3L2OB

Structure-based mechanism of dimerization-dependent ubiquitination by the scffbx4 ubiquitin ligase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
308
structure length
274
Chain Sequence
AASTLTRLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVFFDYMAVYRMCCPYLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTTRRYSVIPQIQKVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-phase kinase-associated protein 1
publication title Structural basis of dimerization-dependent ubiquitination by the SCF(Fbx4) ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/cell cycle
total genus 69
structure length 274
sequence length 308
ec nomenclature
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00646 F-box F-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3l2oB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l2oB02
4KV9A 3BB4A 2Q9AA 2UZIR 4Q02A 1WQ1R 5FTJA 1RRGA 5FUXA 3UMRA 4ASUD 2CMKA 2ZRBA 1VTKA 3RABA 1N6HA 5C2JB 2ATXA 3MJRA 1SKYB 3G0HA 1JPJA 1C1YA 4NDZA 4Z8XA 1ZUHA 5JSZA 2VP5A 5KSZA 1C4OA 1FX0A 1ESNA 1Z6GA 4LV5B 2VHCA 1T5IA 3WBKA 3K0SA 4UXHA 2I1VB 3Q72A 3CPJB 2FV8A 4TMWA 3C14C 1NN5A 5JFGA 1ZW6A 2OV2A 3REFA 4PPQA 2RH5A 3IDQA 3QKSB 4V02A 1QHIA 3BORA 3ZLJA 1JQJC 2D4HA 4Q7JB 1J90A 3KX2A 1GAJA 2QSZA 1ZM4A 4WZ6A 3FWYA 3VR6A 1QHXA 3WNBA 3FFBA 2VP2A 1G7RA 2IW3A 3LVQE 2FNAA 1E4YA 2J1LA 1NLZA 4RD0A 3VNVA 1FTSA 4PQYA 1NF3A 4LJ5A 3EA5A 4I1OA 1E0AA 3AUYA 3TSOA 3T1TA 4ZO4A 3O8CA 3AVXA 1CF4A 4HAXA 2O8BA 1YJ5A 2FZ4A 3C6NB 1A2KC 1KZGB 1N6PA 2ZREA 3L0PA 3RRMA 2ZSFA 1MO3A 1E0SA 4NKRA 2BMFA 3A1WA 3BD9A 4JZKA 3SZRA 3VX4A 4C0SA 5FPYA 2D7DA 4Q4AA 3IIJA 1XP8A 3WXMA 1N6KA 3IPXA 1SVWA 2BMDA 4GFDA 3AVVA 1SXJB 5HE8A 1II8B 1E6CA 2Z6VA 4DSUA 4FCVA 1E2PA 4PHGA 5M04A 3VHLB 2R6GA 1XCMA 3CNOA 3S1AB 3PIRA 1E9BA 4IW3B 2XITA 3WMFA 3NC1C 4BPBA 2ZPTX 5DIFA 1OXUA 4US0R 1S4QA 4HUQA 1J8MF 4Y0VA 3ZGXA 5B2ZA 2ZI7A 4LJ4A 1WXQA 3E5HA 1FMJA 4MRVA 2VP4A 4BWYA 3B78A 1KI6B 4M9XA 3K70D 3CR8A 1G9XA 5AR1A 4W5WA 3JZMA 1IN7A 4YMSA 5K8LA 4MYTA 2H57A 1NVXQ 2OVPB 3TAUA 3K8YA 5SZKB 5FBVB 1W4CA 2GDJA 1TF7A 4UKDA 4OQLA 3Q9LA 5DISB 1W1WA 2O0JA 4RCYA 3VKGA 1Q0UA 2ODWA 1E96A 5SZJA 3ZZ0A 1FNNA 2QM8A 3MUFA 1Z29A 1Y3AA 2C9OA 3QG5A 3TGPA 5JEEA 3VQTA 4FD2A 4B32A 5ANRB 2FZLA 5DLQC 3BFXA 3QKRB 1TQ4A 1E2NA 2GNOA 3GJ0A 2PEZA 2W6IA 1XJQA 1NI3A 1R8SA 2RGEA 4NBSA 3FFAA 4JYBA 4Q03A 2EVWX 3CBQA 2E32A 4RKEA 5EUQB 2VSXA 2J9RA 2QEQA 1HA3A 2IYXA 4G01B 4DLXA 3CNNA 2ZRHA 4LYJA 4AD8A 1T3LA 1NN3A 4UJ3A 1OYWA 2Z5FA 2GCOB 2KSQA 1T5LA 3T5DA 2RHMA 1OHHA 5FTKA 2XXAB 3OIYA 3IEUA 4AKGA 1S3SA 4TQ9A 1KHTA 4A2PA 1FZQA 1QG2A 2ERYA 2V55B 4TLDA 1N0VC 2NPIA 3I32A 3UIEA 5AWFC 1PUJA 1IN6A 4RFVA 2OG2A 2N46A 3GD7A 1SVMA 1Q21A 3QXHA 1TQDA 2WICA 3SJZA 3NBXX 4DUGD 1GVNB 3VKWA 3NHBA 3TK1A 2QT1A 1QHHB 4V0MA 3QG1A 2IYQA 1G8FA 2EFGA 1XRJA 4KVGA 2QT0A 4MGYR 1KMHA 2F55A 1J2JA 1WF3A 3LV8A 1G1MA 4NCHA 4BLOA 1AZTA 1SHKA 5AJVB 2MMCA 5A0FA 3ZS9A 1XTQA 5IBKB 1KZ7B 2CL6X 2ERXA 3KKQA 2HUPA 1XEWY 5EJEA 2WJIA 4MRPA 3C5HA 1MABB 2BDTA 2ZAOA 4HZIA 4TYWA 4HAZA 4QGGA 2J0VA 1UKVY 2WAXA 3F5FA 4DBLC 2YWGA 3ONWA 1DPFA 4M1YA 1T9HA 2F1RA 4Q9HA 5EE3A 4QC2A 1DTSA 5IK2A 4PSKA 1NIPA 3CF0A 3MGCA 1OF1A 3NXSA 1GUAA 5FBLB 2QZ4A 4O2LA 1ZC4A 3AP1A 4AYXA 3P32A 2ODEA 3S1AA 1CR1A 1SVOA 1KAGA 3CF2A 3ECCA 1KI7A 4L16A 2ZUDA 4MRNA 3K0AB 2V4ZA 2O8EA 1EK0A 2QP9X 2BV3A 3CONA 5FOSA 4E22A 1JQLB 1TF2A 3A6PC 2XZLA 1UADA 2AX4A 1KI6A 5JCZA 3QNUA 4C9BA 1VG1A 3EPLA 2DBYA 4M9QA 1JR6A 3AF2A 4RCZA 4FWIB 1S96A 4S2EA 2RKOA 1A4RA 3GLHB 2AKAB 1WBBA 2PX0A 5KDDA 2YC2C 1XZQA 1QVAA 3C6PB 5K8UA 4DB4A 1YZNA 4YMUA 3SJAA 3SU8A 2J46A 3NEJA 2ZE6A 2ZI3A 4QHTA 3GLGA 3CX8A 1U2RA 4Q9IA 4C0LA 5AJXA 4B73A 1KY3A 3K9HA 4Z8YA 2ZAMA 2JA1A 2EW1A 3UMFA 4KFTA 2UKDA 1QHNA 4IXNA 2QORA 2WJHA 4BLRA 4EQ6B 1UF9A 2R6AA 5IK2D 2BM0A 3T1QA 4X8OA 1GNQA 1CRQA 2R6FA 4AYTA 2QTFA 3P27A 4BEBA 3SQXA 4KU4A 4EPYA 3CWZA 3SN6A 2XNDA 1QHSA 3QPWA 2IT1A 2XOKA 1GKYA 1P2UA 3O8BA 1GL6A 2A5GA 1DS6A 3QKTA 4GRAA 2P1OB 3IHLA 1A5TA 1GTVA 4V03A 4A15A 2VHTA 2PMDA 4IFBA 3PQCA 4IDOA 3LBNA 1BIFA 1T0HB 1GFIA 1CTQA 4I6JB 4TSFA 2VF8A 3P4XA 1N5LA 3FTQA 1D9XA 3CIOA 4EPRA 3VR4A 4DIDA 4RZXA 4JBWA 2IXGA 1YR6A 2OCYC 4NYJR 4PZYA 3PUWA 1XPRA 3T35A 4PHFA 3RDPA 1VYVA 1KIMA 5FUWA 3T06B 1W49A 4WAUA 4JVSB 1F2TB 3MFYA 5KPJA 3U3RA 2F43B 2WHXA 2BJWA 2RGBA 5EP1A 3CPEA 3WYGA 2FDCA 1SZPA 2ZSEA 4OJQA 5FPSA 1Q1EA 2ZRKA 2PCLA 1E2JA 4NYIR 4W9MC 1HTWA 1ZINA 2X2EA 4JBXA 3KJHA 4DT1B 4CF7A 2IXFA 5GVSA 3EZ9A 2VEDA 3NTUA 3DEFA 1N6LA 1JECA 4GSYA 2NGRA 3TJZA 4ERNA 5BXQC 1OFHA 4L9WA 2GCPA 4LYAA 3U61B 3OGKB 1AA9A 1W7AA 1ZP6A 4B33A 1W36D 4JLKA 2XOKD 2VPPA 4XH9B 2KWIA 5GVRA 4MKGA 3I73A 4Q5IA 2NO0A 2YNMA 3K0FB 3PEUA 3THXA 4ITRC 1S9DA 2RGNC 3AF3A 1MR3F 1XTJA 5FTLA 1VYUA 4M2LA 4UJ5A 2GK6A 4C3ZA 4LHWA 1KK1A 1IN4A 4LWZA 3UG6A 3GFTA 5KU1A 3T1OA 4OQNA 2HEIA 1T3HA 1FMLA 4CEHB 4CEIB 2FFAA 4A0GA 3K0CA 4IDQA 4LV8B 3NBFA 1DAEA 3TR5A 1ZIOA 4XVRA 4DDWA 1OV4A 3QXSA 3R8FA 3C8UA 1A2BA 1OXSC 1E2DA 2CDNA 4ZKEA 4JT2A 3QJYA 5EQTA 2GAOA 2A2ZA 4DSOA 4CYMA 4V0NA 2QUZA 3IHWA 3PUZA 5L3QA 3EIEA 2DCUA 4G1UC 4CZ2A 4LJ7A 2IS2A 1N5IA 