3L2OB

Structure-based mechanism of dimerization-dependent ubiquitination by the scffbx4 ubiquitin ligase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
308
structure length
274
Chain Sequence
AASTLTRLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVFFDYMAVYRMCCPYLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTTRRYSVIPQIQKVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of dimerization-dependent ubiquitination by the SCF(Fbx4) ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/cell cycle
molecule keywords S-phase kinase-associated protein 1
total genus 69
structure length 274
sequence length 308
ec nomenclature
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00646 F-box F-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3l2oB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l2oB02
2JJ1A 4LV6A 1DAEA 4KJZA 4GPTA 2VHTA 2ZRHA 3AP2A 4TL6A 3U7FB 2DBYA 4EJSB 2OVRB 3DL0A 3NEYA 4YONB 3ZIAD 2ZI9A 3ZIAA 4CF7A 2RH5A 2NIPA 2AK3A 1OF1A 2JEOA 3OEED 2NGRA 4LYFA 3TNFA 1HQCA 3ZH9B 1SVKA 2ORIA 1ZBDA 2FWRA 1ZD9A 5CJ2A 1NMXA 5FTKA 2QNRA 1G21E 3Q5EA 4M9XA 1OIVA 1WRBA 4DDUA 1XTKA 3BD9A 1Z6AA 4LBZA 3OE7D 1ESNA 1NVUQ 2KSQA 4QBGB 4Q9JA 1GZSA 5LBIA 4EPTA 1JB1A 4ZDIA 4D25A 4AKGA 2OLKA 3FHOA 2BHRA 3IGFA 2E31A 4MITA 3SYNA 3K8YA 1FPMA 4KVGA 3X1WA 4TTQA 4C7OA 3KQLA 1KSHA 4IKEA 3B8HA 3EZ9A 1CR4A 3LVRE 4CRWB 3ADKA 1Q22A 2LKCA 2FU5C 1XMIA 1DG3A 1G8YA 2YOGA 1E79D 3DEFA 4DLWA 2Z4RA 3SE0A 5EZ5A 3K0FB 1Z6XA 1CJUC 1E1RA 3P32A 3OHMA 4RJLA 1KZGB 1VCMA 1JR3A 1L4YA 1QHSA 3O8BA 3T61A 2HLDA 2PH1A 3JVVA 1ZD1A 3L0PA 2XOKD 4GI7A 3K9NA 3HYTA 4JKIA 4WZBE 1HUQA 2ZI6A 3GLHA 1G3IA 5EXPA 2LWIA 1GNQA 3GLIE 5BYKA 1CRPA 1H65A 1PJRA 3FKSD 1E9SA 3BB1A 3H1TA 5EP3A 5GJBA 4TQAA 4JBYA 4JL5A 1NVVQ 2CE2X 2WWGA 1LFDB 2E9SA 3C16C 1P7CA 4JSTA 2YWGA 3RS7A 4EPXA 3A6PC 3PEWA 5KSZA 1XRJA 4JSYA 3CPHA 1Z0IA 2BMJA 1JPNA 2R8RA 1TADA 3BERA 4KHZA 1NRJB 4V02A 3ICEA 5HKKA 4CEIB 4ZKEA 1HT1E 2XB4A 1Z0JA 2GNOA 1BKDR 2GCNA 3U3JA 5JRZA 2WWYA 2PCJA 1E2EA 3A4NA 2ZANA 3OIVA 2IT1A 4FMCB 4EPYA 2QMEA 1PLJA 4DLVA 2P2LA 4DZZA 4RFSA 1M7BA 5DI9A 3K0EA 1DOAA 3CZPA 3FWYA 4Q03A 4TN1A 1FW6A 1CR2A 3QKRB 2P1OB 1BIFA 5EXXA 4QRHA 3LH5A 3UK6A 4D81A 1U94A 1DAIA 1J90A 2C9CA 3TMKA 2OO7A 2ORWA 4DRZA 1SVIA 1YQTA 1W4BA 1FTNA 2R44A 2R9VA 1ZM3A 2G6BA 2GJKA 4TL8A 4Y0AA 4F92B 4AIIA 3QSYA 3DZDA 2ZJYA 3VR1A 4MKHA 5E7IA 1TX4B 2VYFA 4F93B 4LV8B 3OIUA 4B2PA 3TR5A 4AWXA 5KPDA 2C96A 5J5CA 4HUTA 4TQUS 1GAJA 3Q7QA 1R8QA 1E6CA 1YZQA 2JJ2D 3VU9A 2F1RA 2C5LA 2PLFA 2FA9A 1RPZA 4C2UA 2Q9CA 3QVVA 1W2GA 1AM4D 2FDCA 1N25A 3EG5A 2HEIA 4PSKA 4EIWA 2IC5A 3ZD7A 3SHFA 4XD7A 5DHAA 3AVWA 3CRMA 1KK1A 2ANCA 2JLSA 1Z07A 4YMSA 4KAXA 3HPRA 2ZQ5A 5P21A 5E7MA 3QF7A 3QXSA 4K81B 1AQUA 2PMKA 1XCMA 5HZKA 2AL7A 2WKQA 4P32A 3U3MA 4JLPA 2QL6A 1T4GA 3B1VA 1WB9A 1W5SA 1KMHA 1OFUX 3EAQA 3C8UA 2GWHA 4X8HA 5FFMA 3VHXA 4C0JA 2EVWX 4TTRA 1SXJD 2BMDA 5JEDA 3FOZA 1R5BA 4TMXA 5HE9A 3BH6A 1Z8FA 1HH4A 2AD5A 2BEKA 1UDXA 1IN8A 5TDHA 4MQBA 1PUIA 3QF4A 2F9LA 1GKUB 2QT0A 2WAXA 1UFQA 1DAHA 1DAKA 1ZUIA 2IXGA 2FEOA 5FOXA 4DCSA 