1A 3QG1A 2PL3A 4JLKA 4JJZA 1Z0DA 3AVPA 2PT7A 2IYUA 5FR1A 2HEIA 1SVSA 4WOPA 1ANKA 1T3SA 2D74A 3QENA 4C30A 2YHSA 1OH6A 4AKHA 1LFDB 5FOUA 4PPFA 2F9LA 1MABA 4OHYA 2HT1A 4JYCA 1II9A 1OFUX 2AK2A 2W0MA 4HLUC 1OPXA 3ETLA 2FPLA 4NCKA 3BIFA 3NG1A 4RD1A 3WP0A 3DZDA 1PUJA 1DAMA 4EPRA 4YXWD 1S3GA 3P27A 2ZPTX 4LY6A 2WWWA 3MRSA 5K8TA 1EESA 3GLIB 1E9RA 1G4UR 2GCOA 4KLZA 1X8LA 1HH4A 2AKAB 4G1UC 4LHZA 1I2DA 4EPWA 3MSXA 4TTPA 2PMDA 2JJ1A 2Q3HA 1E2HA 1XFAA 1GSIA 2JIZD 3T61A 1SULA 3KKMA 3C8UA 2DFNA 4KODA 4MGIR 5HKKA 2BCJQ 2VHJA 3RLFA 5JHHB 1NLZA 2NO0A 4D4KA 4Q66C 2QY9A 4NKRA 3ASYA 4H9GA 5EUQB 4M8NE 3RRZA 1ESMA 3SYLA 2QPOA 3RWOA 2GJSA 3B82A 3K1JA 1E1QA 3LVRE 4UNQA 2ORWA 3GP8A 3E5HA 3ONWA 4N1AA 2C77A 2DWOA 3KFVA 4LK2A 3KUCA 4X8OA 3BC1A 4JL8A 4M1OA 4OK3A 5FI0B 5FPTA 4BECA 2ZE6A 1E0AA 5JECA 1JB1A 1E9FA 1B23P 2WPDA 5A0FA 3NVAA 3EC1A 4IJMA 5FTMA 1ZNWA 1XD2A 2VBCA 2O8FA 1CBUA 4NU0A 2RHDA 1WDTA 2GF0A 3QNUA 4H1UA 3ZS8A 3K0FA 1XJ0A 1QDEA 5JCPA 4TTRA 1OYYA 2VP2A 2QPTA 1KY2A 5GVRA 4C0SA 4Q18A 3LX8A 3AF0A 3K70B 3UMRA 4MKFA 3V9PA 4URXR 2O5VA 1WP9A 3EXAA 2ZE5A 4HUQB 4HYYA 1CKEA 3LLMA 3HR8A 2ZR9A 1NMXA 3JZMA 3OGKB 1GL6A 5FH9A 1SGWA 2OCAA 2X1VA 1CJKC 2C95A 4XOIA 2OCPA 1DAIA 3RRMA 3PEUA 2ZXUA 1Z8FA 1TNDA 1J90A 1M34E 2F6RA 2JLRA 4IVQA 1OH7A 2VP0A 4TYPA 3A58B 1KI2A 5FBQB 1FX0B 2XEXA 4LYHA 4HUTA 4Q03A 1FFHA 3T1QA 2QPAA 1CR4A 1U0JA 1MO5A 3LV8A 3TQFA 2MSDB 1ZM4A 3TUZC 1KJWA 1TL7C 3AVOA 5JRZA 1KK0A 1XP8A 4NHOA 4ZKEA 3PUXA 4XVQA 3GLFE 3NTUA 3SHWA 3FDIA 3R7WA 2F3RA 2FF7A 1N6IA 3LXXA 2IW3A 2ZRIA 4Q9LA 1GRNA 2RB4A 4ERNA 4Q1BA 5JEEA 3I73A 1G16A 3AF3A 3X1ZA 4HLQB 4JT4A 2WWHA 4NYJR 4XTCS 4US1R 1EX7A 4JJKA 2QQEA 2CVHA 4M0LA 3VHXA 5L8VA 1E69A 2HYIC 3RHFA 1Z0AA 1R0WA 2LCFA 4K46A 4KFRA 4LJ8A 4NCHA 1YZGA 3MCAA 5UKDA 2E31A 3THYB 2ONKA 2IUSA 3R9IA 3I5XA 1KMHA 4EFNA 1CS4C 1HE1C 5CDFE 1E1RA 1JQLB 2A78A 1R4AA 4FD2A 3GJ3A 2QL6A 3RC3A 1PLLA 3GFTA 2XSZD 2ECKA 1JJ7A 1HT1E 4D6PA 1RJ9B 4RZ2A 1S1MA 2VLIA 4MUBA 1BYIA 2DYKA 4L9SA 5CJPA 4QGGA 3N70A 4ZCIA 3AP2A 1DG1G 4DDWA 3U3OA 3UKDA 4DT1A 1HE8B 1ZVQA 4EFLA 2HF9A 4RD4A 2RGAA 1GKYA 1D9ZA 1Z28A 2KE5A 4CVNA 2ZU6A 2XZLA 3GLHB 2KSQA 2V4ZA 2ZROA 3FYHA 3AM1A 3IQXA 2QAGB 1M7HA 4HAXA 1XXHE 4TYQA 2FPKA 5FOWA 2BEJA 4Q4HB 4RJLA 1XZQA 3DMDA 1UBCA 1ZUNB 2ATXA 4A2WA 1KTVA 4EJSA 4ZI2A 1S9HA 3FTQA 3LLUA 4BWYA 4DC9A 1JEDA 1EX6A 1VHLA 2ZJ8A 4U5XA 4BLPA 1KNQA 1XX6A 2LKCA 4IOKA 4F4CA 1GVNB 1L7VC 2VF7A 1IY2A 1TQDA 2BM1A 1S9DA 4HB0A 3NBZC 4DUGA 3EPLA 3CW2A 2BEKA 1J8MF 3U44B 2VRWA 4ZIRB 1DO2A 4EKDA 1XEWX 2WJGA 4TYNA 2C04A 5KU1A 4EJSC 4Q01A 2GWHA 1FMLA 4DSUA 3V4RA 5DE3A 5DLQC 1E2NA 4C0HA 4EFMA 2ZJ5A 1OIVA 4IDOA 5C2JB 2JASA 2YJTD 4BEBA 1E4YA 1N6KA 2ODBA 4FCWA 4JLBA 4PAOA 1T8TA 4QG7A 2A7QA 2XXAA 1M1YE 4US0R 5EUMA 4MITA 4C0QC 2GESA 1GIAA 5FR2A 2AD5A 4IDNA 4E5UA 3PJRA 2WM9B 2OXCA 5EP4A 4HAVA 4FN5A 1Z63A 2QEQA 5KOYA 5D3MB 1CR1A 2GAOA 4Y0AA 3VAAA 3SBDA 2QTHA 4MKHA 3TSWA 3DDCA 4OQFA 4K8OA 2QP9X 3T1OA 1WCV1 4M1MA 3T34A 4A0GA 3E2IA 4RD3A 2FDCA 2QE7D 4LBVA 2HV8A 4BPBA 4KITB 2ZYUX 1ZYUA 1Z29A 2XTZA 1A5TA 3IGFA 3X1XA 4ESVA 1FNNA 2C8VA 2P3SA 4R2IA 1EWQA 1ZMXA 1EGAA 2YVUA 2R8RA 1ZM2A 4ZPXA 3WYFA 1ZNXA 2DY1A 3U7GA 4O3MA 3EZ2A 2XITA 3IDQA 1AZTA 4BLRA 4C0BA 4GP7A 4CW7A 4MRRA 3GCGA 3EC2A 4KFTA 2FFQA 1JR6A 1JAIA 3RSLA 5EP1A 4RFVA 1YZLA 3OAAD 3W3ZB 2WICA 2XTMA 3ADCA 2QT0A 3F0TA 1KOFA 3PUYA 4JYBA 4PSKA 5AUNB 4C7OA 2C99A 2OBNA 2BC9A 4P0TA 521PA 3I62A 1NY5A 2YC4C 3RS4A 4LUCA 2KWIA 1S1CA 3E70C 3QE0A 4TN1A 4KLNA 4M53A 3ZVLA 4EPVA 4AKEA 2GAAA 1UJ2A 4O2LA 3A4MA 4P3YA 1W4AA 3KFXA 3QBTA 4AURA 2BM0A 4YONB 1G3UA 1YRBA 1OW3B 1HV8A 3VTKA 1QZXA 1UM8A 1XRJA 4KVGA 5FOVA 1KK2A 1Z0FA 2VHUA 4PC7A 1OH5A 2GBLC 4ZCMA 3EX7C 4URVR 2OM2A 5F98A 3MWLA 1E2JA 4JVLA 4LHWA 4Q00A 4BFSA 1XTKA 3QG5A 4NYMQ 2IXEA 1P2UA 4QBHA 4I1VA 3OEHD 4IHQA 2Y8EA 2ZIAA 2XAUA 3C4JA 3F8TA 1OKKD 3LBNA 3VR2A 1HYQA 1KI9A 1NP6A 3QXSA 4OI2A 3U61B 1R8QA 4OK6A 3ZJYA 1W4CA 3QKRB 2Z5FA 4EPTA 1RPZA 3P4XA 1T9HA 4V0MA 4MDEA 2ATVA 3EPKA 5CIWA 5FPHA 1PZNA 1VYUA 4QBFA 4TYWA 5KNBA 4YMWA 5C4MA 1E0SA 1Q3TA 5B30A 3LAWA 2OZEA 5HCNA 2IS4A 2HUPA 3BH7A 5FTLA 4PZLA 2ZYTX 3AVXA 4XSHA 3KXLA 5BN5A 3B60A 2C98A 1NMZA 4TQUS 3LBHA 1AKYA 2Q6TA 5LB4A 3ZD6A 3VR1A 3ADBA 1UADA 4NONA 2BMDA 3KTAB 3OZXA 2ANCA 4KAXA 4ASUD 3AH8A 3G5UA 2CK3A 1BIFA 5BWMA 5CK4A 2OE2A 3G0HA 1VYVA 2B8TA 1LNZA 3RSOA 1XPOA 1Q20A 4OHWA 2FE4A 2N1BA 4HSEA 4PZYA 4OQXA 3MG9A 3SJCA 3W6OA 2IT1A 2DWPA 4CT5A 4Q4LA 5HZHA 4KHZA 5EE9A 2Z4RA 3TK1A 3PITA 3H4MA 1JALA 2WSSA 3Q5EA 4TSFD 3RS2A 1SVMA 3I4LA 1XTJA 2QGZA 2RKOA 1E2PA 1TF5A 3UPUA 2QMUA 2O0KA 2RCNA 1KK3A 3A37A 1FTNA 3AF4A 3TQCA 1CU1A 3GEHA 3OHMA 3W3AA 4KBGA 3I92A 5L3RA 1Z0JA 3THWA 5TXGA 2OCBA 2R6AA 3EAQA 2XX3A 4TT3D 5DYGA 4ZKDA 3KJEA 1OXTA 2J45A 2BHRA 2JATA 2VTKA 2O8EA 2IWHA 3ZLJA 2PH1A 4QXAA 3CR7A 2EWVA 4TL8A 5G3ZA 2BJVA 4OK5A 2J87A 4WZAE 3U6KA 1GAJA 4LBZA 2GXAA 1FS1A 4P4SA 3GJ0A 4JVMA 5TDHA 4EUNA 1V43A 2GEDA 2IYSA 2HLDD 4BLQA 4FMCF 1TAGA 5IRCD 