2J0SA 2GEUA 3MWYW 3U4QA 3ADCA 4LJYA 1NNEA 4OHYA 3DKPA 1LV7A 3REGA 5DI3B 1W48A 4YMTA 2RCNA 1UAAA 3EASA 3QENA 4TMKA 2WPDA 1VIAA 1IOZA 4JLVA 5JJKA 1NY5A 1E79A 3ASZA 6Q21A 2OEPA 1HQYE 5J47A 5EXPA 4FMBB 5DHAA 1YR7A 3A1VA 2C78A 2ZETA 3P20A 4DSNA 2F9LA 2ZJ2A 2EYQA 2WV9A 1Z0FA 3PR1A 4HLUC 4EQ6A 2ZRFA 2HF8A 1DEKA 2G77B 4Q7KA 3N2EA 3A36A 1I4LD 4ZPXA 5FOXA 4NYMR 1PV4A 2I3BA 3DKVA 3KKPA 3UG7A 1WBDA 2V1UA 1AK2A 4P3YA 3B1YA 1X86B 1KK0A 4IDPA 1JXMA 4KVAA 1CBUA 3GPLA 2AK3A 2QPAA 2I4IA 2XZOA 3W6NA 5TARA 4DWJA 3K9LA 4F7WA 2CHQA 4M4SA 2K5UA 1AQUA 4Q47A 2QBYB 5TVKA 3LA6A 1QBKC 5JRZA 1XJCA 3GJ7A 2B8WA 2OE2A 5CYOA 5JHHB 1JBKA 1IN5A 1FOEB 1J8YF 3AH8A 2BBWA 4I81A 1XU4A 2DWOA 2E87A 1F2TA 4IOKA 5DN6A 2HCJB 2F43A 2WPDD 3CRVA 2B92A 2YC4C 1XEXA 3P1JA 4RFSA 2E1RA 1NMZA 1E79D 1NN1A 2XEXA 1NEXB 2IHBA 4MUAA 3RVBA 2EU8A 5JS7A 3KQHA 3U44B 3RS4A 5JWRA 1ZNYA 1PJRA 4P0TA 2F3TA 2QAGA 5CLLA 5EXTA 2PCJA 4HB2A 2VSOA 3L82B 1MO6A 1GOTA 4OJKA 2XB2A 2OFWA 4NYJQ 2WKPA 3MWJA 5E95A 2OILA 3KXKA 3MAAC 4IEIA 4LBWA 5IRCD 1H8HA 2XJ4A 1R0XA 2EFDB 1F60A 4NPHA 4B3FX 3GLIA 2W2TA 4RVCA 3LBIA 2WWYA 4Q19A 1U98A 5EXXA 3W6OA 5EP2A 3QEJA 1U8ZA 1AKYA 2OM2A 3IPYA 3K0EA 3K09C 4NYIQ 4PTLA 4YXWA 5EXSA 1SXJE 5FTMA 2IYLD 2NZJA 4YMVA 1ZNWA 5L3VA 5FI0B 1NVVR 4WA7A 5H1YA 4G5RA 4DDUA 1F2UA 2GVDC 2KBFA 2NIPA 2Z83A 4PXAA 5B58C 4CEIA 3O8RA 1TUIA 1OYYA 2ATVA 1I4DD 2NTYC 3U7FB 2JJ2A 3RRZA 5DO9A 4PC2A 1G5RA 4TTPA 3B82A 4C0AC 4YLGA 3GJ6A 4BE7B 2G1JA 5LD2B 5JJLA 1U81A 4Q48A 5DN6D 3PEYA 2XTMA 5BYJA 5KUTA 1N5KA 4IOJA 4R9UC 4TT3D 1PUIA 5EUMA 4NP6A 4Q4JA 5B57C 1R5NA 3W6PA 4GMXA 1N5JA 1ZD8A 4WVFA 1Q44A 1QZXA 5EE1A 4D82A 2GKSA 4C2UA 1S9HA 2W58A 1NJFA 1XXHE 3GJ8A 4D0NA 3DM5A 5DI3A 2IUSA 4MYUA 1OW3B 5KDOA 2QTHA 1E9EA 3RHFA 1CXZA 2D62A 2CCKA 1FFHA 2WM9B 4EAQA 4QM7A 4CW7A 2BOVA 2E31A 1FX0B 1DAKA 1H8HD 4FMCF 4H1UA 3V4RA 2AR7A 4N1AA 1EXMA 1OKKD 4LBYA 3FYHA 1TU4A 1VECA 1UEJA 2CLCX 1Z6YA 4YXWD 3CH5A 4QG7A 3LNCA 1VPLA 4KFRA 1G7CA 1FUKA 2B6HA 1Q1QA 5KDLA 3TNFA 1KMQA 3VR5A 3K70B 3ADBA 3B1XA 3U7HB 4RY2A 2QMHA 1GZSA 1ZD9A 3N5CA 4Q4HA 4M1SA 4FMCB 4B75A 1X1RA 1YRBA 2A7QA 3ADDA 2P3SA 1BO6A 1P61B 2JJ2D 1ZU5A 4G5QA 2JAQA 1XD2A 2ZU0C 5BQ5A 4I1VA 1US8A 2O8BB 3GQBA 1VMAA 1XFAA 3SOPA 2HT6A 4M1OA 2O8CA 5C18A 1VKJA 1EWQA 1G41A 2ORWA 3X1WA 4BZXA 4Q4AB 3UMSA 3OFND 4R2IA 2RMKA 1XEFA 3CR7A 2IYUA 2NO7A 1UKEA 2GWHA 4X8HA 1XX6A 2HXYA 2FPKA 1ZM2A 5KYKA 2GJAA 1KI3A 4B35A 4GP7A 4UXIA 4Q9LA 1JXOA 1MOZA 2JCSA 2ORIA 1GILA 3FMIA 2VTKA 4NMMA 1ONBA 4C7OB 1P5ZB 1BKDR 4HUQB 3LVRE 1ZD1A 4LBZA 1O3YA 1XWIA 4MDEA 2G83A 1KI2A 4G0NA 3EPKA 1TTTA 3L0OA 3OGLB 4M8NE 2ANCA 4D4KA 2JJ1A 3SYNA 1RYFA 3SYKA 1PLJA 1R7RA 2J0UA 4KBGA 4Q1AA 3WMEA 2OBLA 2RGAA 2WWFA 4KBFA 4OL0A 3KUDA 4YMWA 3CLVA 3EXAA 2LKDA 1M7HA 2DFLA 1E3MA 2C03A 3AVWA 1VHLA 3AGPA 3I72A 2ZEJA 1YQTA 2ZSDA 3R8CA 2GEDA 2B8TA 4AY2A 2MSDB 2ECKA 2LKCA 3B1WA 4KXFB 3CZQA 4DCVA 5CDFA 4D81A 4LJ6A 5BN3A 4BZQA 2W6JA 4M9ZA 2A78A 1SHZA 3EWAA 5KNCA 4JMPA 3C5CA 1GG2A 2QG6A 2OO7A 1U9IC 3QXXA 5FFMA 1E4VA 2YVUA 1XB2A 1S3GA 1F5NA 2NO6A 3GCGA 2J3EA 3ZH9B 3OAAD 1E1RA 2EFCB 3LXXA 4U02A 4A8JA 4FIDA 1T0JB 1Z5ZA 2DR3A 1P9NA 3U7EB 1CR4A 3F0TA 1NVVQ 5G53C 3WYFA 1ZUNB 1B23P 1ZVQA 3ASYA 3WRXC 5K8IA 1E2KA 2ZI4A 3UKDA 2WMOB 2JLRA 2VHJA 1N6IA 4EUNA 2PJZA 3MWLA 4HLQB 3VU9A 4AKHA 4MGIR 1SGWA 3MG9A 5KHOC 2WWXA 2JJ1D 4A0RA 2FU5C 2BM1A 4B3XA 1KI9A 5DSZA 4Q66C 1OXTA 5LB2A 4QJ5A 2F1IA 3IEVA 1G5PA 2HLDD 3Q7PA 1WMSA 2ZI9A 3MD0A 4PPFA 2P0EA 2YINC 2XGJA 2DB3A 2DHRA 5KSPA 4LCBA 1SXJC 3V00A 1CS4C 1G18A 1KJYA 5DI9A 3BFKA 3AF4A 2OFXA 8OHMA 3T61A 1KMHB 1T4GA 5EZ6B 5C4GB 2W6JD 4ZDKA 5EP3A 2FF7A 4LYHA 4N3NA 3SFVA 4F92B 4DLUA 1RZ3A 3WY9A 5D3MA 2ZRNA 4URUR 1NL3A 3NDPA 1B0UA 1Z6TA 3QXJA 2JIZA 2X77A 4HLCA 2QQ0A 3LH5A 2YJTD 3KKOA 1UPTA 1E1RD 3QBTA 5CK4A 2PZFA 5C4MA 1UKZA 4KI0A 3CH4B 4L8GA 4MQBA 1TQ2A 1MO4A 2KJQA 2FGKA 3BAFA 1NRJB 3ZVNA 5A4JA 4QM6A 1UBFA 3L0IB 2IYVA 1OJLA 2N42A 4LC1A 4KYUA 3MSXA 2ZJZA 4RD3A 5FI1B 3KQLA 4MH0R 3I5XA 3EPJA 4L4UA 3THOA 2P6NA 1K5GA 3Q8XB 5TB5A 4HDCA 4EJSB 4C7OA 1DG3A 2A30A 1GP2A 4TL9A 2O8EB 4JLMA 3SHWA 3QSYA 2WJJA 4IHQA 1FS1A 4LJAA 5JECA 4FN5A 4GOKA 4JJZA 2XNSA 1TPZA 5C46F 1P2SA 3IKJA 1LW7A 1NSTA 4NONA 1U99A 5KOYA 5HPYB 1SVIA 4TYPA 2FJUA 2J7KA 4GI7A 5FOUA 1G8YA 4XOIA 5CYPA 1VG0B 1G4UR 2O8DA 1E2QA 3RANA 4DUGA 4FXPA 4MITA 4Q18A 3LX8A 3AVUA 3MLEA 3RS7A 2VP6A 3D31A 4UNPA 4KFUA 2CEAA 3ZQ6A 1N6RA 2RAPA 1A82A 2JIZD 2BVNA 3GLGB 4RD4A 3FHTA 4BECA 3NH6A 1Z83A 3Q5EA 3A4MA 3SR0A 4R7ZA 1G3RA 1KSHA 4OQMA 4D6PA 1LS1A 4Z54A 2FGJA 4ZCIA 2UZ3A 4U00A 2D7CA 1G19A 4PQFA 4PZZA 1D2NA 1M8PA 3JVVA 1LY1A 4BLTA 5FH9A 1GM5A 1E2EA 5JI2E 1UBGA 2DPXA 1G7TA 1W36B 1AGPA 4CEJA 1R0ZA 3MJHA 2DFKB 4B43A 1OB5A 4M0LA 5L8VA 3OZXA 1UBCA 2F1JA 4Q21A 2FG5A 2DY1A 3PV0A 3WRYC 1E69A 1IY0A 1RRPA 3QOFA 3A8TA 1IXRC 521PA 4JS0A 1OIVA 4LJ8A 2P1MB 4OHXA 4JLDA 3V4FA 2GJSA 2ZUBA 1N6OA 2R6DA 2ONJA 1OXXK 2V9PA 1OFIA 2G6BA 2O0KA 4PO9A 1LF0A 3N2IA 3QF4A 4W7SA 5IDVA 5J4LA 3NDBB 1LFDB 4FINA 4BFUA 2GXUA 1P75A 3A4LA 3HR7A 2GJKA 3P4YA 4NCKA 1KK2A 4URWR 1TAGA 1HEIA 4LYFA 1CJVC 1NMXA 3PCRB 2VBCA 2WBLC 4GL2A 3SYLA 1BOFA 1P7CA 3VR2A 2OAQ1 