2YKGA 4AKHA 2HUPA 3RABA 1N5KA 4OQLA 3EPKA 2REXB 1A2BA 3W90A 4QJ5A 3GLIB 1OFHA 1TQDA 4HATA 4NYJQ 2GK7A 4X8OA 1OXSC 4QM7A 1EFRA 1G4AE 3PXGA 4NDZA 3MCAA 1E2QA 4HAZA 2EFDB 2NTYC 2I3BA 4OJQA 5JZVA 1CIPA 1J70A 3G0HA 2I1VB 1E9EA 2ZI5A 3U6BA 1UKYA 3GLHE 1VG1A 3VTKA 4IOKA 1YHNA 1XTRA 2VSXA 4EFMA 4PHTA 1Q3TA 2DFNA 3B1YA 4MGZR 2JCSA 4C0KA 3AH8A 3AGQA 2V4ZA 1VCOA 2A5GA 5B30A 2WOJA 1LS1A 1TQ2A 2B7CA 3BFKA 3L0OA 5CIQA 3RDPA 2P5SA 4KV9A 3SYKA 4B3XA 4LHXA 4DEXA 1XMSA 2VL7A 3KUCA 2AKYA 4Q4JB 3ZLJA 4ACAA 4ARZA 2JJ1D 1FFHA 2PX0A 2QAGB 1G9XA 2B21A 2UVQA 3GEEA 5L3VA 4BLOA 3TLXA 4PC3A 2G1JA 1KI1A 4B2IA 3IHWA 4KBFA 3LFUA 2IS4A 3I3SR 2QRZA 4FCTA 3U61B 5IRCD 1L4UA 1OHHA 2EFCB 3DMDA 1EFRD 1JJVA 3SC3A 1S96A 2NG1A 4JVNA 721PA 3OEHA 4RCZA 4BFWA 1MH1A 1KO4A 1T6NA 5BQ5A 8OHMA 1CRQA 1KAGA 4BEJA 2BBSA 1X6VA 4M9QA 4TSFA 4UNNA 2G3YA 5KPJA 3CIOA 2ZJ2A 2QGNA 2ZYVX 2RMKA 3VU9B 1AIPA 1RRCA 1XD9A 1QBKC 2ZJ5A 4DLUA 5DIFA 1G8GA 3C7KA 4UNPA 1KO5A 5CYOA 4OQMA 1ZVQA 5BW8A 3H84A 4XSGA 4LYJA 4URZR 2QP4A 4KITB 2AFHE 4QGAA 1G41A 4HZUA 1YZNA 2CCJA 2C95A 1G3QA 1W36D 4A15A 4BFZA 1G3RA 4Q4AB 4RVCA 1XPUA 3PEVA 1U98A 2DYKA 4P4SA 3X1DA 3ZGXA 1KGDA 1UJ2A 1D9ZA 4OHYA 4A92A 4ABYA 4YXWA 2VSOA 1COWA 5BYJA 1G291 4CZ2A 4Q1AA 1Z0AA 3PG5A 2GVDC 3TVTA 1DEKA 3ZZTA 1IN6A 3BB3A 5JCZA 1WBBA 3F0TA 3QG5A 3EXAA 2WZQA 3GFTA 1J99A 2AK2A 4NE2A 3MAAC 4PC2A 3O8RA 3AP1A 3PVSA 2WKRA 5FR1A 2J0UB 1WQ1R 4ZKDA 2JGNA 4KYIB 4DCUA 1KDTA 1KDPA 3HDTA 3WMEA 1VYUA 4NCJA 2WIAA 1AA9A 1KNQA 2BJVA 4HAUA 3DM5A 1EK0A 2LCFA 4HLUA 2IWHA 5FL7D 4UNRA 1GM5A 3NBFA 1NBME 1XNJA 4MUBA 4MYCA 4A4DA 2J7KA 1ZNXA 3QXCA 4TYQA 3L0IB 2VLIA 5K8IA 1F2UA 3CO5A 3ZVRA 4DDVA 4CT4B 1N6RA 1JR6A 3TGPA 1SVSA 4IDNA 3IIJA 5FR2A 2BOVA 2YWFA 2ZRDA 3MJRA 4LJ9A 4DIEA 3NKVA 3A4MA 5GJWC 3RS3A 5JWRA 3Q9LA 1Z0DA 4A8JA 4RZUA 4A1FA 1O3YA 1DG1G 1XCPA 5DSZA 1FQKA 4RSGA 2A5DA 1ZW6A 2ZRCA 1M2OB 3ASZA 3ASYA 3B9PA 3CR8A 121PA 2CLDX 3IIMA 1GTVA 5L3SA 5CLQA 4KLNA 4L4UA 4WAUA 3ZS8A 1KO7A 1DELA 2JIZD 3N5CA 5H8WA 4HLDA 1JALA 3QXHA 2Y8EA 4RD2A 4ZV4A 1E2MA 4RZ2A 3LXXA 5FUYA 4BWYA 1V5WA 1Z28A 5AK0A 1RRPA 1ZM9A 1ZRHA 5JJIA 5CDFA 1G5TA 3NH9A 3OEEA 1KI9A 4RKFA 2ZRMA 3W5IA 5J4HA 1W1WA 1KYIA 3X1XA 1X1SA 1UBGA 3KX2A 4A6XA 4D0GA 4YXWD 5KNBA 2KBFA 3C41J 1WDTA 2FNAA 4A2WA 3NEJA 2ZPTX 4GNKA 4K8OA 3DDCA 1LV7A 4YC7A 4F38A 2QPAA 4LOAA 4TWZA 5FI0B 2WTUA 2V6IA 5JHHB 3KTAB 2PEYA 3UWKA 4OHVA 3OGLB 2VP0A 3QI2A 3T1TA 5EE9A 1SZPA 2GJ8A 5JMTA 3WBJA 2IEZA 4RCYA 3U3RA 3WMGA 1MR3F 1S4QA 1W48A 4BZQA 1K5DA 2ZRKA 2EYUA 3QOFA 3W3ZB 2W2TA 1AK2A 1ZM4A 2IYXA 2XNDD 1XB2A 2W83A 1OXXK 4PHFA 4DB2A 1UADA 2ZSFA 5FBQB 3VMFA 1D5CA 2QP3A 3IKJA 3TW4A 4J0QA 4Q4HB 4A9AA 2VSFA 1AZTA 4QOSA 2P65A 1YRBA 2NPFA 1E1QD 1TU4A 2PT5A 4LJ8A 5DHFA 1E2IA 2ATVA 4DIDA 1AQYA 5JJLA 1E98A 2NO1A 4P4UA 1ZM7A 5A4JA 1I2MA 4B71A 3S1AA 1ZUHA 3GLGE 1WBDA 1Z5ZA 3SHWA 1XP8A 2B6HA 3A36A 1TPZA 4AKEA 4C0QC 2MSEB 3EPHA 4RD3A 3AVPA 1EX7A 3C15C 4NYIR 4HEJA 4UJ5A 5J4YA 4NP6A 4D2IA 2EQBA 1Q1EA 3CRW1 2ZJBA 2QAJA 3RHFA 3R20A 5B64A 2C04A 3FKSA 1J2JA 2W0SA 3AVTA 2GF0A 3FKQA 4FMCF 4JL6A 4B44A 2AFIE 1WCV1 1HY3A 3IPXA 1M34E 1XPOA 