1IY1A 2B7BA 2P65A 1ODFA 2VQSA 2WOOA 4QHYA 5L3SB 1E9EA 2IS6A 4A92A 1SXJE 1ZIPA 2C9OA 3SC3A 3ICQB 4DSOA 1QVAA 1TU3A 5IHPA 4A6PA 1G19A 2NQ2C 1CJMA 4PC3A 1KY3A 2YV5A 3U7FB 4B48A 2ZRMA 1MO3A 1MV5A 2YC2C 4YMSA 1ESNA 4B32A 1R5NA 1MO4A 1E79D 1N25A 1HEIA 2EWWA 1ZNYA 4PHFA 5CM9C 5J40A 3WBKA 2ZE7A 4LYAA 3ZGXA 1XCPA 1E9DA 4Q9KA 4Z1MA 2GZAA 2IXFA 1W36B 4HLDA 2QU8A 4I1SA 3H84A 3GLGB 5EE1A 1UEJA 3VX3A 2ZS9A 1X86B 4B74A 1E6CA 1KGDA 4JVSB 1M8PA 4FW9A 3W8RA 4DB2A 1SXJC 1OE0A 4HDCA 3TR5A 3TGPA 2DPXA 5AK0A 1XEXA 3MWKA 1NNEA 3M0EA 2NMVA 2CJWB 3VR6A 2JDID 4LHVA 2B7CA 2QSZA 1A7JA 3FFAA 1CRPA 4GNKA 2O8BB 1NN1A 3HJNA 4PX9A 1C4OA 4Q7LA 5EZ5A 2JLUA 5EXSA 1JR3E 4TMXA 5FOSA 3IEVA 2IHBA 1OHHD 3KKPA 4B35A 1RRFA 3MWJA 1C1YA 1RVDA 4LCBA 3X1WA 3WNCA 4DLSA 2WWXA 5J4HA 2O8DB 3NHBA 3SHFA 2OBMA 3QVUA 1VDZA 4RVCA 3ZS9A 4Z54A 3B1ZA 4FMCB 1F3OA 2WSMA 2WZQA 5BN4A 2QN6A 5FBWB 3FKSA 3QKSA 1IJEA 1E9SA 4YDHB 4MGYR 2GEVA 2BBOA 4EPXA 2P6UA 1U0LA 2JLXA 1VIYA 3QPWA 4TL6A 4BEJA 4QKQA 2R6CA 1Z3IX 3UXMA 1QHGA 1DBSA 1RW4A 2XOKD 1M7BA 2F43A 5AUQA 2IYLD 1L4UA 1L4YA 1P7CA 1N6LA 5KTYA 4CEJA 4MRSA 4M9SA 3NC1C 4BE7B 4DIEA 1WRBA 4IRUB 4R9UC 1PLKA 3U3MA 3EZFA 4DLZA 4W5WA 2GZHA 3BB4A 4EDHA 2GNOA 1Z83A 1T4GA 1YRAA 4E09A 3ICEA 5H68A 2CDNA 2PT5A 3BFVA 5BXQC 1R0YA 4D4JA 2AN9A 2NZ8A 2D2FA 3AVVA 3J81k 3D6TB 3LX5A 3GLIE 4A6XA 1HT2E 4LJYA 2RGNA 4DCUA 1BH2A 1GKIA 1DAGA 4V02A 5JRJA 2OAQ1 2REOA 4US2R 4V0LA 5K8LA 1TUIA 1AM4D 4BLSA 2GZDA 1X1SA 5AR1A 3ZQJA 1OB2A 2IUUA 2VIIA 4HAUA 3UATA 5M04A 3HDTA 1P9WA 1YZNA 3H0KA 2GETA 2PLRA 3NEYA 1ZBDA 1WQ1R 1COWA 2P0EA 4QNMA 1EWRA 5AJVB 1UBFA 2ZAOA 4A0RA 1I4LD 1ZRHA 1GTVA 1ZJ6A 4JLJA 1VG0B 2GKSA 2JJ1D 1ZD9A 3QUSA 3ZZUA 2ZJAA 3IO3A 1N3BA 1R0ZA 3NBXX 4B3FX 1G64A 1S3SA 4URWR 1UKZA 3K0CA 4UXJA 5AJXA 3WNDA 1IM2A 4QBIA 1TU4A 3WY9A 4A2PA 3L0PA 4EQ6B 4G5SA 1VTKA 1S96A 1B0UA 3MUFA 4Q4JB 1W4BA 3IIKA 5FUVA 3U6BA 1E1QD 3ZH9B 2P67A 5CLLA 2AK3A 2FEOA 1J7KA 1FPMA 4QOSA 1KI6A 4PTLA 5EZ6B 1OH8A 1FMJA 2ASEA 3QBVA 4JL6A 4A8JA 2ZJ2A 1MT0A 2WPDD 1EFHA 2DR3A 2CCJA 2PLFA 4Q7KA 1DEKA 2QMEA 1DAKA 1G7SA 2F1JA 3LNCA 2G9NA 2OBLA 2V54A 2N42A 2X77A 3KJIA 4R7ZA 2AX4A 4URYR 2FA9A 4HUQA 4M1SA 3I5YA 2V7QD 1K8RA 1X8JA 1NBMA 5BQ5A 1FOEB 5KNDA 3NBFA 1W0KA 4L4UA 4LPKA 4W7SA 1ZU4A 3DPUA 3K70C 4B2PA 1S8FA 3O8RA 1E2FA 2P6RA 1XMIA 4JIMA 5DI3A 2JLVA 1OFIA 4CF7A 3T1VA 3Q3JB 2BCGY 3S1AA 4D0GA 3HYTA 3I8XA 3DMNA 1JNYA 3BFXA 3B1XA 3BB3A 1KIMA 5CB6A 3BWDD 3THXA 4H1VA 1E0JA 2HYDA 3DKVA 3CZQA 4PC6A 2A5GA 3TLXA 2W2XA 1LVGA 3SJZA 4BFZA 3F5FA 2ZQ5A 4AC9A 4PPGA 3W8NA 4XIGS 4JBWA 1KI4A 3CF0A 2ONJA 5F3WB 2OAP1 4PHGA 4AYXA 3I32A 1OXSC 1WBDA 3WYAA 2QBYB 2FFHA 3VNVA 2F1IA 2G3YA 4RZ3A 2OLKA 1LDKE 1L8QA 2D7CA 2NO1A 3ZQ6A 5B64A 2IYXA 1JQJC 4AY2A 1FNMA 4UJ3A 1YR6A 1WXQA 2ZI3A 4KXFB 3CX8A 2ODWA 2YNMA 4GL2A 2CMKA 1G291 5TARA 2C03A 3SYKA 2ZUCA 4IXMA 2VHCA 2OXRA 4IDHA 2KJQA 4LJ5A 2ZANA 1M6NA 1TF7A 4BRUA 3SOPA 3AKYA 4G5RA 4N3NA 3TNFA 2QM7A 1CJTC 2A9KA 2QENA 3SS8A 4B47A 5K8IA 4L5BA 4DDTA 2J7PD 4B3GA 1PVOA 4TLDA 4W5HA 1PJRA 1A2BA 1E1RD 2Z43A 1RJ9A 3L43A 5AWFC 2DB3A 1RIFA 4PQRA 5DN6A 2WTUA 4B76A 3BJIC 2J1LA 3GLHE 5EE5B 2C96A 2B21A 2QM8A 3CPJB 1G5TA 1RFLA 3VKWA 4QGHA 1T8UA 4NCJA 3TR0A 4MYUA 4D26A 4A36A 4B73A 4UQOA 2P1QB 2XZOA 1X8KA 4UJ5A 3O8DA 2ZS7A 3TUJC 1BKDR 3HU2A 1VG9B 4JMPA 4M9ZA 4C9BA 3X2SA 5CYPA 3KB1A 1Q1ZA 4FCTA 3GQBA 4BZQA 1U98A 3SE0A 2PBRA 1Y3AA 2ZUBA 2QSYA 1K6MA 3CBQA 3P4YA 1YZTA 1KO8A 3DOEA 3GD7A 3A1TA 4EIWA 1W0JA 4B75A 3TH5A 3BAFA 2IF2A 4ZDJA 2QAGC 3GMTA 3NDBB 3VMFA 2OFWA 5DSZA 1IXSB 3I1FA 1NVVQ 1I4TD 2GTPA 1CEEA 3IHLA 4RSGA 3T5GA 4DLWA 1IN6A 1YZUA 4DUGD 2X2FA 4QBGB 2BKUA 3UIEA 5L3QB 4A0HA 4PC1A 4URZR 4BZXA 4RD0A 4LJ7A 4Y0VA 3FWYA 4NYIR 1E98A 1D2MA 4PAQA 4GOXA 4R71A 4HB2A 1SVIA 5KSYA 4IOLA 2JLYA 4A0FA 5JSZB 3HU3A 4PPNA 2FFAA 1R2QA 1F2UB 3TRFA 3PENA 2YOHA 1Z2CA 4Q4AB 3SDZA 5B58C 3N2IA 1Q1EA 4JS0A 1A4RA 1II8B 5KO2A 3KUDA 4UXHA 2ZI4A 3SQXA 3KQHA 3SU8A 4QJ4A 1QRAA 2D62A 3PXGA 4OJKA 2IYWA 3OEEA 5E7MA 1CULC 1OFHA 5JMTA 1GUAA 5IF9A 1A82A 1GRRA 1W2HA 2GVDC 4GZLA 3D7MA 3I8SA 3WMFA 2Z4SA 4OI0A 1E9AA 3T1TA 2R65A 1WF3A 3IBYA 3GLFA 2JLSA 1P3JA 5C1BA 4XWKA 1R5OA 4D80A 1LW7A 1HQYE 1G18A 1XCGB 4XVRA 1Z6AA 4WW0A 3GJ5A 2W6JA 1U9IC 3UG7A 1QHIA 4KO8A 2RH5A 3UK6A 2EFGA 3K9GA 4NP6A 1ZCAA 1G8FA 5CM8B 3O8CA 3REGA 2J0UA 1KDTA 3A1VA 2A3RA 4IEEA 3NEJA 2W6ID 3JVUA 4MQBA 4EAQA 4HEJA 5JCZA 1FP7A 5DGXA 1E3MA 1MOZA 2A30A 1ZD8A 2D06A 5IT5A 3EA0A 4Q19A 3RDPA 4BFXA 5HCIA 4YQFA 1Q22A 721PA 3RRYA 1CJVC 4L16A 1NY6A 2OESA 5G3YA 2CNWA 2NO9A 4M22A 4YXWA 1R10A 3RAPR 5CDFA 4V0OA 4AD8A 3PEWA 1W36D 4I1UA 3QKTA 5FTNA 2BBSA 4CEHB 5FBVB 3X1YA 1RYHA 3Q7QA 4LGMA 1MH1A 2N46A 3B9QA 2PCLA 3W6NA 2GXQA 2EYQA 4AYWA 3X1DA 1LF0A 3LO5A 3LVQE 221PA 3KL4A 4GI7A 2IYTA 3V4FA 4MYCA 2Q3FA 1UBEA 3B1YA 2WKRA 5GVSA 2J41A 4HB3A 3QEOA 4HZUA 4DSTA 3WMGA 1DO0A 2ZI6A 1IBRA 1DAEA 2QG6A 5DH9A 1BOFA 2PZGA 2ZSAA 1G7TA 1N2CE 1P22A 3CUEF 1EFTA 1UKEA 1ZIOA 5B2ZA 1E99A 2FMXA 1F48A 1Z6XA 