3AKCA 2IWRA 2ZRMA 4V0OA 3THWA 3WHKA 4QGAA 1AM4D 2YWEA 1AGRA 1UDXA 4DHEA 1W4BA 5JS8A 4QRHA 2ZYUX 1YE8A 2PZEA 1SQ5A 2ZVPX 4JLNA 2BKEA 2ZJYA 1TMKA 2P65A 4A36A 3RRYA 3V9PA 1VCMA 2C8VA 4PHTA 4V0LA 3W8RA 1WA5A 3VTKA 1S1MA 3I3SR 1OH6A 2RB4A 2OXCA 1Z0IA 3MCAA 2P1QB 1VG8A 2CBZA 4W5HA 2P1PB 3CUEF 3L43A 4XVQA 4FW9A 3RSOA 4ZIRA 3SBEA 4US2R 4A0HA 1KO5A 1KYIA 4PC3A 3G5UA 1E9AA 3THXB 1KDOA 2ZU6A 3LLMA 3UWKA 4AG5A 4P4UA 1ANKA 2EFHB 4I1UA 4TMVA 2Z4SA 1HUQA 2WKRA 2ZROA 1BMFA 2BMEA 4YONB 2REBA 2YWHA 1Z2CA 4N0EA 1Q20A 3RWOA 4EJSA 1KO1A 2JLWA 1JPNA 4OK3A 4JIMA 5HR5A 2Q9BA 3O47A 2GZDA 2FE4A 3EZ2A 4BZPA 5TXGA 1XD9A 1Z6XA 4GMDA 4R98A 1YVDA 2WJVA 5LDDC 2RGGA 3KJGA 1P62B 2CHVA 4TLBA 5DYGA 5BN5A 5L3QB 1NKTA 2VHQA 4HZUA 1GRRA 3CNLA 4JL6A 1G16A 1KJWA 3TIFA 5IHPA 3U4QB 5FBWB 5FR1A 1X8JA 2CJWA 4HB3A 2PT5A 1DAGA 1YRAA 3C41J 2IYZA 2LCFA 2BCGY 1CJKC 2BIFA 1CRPA 1EFTA 1E1QA 3J81k 4IEEA 5CITA 2J87A 4Z51A 2J5XA 2AN9A 2OCBA 5CB6A 2QL6A 2GAAA 4LHVA 1Q57A 4QJ4A 1GRQA 4QOSA 4B3DA 4D80A 3BE4A 1XXHA 1S8FA 1T91A 2ZRLA 2VIIA 2ZRDA 1BMFD 1Z2AA 3FMPB 2OUKA 1AN0A 4MGZR 2BC9A 1Y63A 4BFSA 1G7SA 2OFOA 3DOFA 3HWSA 3PUVA 4M53A 5CK5A 3T5GA 3ZDQA 5TY0A 2HYIC 4A1FA 1E9SA 1FUUA 5CB8A 2C9CA 3TVTA 4B74A 4LZZA 1XPOA 3EC2A 2ZRJA 3MRSA 4EPVA 5JBQA 3AVOA 1PLLA 1D2MA 1OH8A 4G5OA 5CIQA 2XSZA 3QPUA 3NBZC 4F91B 1V43A 4Q7LA 2R9VA 2FSFA 2VQSA 1E2IA 1GSIA 3DHWC 1KTVA 3E1SA 3V7DB 2FPLA 1D2EA 4TMZA 3ICEA 2FWRA 1J70A 1KGDA 2KI5A 4LY6A 1XEXB 3TE6A 1FW6A 2JLSA 4A4DA 1ZIPA 3CX6A 4K8OA 3LX5A 1RW4A 3BWDD 3PEVA 1IJFA 4RFSB 3EC1A 3T12A 1E1QD 4C30A 2BCJQ 3TUIC 2QAGB 1RPZA 2O8FA 1RJ9A 4I1SA 3HR8A 3RRNA 2IEYA 2QGNA 3BFVA 2WWWA 5GJVC 2GBLC 1S2MA 2ODNA 1KO4A 4HDOB 2BBOA 3C6OB 4AURA 4C2TA 3DOEA 3CKLA 5JJIA 1GIAA 4RKFA 3SE0A 3LRPA 3GLIB 2JLZA 2HJVA 4PPNA 3ZVRA 2JLUA 4CT4B 1NG9A 2YOHA 4OI4A 3W34A 1CEEA 1OH7A 5AJZA 2P6RA 4J0QA 1Z0KA 1M2OB 3GLFA 1KKLA 1N0WA 4ZKDA 3IGFA 2QE7D 3BJIC 3NEYA 4P31A 4RD2A 5KTYA 2PLFA 4BRUA 2QMUA 1D5CA 1F2UB 3ZS8A 3EG5A 2L0XA 3WSOA 2BHRA 3OEEA 5AJWA 2XSZD 3TR0A 1LTQA 2NMVA 2WSMA 2YWFA 4HEJA 4QNMA 2DWPA 3DZDA 2DYKA 4GP6A 2NQ2C 5F2EA 4IOLA 1ZM7A 5AUOB 4JVLA 1EESA 3QUSA 5FBQB 1KDPA 3BERA 1M7BA 4E5UA 3W3AA 1PVOA 2ZSAA 3PJRA 4Q4JB 3QEOA 4TLAA 3I1FA 3D7MA 3NH9A 2AXNA 2V54A 3BRWD 3IQWA 3UATA 2DWQA 2KE5A 4XVUA 1RKBA 4IVRA 5DGXA 1EX7A 3OIWA 1AIPA 2ZIAA 3AUXA 1XMSA 1EGAA 1GKIA 1GWNA 5KSYA 1BYIA 2EQBA 5AJYA 1DAMA 1JAIA 2MSEB 4JLAA 1ZYUA 4G3XA 2P1NB 1KDTA 1U90A 3MKSB 1TEVA 3GP8A 2PJRA 1W47A 4UNRA 2H17A 3LBHA 1E2GA 2CL0X 4QNRA 2IX3A 3RC8A 1AS0A 2WIBA 3ZJYA 2Z4RA 2GRJA 2IEZA 2W00A 2XTZA 4HB0A 4LHXA 4EIWA 2ZS8A 1QG4A 4LGMA 3CM0A 1OXVA 2VRWA 4CIDA 4Q4HB 3AF0A 4B76A 1H65A 4POAA 3A58B 3FOZA 3OEED 4QXAA 4NCJA 2BWJA 4XSGA 1F6BA 4NZYA 1JB1A 1XD2B 1JEDA 4QL3A 1YR9A 2QMEA 2X8AA 5LBIA 2GXSA 1SKYE 4XWOA 1US8B 4DVGA 3IUYA 4BFZA 1Z0DA 1G3QA 1Q1ZA 2EYUA 3CRMA 1JJ7A 2GF9A 4I99A 4L15A 4NL4H 5DYIA 1KI4A 2O8CB 4TL8A 2BBSA 3KTAA 1GKUB 3EIHA 3H2YA 1NVWQ 5BW8A 4LX0A 3ND9A 4HYYA 3SFZA 4TZ0A 3HU1A 4QHSA 1QF9A 2J41A 4AI6A 4RD1A 5E7IA 2WIAA 4IRUB 821PA 2OCPA 5B64A 3VHXA 1HYQA 4TT3A 2JLXA 4V0ME 2IXEA 4OI2A 2QN6A 3BB1A 1BYUA 1M74A 2ZE7A 3QKUA 4BFXA 2R62A 2VL7A 4Q01A 3LDAA 3U60B 3SQWA 4OBEA 4KYIB 3OHMA 3DL0A 4PQRA 1ZM9A 3BXZA 1IY1A 2H8KA 4M21A 4P33A 3VAAA 4GDFA 4QBFA 3AVPA 1P22A 2ZYVX 4Q1BA 3RYTC 5LD2C 2FFQA 4A9AA 2J0UB 4G5GA 1OKKA 2DFNA 5FOWA 4B2LA 2RHDA 1OFTA 5JMTA 4D0LB 3I8SA 4P4TA 3U3OA 1C9KA 4AIIA 3TRFA 1QVRA 4R2HA 1YKSA 1ZCBA 1NN0A 4XSHA 3SI7A 1KSFX 2G0NA 4JVMA 3B2EA 1VYTA 3LQRA 2H1LA 1E2MA 1CP2A 3EX7C 2ZRGA 2C04A 1OH5A 5CJ2A 5DE3A 1E2HA 3IBYA 1E99A 4KCGA 3LY5A 4OHWA 1OE0A 1X6VA 1TADA 2CNWA 3ZQJA 2C98A 3CRQA 4K46A 2PLRA 1KK3A 1Z47A 2HXSA 3VR1A 4BGDA 2H18A 3L0SA 1YZUA 4EFNA 4DLTA 2X2FA 3K70C 1XMIA 3BS4A 121PA 1MV5A 5H70A 4A8JB 1R0YA 1XTIA 1R6BX 2WOOA 1P9RA 3OFNA 3GJXC 1E98A 5HKKA 1JAHA 3X1ZA 1T3SA 4PFSA 1EFHA 2YOGA 2XAUA 4X8MA 3ZD6A 1E9FA 1XNJA 3C4JA 4D26A 2RGDA 4KLNA 3VU9B 4KFSA 5IT5A 3C15C 1U0HC 2GZAA 1ODFA 1FL9A 4CDGA 5FOTA 5J4YA 1P2VA 4Q1DA 1TX4B 2OSBA 3AF1A 3DVLA 4TQUS 1P4SA 2WKQA 2RGNA 1N0UA 2VP0A 4DLRA 4DJTA 4YQFA 2OLKA 1TEXA 3UXMA 4FCWA 1KOFA 2WAYA 5K8TA 3O8DA 1PZNA 4D0GA 2FMXA 3NG1A 3TW8B 5JHGB 1GNPA 5FUYA 1QRAA 1ZU4A 4DB2A 3N70A 4II7A 4M1TA 4TL7A 2AHOA 1R5BA 1UFQA 1T8TA 2CVHA 3JVUA 4E07A 5BYKA 1SVLA 1SKQA 4JKIA 4OYHA 2B7BA 3B6EA 2CNWD 5D3MB 3GJ3A 5FUVA 1IHUA 2J7PA 4D4LA 3X2SA 2G9NA 2H7VA 2G3YA 1NP6A 4ARZA 3AP3A 4QGFA 4CT5A 3CX7A 4CVNA 1RE0A 1TU3A 1FNMA 1CU1A 4NYMQ 1AQYA 3GFPA 1DVRA 4XTRA 1DO0A 4P32A 1JALA 1XJ0A 3QQ5A 1E2FA 1ESMA 1ZNXA 4PAQA 4Q9JA 4TMXA 3L8ZA 5JI3E 3PUXA 5HKKD 1CR0A 2PBRA 3B85A 2VLIA 3HYTA 4JL5A 2CE7A 5DHFA 4Q7MB 3TMKA 4GOJA 4O25A 2F9MA 3OAAA 3F8TA 4O3MA 2H5EA 3Q7QA 3KZ1E 4QFMA 2WJYA 2Q3FA 1N25A 2XZPA 4NH0A 4AWXA 2PT7A 4JSYA 1G8PA 4HLUA 1KNQA 5C1BA 1E9CA 2A5FA 1KI8A 2D3WA 4AC9A 4G5SA 1RIFA 1W4AA 2C96A 3M1IA 4FI3C 1P73A 3AP2A 1NLYA 5HTKA 4DCUA 1KJZA 4TTQA 1NJGA 4TZ6A 1FQJA 4NTZA 4RZ2A 3NWJA 1AZSC 3BBPA 3OE7A 2ZITA 4LRWA 2N1BA 1OPXA 2PL3A 4IFEA 4W5JA 3OGMB 3RAPR 4DCNA 2O8DB 2HLDA 1D6JA 3PEWA 3SDZA 3U5ZB 3DO6A 1ZMXA 2J7PD 3I4LA 1J99A 2CCJA 