1VG8A 4KO8A 4PPNA 1E0AA 3B13B 3QE0A 4HLQB 4B75A 1R5NA 1SKYB 3Q5DA 1ZIOA 4DCTA 2OCAA 3TK1A 3GCGA 3NBZC 4MRPA 3VFDA 3C5CA 2KWIA 1JJ7A 1UPTA 3KQUA 4PZZA 3PQCA 4JBXA 3ICQB 3I4LA 3NC1C 3CZQA 3THYA 3OGKB 3OZXA 1E2JA 4GL2A 1TUEA 1KI3A 5GADl 4C4PA 2F1IA 4KBGA 2A78A 1G1MA 2QN6A 3QBVA 4M1TA 1QG4A 2QE7A 1JAIA 3O8DA 4C3ZA 5F3WB 1CU1A 2TMKA 2A5YB 3WRYC 2O8CA 4HAYA 4W5JA 2H7VA 2J46A 4GBMA 2RKOA 1P6XA 1OFIA 1XMVA 5TB5A 4S2EA 3HR8A 2IUTA 1F5NA 3OE7A 2BBOA 3FYHA 2ZJZA 3OAAD 4NL4H 1H8EA 4Q7KA 5FBRB 5KSPA 4RZXA 1AS2A 2N42A 3QKSA 1QDEA 2CNWD 2W6IA 3VR2A 3GLGB 4LDJA 2YOHA 4Q21A 3ZYCA 1O87A 5FL3A 4DLTA 1OPXA 2ZI7A 3CX8A 3U3KA 2ZRNA 4BFXA 2FV8A 1Z0KA 2SHKA 4XVUA 3RC3A 2ZRBA 3NBXX 1AGRA 1KSGA 1SKQA 3UMFA 3WBKA 2EW1A 4KSCA 3PEYA 4Q5IA 5SZJA 1NMZA 3PV0A 1IJFA 3T1QA 3RSLA 2H1LA 5FPKA 3I8XA 4EAQA 4HAVA 2R6AA 1S3SA 1Z6YA 1JXOA 3VQTA 3KXKA 3QNUA 4P4TA 3A1WA 2WM9B 3IDQA 1IHUA 1FL9A 2BV3A 1ZINA 1X86B 2BCGY 1KK0A 1F60A 1R7RA 2W6JA 4V0MA 4DUGA 5AUOB 1XEFA 2GKSA 2KB0A 4BGDA 2X1VA 4RFVA 1FNNA 1HURA 2EWVA 4QXAA 4WXRA 3K0CA 4HLUC 1OIXA 2ZU0C 3U7HB 5FTJA 4ZDJA 3V4RA 3MRSA 2R6DA 5LPNA 4NMMA 2ODEA 3ZVLA 2C9YA 3IUYA 3OGMB 5ELXA 4JIMA 1RC8A 2FFAA 2GEUA 3AF1A 3Q72A 4Q9KA 2ZREA 1W49A 1OH8A 1VPLA 2QQ0A 5HZHA 3I5YA 3BOSA 2ZR7A 4TLDA 1A7JA 3CW2A 1P2UA 2D7CA 5EE1A 3NDBB 1XEWY 3TQFA 5JI3E 2WBLC 1P9WA 1U0HC 3Q7PA 2QY9A 1OIWA 2QORA 4I1SA 4A8JB 4M1WA 5FOSA 2AXPA 5F98A 1OXUA 1CP2A 1FP7A 2AHOA 4DXAA 2GK6A 1E2DA 1G4UR 4M9SA 4R7ZA 1HEIA 1W0JA 3AVQA 4M1YA 2H57A 5FPHA 1Z22A 3CPJB 3WHKA 5EE0A 3GJ3A 2ZYUX 1FQJA 1QZXA 2KE5A 2GZAA 1TF2A 4R71A 3EARA 3MG9A 1WMSA 4QGHA 1DO0A 4QBIA 5IK2A 3X1ZA 4D0LB 5KYKA 1NF3A 2DWQA 2R6CA 3SFZA 2QEQA 2PZEA 3MKSB 2BVNA 2DPXA 3U4QB 4A0FA 3AF2A 5BXQC 2KBEA 2FE4A 4PHGA 3SDZA 4GP7A 4LJ4A 1RKBA 2F55A 4HB4A 2CL6X 1N6KA 4R2IA 3SQXA 3LBIA 2IYQA 3EZ6A 3LY5A 2QP9X 1SHZA 1DTSA 1KDOA 4PSAA 3KJGA 3R9XA 1JPJA 1NP6A 4FW9A 3IBYA 3H2YA 1NIPA 3THYB 1RVDA 1N5IA 3RVBA 3WMFA 3NHAA 5C2JB 2Q0HA 4EFLA 3QPVA 1GSIA 3KTAA 1XTSA 1VYVA 1Z3IX 1G3UA 1DO2A 2QENA 4IJMA 4Z1MD 2IS6A 4G5RA 3ADBA 5LB4A 5DN6A 3R8FA 2V6JA 2R6GA 1JR3D 2YWHA 2QMUA 3I61A 3PR1A 5AR1A 2F43B 1M7HA 2ZR9A 2CVFA 2O0HA 3BBPA 4DSNA 4JZKA 4Q00A 5AJVB 3DZ8A 1XZQA 1WF3A 1Q12A 4RZ3A 5HPYB 2RHDA 3SI7A 1U0LA 3Q85A 3GFPA 3SOPA 3TQCA 2GZDA 3GMTA 3OIWA 1R0XA 1T9HA 3P20A 1KAOA 3LA6A 3THWB 1KY2A 4G5SA 1Z0FA 4B74A 2O8BB 1I4DD 2RGBA 4LYAA 2H17A 4JLKA 1TMKA 2FSFA 4PQFA 1C4OA 3OFNA 3RS5A 1II8B 4XWOA 3LO5A 4IOMA 2OVQB 1IAQA 1N5JA 1FTSA 2ZRIA 2HYIC 3A1UA 2VTKA 3B85A 1XEXA 3B82A 3P26A 1MV5A 1RFLA 1TL7C 2AX4A 2CEAA 4JLVA 4P4SB 2ANBA 5C4MA 3TE6A 1GIAA 2X2FA 1UEJA 1XF9A 4FWTA 1GKIA 4LUCA 1T5LA 3SU8A 3OFND 5BWMA 2X2EA 3TH5A 1NL3A 4OHXA 3A58B 3LXRA 1W0KD 1G8PA 3T5GA 3TSZA 1ZUNB 1W4RA 2IYWA 4BLQA 4OQNA 5J40A 3U60B 1CJMA 1JQJC 1P73A 3IBGA 2P6NA 1GOTA 3F5FA 2WOOA 4N3NA 1XD2A 2GAAA 4IW3B 5KNCA 1TF5A 3QKRA 4RD1A 3BB4A 3SBDA 3QKUA 3FPAA 1EESA 1S1CA 1JAHA 5HR5A 4LBYA 4N0EA 2HLDD 1F6BA 1VDZA 4TLAA 2P1QB 3CKLA 3DPUA 2J87A 3CPEA 4YMWA 3THXA 1TAGA 3ONWA 4EPWA 4Q02A 1A82A 4F4IA 5JFGA 2JLZA 5DYGA 5GJVC 2D2EA 5BN3A 3B5JA 2IXFA 3GJ8A 