3BOSA 1DTSA 5E4FA 1GG2A 2D4HA 3NDPA 1XXHA 1U8YA 1N6PA 2H17A 2AL7A 2CCKA 2QAJA 2W2VA 4ACBA 1FL9A 1GITA 3WRXC 4QJ3A 2CLSA 1I4DD 3KX2A 4Q9HA 2YOGA 4P32A 3IHWA 3WHLA 2VL7A 3PVSA 3CRMA 4OBEA 2E32A 1G41A 1CIPA 2FSGA 2OSBA 1ZD1A 4B6EA 2IBMA 2VO1A 1I2MA 4JZKA 2MMGA 4MRNA 5LBIA 2WIAA 1XD2B 1P73A 1LTQA 2P2LA 3OF5A 4GRAA 1P4SA 1JJVA 2GK6A 3HWSA 1UEIA 2OILA 2CLCX 2F1RA 3T15A 4B34A 3IEUA 4LDJA 1KAOA 1G21E 2WJVA 5L3VA 3VQTA 3K09A 2IA5A 1OT3A 4NCIA 1C9KA 1NVUQ 1AGRA 1Z22A 1VG8A 2PEZA 3ADDA 1OIXA 4LJ4A 4V0NA 4E22A 1EFUA 3TJZA 4QL3A 4V0KA 1NG1A 1FTSA 2GHIA 2ODNA 1XMVA 3FHCB 1R0XA 1T6NA 3TBKA 3U3KA 1ONBA 3MLEA 3VKGA 5FBRB 3SQWA 2CHGA 3TKLA 3B7GA 3K09C 3L82B 3WHKA 4ARZA 4JKYA 1NN3A 2IEYA 5KDLA 2HJGA 1XCMA 2YINC 2CHQA 5JI2E 2O0HA 2WSSD 1VKJA 1VHTA 3R8CA 2BMEA 2VF8A 1UDXA 3KKQA 2R44A 4K81B 1XPUA 4M1KA 3VX4A 1GFIA 1IJFA 2QRZA 1G7RA 4JBYA 5DNYB 1ZUHA 1P2SA 3BXZA 3W34A 5EXTA 3OE7A 4XWOA 3DM9B 2UZ3A 5TVKA 3R7WB 2X2EA 3KJGA 4RFSA 3R20A 1OSNA 4AIIA 1SKYB 1E2IA 2ANBA 4D0NA 2CHVA 5J4LA 3CRRA 4C2TA 4FCVA 4CEIB 4X8MA 1XMJA 3U3JA 621PA 5JS7A 2CVFA 5A4JA 2C9CA 2HXSA 2GBLA 1SHZA 4C0JA 2C9YA 3PEYA 5E3HA 1QHYA 5KSZA 1JEEA 1N0UA 4MRPA 1KMQA 4PZZA 4HDOB 2VSOA 3K0AA 2EFCB 121PA 5EJEA 1RZ3A 3U4QB 5H1YA 1E96A 4KI0A 5F2EA 5JBQA 4BASA 2PMKA 3GLGE 1NSTA 3I61A 1DADA 3GJ4A 2Q9BA 3A36A 4A9AA 1AS2A 2WWIA 4Q1DA 3D31A 3KKNA 3OIVA 1FQKA 1TQ4A 3L0IB 3D8BA 2YWFA 3T5DA 5FPKA 1T0JB 2OFOA 2O8CA 4OI1A 4M9XA 2JCSA 3B78A 2H57A 2QA5A 2FOLA 1EFCA 2RGDA 3D3QA 5FFMA 2KBFA 4NBSA 1UBGA 4HAWA 4JKIA 3A4LA 1XWIA 4KFSA 1E2KA 2J3EA 4BFYA 1US8A 2BMFA 4KV9A 2UZIR 4DT1B 3EZ6A 2ZYVX 1AJEA 3TIFA 2ZRKA 3REFA 4QRHA 3TAUA 4E07A 3W6PA 2BJWA 2J5XA 5IK2A 3BH6A 1IXZA 5G53C 3DZ8A 3IIJA 2FN4A 3NWJA 4XVUA 3PUZA 1QHNA 3A1WA 4XSGA 3SI7A 4TZ0A 1F2TA 1Q0UA 1Q12A 3CH5A 4A15A 1VCMA 2WWGA 2V6IA 3H1TA 2PZFA 3DVLA 4Q9IA 4LHYA 5TY0A 4D2IA 2EW1A 5CB8A 2QZ4A 4PO1A 4BLOA 3AGQA 3QF7A 1NL3A 2G88A 3LD9A 3C6OB 1VECA 1W44A 4TMVA 4YMUA 4RZUA 4QHSA 3BB1A 4CGZA 4N0DA 2ZETA 4IVPA 2REBA 2V55B 5FTJA 3L8ZA 4ON9A 3NH9A 3P26A 4M21A 1LY1A 3ND8A 3WXMA 1GM5A 1GOTA 2NGRA 5KHOC 1N6RA 1RRPA 1SVLA 2DWQA 2A5FA 3NIBA 4GOJA 1E2DA 1R8SA 4NMMA 4F92B 3AQ4A 4A1FA 2J46A 1TEXA 4JLNA 1QG2A 3WMEA 1EFRD 4B3DA 5EXXA 5J4VA 4KJZA 1OXXK 4TLEA 2JA1A 4HI0E 2WBLC 1JXOA 3FFBA 5LB2A 3EA5A 4DCVA 1RRCA 5DI9A 2PJRA 4QGFA 5H70A 3FMPB 1XEFA 2QE7A 1D6JA 1W4RA 2PJZA 3FB4A 1IONA 4CYMA 1CTQA 4GT1A 3KXKA 2RHMA 1JBKA 5EQTA 3ZYCA 1LB1B 1FW6A 5BYKA 3THOA 5GADl 5KUTA 3VU9A 1UKYA 4EPYA 1O87A 1GZSA 2KB0A 4B3CA 2Q0HA 3ZVNA 3SN6A 3CWQA 1YU9A 1XDBA 3GEEA 1VYTA 3AUXA 1DS6A 1XU4A 1COWD 1IN5A 1G17A 3BGWA 4O0MA 2DBYA 3FHOA 3LRPA 3WRYC 4BUJA 2IX3A 5BYJA 5SZJA 4LJ9A 4RCYA 1UKVY 4NYMR 3AF1A 4IFBA 2BKEA 4HAYA 1SXJA 1D5CA 3QPUA 5AUPB 2DFKB 2ZYWX 3RC8A 4MGZR 4UNSA 3B2EA 4AWXA 4C7OB 3MKSB 2DCUA 3AKEA 2FPMA 4LWZA 4QJ5A 2WWFA 2CEAA 2FWRA 2EFDB 3KZ1E 5FUXA 1NF3A 4PFSA 4HZIA 3OFND 1SQ5A 2XTNA 4LJ6A 2OO7A 2B6HA 5JFGA 5JI3E 3Q8XB 2W83A 4ZI3A 3EW9A 5FPYA 3ZDQA 4E03A 4OQMA 4Q02A 3FOZA 5E95A 3QI2A 4UKDA 2IYVA 3U2QA 5E7JA 2QQ0A 3DOFA 2X8AA 4LV5B 4TLAA 2BMJA 2GJKA 2IYYA 4Q1FA 1DE0A 3QF4A 5JHGB 3B8HA 1NLFA 3UWOA 1ZC4A 4D81A 3CPEA 3MJRA 3R9WA 1H8HA 2IC5A 2QTFA 1T0HB 4LYFA 1OKKA 1Z47A 1NBMD 2JJ2D 1KO5A 3UMFA 4YMVA 5ANRB 3CX7A 1JR3A 2F7SA 1GDDA 1QHHA 5GJCA 3KKOA 1YQTA 2FX3A 3HPRA 4YLGA 4M1TA 1F6BA 5CYOA 1F60A 1T3LA 1YVDA 3B1VA 3MWYW 4TMKA 3VR3A 1HY3A 3EIHA 3MFYA 3TSOA 2GJ8A 3GJ6A 4I6JB 1YKSA 1J70A 2ZSEA 3Q85A 4DHEA 4DLXA 1MRNA 1CP2A 5JLJA 4AKGA 4LC1A 5LPNA 4XD7D 1FZQA 4FMBB 5BW8A 2QUZA 2Z83A 4KBFA 1KDPA 3FGNA 1PUIA 4ASUA 4I4LA 1Z5ZA 4ILEA 1P5ZB 4POAA 1Y63A 2SHKA 4ZO4A 2Z6VA 3QQ5A 5HTKA 2AFHE 1JAHA 1JPNA 1AS3A 3KJHA 1ZINA 1AA9A 3ZD7A 1P9RA 2ERYA 3IILA 2QBYA 2VHTA 2J0SA 4DEYA 2OV2A 4PR0A 2ZRCA 3UG6A 3H86A 1XTIA 2HJVA 3IPYA 3LW8A 2C5LA 4X8LA 5LD2C 1HUQA 1QVRA 2GF9A 2RGEA 3MAAC 4BFTA 1E2MA 4KSCA 5FUYA 4B33A 5FUWA 3U60B 4DCTA 3L0SA 1DARA 3C5CA 2VP9A 1N0VC 2G77B 2GCPA 3SYNA 3QSYA 3L0OA 2W2TA 3CPHA 1W7AA 3GLIA 2BIFA 4C0AC 1U0HC 2ZUDA 1EK0A 2VSXA 4AK9A 1E2LA 1IN4A 4JLAA 5B57C 1S0UA 4GFDA 5HPYB 4LYJA 4C2UA 1IY0A 3CM0A 2H1LA 1NG9A 2EQBA 3CONA 3IBGA 4GBMA 2YYZA 4DDUA 1DAFA 2FH5B 3B13B 1GRQA 4P4TA 4C0KA 4ITRC 1GILA 3CRW1 2NPFA 4TT3A 4KVAA 2H7VA 2XNSA 5CJ2A 4MYTA 5TV2A 1W49A 4OHXA 2WV9A 3RWMB 2R6GA 3FHTA 2D3WA 5GJWC 4ZDKA 5HKKD 3CKLA 2ODEA 3EZ7A 4LBWA 1VMAA 2LWIA 4P4UA 1KSJA 2E9SA 4IW3B 3AEZA 3QIAA 2X19A 5EP2A 2WJJA 2FGJA 3LQQA 2FSFA 4ZV4A 1ZUIA 1A2KC 2WKPA 1OB5A 1AN0A 2Q9AA 1NI3A 1NKTA 2I3BA 3KDSE 1TMKA 4GPTA 4M4SA 3EIEA 1E79A 1XD8A 4TL7A 3WYGA 3CB4A 2ZE8A 1YE8A 1N0WA 3EASA 4GZMA 5IBKB 3KQUA 2W58A 1KDRA 1JECA 4PSAA 4G5QA 3QXHA 3HYRA 4UXIA 3TVTA 3C41J 4S35A 3AV0B 2PX0A 2JEOA 3SNHA 5L3QA 2VEDA 4FWIB 1KI7A 4DLUA 1NIJA 3K9HA 5A5GA 3FPAA 1U94A 1J8YF 1P2TA 3OGMB 4JVNA 2GXUA 3LY5A 1VCOA 5K8UA 5CITA 4WAUA 1T91A 4V03A 1XEXB 1EXMA 2AKYA 3QVVA 5FL7A 1CLUA 2NPIA 2F55A 3KB2A 1P75A 1FX0A 3C6NB 3LBIA 5SZHB 2AD1A 4HATA 