1P2TA 2IC5A 2H16A 4LUCA 2G1KA 1Z6AA 3EZ7A 5TMPA 1DELA 3HU3A 3NVAA 3PXGA 4A0FA 2REOA 3A37A 3U3MA 4AKEA 4JVNA 1DG1G 3KUCA 4TLEA 1HT2E 1DO2A 5IF9A 1YZLA 4A6XA 4Q1CA 4QBGB 1KO7A 2F7SA 2HV8A 3CPHA 3F3YA 4WIAA 3TW4A 2ZRPA 4LBVA 5HCIA 1X3SA 5E7MA 3OESA 2OHFA 2XJ9A 1LVGA 3BB3A 2V3CC 3FGNA 4HAWA 4CEJB 1IONA 3SEAA 2CLSA 4BLPA 3GLHE 3ND8A 2JASA 4BFWA 2P2LA 4R71A 1ZBDA 2PZGA 3WNCA 2QPTA 2WZQA 5FPTA 1HE8B 1Z0JA 2RGXA 1YHNA 5FR2A 2IS6A 1QDEA 2REXB 2ZJBA 1N2CE 1VIYA 2NO9A 4EPXA 4KLZA 1XD8A 2E9SA 2CE2X 3B60A 4JBYA 4WW0A 1VDZA 1FPMA 1AKEA 3H86A 4M1MA 1G6HA 4WXPA 3ADKA 2J45A 3QF4B 3OE7D 1II9A 1IXSB 3DMNA 2PMKA 4DEXA 3K09A 1W0KA 2QENA 1IM2A 1RRCA 2IUTA 1LDKE 2GF0A 2JLVA 1UKYA 4MUBA 4KO8A 5KNBA 4F4IA 3ZD7A 4DLWA 5EE9A 3B9QA 5FOVA 2IA5A 4DDTA 4B71A 5G41A 2OBNA 2ZI5A 3THWB 3EZFA 4UXJA 2Q3HA 3TSWA 2CVFA 1IY2A 1XMJA 3QXCA 4XWAA 4LHYA 4EJSC 1W5SA 2FX3A 1Q12A 2D2FA 2CXXA 3EAQA 3EWSA 1G17A 3A1TA 5D3QA 3KQNA 5JCPA 1G21E 2AWOA 3KL4A 4QHYA 4IOMA 2VF7A 1BH2A 5TV2A 2IS1A 3LW8A 3W8NA 3CZPA 3C7KA 1Z63A 4D25A 4BFVA 1L7VC 4TN1A 4ZIRB 5JRJA 1L2TA 1NLFA 1F3OA 1UEIA 2AXPA 2V6IA 1Z0AA 3B9PA 2OVRB 3P26A 2P5SA 1ZRHA 4Z1MA 1R0WA 4PC7A 1UM8A 4MKIA 2XX3A 2D2EA 1V5WA 5UKDA 4ZI3A 4F4JA 5E4FA 4GZLA 4OK6A 1FP6A 4OQXA 3BH7A 2GVZC 4BLQA 2ODBA 1N6NA 1M34E 4B6FA 4ESHA 4F4CA 2ORVA 1Q1BA 3GFOA 1PLKA 1G3UA 3KB2A 3KJEA 2GTPA 3K9GA 3L2OB 1W0KD 1ZNZA 2OLJA 1YZGA 5FPHA 4B3BA 4KODA 2AWNA 3VMFA 4JKYA 1VCIA 1OIWA 2FOLA 2ZR9A 3DZ8A 4JL8A 2WWHA 1E0JA 3EIQA 1CR2A 1JJVA 3H4MA 2IS4A 1OB2A 2QQEA 2IYRA 2Q3MA 2EWWA 1MT0A 3GLIE 3SJBA 1XF9A 4HZUB 4KAXA 1W36C 3IIKA 2P6UA 3KJIA 2W2VA 4LC0A 2IK8A 2Z43A 3FE2A 5L3SA 3ICQB 4PAMA 4OI1A 2CJWB 1G3IA 1Z8FA 2R8RA 5CM8B 1G8GA 3AGQA 5SZIA 3BH0A 2QROA 4EDHA 3R7WA 4ZDIA 3H84A 3X1YA 2JEOA 3KB1A 1TNDA 1TL7C 2BKUA 3HDTA 3KXLA 5H8WA 1XTSA 1RRFA 1RYHA 1IJEA 4MRSA 1T6NA 2AL7A 2HT1A 4BFTA 4BFYA 4Z1MD 4U7DA 3U6KA 2LWIA 3PENA 5GJWC 1Z06A 4AKIA 2A5DA 1XXHB 2A3RA 2MMGA 4LOAA 1HURA 2F1HA 4P4SB 2GZHA 2QGZA 1EX6A 1ZC3A 3B13B 2OBMA 4A92A 1HH4A 4A2WA 4JLBA 3U2QA 2J59A 2DFTA 2X19A 3B8HA 4C0KA 4XWKA 2FEMA 1ZCAA 4GOXA 4IXMA 2IUUA 5J4KA 4BQSA 4IVQA 2ZRAA 2GXAA 1IBRA 1KI1A 2AFIE 2GXQA 1NKSA 1WE2A 2EWVA 1DE0A 2QRZA 1G291 4JJKA 1Z3IX 1DADA 4ON9A 3K53A 3T34A 4AG6A 1FP7A 5BN4A 2OVQB 1XZPA 2Q0HA 3A4NA 4LDJA 4AK9A 4N0DA 4M1KA 1G3MA 4RJLA 5EP4A 3E70C 4CGZA 1JNYA 1YZQA 1ZUIA 2VH5R 2ZVQX 2CCGA 2Z0MA 3LO5A 4JLJA 5CLQA 1U8YA 5EE5B 1JR3E 4M1WA 3Q85A 5HE9A 5FBRB 1M7GA 3FKQA 1DARA 5J40A 4TLCA 2QA5A 4TWZA 1W2GA 4RZUA 1NBME 2GEVA 1XCGB 4B2IA 2O8FB 1P9WA 1RJ9B 3AKEA 3K0CC 2C9YA 4LV6A 4DLYA 4IDNA 2ASEA 2PEYA 1U9IA 4L9SA 4O2RA 5LB4A 2V8OA 5FL7A 3QKSA 4NCNA 3PITA 4KHZA 4ILEA 1SVKA 2ZJ8A 3AKDA 3GJ5A 3CWQA 4C0JA 1NSFA 2C99A 2QSYA 3GLFB 1I2DA 3FB4A 2QAJA 4M9SA 3QBVA 1HQCA 4WZBE 4GBMA 1U8AA 2GHIA 1CULC 1LNZA 1YR8A 4ZV4A 4B6EA 4UQOA 2QPOA 2W6ID 2HDNB 2WMNB 4D4JA 3W3ZB 4A82A 1G5TA 2ZSBA 3ZVMA 1AS3A 1S0UA 3HPQA 4TMTA 4V0KA 3OEHA 4DEYA 3KXIA 2HYDA 4TTRA 3RC3A 2QI9C 1SXJA 1R2QA 1KY2A 4PSVA 1Z08A 1II8A 3NKVA 1NG1A 3CRW1 3RS3A 3TUJC 1HE1C 3W90A 4JYCA 1OHHD 3FDIA 2YYZA 4MYHA 3W5JA 2FSHA 3FHOA 5EZ5A 3FMFA 1TQ6A 2WSSA 4XJXA 2A5JA 1NY6A 4LHZA 1LF5A 1U0JA 4URYR 1Q3HA 2ZRIA 4HAYA 5FL7D 1Z28A 2OZEA 2P5TB 4A2QA 4DIEA 4QJ3A 2ZJAA 4C0BA 5KO2A 4KJZA 2IYYA 3SS8A 1L4YA 4HAVA 5CDFE 1W5TA 4MDFA 5CJPA 1ETUA 3B1VA 2W0MA 2ZXUA 4B44A 1KSJA 4F93B 1ZAKA 2F6RA 4Y0AA 3K9NA 4URVR 5ELXA 2ZJOA 2JGNA 3DM9B 4P4SA 5P21A 5KPDA 1D9ZA 2ZTSA 3U3KA 4XIGS 2FN4A 3R20A 3RLFA 1CLUA 2GA8A 2VA8A 2YHSA 4YC7A 4NHOA 3QF7A 1WB9A 3NC0C 4HDQB 1U0LA 1N3BA 5JLJA 1UJ2A 3I8XA 3OEHD 4B48A 1XCPA 3B5JA 4DKXA 2QAGC 5JEDA 1EFCA 2GILA 1COWA 3SBDA 3MMPA 1I4TD 2QE7A 3GEEA 2TMKA 2JATA 3QKRA 1GL7A 4LI0A 1SXJD 4NU0A 3RS0A 1ZJ6A 2C5LA 621PA 3OF5A 4DDVA 5KSOA 3WP1B 4JLOA 3BOSA 4DLZA 3UPUA 3KTAB 4RSGA 4XD7A 4O0MA 5GJBA 5DNYB 3I5YA 2V6JA 2CHGA 3CW2A 1P72A 2WSSD 2AKYA 2A9KA 2NG1A 4IDHA 4D2IA 2IL1A 2MSCB 3HP1A 4LPSA 3TLXA 4QKQA 4C0HA 3B1ZA 1KDRA 1KKMA 2X1VA 4ESVA 4MKHA 3CO5A 2GCOA 3FVQA 2XXAA 3FHCB 2IWHA 2BEJA 3IBGA 4DZZA 1SVSA 1E94E 4DLSA 1XTRA 1E2LA 4AYWA 3WP0A 4MRRA 2G88A 4MKFA 3GJ4A 4B47A 4Q1FA 1OSNA 3W5IA 721PA 2GCNA 1K5DA 2PX3A 2V7QA 2ZS7A 4HI0E 1OFUX 5F3WB 2ZANA 2R6CA 3KFXA 1G64A 3CRRA 1Q22A 3JZAA 4U5XA 2ZE8A 1QHHA 4E03A 5AUPB 1R10A 4URZR 1X8KA 2QP3A 1SULA 5FTNA 2FEOA 3EA0A 1VG9B 3U6BA 1EFRA 3D6TB 5LPNA 2BMJA 1COWD 1NVUQ 5J4HA 3L8YA 1LB1B 4FCTA 4URXR 2KB0A 1MABA 4GZMA 4HAUA 3MWKA 4ZDWA 5JWHA 3LW7A 421PA 3AB3A 4IJMA 1GITA 1EG7A 2XNDD 1W44A 4XD7D 3TBKA 3X1DA 1BS1A 5F9HA 1UDWA 3AEZA 2C2HA 1DAHA 4ACBA 4S35A 2QY9A 3QE0A 3PFIA 2AK2A 3TVDA 2CL7X 2VP9A 2I1QA 1XTKA 2Q9CA 3HPRA 1I2MA 2HCBA 3NIBA 4TSFD 4B3CA 2WWGA 3GMTA 5DH9A 1CJTC 1WCV1 1WP9A 2UVQA 3E2IA 4ZDJA 4TYNA 3GEIA 3K0AA 4B2PA 3OIVA 4JSTA 4KSCA 2QTVB 1KNXA 5H68A 5AK0A 4WOPA 2R44A 2ZYTX 3HYRA 2V7QD 1J7KA 3WHLA 2EFEB 2YZ2A 3FKSA 1EWRA 5B30A 4FWTA 3AQ4A 3UANA 4OK5A 4BRWA 1HT1E 2O5VA 2VSFA 3SHFA 3GLHA 4BLSA 1DOAA 2A5YB 2IHYA 4B3GA 1NMYA 3THYB 1EFRD 4BUJA 4C0QC 2IF0A 1RC8A 3IO5A 4H9GA 1CKEA 1XMVA 1GNRA 2FPMA 3FPAA 3TKLA 5BWMA 2FSIA 3HU2A 3T15A 2QM7A 4KSBA 2NO1A 4QBHA 3R9XA 