2GCOA 4G5QA 3L8YA 1E9AA 2VO1A 4YDSA 1KJZA 1RYFA 2RGXA 1IJEA 5DNYB 4LPSA 3AP3A 2P1MB 1UBCA 3RAPR 1CF4A 3TUIC 5FTLA 2BMFA 3NIBA 4GMDA 4JLDA 3ZDQA 2JATA 2W58A 3RRNA 2OHFA 4ACBA 3FDIA 4B3DA 2J7PA 3E2IA 3GEHA 5FH9A 2DFKB 2VHCA 2FPKA 4QHTA 1E69A 1HYQA 2Z6VA 3FGNA 4O25A 2ZSDA 3EZFA 1J7KA 1YJ5A 4MH0R 4R98A 1AJEA 1VHTA 1WA5A 1AKEA 3K0SA 5E95A 4D6PA 3U4QA 2FFHA 2Q3MA 5L3SB 1ZU4A 1Y3AA 4DT1A 1QHHA 5AUPB 2OILA 2GF9A 5FTNA 3UG6A 3E5HA 5KU1A 3FHTA 5FBWB 1SGWA 2XXAA 1P9RA 2OG2A 4Z8YA 5KUTA 2ZVQX 2HT1A 2J3EA 4BLSA 1PLKA 1ONBA 4A6PA 1OFTA 3ZQJA 4JLOA 2GTPA 1AKYA 1MT0A 3ADCA 1MRNA 4AC9A 4ZIRB 3KKMA 1X8KA 4FMDB 4QC2A 4UNSA 2ZS9A 1VMAA 3IO3A 1W7AA 3P1JA 2XOKA 4QM6A 2WWXA 4BFUA 1Z29A 3PUZA 4XVQA 1SVWA 1YU9A 2BDTA 1Q1ZA 4XWKA 2BC9A 2NOAA 3I8SA 3LNCA 5TXGA 4TT3D 4C7OB 3KJIA 3FB4A 2ONJA 3PJRA 4GRAA 2I1QA 2JLWA 2WSMA 3K0CC 1NNEA 3W3AA 1VIAA 2GZHA 4Q1EA 3LQQA 4BRWA 1HV8A 1GWNA 2BKEA 2OE2A 5K8LA 3J81k 4PO8A 3QBTA 3K0AB 2ZI4A 4HDQB 1KY3A 1Z63A 5CB6A 3T06B 2ZU6A 4TMVA 2ODWA 1P4SA 1WE2A 4IOLA 1IONA 4JLBA 4Q7MB 3THWA 1YVDA 2C78A 4MUAA 2CCGA 3Q8XB 3CNOA 1I4LD 2VHJA 1XX6A 4DUGD 4FCVA 5DE3A 4YQFA 1G8FA 2RB4A 3VR3A 1U8YA 1UKEA 1GG2A 1OKKD 3K53A 3CBQA 1IXSB 5JRJA 2ZR0A 4LBVA 3AUXA 5DO9A 1CJVC 4QL3A 2Q6TA 2WV9A 1DARA 5UKDA 3MFYA 2R62A 2GETA 3S1AB 4JYBA 2A30A 4GZMA 3UIEA 5KO2A 4BLRA 1E0JA 1EGAA 2IWRA 4I1UA 3TUJC 2ZYWX 3DO6A 1N6IA 4KSBA 2P1NB 1BMFD 1UAAA 4US0R 3CNNA 4Q9IA 4B43A 4YMVA 1OB2A 1G18A 1YE8A 3AVUA 3C5HA 4DC9A 2GJ9A 4PTLA 4BFTA 2DCUA 3LBHA 4RD6A 4ERNA 5FBLB 3N2IA 2CJWA 1SVOA 1E1QA 2GBLA 2OCYC 3IO5A 2JLRA 5CK4A 5HCNA 2JJ2A 2VHQA 4OQFA 2PEZA 4BUJA 3VHLB 4Q9LA 2D62A 1Q3HA 4NBSA 3EZ7A 4P3YA 4GMXA 4NYMQ 4KLZA 4HDCA 5EP4A 4B32A 5SZHB 4B35A 1IXRC 2V55B 4BZPA 3N70A 2CLSA 3MWLA 3QXXA 1X3SA 4IFBA 4AYWA 1EFUA 1IY1A 4QKQA 1FP6A 1LNZA 3PENA 5FUWA 1UKVY 1G16A 2JASA 1MO3A 2P1PB 4URVR 3EC1A 2OFXA 4MRVA 4G01B 2AWNA 3UXMA 1Q0UA 2CK3D 2GXSA 5LB2A 1LTQA 2DWOA 2Q3HA 2IK8A 4FIDA 4QBFA 3C6NB 2OBMA 3AVOA 1T3HA 1OLOA 4XTRA 3UWOA 5L3RA 2IF0A 3I92A 2XXAB 1SQ5A 3FHCB 4PX9A 2O8BA 4M1OA 1ANKA 2ZE8A 4Q1BA 4URUR 3V00A 1Q21A 2C2HA 4ZI3A 5DH9A 1II8A 621PA 3AGPA 4OKSA 4W9MC 1JECA 2D3WA 4IVRA 5EQTA 3IPYA 1UDWA 2WJJA 1QVAA 2HCJB 4NH0A 4KU4A 4AYTA 4XOIA 3UANA 1Z2AA 2XGJA 3GPLA 3IQXA 4ZI2A 2REBA 2G83A 2BWJA 3O47A 3AVXA 3KJEA 1VYTA 3CRQA 2JIZA 4NCHA 4O3MA 3ZVNA 3K70C 4ZO4A 4M9ZA 2HF9A 1E2GA 3P4XA 2WSSA 1R0YA 2J0QA 3W8RA 3ETLA 3JZMA 1W0JD 2RGEA 4DDTA 5CK5A 1L2TA 5FI1B 4HAXA 4FD2A 2Q21A 3W6OA 3WYFA 2HV8A 2PZFA 1II9A 2E1RA 2HJVA 5EE3A 5AWFC 4DHEA 1J8YF 2G9NA 2X19A 2CBZA 3IEUA 4LPKA 3LDAA 1P5ZB 1Z2CA 3QQ5A 1N6LA 4OK6A 1R2QA 3ZS9A 2QE7D 3B9QA 3C4JA 4Z1MA 1PVOA 1IXZA 3KB1A 4P33A 5DN6D 2QA5A 4XVRA 2XZPA 5G41A 2I4IA 3KXIA 4TSFD 3AQ4A 1XFAA 2GEVA 1OH7A 1EWRA 4NPHA 2HYDA 4LHWA 4UXJA 3FTQA 3MWJA 4TQ9A 3BFXA 3FMOB 1AS3A 1B0UA 4JT4A 4Q19A 4PFSA 4TLBA 1FUUA 1C9KA 4LYHA 1MKYA 1QHYA 4BE7B 1KIMA 4RY2A 5DI3B 1GUAA 1G3MA 1KK3A 2XJ4A 2IYLD 2OFWA 4HB0A 2G0NA 4BLTA 2FF7A 4E03A 4EQ6A 2NZJA 4PHHA 3A37A 2QMOA 4AY2A 3KFXA 4PO9A 3VAAA 3LX5A 1ZC3A 2ATXA 3VR4A 4A0GA 4DT1B 3EPJA 4DWJA 2NO9A 2GEDA 