3AVTA 1T5LA 2GILA 4BFWA 3K0SA 4XH9B 1Q1BA 1QHXA 5KDOA 2GVZC 2KBEA 4F38A 1DOAA 1N6HA 4BFUA 2A5YB 3VR4A 3ADKA 4QM6A 1G20E 1WA5A 4MA4A 4O2RA 1OLOA 2VSFA 4IFEA 1D8TA 2CL6X 2VA8A 1KKMA 3HPQA 5AJYA 2H18A 2ZI7A 3PIRA 3QKSB 3DEFA 3IQWA 4PQFA 3I72A 2XOKA 3AVYA 2H5EA 2WVJA 3Q5DA 1X1RA 2C2HA 4JL5A 2QMOA 5KPDA 3GFPA 2IXGA 2REXB 1OJLA 1U8AA 2F43B 3EARA 4QNRA 5FPSA 1NN5A 3FKQA 4UNRA 1CR0A 4CEJB 3GJXC 3BE4A 1SVWA 3BK7A 3SBEA 2BVNA 2XNDA 1Z07A 1HA3A 3G82C 1G4AE 3M6AA 5G41A 2ZVQX 2NOAA 5DIFA 1R6BX 4AYTA 3THYA 1Z06A 2Q9CA 3U5ZB 1TTTA 3EWAA 4WIAA 2J0QA 2XJ9A 1SKQA 4NDZA 4B3BA 1CF4A 2GJ9A 2AHOA 2J59A 3Q72A 4IOJA 1ZM7A 4LV6A 2QP3A 1II0A 4CEHA 1OXVA 4OKSA 2OVRB 2HT6A 1H8EA 2NO7A 5GJVC 4LI0A 1BMFA 2CNWD 3C15C 2XB4A 3NKVA 1VCNA 2VH5R 5IDVA 4LPSA 4D82A 4LJAA 1AQYA 2RGXA 2WIBA 4NYJQ 5G40A 1NKSA 1WBBA 4Q1CA 4DJTA 3GLHA 1SVOA 4XTRA 1IHUA 2FGKA 4NCNA 4Z8YA 2QAGA 1XJCA 2R2AA 2O0JA 5LDDC 2V6JA 4Q4HA 4FWTA 1Z0IA 3KQKA 2AFIE 1SZPA 2EFEB 1D2NA 2ZRFA 4NE2A 4DXAA 3WNBA 3A8TA 3GEIA 1N5JA 3CRQA 4GOKA 2RAPA 3EWSA 1XMSA 3L8YA 3N5CA 1Q21A 3ZIAA 3U44A 2G0NA 4DDVA 1KO4A 4ZIRA 4P33A 1NRJB 3LQRA 3PUVA 4DCNA 2FEMA 4DLVA 1E0KA 2FNAA 4HDQB 1CR2A 1KI6B 4RD6A 4Q21A 1MRSA 1AQUA 3CRVA 2DHRA 4HLCA 2GEUA 4RKEA 1DAHA 4A8JB 4OHVA 2FFBA 5CLQA 2ZJBA 2WAYA 2ZI5A 1G7CA 3CNNA 2V7QA 2ORIA 4DB4A 1S4QA 2P5SA 3A4NA 2G1KA 2H8KA 4U7DA 3QY0A 1XTQA 4PQYA 2V8OA 2EFHB 2J7KA 2QGNA 3NXSA 5D3MA 3V00A 4CZ2A 4W5JA 5F9HA 3QPVA 1XJQA 2PX3A 3IUYA 1GWNA 2O52A 5FOTA 4M9QA 4W9MC 1QF9A 6Q21A 1U9IA 3RS5A 4YMTA 2ZR7A 3NH6A 1PV4A 2IS1A 3QXJA 1K5DA 5DI3B 3S1AB 1XBTA 1TX4B 1G3RA 4A82A 1XB2A 4CIDA 4WVFA 4ABYA 1TADA 1TUEA 2MMCA 3FVQA 1KZGB 3THXB 3AP1A 4BFVA 1SKYE 1KK1A 2G0TA 2Z0MA 2PZEA 4LV8B 2IYRA 4B3XA 4D0LB 4F93B 2NG1A 3B5JA 5JEDA 1NEXB 3DHWC 2FSHA 2QT1A 3OE7D 2AWOA 2G6BA 1TQ2A 1DELA 1HTWA 2CE7A 4RY2A 2ZSBA 1ZW6A 1S2MA 4C3ZA 3EG5A 4KFUA 2WJYA 4CEIA 2WKQA 4JLOA 3P32A 3KQNA 4I81A 5C18A 1MABB 3V7DB 1CRQA 2ZS8A 4RKFA 2FJUA 2GJAA 3T35A 3LFUA 2ZU0C 3TAHA 5FBLB 4TTQA 1G9XA 2ZJZA 3PR1A 4TWZA 3LWNA 2HCJB 2XZPA 3U4QA 5DHFA 1UPTA 8OHMA 5SZKB 1K5GA 1W48A 2J7PA 2WJHA 3SJBA 1TF2A 5ELXA 2GCOB 4G0NA 2IL1A 2JIZA 1OYWA 5CK5A 2P1PB 1HQCA 1KI3A 4BGDA 3FMFA 3JZAA 2YKGA 4M2LA 1NVVR 4G01B 2OG2A 3O47A 1E2GA 1SVKA 2QTVB 4I99A 3W9YA 3BBPA 2ZRHA 3M1IA 2F9MA 2PCJA 3BH0A 2IK8A 3FMOB 5FI1B 1IN8A 3K9LA 3ECCA 1W5SA 2IYZA 2P1NB 5JZVA 3TW8B 3CWZA 5C46F 2JLQA 2YWGA 3QKRA 2GRJA 4QM7A 1WMSA 4BQSA 4U02A 3RS7A 3W5JA 1G8YA 1MR3F 5FOXA 2FZ4A 1Q57A 4YDSA 3MMPA 2GXSA 5IK2D 4IVRA 2UKDA 1KZ7B 2OT3B 3O8BA 5J4YA 2O8FB 2OVQB 2MSCB 3LXRA 1E32A 3ND9A 2IF0A 2OCYC 3FE2A 2NIPA 2E1RA 4HB4A 3K0FB 3SFZA 4L9WA 2UVQA 2ZREA 1N5LA 1Z6YA 2GA8A 3K9NA 4CRWB 1EG7A 2ZVPX 3KTAA 5CIQA 3W90A 2JGNA 4TLBA 5EXPA 1IAQA 1NN0A 4IEIA 2ZRGA 3B9PA 2P6NA 2ZRAA 1O3YA 2CL7X 1G3QA 4PO9A 4A2QA 2Q21A 4ESHA 4QFMA 3FMIA 3QJYA 5TB5A 1LV7A 1NVWQ 4LSGA 1QHSA 5DO9A 2OUKA 2CK3D 1F5NA 1LF5A 4XWAA 3SR0A 3GJ7A 2BWJA 2TMKA 3P20A 2R62A 4MKIA 2P1OB 4A4DA 1Q3HA 2P5TB 3K53A 5C4GB 2H16A 5JWOA 4RCZA 4D4MA 5FTKA 4BRWA 2FSIA 2V3CC 3UWKA 2AXPA 4UNNA 1KHTA 1JPJA 4TLCA 4ZCLA 1JI0A 1PLJA 1E9CA 1GNQA 1KI8A 1KJZA 1D9XA 3DL0A 3QOFA 3VKHA 1AS0A 2ZRPA 3KXIA 2ORVA 1XPRA 3EIQA 2CL0X 3OIYA 4M1WA 4GMXA 3OIUA 4JT2A 4TMTA 3K0EA 2MSEB 3P1JA 3GLFB 3R8FA 5TMPA 5JJKA 2J9RA 3C5HA 4F91B 3CZPA 5AJWA 1P9NA 2QNRA 5J47A 3QEJA 5KDDA 4DSNA 5L3SA 2ZSDA 3PEVA 1IQPA 3HP1A 1LS6A 4NZYA 1YR7A 2W6IA 3VNUA 3MGCA 1DG3A 2J0UB 2V9PA 3CNLA 1W46A 2ZR0A 4L8GA 1N5KA 4PXAA 1Z08A 4NH0A 1YZQA 3BFKA 1GP2A 3B85A 3M4YA 2I1QA 4M1YA 1JXMA 2ZRBA 4AG6A 2XSZA 1AK2A 1KMHB 1E2EA 2RGGA 3Q9LA 4IXNA 1VCIA 1SXJD 3TSZA 3Q7PA 3QKUA 4KSBA 3NC0C 3HR7A 1G3IA 2FG5A 3TW4A 421PA 1KDOA 3GLGA 1MKYA 4AKIA 1P60A 4Z1MD 5J5CA 1TEVA 2GDJA 1XNJA 3AKCA 3AP3A 3WP1B 1IN7A 4B43A 2ZSFA 1N6NA 3RNLA 4PANA 3WSOA 4KYIB 3UMSA 3R9XA 1IXRC 1SHKA 4FINA 4AI6A 2D2EA 2VP5A 4MYHA 1X6VA 4JLPA 2CJWA 4TMWA 1H65A 1UF9A 4OQLA 4B2IA 4GSYA 1W36C 3C16C 2O8BA 821PA 3B6EA 3ZVMA 1M74A 4HZUB 2JLZA 4URUR 2C78A 4I1OA 1ZM9A 4DCSA 3LA6A 4PHHA 2O8DA 4EJSB 4QGAA 1KSGA 2F3TA 4V0ME 4DRZA 1H8HD 1XXHB 2B92A 3T12A 2CE2X 4LOAA 3I3SR 1Z6GA 3PQCA 1JR3D 1G5RA 1W47A 1MO6A 4R2HA 1TPZA 2VP6A 2ZRJA 3ZZTA 2FU5C 3IIMA 1AGPA 1V5WA 2ZRLA 2GCNA 3FKSD 1KSHA 4FMDF 2DFTA 1RE0A 4F4JA 5JJLA 1P62B 1KJYA 2R9VA 5P21A 1XTRA 1AIPA 1Z2AA 2E87A 4NTZA 4FIDA 2AR7A 1DPFA 4R98A 4PAMA 2AXNA 3A1UA 1GNPA 4DIDA 5EP3A 2XXAB 3OGLB 1KSFX 3AGPA 4L15A 3IPXA 4TQAA 4ACAA 2BOVA 4WBSA 2BV3A 1A1VA 1RYFA 2XJ4A 5JWHA 4B44A 2B8WA 2WMOB 4WZ6A 5BN3A 1KAGA 4B6FA 3ZVRA 3RS3A 1KO7A 1YJ5A 4LHXA 2VP4A 4NL4H 3EPHA 1FQJA 2HXYA 4Z51A 1Q44A 2IEZA 1E94E 5SZIA 4ARZB 2YZ2A 2J0VA 2NTYC 1NSFA 3ASZA 1P61B 3EPJA 1T5IA 2ZAMA 3W5IA 4DVGA 2JAQA 4JBXA 4LX0A 2L0XA 2JJ8A 1YZKA 4G5GA 1NJFA 2W00A 3GPLA 1M7GA 5H8WA 5F9FA 3OAAA 4OJQA 4P31A 1G6OA 1UDWA 3GJ8A 1Z6TA 2EYUA 3N2EA 4JSTA 1NLYA 4RFSB 4FMDB 4EQ6A 3RYTC 2QRNA 3T06B 4IOMA 4Q4JA 2D7DA 3RVBA 3A6PC 1BS1A 1KKLA 1D2EA 4DWJA 5KPJA 