4MGKR 3T1VA 4OHZA 3ETLA 2XB4A 3TQFA 2IF2A 1H8EA 4OI0A 2JDIA 4NE2A 3FMOB 1IN8A 1JEEA 3KDSE 1U94A 3WNDA 3PG5A 2H92A 4Q4LA 4CRWB 3ZVLA 2ZRCA 3C16C 4ARZB 2ANBA 5J4VA 2RGCA 3UK6A 1GDDA 1ELOA 2OT3B 2ZUCA 5HCNA 1L4UA 4YDSA 4ZI2A 2ZR7A 4PHHA 1E32A 3AV0B 5SZHB 2AFHE 3QI2A 2WTUA 3ZZTA 4EPTA 1FQKA 4HLDA 3Q5DA 1K8RA 4HB4A 4WXRA 3VX3A 1G6OA 2F3RA 3GEHA 4HATA 4LSGA 3FKSD 4DC9A 3DDCA 2IYTA 2QMOA 3VFDA 2XTNA 4MA4A 3KQKA 1UBEA 3RNLA 3LFUA 3WYAA 3AM1A 3B7GA 4US1R 5JZVA 3RSLA 4PC6A 2C77A 3CF6R 4RZ3A 4PANA 2O0HA 3LQQA 4OKSA 3A1SA 1AS2A 2VYFA 3KFVA 4H1VA 1A1VA 3AVYA 2YOFA 2R65A 2NOAA 2O52A 2CK3A 4A8JC 1H8ED 3KKMA 2JDID 1XBTA 1WRBA 2KBEA 3BGWA 3IQXA 1W46A 3QVUA 4TL6A 4DT1A 2WWIA 4IVPA 3VKHA 3TSZA 2Q6TA 2GJ8A 4I4LA 1XPUA 1P60A 4PAOA 1Q3TA 3WMGA 3BIFA 1YZKA 2SHKA 2HF9A 4ACAA 2WJGA 3RS5A 1Z07A 4KITB 4IKEA 4OHVA 3CB4A 5E3HA 2W0SA 4ZCLA 1W4RA 2YV5A 2ONKA 3K0FA 4Q9KA 3HJNA 4OQFA 1M6NA 3Q3JB 1E9RA 1L8QA 4JLPA 2V1XA 2GJ9A 4BASA 4PC1A 2FFBA 4UNNA 5GJCA 5G40A 1X8LA 2JLQA 2D06A 3D3QA 4LJ9A 4F38A 5AUNB 5HZHA 2Y8EA 3ZIAA 3DPUA 3QPVA 3EW9A 3ZZUA 5J5CA 4CEHA 1MO5A 2ZI6A 1RVDA 4ZCMA 4PZLA 4BEJA 3LXRA 2P67A 3SNHA 1HV8A 1M1YE 1VCNA 2VHUA 3U7GA 2GBLA 3IILA 2WVJA 1MRSA 1R5OA 3AVTA 3UWOA 3AKYA 4E09A 4WZAE 5EE0A 4EFMA 3GLGE 1MRNA 4B34A 5A5GA 1GRNA 5FL3A 4TYYA 2GETA 4YDHB 2CK3D 2GK7A 3IO3A 3LLUA 4XTCS 3TQCA 2GESA 3RS2A 1T8UA 3THYA 2OAP1 2IYSA 2W2XA 2B21A 3KKNA 1ZM3A 5G3YA 4RD6A 1E9DA 1S1CA 4TQAA 5AUQA 3TUZC 3WBJA 2ZE5A 1W0JA 4Q00A 4EFLA 4EPWA 4EKDA 5JSZB 2FH5B 4K81B 4UNQA 1XEWX 1RFLA 4LK2A 1MKYA 3NBYC 4GPTA 1KO8A 4M22A 2BBTA 2PH1A 3PUYA 2B7CA 1KSGA 3QY0A 2FFHA 3EARA 3H1TA 5F9FA 3ZYCA 3OIUA 1JR3A 3A1UA 3AVQA 3VR3A 4HUTA 3M0EA 1II0A 3LD9A 4DSTA 3VNUA 2WOJA 3ZIAD 2QU8A 1MH1A 3G82C 4A6PA 1TUEA 2NPFA 2J0QA 2Q21A 1NBMA 2OXRA 2ZM5A 2JLYA 3D8BA 2AD5A 1IAQA 4DLVA 2C95A 1DAIA 4QBIA 1CIPA 4PR0A 4NCIA 1OT3A 1R4AA 1QHGA 1LS6A 5CIWA 2QBYA 3R9WA 3NHAA 1YU9A 1E0KA 3PVSA 4TYQA 3R9IA 2IBMA 1X1SA 3M6AA 3I62A 1JI0A 1XDBA 5JWOA 3H0KA 3RWMB 1YZTA 1NIJA 2YKGA 2BEKA 4L5BA 3EZ6A 3U3JA 2ZJ5A 1DBSA 1GL9B 1W2HA 1WDTA 1F48A 2BJVA 4DCTA 1W0JD 1TF5A 2QP4A 2OESA 1A7JA 1IXZA 1IQPA 3I92A 2JJ8A 3BH6A 3U44A 1D8TA 3SJCA 1G4AE 2NZ8A 4HSEA 5L3SB 1Z22A 3GLFE 5HZKA 4ABYA 4ASUA 3QVVA 3SC3A 4LPKA 5TDHA 1P6XA 3LAWA 1FTNA 2AD1A 1OLOA 3R7WB 1K6MA 1G20E 4Q1EA 1JR3D 1O87A 4WBSA 4DXAA 3X1XA 2OCAA 2ZYWX 1CJMA 1VCOA 4PX9A 4FMDF 2HJGA 3IIMA 4DCSA 1G8HA 2R2AA 3QIAA 2W83A 3M4YA 1NBMD 3TH5A 4GNKA 1P3JA 1VHTA 4X8LA 2ZS9A 2CLDX 2IYWA 3DMDA 1HY3A 5E7JA 5F98A 4MYCA 5G3ZA 4DRZA 5GADl 2FA9A 1KAOA 5FPKA 1OIXA 4D4MA 2FSGA 3KQUA 3EPHA 1QHYA 4FMDB 3K1JA 4PPGA 1R8QA 3I61A 5CM9C 1EFUA 2VO1A 2ZR0A 5L3RA 2QRNA 4GT1A 4JT4A 2QNRA 4PO8A 4QGHA 3W9YA 4PO1A 1DAFA 3BC1A 1AJEA 3LWNA 1CJUC 221PA 2ZQ5A 3TAHA 4UNSA 4PSAA 3BK7A 2G0TA 2D74A 4C4PA 5KNDA
chains in the Genus database with same CATH superfamily
4KV9A 3BB4A 3W2FA 5I9BA 1N1DA 2I76A 5BPFA 2D13A 3CQ9A 4BKPA 1KIFA 1DCMA 1UWVA 2QL7A 2J9FB 5BOSB 2C42A 1RVV1 1N6HA 2VI5A 2ATXA 5C1IA 3JWJA 3GNTA 1RXWA 3IUBA 1DIBA 2XCLA 5FFFA 3CLUC 4Z8XA 5TX7A 1CYEA 5IUKC 3HV0A 5LU9A 5HM6A 2Q1XA 4L78A 1Q84A 1Z6GA 3L1NA 1T5IA 4WLVA 5FL7D 4OGLA 2C84A 4K26A 3K0SA 4IZ6A 4MUJA 1VHJA 3DGFC 2OV2A 2JBAB 2ZIEA 4L27A 3QLVA 4OM8A 3DTTA 3H5WA 3GWGA 4TVOA 3FNBA 5LVAA 1ZXLA 4V02A 2FUEA 1QHIA 1C8KA 1VRVA 3NOOA 3ZLJA 3TIVA 5C8YF 5HFAA 1JQJC 1N2BA 2Z08A 4Q7JB 1UPCA 1J90A 2IITA 3KX2A 3MB8A 3OA0A 4YJDA 3IE0A 1VA5A 2XB9A 4CCYA 4RMJA 2VP2A 1G7RA 1GAXA 1G2OA 2FNAA 1E4YA 2J1LA 1TVEA 4JGIA 1NLZA 3MJSA 4RD0A 3HKEA 4ARUA 4LJ5A 1A1SA 4J1TC 1E60A 2EP5A 3D9QX 4MMXB 3AUYA 3TSOA 2C1XA 3GRVA 1CF4A 3RYFB 3ICOA 4ZHSA 2XZTA 3HNOA 2D1RA 1KEZA 5FQOA 4B8ZA 1D2GA 1N6PA 1VZ2A 2MDTA 2ZREA 3L0PA 3U7GA 4HAIA 2Z8YM 2SECE 5AW4A 1CQZA 5NLLA 2PRSA 5J63A 1M0TA 1QTNA 3HZOA 4B0OA 1EVEA 4DLAA 2NTJA 4GBJA 4GECA 3SZRA 3WR5A 4DQ0A 2D7DA 1XTTA 4IDBA 4Q4AA 4JJEA 3WXMA 3R0ZA 2C7RA 2H3HA 5ALYA 4DAOA 3EY9A 1DXQA 1HZZA 3GZ4A 1WY5A 3TAXA 1E2PA 1Y5LA 2TECE 1T9KA 3HABA 2H4JA 4KEAA 4R1MA 1Z9BA 3G0IA 4K7JA 3VHLB 1Z62A 2R6GA 3BK1A 5IZCC 3CNOA 2ID9A 1O4WA 2XITA 3NC1C 2JJQA 5CEFA 2H7XA 4N7MA 1S4QA 2BZGA 4HUQA 4D92A 2W2OA 2NU9B 1E1YA 4Q9AA 4LF9B 1J4AA 4ZRNA 1KMCA 4EY6A 4IGIA 2IHTA 3ZJ4A 3ND6A 3GNLA 1DRJA 1XJWA 3GL9A 3TZQA 3ZBQA 5AKKA 1ZZEA 5AR1A 2VJ5A 1AGYA 5B37A 3T9EA 1U63A 1EXNA 1JKIA 2WJ4A 2JIBA 3JZMA 4YMSA 2FP3A 4AROA 3A6DA 4MYTA 3IT2A 2AZDA 1VMKA 2A92A 1A5ZA 5AIAA 1FUIA 2H85A 4P7BA 4D1YA 4H0FA 4I4CA 4DBZA 1YDFA 2NQTA 1CUAA 3KZNA 4RKRA 2HOQA 3WC4A 5A5FA 1HOTA 3DZBA 2D1QA 4PS0A 1D1TA 3CH6A 4OQLA 2FPRA 1RJWA 3C4VA 5DISB 1KOJA 4XW2A 5A05A 2QYTA 1E3WA 3NP7A 3EG9A 3R0XA 4RCYA 2QV7A 3VI4B 4QG3A 2OOKA 3EEBA 4WINA 3J27A 3Q6NA 2ODWA 2ZQZA 3G2KA 3TQRA 1HDYA 2KPOA 1FIUA 1HE5A 1FNNA 3DDNA 2X8BA 1CUEA 2C9OA 3TGPA 3T3HA 4PRYA 5LZ9A 3QLEA 5K3OA 4FD2A 2Y93A 3OIDA 3HU5A 1A9QA 5DLQC 2ZZMA 1T36B 1TZ2A 2B4AA 3BFXA 3G89A 4ZMSA 2JHAA 2XMPA 5BPHA 1O1YA 1Y5NA 1QWSA 2I67A 5KNBH 4OLJA 3W2EA 3IOYA 4EHJA 3I9KA 2UVPB 5JJCA 3O3CA 4KHQA 3IL2A 3UEOA 4BNWA 2J31A 2NU6A 3REOA 4G0VA 1D0IA 2F9FA 1JWLA 1HA3A 4P34A 3FYDA 2PXXA 5KVQA 3CURA 2IPOA 3C7DB 