2ZE6A 4KFSA 5FOUA 4US1R 4I6JB 4E5UA 2YV5A 1T91A 1E0KA 3TR0A 3HJNA 1G64A 4M53A 2CJWB 4RD0A 3G5UA 2JLUA 1ELOA 2ZAMA 4M1KA 5JSZB 3REFA 1LDKE 1VG9B 1NBMA 1NN3A 3B60A 3PUYA 5F9FA 1RZ3A 4NCKA 4EFNA 5KDOA 1FX0A 521PA 1OKKA 3CR7A 5GVSA 2RHMA 4GOKA 4PQRA 2GJSA 5AJZA 1ZYUA 2CXXA 5SZIA 2PJRA 3LAWA 3T1VA 3IHLA 1NVXQ 1G7SA 2W00A 1D8TA 1NY6A 1R4AA 2IYSA 2JDID 2VA8A 3PITA 2P3SA 3T12A 1P60A 2FSGA 2ZITA 1Q1QA 2QPTA 2J7PD 2ZRAA 3AV0B 3SBEA 2VP2A 3E1SA 4TLEA 1XTIA 4QGGA 1XCGB 1G7CA 1TEVA 4M22A 2B7BA 3AKYA 3AVYA 4QJ4A 3C6PB 1Q44A 1FMLA 2OT3B 5B2ZA 2FOLA 1US8A 5J47A 2CL0X 4CW7A 4X8LA 2O52A 1T0JB 5D3MB 3BWDD 2QUZA 3A4LA 4WA7A 3GJ6A 3RS4A 3KKOA 4BFVA 4DCVA 4DLYA 2ZIAA 1E2FA 2IW3A 2WMOB 2AXNA 3K09A 2WIBA 4Q01A 4OJKA 4BPBA 1ETUA 2OBLA 1UEIA 1XDBA 1P22A 4JVMA 3T1OA 2C9OA 3THOA 4BEBA 5JECA 3CNLA 5EE5B 2QGZA 3ZD6A 3NTUA 3VR6A 4PZLA 2IBMA 2LKDA 3DMNA 4MGKR 3R9WA 1E32A 2JLXA 1VECA 3GQBA 2F3RA 3PFIA 1LB1B 5KTYA 4LC1A 3WP0A 1CR0A 1P62B 4AK9A 1LY1A 2IF2A 4Z8XA 4RKEA 1SXJE 1N2CE 3WNCA 4CEJB 3REGA 4B33A 4C0AC 5KSOA 4V0OA 3PEUA 3RSOA 1VCIA 3BFVA 2QBYB 3AF4A 1W36C 4XWAA 2DHRA 4V03A 1A1VA 1F2TA 1S2MA 2L0XA 1EFCA 1G5RA 2CHVA 2QAGA 4DSTA 5DYIA 2GBLC 2BEJA 3MJHA 3RS0A 3K9GA 4MKFA 3TIFA 3BORA 1WP9A 1E1RD 4HDOB 4Q47A 4W7SA 5D3QA 3O8CA 5TARA 1CLUA 2PBRA 2P5TB 1BH2A 3EASA 1G5PA 3U2QA 5B58C 3KL4A 4PANA 3K9LA 1YR8A 2WMNB 3KZ1E 4B73A 3AUYA 1E96A 2C98A 4HB3A 3QENA 1N3BA 4P31A 3RYTC 1AGPA 1D2NA 1KI6A 1SVMA 2PCLA 2OAQ1 4OI2A 2C8VA 2EFGA 4LGMA 1YRAA 1II0A 3HU2A 4TL7A 2XTMA 4ZCIA 3U44B 2O8CB 1N0WA 1NN5A 2EWWA 4B2LA 1UBFA 4HZIA 1LF0A 5JEEA 2B8TA 1YZLA 1KI8A 2W6JD 4OK5A 4TTPA 4TL9A 1N6PA 2JDIA 4Q4LA 4IXNA 2RGAA 1ODFA 3ND8A 3TW8B 1SVLA 2QMHA 5ANRB 1G7TA 4AI6A 1R8SA 2R65A 2JLVA 1NY5A 1UF9A 4PO1A 1K8RA 1CULC 1NSFA 6Q21A 4EJSC 1NBMD 3R9IA 3KKPA 1N6HA 1A5TA 3PCRB 4QNMA 2RGNA 2FJUA 4IDOA 2V9PA 3U3OA 2ZETA 3CX7A 3EIHA 2J5XA 1OT3A 3WYAA 2W2XA 2VP6A 4ZCMA 3GLFB 3GFOA 4FI3C 2N46A 2YNMA 3FFBA 1PV4A 3AB3A 1N6OA 1XBTA 4I1VA 4QNRA 2FZLA 4II7A 1G19A 5A0FA 3RANA 3RRZA 4ASUD 5FUVA 4D4KA 5EXSA 3KKQA 3QY0A 3TUZC 5JWOA 3GJXC 2XNDA 2BIFA 4FXPA 4D4JA 4POAA 2O8FA 4Y0VA 1JQLB 3IEVA 4B6FA 4URWR 3K70B 4A36A 1HA3A 4JVLA 2ONKA 4M0LA 5JLJA 2PX3A 5GJCA 1BYIA 2WWWA 3IIKA 1M1YE 2C77A 5F2EA 1KJWA 2FPLA 4B6EA 1E3MA 3DVLA 2J0SA 2CVHA 2HDNB 3VNUA 1XD2B 4PC7A 4QFMA 2ZUCA 1QRAA 1E2NA 2ZUDA 4IFEA 1BS1A 4DEYA 1VCNA 2BBTA 4M1SA 2UKDA 2XZOA 4IDPA 3W6NA 2G0TA 4N0DA 1XU4A 1MO4A 3K1JA 3KKNA 4EKDA 5C18A 1M7GA 3THXB 3A1SA 2FZ4A 3WHLA 2QPOA 1KSJA 1ZAKA 2CCKA 1Q57A 4D26A 1NLZA 1ZNWA 2GCOB 3K70D 4TZ6A 3BH0A 2O8EA 4V0ME 3UATA 2ZI3A 5DI3A 5CYPA 4L5BA 2N1BA 1LW7A 3NVAA 2NQ2C 4OHZA 4HSEA 1ZIPA 4LWZA 1Z6TA 1G6OA 2QBYA 4EPVA 1HQYE 1DADA 1F2TB 2A2ZA 2GA8A 4C0BA 1NSTA 1E4VA 1E4YA 2WJVA 3C14C 4KXFB 4RFSB 4M1MA 2EYQA 1COWD 4JJKA 5JSZA 5HTKA 1GDDA 1EG7A 2QM8A 2ZROA 1W36B 2OCBA 1XWIA 5FOVA 3D3QA 1E9RA 1NIJA 2A3RA 5HCIA 3TKLA 1TTTA 1VKJA 1GITA 3LLUA 4D4LA 2P6RA 3FMIA 1PUJA 2CNWA 2W6ID 2QSZA 1VHLA 3BJIC 3SS8A 4AG5A 1U9IA 1M8PA 1LVGA 1T0HB 2RGGA 1Z47A 2J9RA 2XAUA 5FBVB 4CDGA 5JJKA 1QF9A 3K9HA 3NC0C 4MKGA 5KOYA 1A4RA 