1U8ZA 3F3YA 2RMKA 1G5PA 4Q5IA 2ZEJA 4KYUA 4Z8XA 1Q1QA 4TZ6A 3DKPA 1ZU5A 3VHLB 2R6FA 4PHTA 3UANA 3B1WA 4JLMA 2CCGA 1ETUA 5J4KA 5HZKA 5KSOA 3K0AB 1FUKA 2OVPB 3AUYA 4Q9JA 1XZPA 5FL3A 3RS0A 1OF1A 3U3RA 4DLRA 1HURA 3TE6A 1QG4A 1NMYA 5KYKA 2F1HA 3EZ9A 4DLTA 3WBJA 3DO6A 1RRGA 4GMDA 2ZITA 4U00A 1N6OA 4TMZA 4QC2A 5JWRA 4LBYA 3K70D 2O8CB 2ZRNA 1J2JA 2IYQA 4N0EA 3ZZ0A 3OEHA 1WE2A 1AZSC 3CF2A 3SFVA 3PFIA 2IWRA 2I1VB 2XGJA 4II7A 2OLJA 2YOFA 1US8B 1G8HA 1VG1A 1W0KD 1XEWY 2ZJYA 4X8HA 2ZRDA 2CXXA 3LH5A 4Q47A 5AUOB 1IOZA 5FL7D 4IDPA 2RGCA 4PSVA 2NO6A 1NJGA 1VPLA 2A5JA 2BBTA 3MJHA 4FXPA 4QHTA 4XJXA 5JS8A 1F2TB 2PEYA 2EVWX 1L2TA 2VYFA 4NPHA 3SJAA 1E4VA 3C7KA 2A5DA 3SZRA 4LZZA 4Q7JB 4CDGA 1OFTA 1FUUA 4OL0A 2GK7A 3SEAA 5KNCA 2QP4A 4DEXA 3PCRB 4PO8A 4F4IA 2ZM5A 4D25A 3U7EB 4PC2A 1YR8A 4MUAA 4TL9A 1XD9A 4WXPA 2P1MB 2G83A 4TYYA 4B71A 3CF6R 3QXXA 1NVXQ 4PPQA 1X3SA 3QXCA 1TQ6A 3LDAA 4IDQA 1OV4A 2HDNB 1OIWA 2WOJA 4MRVA 1EFRA 4TSFA 1UAAA 4JLDA 1G8PA 5DHAA 2JLWA 2W0SA 1U2RA 2RGBA 2XNDD 2OEPA 1N5IA 1ZP6A 4HAZA 4UNPA 2Q3MA 1KO1A 1P6XA 3PUWA 5DYIA 3PV0A 1P2VA 4G3XA 1DVRA 3C6PB 2CLDX 3RANA 3CR8A 2VHQA 3OIWA 1GL7A 1XF9A 2QROA 1G1MA 2NZJA 2HF8A 1G3MA 1ZC3A 1FP6A 3THWB 2QORA 4LRWA 1VIAA 3BRWD 1RC8A 3L2OB 3HU1A 5D3QA 2G1JA 4ZDWA 4Q1AA 2VPPA 1ZM3A 3A1SA 5DN6D 3CNOA 2YWHA 2O8EB 4JLVA 1CXZA 1ZNZA 3JVVA 2OHFA 1BO6A 1BYUA 2I4IA 1H8ED 1GNRA 2HLDA 4MDFA 1BMFD 4B2LA 3TMKA 4GDFA 1QBKC 3VU9B 2EU8A 5HE9A 1NIPA 4P4SB 4DBLC 4KCGA 3CH4B 2RGNC 1G8GA 1R5BA 1U90A 3BORA 4GP6A 4RZXA 4J0QA 3CIOA 5JJIA 4JSYA 1Z0KA 2BBWA 2OFXA 5HE8A 3MD0A 4OI4A 3K8YA 4KU4A 2ZJOA 2DFLA 3DM5A 3GFOA 3BD9A 4TQ9A 5E7IA 4WXRA 1KYIA 1ELOA 1ZCBA 1SXJB 3CLVA 4OHZA 1R7RA 2HCBA 4MH0R 4RD2A 5AJZA 1W0JD 1YHNA 1GL9B 3TUIC 1ZAKA 4BZPA 3CO5A 4Q48A 4YC7A 3OFNA 3H2YA 2V1XA 4MKGA 3RRNA 3AB3A 1CJUC 4FI3C 2FV8A 1GKUB 3ZIAD 2IS2A 2AWNA 1E9BA 1W1WA 3RABA 2XB2A 3K0CC 1W2GA 3LW7A 3AVQA 2JDIA 1OXUA 4DKXA 5JSZA 5EE0A 3U7HB 4DLYA 1NBME 1T3HA 1F2UA 3AVUA 2WWYA 4D4LA 4Q4AA 3NBYC 1OHHA 3PG5A 1KI1A 2WHXA 4LC0A 1M2OB 3AKDA 1KNXA 2V1UA 1II8A 1U81A 2IHYA 2ZTSA 3E1SA 2A2ZA 3OESA 3QF4B 2QMHA 4O25A 5GJBA 3NHAA 2JJ2A 1YR9A 1UFQA
chains in the Genus database with same CATH superfamily
4BQQA 3KHSA 2HHJA 3PI7A 1Y7LA 3LLVA 3KLBA 3ZU3A 4ZDIA 4F7WA 1VA4A 1ZQ9A 2QI9C 1W5TA 3E9ZA 1V95A 1J9ZA 4G1BA 4YJGA 3TVDA 1FNDA 2Q1SA 1YZVA 3JPWA 3EH2A 3OEED 5AVUA 1CV2A 1NFRA 3GXBA 2WEKA 2XCOA 4KDFA 3S2YA 5JXJA 3CVYA 1RQ2A 5BRJA 1NXVA 1PJLA 1YJXA 2LKDA 1G20A 3HA5A 4RLSA 4WA7A 1CLEA 1D0IA 2V7XA 2E4XA 4XM0A 4IIXA 4RHYA 5LQKA 4C4SA 1N2HA 3DGEC 4PZCA 2WAXA 4DA4A 3L7OA 1JU3A 3JRXA 2YWEA 5EJIA 4IX9A 5EHQA 1NBEA 2PPVA 3CE9A 4M99A 3H5WA 3ZWDA 1YKFA 3PRKE 1XDWA 3ZLTA 1CD5A 4I3GA 1E5LA 1F7UA 2XWQA 1XTSA 2WIFA 3ZEAA 3VFDA 1MTOA 4HLUA 1Y5RA 3ZDCA 3UK1A 2BDTA 2WU0A 1BXKA 1GQRA 4KJXA 4OB7A 5C7LO 3AVPA 3MXOA 1FEZA 4OP3A 1DC8A 1SVSA 4WOPA 4B7UA 1ANKA 4AKHA 1TLLA 3HG7A 3QENA 1UBNA 3TLAA 2X8JA 4K7JA 3OQMA 1OH6A 1OLXB 4YUVA 2YW9A 3NFRA 3FDFA 3I45A 1QQ7A 3F6EX 4GEGA 5ILGA 1OROA 2ZG6A 2ZRQA 3EMDA 3LXUX 1M9NA 3KYIB 3TQOA 3W78A 3BWXA 4EVQA 4FHDA 3WP0A 1E4EB 1AH2A 5DCYA 1V8DA 4TSKA 1C3EA 3UKJA 3DZDA 5C7OO 2Z8ZA 3IJRA 1FFEA 2VYVA 2GN1A 3KSZO 1EVZA 4O33A 5HOEA 1B8PA 2WWWA 3MRSA 4ZREA 3WWZA 5K8TA 3BXHA 2ERCA 1DEHA 2AKAB 3EFEA 2XGSA 1N2GA 2ZIVB 4RK5A 3BICA 2PSFA 2BEWA 2E5WA 1QH1B 1WXGA 2GMWA 2FEXA 4RVGA 5TMDA 3RC1A 3DZJA 3C8UA 3REOA 3E9YA 4B7ZA 4WNAB 5JHHB 2RKHA 4UEKA 3OLVA 2R79A 4XYBA 4QSMA 3ZZMA 2NO0A 1X1AA 3RIHA 4D4KA 1GG9A 1ISPA 1K2WA 4DGQA 3ESXA 4RANA 4NKRA 3OT1B 4X1KB 4CLEA 3SYLA 2HRDA 1ZSYA 2P4HX 4M8NE 3LSTA 5HW0A 5L4NA 3DVAB 1J8VA 1P29A 2AFIA 3VM6A 4F1KA 4N1AA 5EIFA 1RYDA 3AUFA 1M2KA 3QWBA 3CW9A 4LK2A 3ZNQA 3KUCA 4RH1A 5AP9A 5FRDA 3BC1A 1P1RA 1X7GA 2AOTA 4I9NA 4LK3A 3R44A 3FLEA 5FI0B 1LJ8A 3S70A 1E0AA 4KKXB 4NEQA 1MEJA 2NYRA 3I28A 1FP4B 5EFOA 2H2AA 5B1DA 3ENQA 3EC1A 3H5TA 4JA2A 2FW9A 1MZPA 4GVXA 4NE7A 3UT6A 4H1UA 1Y6ZA 3IOEA 1T36B 3I9LA 3EEOA 1LNQA 2AX3A 1ZISA 3I9KA 3LCCA 3D2AA 3HK2A 2XMDA 2C1XA 1CUUA 1OYYA 2IHVA 5KCMA 1WUTA 1OZGA 3O82A 5J2TA 3KLMX 3HKCB 4D8VA 1KQPA 5BSWA 5LUAA 3GJZA 2VNHA 1PGOA 4URXR 5J23A 3NT4A 4HUQB 2UVPA 4QNCA 1KVSA 2XHEA 1GGKA 3D43A 4HYYA 4D43A 1U11A 3R4VA 2I9PA 3FOCA 1XZKA 3LLMA 3RSHA 1OX5A 4FX2A 5K3AA 5G1PA 1QHFA 3Q4GA 3WQBA 1FFSA 2FPRA 4KQIA 2J5RA 2J30A 2OCAA 1ZSVA 5B53A 3PI6A 3RBAA 2VJ4A 3GLUA 1CJKC 2R7LA 4XOIA 2OCPA 3TPZA 3R0XA 1CQZA 4PSDA 3RRMA 2HJHA 1P4HA 4E2ZA 4IIGA 2ZXUA 3OJXA 2LV8A 2CLEB 4GHWA 2GJ4A 3BL8A 4IVQA 2VP0A 4GMHA 1L1EA 3VSBA 5AW7A 3F9CA 1I01A 3KAQA 3G8BA 2PG3A 4J7CA 4CKBB 4FJXA 4F2HA 5JXWA 1FFHA 3ZY6A 3VHRA 2QPAA 1X2BA 3UJ6A 3QBDA 3UFBA 1J1ZA 3LV8A 1SXHA 4NFSA 4XASA 6REQA 3KZOA 3TUZC 3AEXA 3H04A 4KH1A 4Z99A 1KJWA 1XO1A 5JRZA 1JVNA 1KK0A 1XP8A 3JWPA 4WI1A 4XB6B 4ZKEA 4JI6B 3GLFE 2B25A 2EKZA 3AUAA 4NK4A 5CXXA 3ENNA 3LF2A 3SHWA 4JP3A 2JFPA 2NNLD 2F3RA 3ISTA 4C6SA 1YJ8A 4DTRA 2YCLA 2RB4A 5EWLB 4ZYUA 1PGNA 4Q1BA 3E15A 2G04A 5E6SA 