4NZPA 4AJOA 1JDZA 3IQDB 7YASA 3ZE2B 1T3LA 4GP9A 4PTYA 2GCOB 3B53X 2NNWB 5FTKA 4P38A 1VPTA 3KYBA 3ZBTA 4A2PA 4I1PA 1QG2A 1X38A 1TC2A 3I04A 1UJNA 3BIOA 2QUAA 3A1FA 3I32A 3LT2A 4TLDA 3VZRA 2OP1A 1TT5A 1C7EA 3UXHA 4AWAA 3QZUA 2YZMA 3BWMA 4F3YA 2AJCA 4YRTA 3HXLA 1TVCA 1I0LA 2AFHA 2VDKB 2WICA 3H8SA 5HF5A 3SJZA 5BWBA 1GVNB 5KQMA 1V2HE 1OWOA 1GAEO 2QT1A 2CMGA 4V0MA 1EKXA 4TTJA 1J1ZA 3VISA 4ZICA 1K7CA 2PGLA 1KARA 5E6RA 1ZBQA 1ZK1A 2QT0A 3O21A 4MQEA 3VSEA 3IB3A 2QX9A 3AFIA 4MV7A 1QV7A 3VPBA 3C3YA 5K3EA 2IP2A 1SHKA 4GICA 2VQ3A 4QOIA 5FA5A 2BEVB 5C37A 3PCXA 2Z9DA 5HKLA 5I7FA 3DOJA 2DG2A 3KKQA 2QVBA 4CMEA 2ZLBA 2PSFA 5EJEA 1PL6A 2HMWA 2YDXA 1VSUA 3AUJB 4MRPA 4QFBA 2FX2A 1MABB 1YL5A 4CLEA 1CJCA 4HAZA 2BFFB 2J0VA 3MJFA 1VE7A 1TD9A 4JLWA 4WACA 4NBRA 1KFJB 3ONWA 4I6EA 4EARA 3LCJA 3PXAA 1EJ6A 2F1RA 4B4DA 3ZGLA 1I6WA 1OLSA 2HQOA 4PONA 3VI3B 2G06A 3H0EA 4YX9A 1IUKA 1D2CA 1F0PA 2FUCA 1GUAA 2LZ0A 1KJNA 4XQCA 2A1TS 2QWXA 5AJUA 4ZU6X 5I9MA 5BW4A 3JWPA 3AP1A 5I48A 1KPHA 1JU9A 4I5IA 3RH0A 3S1AA 3P4UA 2O7SA 3G0DA 4QYWA 1SVOA 1P4HA 1GQQA 4ZZ1A 3GPBA 3ECCA 3CZ5A 1VFPA 4HUJA 2ZUDA 4BUZA 4MRNA 1PG2A 2EHJA 2XUKA 3K0AB 1GQSA 3ZE9A 4FGJA 1H22A 5H4GA 4B3RB 1JX6A 3FLEA 5GPBA 5F78A 2ZM6B 1TF2A 1SHJA 1VKNA 4K6FA 5CEEA 4BFLA 5KQRA 3HLTA 5CLGA 2XZLA 1O54A 5EESA 3CGGA 3G49A 4C9BA 3GFBA 1NTOA 5LKAA 2FMIA 1JQ3A 5KCZA 3GW8A 3IEKA 2WW8A 1IWBB 1KVSA 3KLBA 1V26A 1M5UA 4AJEA 3PGMA 1EM6A 1R15A 2LIPA 3UMSA 2IYFA 3UGKA 4IZHA 1KVQA 2XE6A 2YC2C 2WAAA 2QI9F 1XZQA 2WIDA 4Q24A 3C6PB 4DB4A 3NHKA 3FFXA 1P74A 3KPJA 5CFMA 4Y7DA 4UZEA 3FGZA 2C2YA 2EKPA 3SU8A 1L4MA 3B3FA 2Q4BA 3R9XB 4QHTA 3CX8A 1U2RA 4Q9IA 3MOGA 4C0LA 1IEWA 2GO7A 4ZVLA 5L95A 3DZHA 1KE1A 3UIQA 1KY3A 4RA9A 1UFRA 1VE9A 4Z8YA 4BX2A 5JARA 2F3PA 2D0IA 4GYKA 1KXZA 4BMZA 1QHNA 1REQA 2QORA 5LN1A 5B1YA 1YKFA 3QVGB 4BMPB 2COKA 2SKCA 2BM0A 2ZYSA 3QVSA 5T57A 1PWXA 1GNQA 3AXTA 4M9UA 1CRQA 1OA1A 2R6FA 1WMDA 2PQ2A 2QTFA 3FVVA 3OPVA 4BEBA 3PRYA 4EPYA 5CNJA 3UV3A 3HRHA 2H51A 3O7MA 3QPWA 2VF2A 4K1LA 3O8BA 1GL6A 5LA6F 5BV7A 2A5GA 4GRAA 4RK6A 1ZWLA 3QESA 4XCXA 3IHLA 4XFKA 1A5TA 1JHRA 1GGEA 1GTVA 3CLTD 4L5IA 1X7XB 3SZOA 3U62A 4ZHQA 1N7JA 3E5RA 2RHOA 1JUDA 3EA4A 3RHSA 2N9UA 4LDNA 1BIFA 1GFIA 3K92A 2PD3A 4TSFA 3WGQA 3P4XA 2Z9BA 4N3GA 1N5LA 1VLHA 1D9XA 4IFTA 3HXOA 2Y27A 1QGAA 1SQ0A 2IH2A 3ROTA 1X8XA 4JBWA 3LDHA 3FBGA 3LCVB 1YR6A 3LHDA 1LPPA 2ZJ7A 1O94D 4YRQA 3VH1A 3PUWA 1K5PA 3FOEC 3UN1A 4HCBA 3UAGA 2JGDB 1U8FO 4PHFA 1PR6A 4DCCA 3JQAD 1JLRA 3KWMA 5I7SA 5T41A 2IZ7A 4C22A 5KPJA 2MSKA 1UBNA 4HQOA 2F43B 1IHDA 3ND5A 3P2YA 2EQAA 3WYGA 5FWYA 2GZ2A 4FVMA 1CUUA 2VXYA 5C1DA 1GDHA 2DUNA 2H4ZA 5KVSA 2PCLA 1E2JA 1ULTA 4NYIR 3S1SA 3AW8A 4JBXA 4DT1B 5GVSA 3OMWA 3VNSA 3LIIA 5EFOA 2IXFA 5M7EA 2UU9B 4L74A 1N6LA 4IIGA 2ESRA 2P41A 3PDUA 1ZESA 3WWDA 1EUQA 1YQQA 2EZUA 3Q7RA 1SUIA 3W05A 1AA9A 2X5NA 5IMSA 3UFBA 1MJGA 1ZP6A 2VTEA 4B33A 3CNBA 3QV2A 4EX6A 4JLKA 5HTOA 1CVIA 2WYVA 1H2EA 3F8WA 2XOKD 1O6FA 3NBAA 4QEDA 3TLCA 1TK2A 3ZHYA 4E4YA 4FB5A 5K8JB 3O93A 1E7MA 5LJLA 4D8XA 2BFDB 1YQXA 3M6LA 3PEUA 1S9DA 2RGNC 3JQ7A 1MR3F 4II3A 4KPEC 3DTNA 4JOCA 1NLUA 2F48A 4OQPA 3UAVA 5FTLA 4WK0B 1LC0A 5LZ2A 1IN4A 3ETJA 1VIDA 3GFTA 3TTSA 1S3IA 1MB0A 3T1OA 1FSGA 1GTJ1 3L3BA 4TM8A 4OQNA 3K73O 3KHKA 4M9RA 2HEIA 4PIPA 1FMLA 3W4IA 4H2DA 2FFAA 4O2BB 1TJ3A 1VJCA 1YS6A 3K0CA 3DT8A 1PHRA 4R7GA 3WLSA 2I9KA 3DOCA 4X91A 4XVRA 1OV4A 2OZMA 3OEWA 2WSBA 1JWAB 3PXBA 3R8FA 3C8UA 2VF4X 4H0CA 2P9BA 2QDKA 3JYNA 4PYKA 1TJ5A 2CDNA 3AU9A 5ICSA 3B2NA 1LD3A 4LRTB 5I5GA 4J3NA 5LIPA 3RPEA 2BPOA 1P7ZA 4V0NA 2VZ0A 4NOKA 5IKOA 5DXFA 3UFXB 2YHUA 4HGZA 4CZ2A 3IHTA 1TIBA 2QX7A 3BMCA 3E9NA 5B6PA 3DTVD 1N5IA 1K2WA 2XUOA 1EYZA 3A10A 3MWYW 1WHTB 3ENNA 2ZIXA 3IP7A 2IV7A 5JCXA 1W48A 2AFIB 2YV4A 1YNOA 4R40A 2CMDA 5EOVA 3A3KA 3R3XA 3EASA 3ZKAA 2JGRA 3UHJA 3SCXA 1PD0A 1IFXA 1TIKA 1VL2A 1NY5A 1E79A 1Z2EA 3PNKA 3R5FA 4RANA 4RPLA 4BL5A 3EDYA 4C21A 4LFBB 3QWAA 2X0JA 1CQWA 4FMBB 3A1VA 3H18A 3INYA 2ZJ2A 4FJHA 2WV9A 1Z0FA 3DLPX 3PR1A 2VBIA 5AK6A 3ZC3A 3FWKA 4EQ6A 5HX7A 2QW0X 2WWTA 1ZOLA 1UFVA 3ZZ1A 5HMLA 5JZSA 4MYRA 1EA5A 4JI5B 5KX5A 1NFQA 1FTWA 3MM4A 1RKXA 4W1QA 3DEAA 4N9WA 3G0CA 5KYWA 5KSWB 4BYGA 1X86B 4LEIA 1GXSB 5B6JA 2SICE 2W2NA 5BNIA 3KT3A 3FUUA 1RCFA 4EYWA 4RDIA 4AUNA 1OC2A 4BO3A 5I9IA 1CZOA 1CQIB 1JXMA 4ZPJA 1CBUA 4Z9BA 2GQ0A 3ZW8A 2FP4B 3K15A 2ZBUA 3WA6A 5JPDA 1MMFB 1NASA 5A3VA 4XDZA 2J3LA 3UWPA 4ZAWA 3CWCA 4AL4A 2QBYB 3LQKA 2ABWA 1L4FA 3GUVA 3BTVA 1QBKC 4J1NA 2X42A 4OD0A 4JJ6A 5DX1A 4J03A 3UJCA 2Q3LA 3H11A 2GPAA 3Q88A 4BO5A 4DXHA 2K7FA 1NF9A 3G8CA 5JHHB 3BJRA 1J8YF 1IM5A 3BQMB 1RT9A 1OI4A 1EVQA 2E87A 1NXTA 1X1QA 3JR7A 4IOKA 2Y6UA 4J4TA 1DGQA 2QV0A 1LLCA 3BCRA 3DS8A 4H7JA 2HB6A 3MQ2A 2GARA 3PU6A 1HFKA 2XADA 1ZK0A 5AI9A 3DC7A 5FA6A 1M34A 2E1RA 3QUAA 4GI2A 2RH9B 2JL1A 3N2KA 2HUNA 3TDKA 5IFLA 1PJRA 2QL5A 4P0TA 2PCJA 5B5SA 5KMGA 4HJRA 4HNTA 1MO6A 1DDIA 2E37A 2E85A 4OJKA 2XYPA 1GPMA 3O4RA 4JP3A 3DYIA 1HE4A 2OFWA 4NYJQ 4N48A 2GN4A 2HF2A 1V0JA 3UYLA 3MWJA 3QVTA 1Z4NA 3PDJA 4IEIA 1KBZA 1W87A 5IRCD 1H8HA 3R3SA 2XE8A 4F9FA 1X7WB 4B3FX 2P78A 3G6WA 3LBIA 4Q19A 5EXXA 1QOZA 3R7SA 4L1KA 