4JYCA 3RC8A 4UJ3A 1XXHE 4YLGA 4GP6A 2IUUA 2V7QD 3MD0A 3SEAA 3QVUA 3I62A 1RJ9B 2G1KA 4M8NE 1OXTA 3CH4B 5FOWA 5K8UA 3CWQA 2IA5A 4TYPA 1NG1A 3TVDA 3AKDA 3I5XA 3T34A 4FMBB 3BGWA 2X77A 4HB2A 3F3YA 4MYUA 3DOFA 3K09C 4MRNA 2DR3A 5H68A 1GNPA 3EIQA 4TMKA 4LY6A 1DAMA 1NLFA 3CH5A 1YR7A 4I99A 5TMPA 3KQHA 5A5GA 1Z06A 2D4HA 4Z54A 3EA0A 3KUDA 3KXLA 4ESHA 4NU0A 3BC1A 4DB4A 2O8DB 3TAHA 3MLEA 5IT5A 2OFOA 3ZQ6A 3SNHA 421PA 4X8MA 1IM2A 2R2AA 1VTKA 4IXMA 3B6EA 5FOTA 1P2TA 2CE7A 1ZC4A 4B47A 3KQNA 1KO8A 1CS4C 2GRJA 4QHYA 5AUQA 2OZEA 3QEJA 4PPFA 1QHXA 3GJ0A 1RIFA 1KOFA 3AF3A 2ASEA 4Q66C 2GDJA 4Q1DA 5JWHA 1DE0A 2RGCA 4DDWA 4C0LA 4FWIB 1H8HA 1E2HA 2OUKA 2QAGC 3RNLA 4LV5B 4WBSA 5AJWA 4QG7A 1BO6A 3U5ZB 5C4GB 2HT6A 4UQOA 3B78A 2VH5R 3V7DB 2YHSA 5DLQC 2BCJQ 3E70C 5FTMA 4YMUA 1R10A 1XTQA 4LSGA 2REOA 2UZIR 3A8TA 4LZZA 1ZCAA 2WWHA 1IN5A 3CX6A 2J0VA 1XEWX 4L9WA 4DBLC 3U44A 1OYWA 1GKYA 4NYIQ 5CJPA 3UMSA 5EXTA 1P61B 1Z08A 1OHHD 2DFTA 2P67A 2PL3A 2P6UA 2YJTD 3D7MA 4XIGS 2V1UA 3MMPA 2FFQA 2YOFA 2PMDA 1VG0B 4EPRA 1YZKA 1QHHB 4B3FX 3CF2A 3LLMA 2ZRJA 3LW7A 4O2RA 3MWKA 2WICA 2O5VA 2J45A 2IHBA 2JA1A 5IK2D 1MO5A 3GLGA 2RGDA 1U90A 1G6HA 3DM9B 2VEDA 3L8ZA 2ZE7A 4XTCS 4G5OA 4C30A 2RGNC 2YYZA 1VIYA 3VKHA 2O0KA 3CB4A 3LWNA 3VR5A 1IY2A 3EZ2A 4TYNA 4CGZA 2QTHA 2HF8A 5E3HA 4GT1A 4B76A 1R0WA 4XD7D 4IVPA 1GRQA 1GVNB 5KSYA 4LHZA 2JJ8A 1W2HA 4LRWA 3Q3JB 3D8BA 3GLFA 2FGKA 1EFTA 4OL0A 4TZ0A 1DAFA 1KKLA 5H70A 2NZ8A 2WHXA 2Z43A 4LJ6A 1GILA 1V43A 5CM9C 4B3GA 1KZ7B 2VRWA 2FSIA 2GXUA 3QF4B 1X8JA 1E9BA 1G7RA 3P27A 4F4JA 3B7GA 3BS4A 1OSNA 4N1AA 1N0VC 4CEHA 4E09A 3AKEA 5SZKB 4OI4A 1T8TA 2WAYA 1KKMA 4H1VA 1XJCA 2ZRFA 5JHGB 1NVVR 3EPLA 4JS0A 1NG9A 1CBUA 1GL7A 2ZRPA 4BRUA 1OB5A 1DPFA 5CLLA 1FZQA 2QT1A 2ZSBA 4PPQA 5D3MA 4DSOA 2DY1A 3QEOA 4L8GA 4C9BA 4EUNA 2Z83A 1H8HD 3ND9A 5FPYA 821PA 3LQRA 1ZP6A 4Q9HA 1KDRA 2XSZD 3TAUA 3AF0A 2Q3FA 3FMFA 4GZLA 1ZNYA 1TQ4A 2KJQA 3I73A 1P2SA 1XEXB 2O8EB 1IN4A 1M74A 1U8AA 1I4TD 1W46A 3I72A 1JBKA 4QBHA 4LJ7A 2FEMA 3FVQA 1RW4A 3H0KA 4JLAA 2IYRA 3CUEF 3QUSA 2F1JA 3CF6R 2JLQA 3PUVA 1U8ZA 3CM0A 2Z5FA 1D2EA 2V3CC 3HWSA 2EU8A 4CEJA 2NO7A 1D2MA 4JBWA 1KNXA 2OXRA 4DLRA 5L3QA 4KFTA 5KDLA 1F2UB 1QHGA 4JLJA 4LBWA 4BQSA 1NVWQ 2NMVA 1L8QA 1HT2E 1OJLA 4B3BA 4DKXA 1KJYA 2B8WA 4CYMA 5JBQA 3C6OB 1G17A 4L15A 1ZNZA 3HU1A 2IYYA 1JR3E 5J4VA 2DFLA 2WKPA 2BM1A 3T35A 5DISB 1W47A 1YZGA 3EW9A 3GLFE 1NJFA 2ODNA 3T5DA 3TJZA 2IS1A 2CK3A 3QIAA 2NO6A 2F6RA 1S1MA 5K8TA 2IL1A 4KFUA 1R5OA 3TSOA 2QI9C 4PXAA 3WYGA 2AKAB 1JEEA 2ZM5A 1N0UA 2UZ3A 2F43A 1TQ6A 2BBWA 4HLCA 4KCGA 2ZYTX 2HXYA 2AWOA 2ORVA 3D31A 1KI7A 1XTJA 1NN0A 4LCBA 1PLLA 5J4LA 1W4AA 2GAOA 2J59A 3NXSA 2GHIA 4BASA 2ZS7A 2EFHB 1HTWA 3MSXA 1JI0A 5HKKD 5G40A 2FN4A 1Z83A 4URYR 4OI1A 4C2TA 2VF7A 3GLHB 3RLFA 1LS6A 4B3CA 4F4CA 1ESMA 5CB8A 2JLYA 1BYUA 1E99A 4I81A 4ZPXA 2VP9A 3D6TB 2CMKA 2WWFA 2GESA 4C0HA 2ZRLA 1P75A 3M1IA 2RAPA 3QG1A 2XJ9A 2XSZA 4JJZA 3SN6A 3LRPA 4WOPA 4NTZA 4TLCA 1Z6GA 4KFRA 2QG6A 2XZLA 2FH5B 1H8ED 3X2SA 2V7QA 2VQSA 5EP1A 4PSVA 4E07A 1EFHA 1KHTA 2QRNA 2VP4A 1MRSA 5EZ6B 5L8VA 1I2DA 1K6MA 2V1XA 4FMDF 2ZE5A 