3G1WA 3AF3A 3X1ZA 3CNEA 4RHCA 3WK4A 2XCUA 3M2PA 2NPOA 3D4NA 1P3Y1 4UEWA 1JHVA 3B52X 4RV5A 2P30A 4GW3A 5E4TA 2CVHA 4M0LA 4JYAB 1EX1A 2QJWA 3D0RA 5LDGA 4CKZA 1KIFA 5K7SA 3FYDA 3ZV4A 4M3ZA 1BEZA 3RHFA 1Z0AA 10MHA 3QEWA 4Q4CA 5IH7A 2R7AA 1LDNA 1KH2A 1FS6A 4KTTE 4TV9A 3D2CA 1PJCA 3N8DA 1X0VA 1YZGA 1VIDA 2BSXA 3F46A 1XROA 2FEKA 2IUSA 1V11A 3R9IA 3I5XA 3D59A 1CS4C 4JRPA 1X87A 4DY4A 1R4AA 4IMJB 3RC3A 1M2VB 1XJWA 3RBXA 2ECKA 1JJ7A 1YRQA 1HT1E 1YBHA 3DT9A 1IDOA 2VK8A 3EGDA 1U6KA 4FGUA 3WWDA 4RLQA 4D6PA 1UAGA 2QL9A 4MUBA 1RLUA 1L5KA 2DYKA 2QRPA 1A88A 3RMDA 3ROFA 4WH0A 4ZCIA 1Z8HA 1BGWA 3L8GA 7YASA 1FXXA 5DK4A 4DT1A 1AXGA 1HE8B 1J22A 2O2SA 2CD9A 3EGCA 1MXHA 1XHEA 1SRRA 3QLUC 3RYIB 1GKYA 4OX9Y 4LQ4A 3GLHB 4K86A 2J9FB 1VL8A 2BUAA 2CVOA 3V2HA 3A11A 2ZP1A 4M42A 1Q74A 4AL4A 4HQNA 4PFJA 3DP9A 4HAXA 1E3IA 3LT5A 2HPHA 4QECA 5AKKA 1VGVA 1DTWA 2PXCA 4Q4HB 3JYLA 4RJLA 5AI9A 1G63A 1PQ4A 1XZQA 1UBCA 5BOSB 2WSIA 4EJSA 1KTVA 5EMHA 4ZI2A 3BWYA 1KF0A 1A9XB 1F38A 4QPJC 2WJ6A 1EMDA 4BWYA 4DC9A 1JEDA 1EX6A 1VHLA 3AR5A 1JHXA 1A4IA 4IOKA 1XHLA 2W2KA 4F4CA 2WF7A 3ZDEA 4WMLA 4K1XA 4F06A 1ADCA 3MWEA 2VF7A 1K3TA 2HPVA 2BM1A 4BKQA 4DUGA 2BEKA 1J8MF 1PI3A 2A0YA 3IRVA 4TKZA 4EKDA 4ENWA 3EY4A 5HRAA 1QYCA 3ILVA 2B1QA 1LSJA 2OL4A 1QIHA 1HC7A 5B1YA 3IXLA 1E6WA 1FMLA 2FF5A 4DSUA 5AM0A 2LXNA 3LUKA 2AYYA 3ZI7A 3RVJA 2LE0A 5C2JB 4ARSA 2JASA 4TOIA 3T3PB 4EABA 1VMEA 2ODBA 3QVJA 4PAOA 4HF7A 2PX5A 3ESBA 3FG9A 4QG7A 4LI3X 1I14A 5C8YF 4US0R 5EZSA 3PKIA 5EUMA 4MITA 4C0QC 1F7VA 4FOLA 1C1XA 2HZBA 1TEHA 1L3BA 4TSRA 3Q11A 4E5UA 4HDKB 1Z63A 4UUOA 13PKA 2EF0A 4CKXA 1RPJA 4CUKA 1JVBA 2DQZA 3VAAA 3PDWA 4I55B 2QTHA 1AV7A 5LA6F 2AI2A 2BE7A 4COKA 3DDCA 4OQFA 3T1OA 1V6CA 2OGSA 4M1MA 3T34A 3WXBA 1PEDA 1U0FA 3E2IA 3AJ9A 1NVEA 3I9V1 2I34A 1N1CA 2QE7D 4LBVA 4RJIA 5D84A 5BV1A 1APBA 2Z8YA 3B2QA 4M9RA 1EB9A 5KC8A 2CXPA 3F3MA 5DK6A 1ZY2A 1Z3CA 4N7JA 1QK3A 4R9SA 5ALJA 4HXYA 2R00A 4JYMA 4JENA 4PCUA 3QWHA 5B7NA 2CLKB 2RB5A 3S68A 1TCCA 1ZMXA 3E23A 2YIMA 2CDCA 2YVUA 1L4HA 2A9RA 4I6GA 3KOUA 4X7RA 2FI1A 3ZU4A 4NDAA 4X91A 2QYSA 3TLKA 1A7AA 1GPJA 1QPGA 2DY1A 3LQ4A 1AXEA 1CC1S 4MI3A 3OOYA 4M1QA 4O3MA 5DX8A 1I30A 2H5IA 2GKOA 3NS7A 3EC2A 1EDOA 2WF8A 4MRRA 3RUCA 4KFTA 2IXDA 3Q40A 1WSAA 5H4GA 4QBTA 1JAIA 1EUDA 3OKFA 1EJ6A 3AI3A 4NEGA 1FZ4E 5EP1A 3LI2A 3RSLA 3OCZA 2XTMA 3W3ZB 4ECAA 4FIZA 4ZYYA 5PGMA 2FEAA 3F0TA 3KKKA 2OO5C 1MJGA 5D1NA 4PGMA 2JZNA 3H8WA 4GICA 1WOYA 2OBNA 3DC7A 2Y93A 4P0TA 5CXUA 3P0JA 4OGWA 2PVPA 1UMCA 3WLOA 1YF3A 1XCLA 5EXDA 4E2WA 5A71A 3E70C 2DTUA 4MR7A 4TN1A 3RIMA 1IPEA 1O9GA 1RQLA 2AMVA 1M76A 5AKYA 2GAAA 1JYSA 2JD1A 4O2LA 2I99A 4AY3A 4DL9A 2OVBA 4IHKA 3ZYZA 1RZRD 4P3YA 5IKPA 1IQUA 2H9AA 2BM0A 2OHXA 1YRBA 1OW3B 4TS4A 3VBEA 1JDBC 1MC4A 4TS1A 3P9PA 3LWDA 3A32A 4WBNF 1KAEA 4KVGA 5FOVA 1I1NA 2PFSA 4QTTB 3QEBZ 4PC7A 4JJ6A 3Q3GE 5IH3A 2ZYRA 1AC5A 4X71A 2EX0A 1HM5A 5KAPA 4ZCMA 3L77A 4KP7A 2ZLBA 3HBFA 1Z38A 3I4FA 3KQVA 5AI6A 3RGWS 5F98A 3MWLA 1KYVA 2HMWA 5LQUA 4Q00A 3ZXXA 2HMYB 2I2AA 3HA7A 1XTKA 4GLJA 3QG5A 5LXTB 1ZL2A 2RJOA 1ZH4A 4QBHA 1YOVA 4IHQA 1EAMA 2Y8EA 1Z7YA 1Y6QA 3A7DA 1J1IA 1USGA 3C4JA 3QBJA 4QOEA 3PC3A 4KGVA 4LF5B 1FMCA 3QXSA 4KLAA 1R8QA 1L7RA 1ABFA 3T8YA 3E27A 3MW8A 3QKRB 4EPTA 1T9HA 4V0MA 4I6JA 5CIWA 2O4UX 1DJLA 3G5TA 1QWOA 3ET4A 1BMTA 1Y5NA 5C4MA 3MYYA 2O7QA 1Q3TA 1VL5A 2GLXA 2VAWA 1C81A 3KT0A 5HG0A 2CXSA 3ZCTA 5HCNA 2IS4A 3BH7A 5CRIA 4H6XA 5F73A 1NJ8A 3NEPX 1N9GA 1QIFA 5B4TA 2DEUA 1IVSA 3KXLA 1GR0A 1H3FA 1NMZA 2ETVA 1LX6A 2NTVA 5EIAA 3LBHA 4X63A 1NI5A 1X92A 1XKLA 3ZD6A 4IHAA 2RJ3A 4BDTA 2PKWA 5FT9A 1Y8RA 4MPJA 1NNSA 3OZXA 5CFQA 2DUUA 2F00A 2IGBA 4FR2A 4ASUD 1WVIA 5CUQA 2JPNA 2RKBA 1TYBE 1YL5A 2CK3A 4B0PA 2JLBA 3WB1A 2FUCA 1BWQA 1I4EB 2OE2A 1JT9A 3DAGA 1RJGA 3G0HA 2DHQA 4HGPA 4AFNA 1M73E 1DFHA 1Q20A 5MN4A 5CCEA 2N1BA 5KQPA 3NFYA 4G26A 1BD4A 2XA2A 4PZYA 3SJCA 3NPAA 3W6OA 1J0CA 1MVNA 1VBMA 3QUAA 4CT5A 3HCEA 4IRXA 5HZHA 1Y1KE 2Z4RA 4DR3B 3PITA 2YWBA 5ALKA 3UKOA 5K0JA 5L40A 1JLKA 3QK7A 3F8SA 4FP9A 4TSFD 4HYEA 2D2IA 4GBJA 3STUA 1E2PA 3ZOZA 1POWA 2VT7A 4Q05A 1G6KA 1TMOA 5EHGA 3UPUA 3ZCRA 2XDQB 2O0KA 4MW0A 5EA2A 1H6AA 3ZWBA 3AMVA 1FTNA 4MP8A 1TK3A 5KMGB 3A9TA 1QQTA 3OZGA 4UUMA 4RVDA 2QQGA 4L02A 4NOJA 3M1LA 3BVOA 2R6AA 1VPTA 1QG6A 3AF5A 3NOVA 3VI4B 3C8ZA 3WK5A 3D81A 4ZYWA 2UXCB 1I9GA 3I2YX 1OXTA 3I2KA 3KJEA 4JBGA 3BF7A 2BHRA 2JATA 2VTKA 2JL1A 4XOUA 4EVSA 2Z3ZA 2X0IA 1JILA 3DUWA 3FFTA 3A3PA 4OUKX 3RC9A 3AI7A 4WZAE 1GAJA 1TC1A 4EQZA 4P4SA 4EUNA 3DYBA 3QMWA 1NP7A 2GEDA 1P1CA 5AKHA 2HLDD 4AS2A 1HDEA 5IRCD 2NO4A 4PGAA 3V6LA 3EDYA 2VQSA 4C0XA 1ACLA 4CG2A 4JP8A 3WAGA 1SXJE 3DEIA 2OB1A 2ZBGA 3SC3A 1SZDA 4IV0A 1SG9A 3TOCA 1G19A 1VJCA 2YV5A 4QQNA 4PFQA 1DP4A 1U8CB 2ZRMA 1MO3A 1MV5A 1UFOA 1EXDA 3PGJA 1HPLA 3KQTA 1D1TA 4B32A 1O8CA 5EMJA 5CDTA 4P9NA 3G1UA 5BMOA 3LA8A 5CM9C 2BHTA 2ZE7A 1ML3A 1Z2PX 1Z5PA 1OWNA 4Q9KA 2B36A 3RTBA 3BXGA 1DLJA 2GZAA 2GK3A 2IYEA 3SSMA 1V47A 3OJ0A 5DZSA 2W8BA 2AG6A 3RYFA 