3QEJA 1GCUA 2JC3A 5C80A 3QEWA 3PFKA 4FS8A 2X6QA 1Z4JA 5D84A 4EG8A 2NZJA 5L3VA 1P17A 5A6SA 3NFRA 3N1EA 4G5RA 2NIPA 2HQRA 2KBFA 1VZ3A 2Z83A 4CEIA 3O8RA 1NW8A 2YMQA 3R09A 4JP2A 5E4JA 2JJ2A 3CJQA 4S1WA 2CLLB 2HL6A 5DO9A 4LXGA 3RSZA 1G5RA 5TPWA 3PKZA 5A3RA 1N4DA 4MQ6A 3M34A 4LC9A 1VCHA 3INNA 1QF6A 3E7PA 5GGYA 4ENRA 2VT2A 1G2PA 2JIQA 3VPGA 5KWJA 3OA2A 4IHAA 5AW6A 3JAKB 5HJ5A 3NUGA 2NTVA 1UXOA 2W22A 5T4FA 4R9UC 4W1PA 4GC5A 4MVJG 4NP6A 3GUHA 4FSDA 4Q4JA 1OI2A 1R5NA 2PPVA 1BHSA 4YY3B 2Q28A 2V98A 2DFPA 1ZD8A 2W2KB 1Q44A 4D82A 1XU5E 1UJBA 2GKSA 4HAOA 1JHVA 1NJFA 1CJSA 1XXHE 1GT91 3DM5A 3RODA 4B46A 4JMLA 4BIIA 3RHFA 3KQQA 4LTNA 5LC1A 3RRBA 1R74A 2WYUA 3I5AA 5AXCA 1T2AA 1MH9A 4KWIA 4NOLA 4UPVA 1XN1A 3P9YA 3VDNB 2WM9B 5AKLA 4FJ0A 5IH3A 2IYPA 2BOVA 1FX0B 2D1SA 2JJYA 3L0YA 3O75A 4FMCF 4H1UA 4INAA 4PG4A 4IGAA 2H7YA 1YB4A 2VHEA 5CA0B 4G86A 4OHRA 2DR2A 1UQRA 1F1JA 3GJQA 3QBJA 4OQZA 4TXNA 5DTJA 1Z6YA 5ALQA 4YXWD 3YASA 4HS9A 4YT4A 2G8LA 4KFRA 3D1LA 2XW6A 2WUFA 2QZJA 3IVGA 5U1PA 1UOQA 3U7HB 4WLEA 4HJXA 5GM1A 1JSRA 1C1XB 1N9ZA 1Q7TA 1UBMS 3L8FA 4LRQA 4DMLA 3AIOA 3N5CA 3CG0A 2DQ4A 1GEEA 1FZ5E 1E3IA 1X1RA 2JPDA 3NBMA 1ZGJA 1BO6A 3STWA 4E5PA 1P61B 4F11A 3MJCA 3WB2A 3I6MA 1T34A 3UC5A 1XD2A 2ID8A 4WNAA 2ZU0C 4AZWA 4GX5A 5LCXA 1LDGA 2I22A 3JQFC 3MTAA 1U65A 2I4MA 5EIXA 2J08A 1XFAA 3BRCA 1IOWA 1SAYA 2O8CA 3EGXB 4NX2A 1EWQA 3I4CA 3D6FA 1I4OA 1ZGCA 4LJKA 4L7VA 1MF7A 2YZGA 1ZDMA 4P7KA 5WRFA 4BZXA 4TTSA 1JNXX 4R2IA 4AS1A 1XEFA 2NXJA 4IF6A 5K0JA 1UKEA 1YBFA 3QP9A 1O03A 1JP7A 2ZBDA 4MR9A 1KPGA 2FPKA 4UHKA 4WJLA 2GJAA 1KI3A 4KX3A 5AXBA 2BR4A 1PDOA 4UXIA 3DAFA 4B2YA 4Y8VA 3FMIA 3N6RA 2PM8A 4FZRA 3CY6A 3BICA 1C3OA 3KVRA 4NMMA 4P3OA 4C7OB 1P5ZB 1QE3A 1SG0A 1BKDR 1V8ZA 1XR3A 1ZD1A 3AY3A 3PHJA 4KGXA 3C1TA 3BTUA 2O4CA 2X5XA 3RT7A 1NBWB 3L0OA 4EHLA 3ESQA 5DMHA 3VR5D 1F2DA 4BVBA 1RYFA 1WAMA 3AY7A 3EQ8A 1R7RA 2AN3A 2J0UA 2WFLB 1XRNA 2BP7B 2OBLA 1F38A 2ZTVA 3MB5A 1K68A 4KBFA 4UPDA 5HILA 3T9DA 3CW8X 3ODPA 4DTSA 2MYNA 1X9IA 4NOMA 3E9YA 2VNHA 3GGSA 3JV7A 3TQOA 3EXAA 4BGEA 3RI3A 1E3MA 4DF3A 1TKAA 2GS9A 3MTGA 1NNUA 2ZUTA 5CVEA 1VHLA 3I72A 1A27A 4LDQA 2XDYA 2X6RA 4NI5A 3FOFC 1HLGA 3UT6A 1Z73A 2X0EA 1ZR4A 4JLSA 2MSDB 1IQUA 1LUAA 1XCLA 3B1WA 3OJWA 4KXFB 3CZQA 1U0EA 1M8FA 5BMVA 1P6QA 1SBCA 2JAPA 4NEQA 4EHHA 2F3UA 4YR9A 4LJ6A 5BN3A 2PYIA 5BSEA 5MN6A 3QOYA 2IDMA 2EL7A 3EAFA 3IT0A 2AHRA 4DANA 3CUYA 1VLZA 2PL9A 3DSRA 4LRSB 4MQFA 3ZWWA 4CQJA 2BSXA 2DC1A 1XTUA 1DJPA 5KOIA 2BEWB 1C29B 1FRNA 5EA2A 1XB2A 4XYGA 4DMKA 1JFFB 4WT7A 1C0KA 4R83A 2YZNA 1JHZA 3LXXA 3D6NB 3M5CA 3PUJA 4U02A 3ZHTA 1BXGA 1DMRA 3JARB 1F6DA 1ZH2A 2BGLA 2DR3A 3MBOA 2EGGA 1FNSA 3QMPA 5AHOA 3EB9A 4DG5A 1P1IA 2M98A 4EWLA 4D5GA 5K8IA 4IT5A 3U3ZA 4FDLA 2WMOB 5L6MB 2HBYA 3IE2A 3VU9A 4YAOA 1SQ6A 2BZ1A 4MGIR 2VRNA 1GG5A 5KHOC 1CY6A 2INGX 4BQEA 4R05A 1J8FA 2X1MA 3ANMA 5TJ9A 1KI9A 2QR5A 4GMKA 4QT0A 3SVTA 3N53A 2V74B 3H5VA 3WOVA 3CX3A 5LZ5A 4YJ3F 4P3XA 4Q66C 3GLKA 4XUCA 5JYBA 3ORSA 4XIFA 5C5IA 3JSXA 3R5XA 4M3UA 1PT5A 1W85B 5G0UA 5CDGA 5TLSA 1EA7A 3MD0A 3S2GA 1WZ2A 1W52X 2XGJA 1PVDA 4X5NA 2J07A 3HB4X 3SMVA 2DB3A 1PR0A 2VPTA 1GG9A 2ISSD 4ZTUB 3SDBA 5IG2A 2BYTA 1G18A 5IX8A 3BFKA 1ISFA 3FDXA 3C48A 3A14A 2WJ6A 3ED5A 5EZ6B 1NJ6A 1P19A 2G5GX 2WF6A 2QZPA 4LYHA 4N49A 3I58A 4F92B 3HH8A 2GZSA 1JG2A 1JILA 1TCVA 2BTOA 5AYVA 1QUFA 3E9QA 4NABA 1YAJA 4OYRA 3W6ZA 3NDPA 4AQYB 1S01A 1V45E 1F14A 4O59O 4BB5A 1ACJA 1YFZA 2CVOA 1XGKA 4IQ8A 4UE3S 4YJ2F 2DSTA 3P2IA 5H02A 1UPTA 4Z1OA 2XCIA 3RASA 1YS2X 1AU9A 2PZFA 1NVEA 3F6PA 3QBTA 5A06A 5K0FA 3H1BA 2O2DA 1EVYA 1S8NA 1UKZA 2B69A 4FHGA 4MQBA 1PJLA 2KJQA 2FGKA 3BYZA 2X7HA 3CKKA 4M42A 1GGHA 3AJDA 3E9EA 5SY6A 1QU3A 5IN5A 3H17A 5BVHA 4QM6A 1TAUA 1KAEA 1XRRA 1OJLA 2N42A 1THTA 4KYUA 3DZIA 5FI1B 1GVHA 1FP1D 3EPJA 1JIUA 5E0OA 1CUWA 4IHKA 4ITVA 5GQSA 5K51A 2XA2A 1EMDA 1DG3A 1M9NA 2I3GA 1O95D 3K94A 3RCBA 1UKBA 2IZ1A 4J2HA 3WQSB 5KNDD 4OH7A 1DOZA 2WJJA 3BCSA 4IHQA 1C0PA 3I76A 2WD9A 4L5YA 2QX6A 2PKRA 1TPZA 1IXYA 1WG8A 3AF5A 5TF0A 1LW7A 5I4CA 1TOAA 3LS2A 4L76A 3BD6A 4NONA 1DDOA 4R6XA 2GYVA 1IXKA 1I10A 2IHNA 3G85A 3UJ7A 1MRZA 3NEPX 1SVIA 4PE5B 4TYPA 5EVCA 2FJUA 2J7KA 5FF9A 3KUKA 1SUPA 3L1HA 4M36A 4NRDA 4XOIA 4AY6A 4XRGA 1E2QA 3ITDA 3AVUA 4Q18A 2HJHA 3LX8A 3GVCA 1L7BA 2QG4A 3A6LA 3VDXA 2HSWA 4FFLA 5K99A 3RS7A 1GNSA 1RHRA 2VP6A 1DP4A 3U9SA 4G97A 1SU6A 5KNCH 4X92A 1IEVA 2ZCJA 4AZ0B 4WZAB 1PWHA 5C8XA 4FDTA 4H1HA 3FHTA 4PZEA 2JHCA 1ZL0A 3Q5EA 3HKCA 3A4MA 1EEHA 1YVRA 2IZ6A 2C5HA 2XVXA 3AERA 1MJHA 4INPA 4KOEC 5KEIA 4G0UA 1U6IA 2AC4A 4IGKA 2AG0A 4FT2A 4U00A 3CF4A 1H2HA 4TWJA 1GPDG 2D7CA 1G19A 3P9KA 3RVRA 3ZWYA 4ZGWA 1QMPA 2A94A 4BLTA 1JN0A 2VR1A 3GEGA 5DLEA 4MR8B 3RGWS 6NULA 5E38A 2WB2A 3MJVA 5K4AA 5REQB 3QPDA 3OX2A 2OQVA 3EEOA 4CEJA 3MJHA 3PFWO 4R3WA 1V35A 1XROA 1OB5A 4M0LA 4MP6A 5T6BA 1YK1A 4B3JA 1ZUNA 1TJPB 5I6DA 4JX8A 2FG5A 4RV5A 2DY1A 4Y2PA 5I9NA 3BMQA 1HTBA 1HRKA 3ZDFA 5CDHA 3A8TA 521PA 3QVWA 5BWCA 4KR7A 1G38A 3R4CA 3IMGA 2P1MB 2OD7A 1YGYA 4D3SA 1S8AA 4ZYUA 1IBKB 4JLDA 5AVSA 5DF1A 4URFA 4DPLA 1W6UA 5IJ9A 3O3OB 3G2OA 4DR3B 5IXSA 5E1BA 5ILOA 1OXXK 3SQDA 4W7SA 3NDBB 