1DAGA 2O8FB 3KJHA 4AYXA 3NG1A 2CL7X 1U99A 4KI0A 4L9SA 2HXSA 1E9DA 1LF5A 2P0EA 4Q4HA 4IEIA 2IYVA 3EWAA 3W9YA 1SKYE 4MRSA 2PLRA 4M21A 3V4FA 1F3OA 2O0JA 4QJ3A 3BIFA 1UBEA 1XXHB 1CJKC 2FMXA 2PZGA 3LVQE 1FUKA 3LV8A 2CLCX 3PUWA 3AM1A 4A0HA 4IRUB 2ZSAA 2VF8A 2ZRGA 1G20E 3SJAA 4ZDKA 5DGXA 3ECCA 3I1FA 2IHYA 4CEIA 3CRVA 1SHKA 1S9DA 3RWMB 1P72A 2ZJAA 4EQ6B 2QSYA 3R7WB 4UNQA 4OHWA 1TNDA 1XJ0A 4FCWA 5JCPA 2WJHA 4Q48A 2AN9A 1OV4A 2A5JA 2BKUA 2CDNA 5EP2A 4LJYA 1AN0A 1T5IA 4CIDA 1BMFA 2H5EA 3TSWA 1YR6A 1OYYA 2ZJOA 4QHSA 3W5JA 3U7GA 3LD9A 1IY0A 4Q7JB 1KSFX 3CLVA 1W5TA 2DB3A 5KDDA 2NPIA 1S0UA 2G88A 5G3ZA 1FX0B 1EX6A 2D06A 1TF7A 2WJYA 1YZTA 1ZCBA 5TVKA 3F8TA 5FUXA 1A2KC 4ARZB 4ON9A 3ZZ0A 2W2VA 4Q7LA 1XD8A 2ZJ8A 3L0SA 1S3GA 4FINA 3BXZA 4PAQA 3FFAA 2OM2A 1TUIA 4ZDWA 2QZ4A 2Z4SA 1GNRA 3OESA 2YINC 1QHNA 2F7SA 4U7DA 4MA4A 2ERXA 2IYTA 4G1UC 2V8OA 2VBCA 1E2PA 3R8CA 1Y63A 4MRRA 3IQWA 1IQPA 1S8FA 1ZMXA 4DVGA 4LHYA 3QJYA 3P4YA 4W5HA 5CM8B 2C99A 5H1YA 4US2R 3SZRA 3SJCA 5M04A 3GP8A 1U0JA 3VNVA 1KK2A 2ZAOA 3GJ4A 2ODBA 3QKSB 4LHVA 4YMTA 4OYHA 3ZZUA 1KMQA 5JS8A 2CHGA 4D80A 1RJ9A 5GVRA 5TY0A 1P3JA 1KI4A 2A5FA 5LD2B 2XB2A 4O2LA 3B1ZA 1E2KA 4DLXA 5G3YA 3CWZA 3UKDA 2XITA 1OXVA 4Q1FA 2OVPB 2GXQA 2OESA 5B57C 1RE0A 5AJXA 2OBNA 5CITA 3OF5A 2ZTSA 2YC2C 3CONA 3L2OB 4MKIA 2QROA 5IHPA 1JNYA 2XX3A 2FSHA 4FN5A 4Q4AA 1AS0A 3SJBA 1F48A 3W34A 2H92A 4DCNA 1B23P 3MWYW 3ZVMA 1JEDA 4IEEA 4MDEA 2E32A 4NYJR 1W4CA 3VX4A 4BECA 3M4YA 1T8UA 4ESVA 2KI5A 2MSDB 4H9GA 4M4SA 5BN5A 2IYZA 2FPMA 3UG7A 4MYTA 4NHOA 3LBNA 4UKDA 2A7QA 3W8NA 2D74A 2W0MA 3SJZA 4R2HA 5C46F 3WNDA 3OIYA 3WY9A 4UXIA 1GP2A 4B48A 4JKYA 4IDHA 1YR9A 1Q20A 3ADDA 3EC2A 2F3TA 5KNDA 4BLPA 3I32A 3QKTA 4TMTA 3RRYA 3GLIA 3VKWA 3GJ7A 3B2EA 1CTQA 3DKVA 3WXMA 2ZXUA 4LI0A 1P2VA 2F9MA 4LK2A 2IX3A 1CXZA 4TMZA 1KTVA 3WP1B 4WXPA 2BJWA 3SQWA 1E9CA 4MYHA 4PAOA 3FE2A 2JAQA 1NKSA 1NMYA 2MMGA 2Q9BA 5E7JA 3L43A 4H1UA 1ZU5A 4HUQA 3VX3A 2GJAA 1E79A 2XTZA 1NEXB 4S35A 3L82B 3N2EA 2F1HA 4A8JC 4OQXA 2ECKA 3NBYC 4JVSB 1SXJA 2MMCA 3TRFA 1C1YA 4C0SA 3BH7A 1M6NA 4Q4JA 3QPUA 5FL7A 4PR0A 4BZXA 2Q9AA 4EJSA 3JVUA 1UKZA 1XPRA 1NJGA 4XJXA 1X1RA 4A0RA 4JT2A 3HYRA 2OEPA 5LD2C 1FS1A 3KB2A 2H18A 1EWQA 1YZUA 1T3LA 3WRXC 3HP1A 1XMJA 5LDDC 1NI3A 5CDFE 4EDHA 3WSOA 1KMHB 2DWPA 1U81A 3GD7A 1AZSC 4PC6A 4GSYA 4Q18A 2OLJA 2VPPA 4LC0A 2QM7A 2HJGA 2OXCA 1MABB 1GRNA 3A1VA 4NKRA 1XJQA 2OSBA 2VIIA 1WXQA 3RWOA 3DHWC 4BFSA 2YZ2A 4F7WA 2O8DA 5IBKB 1GL6A 4YDHB 3CRRA 1HE1C 3U6KA 2ZVPX 2R6FA 4NYMR 4DLZA 2D7DA 3BAFA 1NLYA 4CVNA 3GJ5A 1UM8A 3NDPA 4CT5A 4PZYA 2IXEA 4HI0E 2FFBA 1CR1A 4HZUB 2GCPA 1MO6A 4M2LA 3GEIA 4E22A 3HR7A 1DBSA 4PQYA 5E4FA 5EUQB 1TU3A 1DVRA 1CJTC 2MSCB 4U5XA 1J8MF 2QTFA 4IVQA 1XZPA 3HU3A 2ZUBA 4IOJA 3PUXA 1DS6A 2ERYA 3QPWA 4AG6A 1N6NA 1XXHA 4HYYA 1ZM2A 2WWIA 3DOEA 5KHOC 2K5UA 4WZAE 2NO0A 2V54A 4ASUA 2FX3A 3M6AA 2OCPA 3T15A 4OBEA 2WSSD 3B1WA 4PAMA 2QTVB 2H8KA 3M0EA 1U2RA 4OK3A 5JS7A 3NHBA 3R7WA 4JMPA 4L16A 5JI2E 5AJYA 4V0NA 2GXAA 1E2LA 4P0TA 3ZJYA 1R6BX 2Z0MA 4Q1CA 2XTNA 2IYUA 1P9NA 1T3SA 4WVFA 3WNBA 3SFVA 2AR7A 3AVVA 3JZAA 4Z51A 2H16A 