3GK3A 2PZAA 5F7XA 4ARZA 2HQOA 1NF9A 5DHQA 3U9LA 4B74A 1ISIA 2OYQA 1E6CA 4FW9A 2H0RA 3W8RA 2OHGA 3QIVA 1G8AA 1OE0A 1FDUA 1XKTA 2DPXA 1IUNA 3KVOA 2ILVA 5BUQA 2FR1A 4L0DA 1ZD3A 3E53A 3MWKA 4CIBA 1NNEA 4IDBA 3DDSA 2NMVA 3O21A 3T7RA 4LQCA 5I3ZA 4EA9A 4F6LA 2QSZA 1L4MA 2PQMA 3FCEA 4JR0A 4ZPJA 5TQVA 3TQSA 5KYWB 1C4OA 2JJMA 3BSYA 4Q7LA 3U81A 3DTTA 3QUCA 3SKYA 3ETHA 1JR3E 4LZJA 4TMXA 5FOSA 4FM9A 1YDGA 3EF3A 4JZYA 5AVWA 1Y81A 1X94A 1VJRA 2PWBA 5C8XA 2H1WA 3R3YA 1RRFA 2LIVA 3NVMB 2VNSA 3GPDG 4I4TF 2WWXA 1LEHA 4QQ8A 4XUGB 5EIEA 4JGGA 2P11A 3GGDA 1N3IA 5BQPA 3SHFA 3QVUA 1VDZA 3E7FA 5HSGA 3ZCSA 3B1ZA 4FMCB 2WUEA 4X6YA 1QFSA 2WSMA 2WZQA 4K9QA 4YHBA 3W7VA 4ES6A 1SN7A 3CW8X 1D2RA 2COKA 4MPPA 4WNIA 2QN6A 3CH7A 1N2XA 1P5HA 1XKXA 1KJNA 5FBWB 4EGQA 1IJEA 2E7ZA 1XA0A 4EPXA 2P6UA 4YMGA 5HCUA 1Y9ZA 2BEVA 4RM3A 3P0RA 4QKQA 2C5EA 2E85A 2R6CA 3U0BA 3UXMA 1MENA 4JQZA 4KH0A 1DXOA 4MYSA 2QLBA 2C5GA 4F3NA 4YCNA 4PICA 1HMPA 2IYLD 4GD3Q 1CY6A 2ZWPA 1HDXA 1X1DA 2ZXEA 1GCOA 3FGZA 5K1ZA 3T5BA 4B7AA 1MC8A 3NC1C 1CFZA 3MMNA 3WGGA 4IWXA 2V98A 4GZ5A 2XQJA 4N03A 3U3MA 3D6FA 4KHWA 4DLZA 2NNWB 2GZHA 1DC6A 1PEYA 4EDHA 5WRFA 5JSHA 4XYMA 5A03A 1SAYA 4B3SB 3DO8A 1DBRA 1E61A 1JQKA 1YRAA 3STYA 3WSTA 3ICEA 4I2VA 5A3RA 2DFPA 1E64A 1UINA 4D6YA 2D2FA 3QRWA 2ODPA 2Q6OA 3LX5A 1KL7A 3KZVA 3N7TA 1YS2X 1SCIA 4JAVC 4LJYA 4S0ZA 4A6XA 4ZAFA 4Z4EA 2JFBA 4JV5B 2XUFA 1DAGA 4V02A 2CNOA 3ZDRA 5K8LA 3PD0A 4KLCA 1Q91A 1PW7A 4HS9A 5TGDA 5BR4A 1X1SA 3ZQJA 1OB2A 5JG7A 1ZA1A 2IUUA 3UATA 1KEUA 5M04A 1GPBA 3VPSA 3ESYA 1U7DA 4GX1A 4IXWA 2AN5A 2GETA 2PLRA 4HOYA 4N5MA 1ADJA 1ZBDA 2WNHA 3ABZA 4CKWB 1P5FA 1UBFA 3IODA 1ZRHA 4R81A 4IV5A 1GTVA 4JLJA 3T3EA 4N76A 2JJ1D 3AXTA 2IUEA 4GX5A 4F04A 5J2UA 2JGJA 2PRSA 3IO3A 1N3BA 3KYJB 3NBXX 1S3SA 1YJCA 3G7UA 3K0CA 1OCEA 1C3OB 3CTPA 3MRTA 2DF8A 1EVLA 4OM7A 4OJYA 4JD5A 3WNDA 2VQ6A 3WY9A 3QVWA 2FR8C 4G0PA 4EQ6B 4A5SA 1P9LA 1ECBA 1VMIA 5COQA 4E70A 3NWPA 1D04A 4JUFA 5JZSA 4MWGA 3IIKA 2LIPA 1CQJB 1AZWA 1CZKA 4LJLA 5AKZA 3TTWA 3ZH9B 2B7LA 2P67A 2RHOA 2VJCA 5HFAA 2PD3A 2VATA 4A8TA 3HYNA 4B4OA 3HBLA 1J7KA 1LPMA 1V0JA 2O1WA 3EUFA 4JB0A 5E8RA 1QYXA 3EAFA 1OH8A 2ASEA 1ICIA 1DBVO 1L5RA 3IVMA 3IR5A 3QBVA 3KEFA 3RTEA 3WRVA 4A8JA 3NDRA 4QO7A 4E3SA 2DR3A 2CCJA 2PLFA 4NQZA 5HILA 3GLTA 3SF0A 4EKIA 1DAKA 1KMNA 1WF6A 3A3NA 5CD9A 2HC9A 2G9NA 1FTGA 3H8SA 3JAKA 1UH5A 3DBOB 2N42A 3I1IA 4R7ZA 1CUHA 3LZCA 4UBIA 3UQZA 1IEXA 5F3RA 3RV4A 4E2YA 5JZBA 2ASVA 4FGKA 4BNNA 4M1SA 3JQAA 5HK9A 3I5YA 2PJDA 3GLVA 1E6KA 4MIKA 4AJHA 2B30A 3PXEA 1J9EA 2ZUUA 4XPZA 2CMGA 1DQPA 2XDYA 3M6FA 3SQOA 4A23A 1S89A 1VPDA 4CL3A 4YRGA 5LKAA 4JC8A 3OOEA 1SIBE 2R68A 1S8FA 2PR7A 3O8RA 2A58A 2Y2VA 1E2FA 4GI5A 3R7BA 2Q3EA 4PX3A 1OFIA 3T1VA 4PN7A 3ZN2A 4UBMA 3FIJA 3EGXB 4YO7A 2KW5A 3WGKA 4HCBA 3NT5A 4BMVA 2EP7A 3BB3A 3COYA 3LUPA 1GJRA 3OMXA 3THXA 2YMQA 3H9CA 3UJHA 1E0JA 5K8VA 1HOTA 3FBGA 3TRHA 2HYDA 1IZ7A 1NT2A 1SCUA 2EP8A 2X4LA 3E4CA 3OQNA 3CZQA 4WKNA 3HCOA 1RKVA 5DTRA 5BVHA 1K92A 4L27A 4CL0A 4JXZA 1NDQA 1LVGA 3ZNOA 1V7PC 3LPCA 1UBUS 4MO9A 1L8XA 4XIGS 2CXHA 2PN1A 1KI4A 2CFOA 4NBNA 2PE5A 4CDNA 1UC9A 1XMXA 3V4OA 3JPYA 3MRXA 3IDSA 4INZA 4MUYA 5IAGA 4FI3F 3SVLA 4I9LA 3JQDA 3EHEA 3RTCA 1XDDA 2BL4A 2G3YA 2VZ9A 4K9KA 2E48A 5JY6A 1E2UA 2EGGA 1LDKE 1L8QA 1RE1A 2OLKA 4H6PA 4OF4A 3ZQ6A 2IYXA 4CCYB 4UJ3A 1YR6A 1WXQA 5LOVB 5EKXA 3CX8A 5LZ2A 5JYCA 1IEWA 1RFGE 1MRZA 4BIIA 4YMIA 3MZ0A 4JGIA 1K7CA 4PBSA 5BV8A 1Y9DA 5TARA 2C03A 1WSBA 5C52B 4W5RA 5CFLA 2ZUCA 2VHCA 2OXRA 3HCBA 3KWLA 4IDHA 2LPMA 5ETJA 5CA0F 1TZJA 1M6NA 2PSSA 3TNFA 2XNCA 2QM7A 4B47A 5K8IA 1K7XB 1PJAA 3A6FA 3AEYA 5ILOA 4Z2YA 4OXIA 3CUKA 2J7PD 1T9KA 3A25A 4J4BA 3HB4X 3FB1A 4DHWA 5TPZD 1A2BA 3GHHA 1CS0A 4G86A 1W94A 2JH3A 2QTVA 5DN6A 4M3NA 1YACA 3BN3A 2JBWA 1R5JA 1QJCA 3DUFB 3GLHE 4DBZA 2HA3A 3NHFA 2Q2QA 3BK2A 2C96A 4Q39A 4EKEA 2HADA 5MFPA 4FOPA 1F51E 1RRVA 2QM8A 1L4NA 3GUCA 3HN2A 5LZ7A 4D9MA 3VKWA 1M5UA 3GGOA 5IAAA 3EVAA 3CURA 2P7HA 1FFXB 1MQ9A 1JBEA 2IPLA 2P1QB 2VYND 3S2UA 3D6MA 2XZOA 1X8KA 4UJ5A 5G4LA 2ZS7A 2Z1DA 5AVSA 2DXIA 1VG9B 2DHCA 2C7GA 2R7MA 2D1RA 1Q1ZA 4FCTA 3GQBA 2NSYA 4RIEA 3HJTA 3ELUA 2R1TB 3SE0A 1M2GA 5AVTA 1Y3AA 1RPNA 1K6MA 4G8JA 1YZTA 3WGUA 2XUZA 3IQFA 1KO8A 3IH5A 1RAAA 2TMDA 3A4IA 2WU3A 5CX4A 1USWA 4RKRA 5DSXA 3ZCUA 3GA5A 4J43A 5E7QA 5J59A 3WLFA 4B75A 3TH5A 4DQKA 1JG1A 2J3DA 3MTBA 2B78A 5TRTA 3JQBA 2FX2A 3NDBB 1E3JA 3NPMA 4CG0A 1NJ5A 1IXSB 3I1FA 4JS5A 1NVVQ 1PTJC 3M5DA 3ZK9A 3IHLA 1CEEA 2Q4EA 4OHUA 4YUYA 1IN6A 4KQEA 1JZSA 1T2AA 2BKUA 4L5YA 1QGDA 3PUJA 5G0TA 3U7QB 4J1TC 4REQA 1JKJA 3FWYA 2MMBA 1C7ZA 1LLQA 4WOCA 1E98A 1PZEA 4PAQA 4GOXA 3CY6A 4YCSA 4B40A 4YAOA 2JS7A 4JI5B 4IOLA 3DE7X 2JLYA 3NTQA 3HU3A 1K97A 2WP8J 1F2UB 1UIRA 2YV2A 2YOHA 1Z2CA 2XRFA 2CUZA 3IJ5A 3N2IA 4LC9A 1Q1EA 4DTMA 3KLOA 4YP0A 3PWZA 5KYUA 2VJLA 5JCOA 3AUUA 2FETA 3IURA 2I6GA 2WC1A 4UXHA 1M34A 3H9JA 1GFWA 3IAHA 2CJYA 2G5PA 4E2FA 1GAXA 1QRAA 3AU9A 2DG2A 4F96A 2RG1A 1UC8A 3GAMA 4O08A 4OPMA 