3R0IA 5HS6A 1A5SB 3JQ8B 1V8BA 4BFUA 1YK0A 3C43A 1PNQA 2GXUA 3A4LA 1LK7A 1ODLA 3HR7A 4TSRA 2H7CA 2O2ZA 2AYYA 1TAGA 3PSHA 1MX1A 3T1YB 3ROKA 1CJVC 1EE2A 3OJCA 3PCRB 5AM1A 1RYEA 4IQGA 3SYLA 1BOFA 4MJLA 1IHXA 3VR2A 1LA2A 3GRKA 4MLZA 3KWLA 1L7XA 4DIFA 3MUNA 2PH7A 5IYZB 4Y9SA 4OB6A 3V8PA 4V0OA 1UBLS 2V4MA 3NNNA 3ZHVA 4YIKA 1YUBA 4GAMC 2B0JA 2X3FA 2ZJ3A 3K8OE 3PD0A 3B36A 2J4CA 4QGAA 1XVIA 1ILEA 4DHEA 3B1KA 1MW9X 4DTXA 5D00A 1QYDA 2BKEA 3LDUA 3SPZA 2FN3A 3LTEA 4A36A 3V9PA 1EVLA 2C8VA 2HBRA 4UHBA 4FHEA 1N3IA 2WJWA 1S1MA 1Z34A 2VAWA 4WOJA 4ZXFA 2XBMA 4UTZA 4W5HA 4YQFA 1BWSA 2C3UA 2QLJA 2MJLA 1KO5A 3UHFA 1BQ4A 4UBJA 3T5PA 3CSUA 4LZWA 3DHEA 3CVJA 2QYHA 3OE4A 3THXB 3HUEA 2ZU6A 3UA4A 5EYPB 3UWKA 3T7AA 4UMFA 4GSKA 4D02A 4XYEA 3H97A 5IABA 3Q0IA 2Q5FA 2ZROA 3WQRA 1J8QA 2IU4A 2WIJA 2W90A 5I4IA 3U7QA 4BMSA 2WLSA 3DD5A 3T5CA 4D9HA 4M0PA 1Z2CA 1DOHA 2Q07A 3HDHA 4N0EA 4EJSA 4DKJA 4LQDA 3L8GA 3OQPA 3EXIA 3OZSA 4GQAA 4Y98A 2FPIA 2Z1NA 1M1UA 3K9CA 4HOYA 3EZ2A 1SUFA 1PHPA 2FE4A 4Q3KA 3V8MA 3WAKA 4DMCA 2FR8C 3E9DA 2G1PA 4EB0A 3CLRD 3H5AA 4GMDA 4R98A 4P2BA 2WJVA 3TAFA 2UUAB 3AR6A 1UMBB 4MWGA 3UQYS 4GO1A 4RAQA 2GN8A 1ECPA 3AX6A 3O9VA 1LDEA 1PFVA 5BN5A 5L3QB 1N78A 2Y0DA 1NKTA 1SC4A 4LDZA 3K6SB 3UH0A 2ZDHA 1Y89A 1KJWA 1UFKA 3KV1A 4GZ6A 5ALUA 1B76A 3PQFA 3U4QB 2Y4NA 3UOAB 1TPYA 5CFRA 1KXJA 5EPUA 4QOHA 4V2UA 1WVGA 2IXTA 4FZJA 3NUQA 3ANNA 1I01A 5DHUA 2ZWMA 1QFSA 4XUGB 1YRAA 5EJ5A 1H6BA 5I8WA 2BIFA 4O4LA 1WTAA 2P3QA 1CUBA 4FTWA 1U0SY 4KRXA 4AJJA 4F2WA 1XXLA 1BQEA 3J81k 4YRFA 4IEEA 5CITA 2R8OA 4RXTA 2YDYA 1OX4B 2OCBA 4XPZA 3OQ6A 4Z51A 3CNQS 2GAAA 4DLBA 1Q57A 4NY1A 3F2IA 5DCUA 4B3DA 1I5RA 3URMA 1QFZA 2NZVG 3QWHA 1XXHA 3ZV3A 3CUKA 4PNHA 4DC0A 4O0LA 3DW1X 4Z4IA 4AICA 5A04A 1BMFD 3FMPB 1HKHA 2E55A 3AG6A 3HV2A 4C6SA 4QGSA 2QVYX 3HGMA 4FGKA 4R16A 1Y63A 3KR0A 2H4TA 1G7SA 4EJFA 1P1RA 3EGOA 3C3XA 1U4SA 2LF3A 1EFVA 4GYJA 4OXYA 3UMVA 3NP9A 2OM6A 4B5LA 4EL0A 1Q1AA 2JANA 5CK5A 2DHDA 4OHUA 1A8IA 4FSXA 2HYIC 1E9SA 5BUZA 1FUUA 3IS3A 2VC2B 4PYQA 1XPOA 3EK2A 3PP8A 5F4ZA 5CVTA 3G17A 2NSYA 3LDFA 3M2TA 3AVOA 1DBRA 1VP9A 5KVVA 4DV4B 1YZYA 1ODSA 4G5OA 3DFUA 4IJKA 1DLJA 5BQPA 5LLSA 3LZCA 4ND8B 1PFWA 2XSZA 3IJEB 4GHWA 3ZX4A 4B7XA 1ONOA 1D2HA 1V43A 2R9VA 2JI6A 4KXVA 4F06A 2VZEA 2JCGA 1PX2A 4HGQA 2OAGA 2X4GA 1KTVA 1ZIXA 3E1SA 4S1OA 4UEWA 4Y6PA 1JSXA 4WL0A 3D2BA 1LV8A 1D2EA 2WIGA 3ICEA 1J70A 1ULBA 3TE6A 3M4XA 2JLSA 1E6MA 4QELA 4JYAB 1C1HA 1M75A 3S40A 2ZIFA 2IHZA 2BCJQ 3TUIC 2QAGB 3HP7A 1RPZA 3WX0A 1ULSA 3PNLA 2GEBA 4K03A 3LMKA 4I1SA 1W1UA 5L53A 4WKBA 3DZFA 1CR6A 5K3AA 2B0CA 1FP4B 1SVUA 1YCDA 2JD0A 3O94A 5ALIA 1PS8A 4ZT7A 5MFZA 3L0BA 4MO2A 3DAYA 4NV3A 3C6OB 3TINA 3QBEA 5AM2A 4MGHA 3I01M 4O4HF 5E0KB 3HO6A 5K3DA 4P86A 3CKLA 4UTRA 1GIAA 1MJFA 3SE0A 1OZAA 3RWBA 2HJVA 2RBKA 1RLJA 2G72A 2A1UA 2HJRA 3EQZA 5T8KC 3UK1A 1NG9A 3IFSA 1BGVA 4F5EA 4OXNA 4R54A 1KKLA 1VLJA 2P90A 3DE0X 3V7FA 1MVOA 2ZVDA 4MCAA 3W1WA 3BJIC 3ZY5A 3AYXB 3EXFA 5KTYA 1V39A 4BRUA 1ECLA 1D5CA 1P0IA 4Y6OA 4CLOB 2W2LD 2B1GA 4IQ4A 2F8LA 3L93A 2YIDA 3ZS8A 3F6BX 3WSOA 3DLHA 1SXGA 3EJ6A 1HFJA 5AJWA 1J0EA 1LTQA 4ZVVA 2A33A 2O3TA 1V1JA 1I0IA 3QUQA 3TR0A 1Q0HA 3UB4A 4QNMA 4G0MA 2DWPA 4JDPA 3DZDA 2NQ2C 1L7EA 2Y0BA 4IOLA 5ED4A 4JVLA 5HIMA 3RSGA 4NATA 1FU7A 3O83A 3GGOA 5IHXA 5MHTA 2NQ8A 3V34A 3BERA 3K9WA 1SCQA 4KR3A 3NRJA 5E6UA 4CMGA 4M6WA 3GR6A 1PVOA 4IILA 1UXHA 3ZUPA 3QK7A 5IBRA 3EVAA 3PJRA 4BO9A 5C8ZA 1H4QA 1Z5OA 2B2CA 4TLAA 4DE5A 5DNVA 3CNHA 1GGNA 3I1FA 3R6DA 4CUZA 2V54A 3KLPX 1RD4A 3ZG6A 3DV2A 4KE8A 3QGMA 3SHTA 4CM1A 4GKKB 4MHOA 2LUOA 3RKSA 3AUXA 1XMSA 3PL1A 3QE3A 1J6UA 4DPMA 1JAIA 2MSEB 1YVEI 4G3XA 1IMOA 4QT4A 1K6EA 3SZLA 1QG0A 4M7OA 1TEVA 4OMFG 3U40A 5AVYA 5CBKA 2WU3A 3LBHA 3L0MA 4O6VA 4DA8A 3UICA 3DEKA 4QNRA 2W4QA 1DDGA 1SUCA 2JAOA 1PR4A 1AHHA 3AC0A 3FSJX 3HG7A 4R2LA 4DTCA 3ZJYA 3W5DA 3VU8A 4XUEA 3U26A 4UEKA 2XTZA 4LHXA 4F04A 2IYOA 1ZVMA 4LGMA 1VB3A 3C95A 3NGXA 3IPAA 1NC1A 5THXA 1TI7A 2FSUA 2QRVA 3CM0A 3LGXA 4DGQA 4CIDA 4ZEMA 2ST1A 1AF7A 4Q4HB 2NSDA 1H65A 2BLNA 4ZOBA 1IZ0A 1LBIA 1W9MA 4UVEA 1MGPA 3FOZA 1Z2NX 4IUBS 2DXIA 4QXAA 2NUBA 5JD3A 1QYVA 1PWYE 1OBOA 1A8SA 4Y1RB 4KPUB 2UZ0A 3VR0A 3ZE6A 1V4BA 3IUMA 4G24A 1A9XA 3MWFA 4MIOA 2N47A 2QX8A 3T1HB 2QMEA 2X8AA 5LBIA 2LBPA 3GGGA 4XWOA 4ZJYA 1US8B 3GQBB 5KCMA 2HMVA 4E5MA 4CPDA 3QEBZ 1PNRA 4KO4S 2H9IA 3KZCA 3CJRA 1Z0DA 2XNJA 3H1PA 4B4VA 5I9LA 4Z4QA 2O48X 4ZK6A 1KI4A 1SCJA 4TL8A 4EKIA 2BBSA 2IGBA 5B3KA 2QLBA 4BNLA 1GKUB 3EIHA 3H2YA 3SFZA 4IG4A 2UYHA 3FAKA 4TZ0A 5H4HA 2WC1A 2B5VA 4AI6A 4RBNA 5MDHA 3HWRA 4J9VA 1XVEE 2WF5A 3VBEA 2OCPA 3OOEA 4XB6B 5FADA 3VHXA 3TG2A 2XCSB 1LEHA 1ZMTA 3D7LA 3WAGA 1BDJA 3LUHA 2ZT6A 4N3AA 1W8DA 3LC2O 1T10A 1M74A 4FX2A 4M41A 1IY8A 5BW6B 3O2JA 3DOIA 1L7AA 4KDEA 1XL0A 2VL7A 2V7UA 1RQ7A 2H2WA 1UBHS 3MTEA 3C7CB 3U60B 2CUNA 4ECEA 1WZUA 4OBEA 1H69A 2VK2A 4KYIB 3PL5A 3O26A 1N3YA 4PQRA 4JUAA 1USKA 3WZ2A 3VRHA 1HDZA 1XZDA 4GDFA 3NKFA 3VAAA 3CN9A 3G68A 5E8RA 4DMHA 1L5VA 2CL5A 2F17A 5E7QA 4CKBA 5L6LB 3CCBA 1BRTA 3NGMA 1RKQA 2O3SA 1J0AA 1PI3A 4G5GA 4QQNA 2DFNA 5DRTA 5JMTA 3BIWA 1K08A 1V11A 4KTVE 3N3BC 3TFWA 1ZMRA 1BH6A