3CH6A 4ZQFA 4C22A 3LT1A 3SS7X 3S7ZA 4V3CA 5HBGA 1A82A 2J3KA 1P44A 1KVRA 2C4WA 3VOBA 1EVIA 2CLIB 2HI0A 1QFMA 2PUJA 3D7MA 3JD2A 2Z4SA 1JHYA 4GZLA 4U9IS 1TTQB 2G67A 3ILYA 3L0MA 1P3JA 2AVDA 2YZ7A 1G18A 2XMPA 1GZVA 1Z6AA 4WW0A 5TGTA 4YBRA 4UTZA 1WR8A 3KR2A 4JI1B 4NP6A 1EJ0A 1G8FA 3REGA 1XZDA 4IEEA 3WL3A 5AO9A 2GLTA 2F8MA 4EZEA 5AD1A 1E20A 3JVUA 3W4KA 2HMUA 1FVHA 4NZOA 5B36A 4QPNA 5EJ5A 1FXWF 5IJXA 3P96A 5LQAA 4Q19A 1ZRNA 3MWFA 2PUBA 4ZVSA 3TL3A 4IGIA 1TDJA 721PA 2DWUA 4X6UA 4HWGA 1KY4A 1MAWA 4IIDA 1M6HA 5J2TF 5G3YA 2NO9A 3N2KB 4V0OA 4EA7A 2GZ2A 2VCHA 3R5JA 2YV3A 4I1UA 1GFSA 4L78A 4CEHB 1BS9A 3ECAA 3HFSA 1JTVA 1RYHA 1CRWG 3BQMB 3NWOA 3SIPA 2N46A 4RL6A 3SMVA 2QU7A 3LFTA 3QYJA 1OC2A 2Y68A 4AYWA 2OHHA 3NX4A 2DUNA 4L3OA 1NM5A 4MVJH 2IYTA 4BBPA 9ATCA 5HIKA 3FRHA 2I3DA 1UBEA 2LBPA 1X9IA 2IZZA 5MN5A 5GVSA 4AJ2A 7MHTA 3QEOA 1GCAA 3WMGA 5PNTA 3PU6A 3D4BA 1JL3A 4INAA 4RVUA 1U7XA 1Z73A 2A0UA 2HDHA 3AESB 3HYSA 3G89A 2JIOA 4U2BA 4WCFB 3QFRA 1AKRA 5J58A 2P1DA 1UKEA 1ZIOA 5B2ZA 3RS8A 2HRCA 4XKJA 3BOSA 5IDQA 3RS9A 4EP1A 4URHA 3OBIA 1FLDA 2B4YA 3OC0A 3SIWA 4JROA 2NSLA 3D2LA 1XXHA 2R84A 4U7JA 1WUJS 2A9FA 3KG2A 1BHSA 5TVGA 3FYTA 3UA4A 2X8BA 4JOQA 4ACBA 3WRXC 1JZTA 2XRMA 2CLSA 3SLGA 3NHPA 3KX2A 4Q9HA 1V1RA 3GGSA 2GPNA 4GEKA 4AQYB 2EGHA 1D4FA 3EXG1 1YCFA 1EA5A 1ID8A 2XTAA 3CRMA 3SHQA 4EF4A 4RVNA 1U0GA 1RCFA 1SMKA 2OOKA 3DVQX 4FVTA 4KQMA 4LSWA 4LISA 3TSCA 5KNLA 2VTBB 3BHNA 3CGWA 5JAIA 4JZKA 1I2MA 1XT6A 5AK4A 1XD2B 3L1KA 1P73A 1LTQA 2NTEA 4GRAA 3IKMB 2OILA 4KGZA 3WKBA 2CLCX 3NASA 4GOMD 2MDTA 3T15A 2FWIA 5LQRA 2EHJA 5D01A 2QPLA 4E5DA 1BVHA 2NQTA 3G59A 1PX2A 5A4FS 1GGMA 1A9OA 3EGVA 2I7DA 3ITKA 5L3VA 1KOLA 2X7JA 2CDBA 2YVKA 3DOHA 3TRIA 1Y42X 2IA5A 3SXUA 3CZCA 1NVUQ 3N9IA 1AGRA 2GNAA 2PEZA 2ZTHA 3NKFA 3N74A 4LJ4A 3KSUA 5JT1A 2HB6A 3R3VA 1A8QA 1EFUA 1Q83A 4TV9F 3F98A 5T3YA 3PDIB 5C80A 1SD5A 1WXIA 2PQ6A 4YP6A 1PHPA 4C7JA 2JFQA 3SNKA 4DTUA 1KQOA 2ODNA 3K4PA 4X3PA 2WW8A 5DNUA 3VKGA 3P4UA 4R31A 3K09C 3TKLA 1PJ4A 4FWBA 2ZWMA 3DZIA 1DIOB 2PMWB 3K5WA 1I2CA 4OG2A 1ZK4A 2GI4A 1NN3A 4N5NA 2I65A 1H2FA 2W11A 3UK7A 5LWHA 2ATCA 1XCMA 1XAGA 3K6SB 4XGIA 1CF2O 2I66A 2RAVA 1VHTA 2W7TA 5AW9A 4M1KA 1ZGZA 1GFIA 1GFZA 3VX4A 3ZWOA 4BLVA 1XVLA 4L7VA 1G7RA 4BS9A 5KNDH 1QLWA 1CW2B 1ZUHA 3BXZA 4BXOA 5EXTA 4BBJA 4QU8A 3DM9B 2UZ3A 1T9DA 5TVKA 3R7WB 1E63A 4F56A 5T4HA 1X7DA 1HTBA 1LDMA 2AOWA 4PG4A 1M5TA 4W7IA 3DV9A 4AIIA 1K0UA 5JSKA 1UBLS 5HQTA 3ICWA 4D0NA 2QL7A 3OTHA 4P0PB 1OX4A 1N92A 4MB0A 1F8FA 3C39A 1Z5WA 4X41A 4CEIB 2IYNA 1XMJA 3I9JA 2WUWE 3U3JA 4TKVA 3TLCA 621PA 2ON6A 1HDIA 5JS7A 2CVFA 3H5IA 5LIPA 3TFOA 3VHXB 2OGUA 1V8PA 2VHZA 4Y1RB 2IEDA 5E3HA 1UBKS 4DYDA 1K66A 3KOMA 4JY7A 4O2BB 4Q3NA 4PZZA 3BE6A 1NPDA 5I47A 3GYGA 2VAVA 4O4LA 4DMHA 4L8FA 1G98A 1NQUA 2E49A 3RRBA 2YVLA 4K6MA 5LA6B 2WR8A 4WEOA 1L8AA 4HV4A 2EJWA 3P9SA 1TQ4A 4BP9A 3P2MA 3HM2A 4OI1A 3DONA 3I04A 3TBFA 3HC7A 3B78A 3PFFA 4RPLA 2XOEA 3JS5A 3TYXA 2QA5A 5FFMA 3HA3A 2G9VA 3D3KA 4NBSA 2MIIA 1YGYA 5JJBA 1UBGA 1ZJ5A 4JKIA 4TTTS 4V0RA 2MZWB 1V3VA 4N8SA 1YR3A 1US8A 2BMFA 1HNZB 4S1PA 3CFRA 4HDNB 4OXXA 2I55A 4G0WA 2PD6A 4B7XA 1N8KA 1C2YA 4KUEA 1AJEA 2BFBB 2GN6A 3PXAA 2WTBA 1QS0B 1Z4JA 3DXFA 3W6PA 2HREA 2NSDA 2C8KA 3M34A 3OSZA 4C1NA 2J5XA 3TAEA 2QUHA 3BH6A 1I0IA 4ER3A 1QIGA 1TUBB 5DGDA 1IXZA 1RQXA 5G53C 5IYZA 1T9GR 1Y6JA 4CMIA 1BE8A 3IIJA 2ARKA 3NWJA 5CHEA 4JX9A 4XSGA 5F1YA 3I3OA 4BLUA 4XVUA 5CYGA 3MGAA 2VHWA 4ZJYA 4OY3A 1Q12A 2FDXA 2OGTA 3LUAA 1ZA2A 4PO3X 1MAVA 1Q11A 1OBCA 1XIVA 4I6EA 3OPNA 2WWGA 4P7FA 1X1CA 4K5QA 5EL0A 4ZYXA 3T95A 5IKOA 1T4CA 2IPXA 4BLOA 3AGQA 3A3YA 3KJZA 4DQ0A 1DIHA 4YMUA 2HTFA 1B3RA 9ABPA 5DHSA 3BMQA 2KLBA 4YV7A 4QIHA 4CGZA 1H1LA 3W5VA 2BRUA 2EDAA 4GPIB 5FTJA 2BI4A 4OJNA 2WD7B 3F4BA 3NH9A 1K4KA 1HETA 1LY1A 3FUXA 4OFBA 3SQNA 4WKBA 5KHOC 1GM5A 3TJYA 1N6RA 1Z35A 2JQTA 4YJ2F 1SVLA 2DUWA 5H7XA 4S05A 1NFQA 4QVIA 1E5XA 3NHLA 3NHGA 4WL0A 1AGXA 2GZMA 3NAZA 1ULBA 4P7GA 1VPEA 3TL8B 1Q19A 3AQ4A 3EYAA 2FUKA 1Z0SA 4YAEA 5BWOA 3HCFA 3DTYA 3OLWA 2FLKA 1EFRD 3BIWA 1F8UA 1V8ZA 2YFKA 4B3DA 1PZHA 5J4VA 4TLEA 3IQHX 4MGHA 3IMKA 4HI0E 2B1EA 5E1MA 2G1PA 1FYVA 2QNIA 5DI9A 3TX2A 1YRLA 4B7CA 2VWPA 1M6WA 3LK6A 3INGA 4HGQA 1D6JA 1U9CA 3OJCA 4JEIA 3S2GA 1A8IA 3T1HB 1ODCA 2PJZA 2I6QA 2JCXA 3N3AC 3A2LA 4Y2PA 2I6SA 4GI1A 4QTXA 1CTQA 3O3OB 4IQGA 2PGIA 3GARA 3H9BA 1WXHA 3U49A 3AKZA 2J9YB 1JBKA 5EQTA 3ZYCA 3OQOA 3FLBA 3HFJA 4YR7A 4XX0A 5A7GA 1YA8A 3IUEA 5AJTA 1JRLA 2O8VA 4EPYA 4ZRNA 3OQPA 1GZSA 3IE1A 1E1CA 4KNWA 3ZVNA 3O0TA 3G7NA 4ZQBA 5FI5A 3CWQA 3SN6A 1XDBA 1VL6A 2Z57A 3WLJA 4GWLA 4EUKA 2X4GA 1EFKA 1DS6A 1PFKA 1A1SA 1MHTA 1IN5A 4TGLA 2G4CA 2VDRB 3BHJA 2R5WA 2WHQA 3HMQA 3WRYC 1VJGA 2YS6A 2IX3A 3VBCA 5BYJA 1J49A 1A69A 1FUYB 4KN9S 4UM8B 4ZVKA 1UKVY 5IDWA 4LN1A 2FMFA 4IFBA 4OMFG 2CHFA 1H9BA 5IT4A 2P41A 3QPUA 5AUPB 1UAAA 3IT3A 2ZYWX 4I14A 4FNGA 4MGZR 4UNSA 3VH4A 1MX3A 1Q0TA 3B2EA 2DCUA 1DOHA 2ZIUB 4X7BA 4QJ5A 3V6MA 2FWRA 5FUXA 3EVGA 1YRYE