2FG5A 4DLSA 3VKGA 2B92A 2XNSA 2BM0A 5IDVA 4RD4A 1ZJ6A 2OV2A 4LX0A 4WZ6A 4U02A 4B34A 4URXR 4WW0A 4DSUA 1HE8B 1D9XA 1U9IC 3UMRA 4D0NA 5EUMA 5G53C 3BK7A 3UPUA 4ITRC 2YC4C 5AUNB 1JXMA 4W5WA 1NN1A 4I1OA 3U7EB 2D2FA 3IILA 1EXMA 3MGCA 2CHQA 4GDFA 2AD1A 2WPDA 4JLNA 4MDFA 1YKSA 4A82A 1RRFA 1FOEB 2PT7A 4ILEA 1RYHA 1SXJB 2E87A 2C03A 4UXHA 4JL8A 1E9FA 3LX8A 1GFIA 2HCBA 4AD8A 2GVZC 4AKIA 4MGYR 1CKEA 4D4MA 5BN4A 3OEHD 2GILA 3K0FA 2BMEA 2J41A 4WIAA 1US8B 4KODA 5FPSA 4HAWA 5J4KA 4TT3A 1FMJA 1IN7A 3HPQA 3RRMA 4KYUA 5IF9A 4CEHB 2A9KA 2PJZA 1E94E 5TV2A 1D6JA 4G0NA 1X8LA 4R9UC 3LW8A 1OH5A 4TYWA 2XEXA 1IBRA 4GOXA 4MGIR 3DKPA 1ZD8A 3KQKA 4A2QA 1N5LA 1OE0A 1NKTA 1W0KA 3TBKA 4ZIRA 3EX7C 1CEEA 1MABA 3A1TA 2WJIA 2G77B 5CIWA 1GRRA 4TMWA 4U00A 2QQEA 1OH6A 4BFYA 4O0MA 1BOFA 2WVJA 3AKCA 2J0UA 4ZCLA 4D82A 4NONA 3H4MA 5F9HA 2ZEJA 4A2PA 2IS2A 2X8AA 3OAAA 4DJTA 1SULA 1K5GA 4LJ5A 4V0LA 1IOZA 3G82C 4GFDA 4G5GA 2IEYA 4I4LA 4AURA 3K0AA 1MOZA 1KI2A 4QGFA 3W6PA 3NH6A 2VHUA 3EWSA 3SR0A 2ZSEA 3H86A 1Q1BA 3NWJA 3BE4A 4NCNA 5HE8A 2ZS8A 4IHQA 4XH9B 3PIRA 1KO1A 3AEZA 1E0SA 3KFVA 4PPGA 1S9HA 4NZYA 4F91B 5L3QB 2WJGA 2WPDD 4GOJA 3V9PA 3EIEA 1L7VC 4V0KA 1FNMA 2FGJA 3BRWD 3B1XA 3CF0A 4OI0A 5FPTA 3X1YA 2RCNA 1G8HA 3SYLA 2IUSA 2OAP1 4HUQB 1RRGA 4G3XA 4JLMA 1GL9B 3EA5A 1TEXA 1PZNA 1R0ZA 2J1LA 4IDQA 5EJEA 3QXJA 221PA 5C1BA 2EFEB 1KI6B 3KDSE 2QU8A 2YVUA 1W44A 1QHIA 3RS2A 2YWEA 3MUFA 4XSHA 1QVRA 4KVAA 1SXJC 1QG2A 4NCIA 4PC1A 4LJAA 4TYYA 3FMPB 1OW3B 2VP5A 4K46A
chains in the Genus database with same CATH superfamily
2JJ1A 2QZJA 4LV6A 3ROGA 1DAEA 1OZHA 3WGZA 4CKCA 1FU8A 4TL6A 5CX1B 1BJRE 3UO8B 3U7FB 3HDVA 3NYIA 4EJSB 4IEFB 4EY7A 3DL0A 1J1UA 2ZI9A 1JF8A 1ENPA 1B93A 1B26A 1FXUA 4X3OA 2RH5A 4PTZA 5ECWA 3O8OA 4NCBA 1E5DA 4RXTA 2A0UA 2FY8A 4TYMA 3IOEA 2QTLA 4ZOAA 3RHZA 4LQ4A 1KPHA 3ZH9B 4DIMA 5ITZB 1ZBDA 3D1VA 2B1EA 3BL8A 3NNDA 4R05A 5CJ2A 3ZHRA 5FAKA 5IUKC 2ZIFA 5FTKA 2IPLA 4EUKA 3GDHA 1AGXA 1PFYA 3N87A 4M9XA 4OY3A 3ZXYA 1ZBQA 1WRBA 1L9KA 1LXCA 1XTKA 4FNAA 3O9VA 3ND6A 3CSDA 4J0KA 3W78A 1EINA 4UW9A 2P9BA 1N1GA 2QQ5A 2RHGB 1GZSA 3CG4A 1VGVA 1X7HA 3FHOA 2BHRA 3BF8A 4RE6A 2E31A 1PWYE 5LA6F 1QOZA 3SYNA 4KVGA 3SLKA 4XM1A 4E88A 3WMRA 4IKEA 2JW5A 3EZ9A 3ROKA 3LVRE 3SIXA 1B00A 2FMIA 1ADYA 1XMOB 3P2JA 4IICA 4WUTA 1XMIA 2MDTA 1G8YA 1VC2A 3LZDA 3RS8A 3DEFA 3ZHCA 1R0LA 4JI0B 2Z4RA 3DAFA 3H9QA 5BNTA 3NBKA 1UBKS 1CEQA 2EX0A 2HIAA 1CJUC 3I52A 5EZ5A 2KLBA 3LDBA 1NONA 4PU0A 4AQYB 1JR3A 3VU1A 2KM1A 2HRCA 4DOMA 1YBAA 3L7IA 4GGMX 3L7YA 3T61A 2UVPB 4D5GA 5HQ3A 3MS2A 2PH1A 3JVVA 2ORED 4EJ2A 5HS4A 1LPSA 2XCSB 3KK0A 3UAXA 2GBGA 2B3TA 4GI7A 5I9SA 2I8AA 2OOKA 2P75A 2WNIA 3I4FA 4XIYA 3AESB 3GMDA 1F51E 2LWIA 3QKWA 4HMQA 3LP6A 5C34B 1GXSA 2VJNA 5P8WA 2FWJA 1H65A 4HDMB 4MUXA 1CRPA 1LPNA 3FKSD 1E9SA 1M8KA 3ZZMA 4JBYA 4JL5A 4KRFA 5EMNA 5I7WA 5IREA 1P7CA 1QPGA 4FYJA 4JSTA 3RS7A 2C0CA 4FOSA 1GLGA 4JJAA 2W6PA 3W5CA 4FP9A 4J1NA 3JQ8B 4XVHA 3PEWA 4OYYA 3A6PC 4J6EA 4ZA2A 1Z0IA 5JTTA 2IHNA 4DTOA 1NE2A 1TADA 3PL1A 5JLAA 3VR5D 2AJTA 3B9BA 3BA6A 3WL4A 3DOIA 3NAEA 3GG9A 3NKFA 1ZN7A 3PPIA 5DTEA 5FQOA 1MEEA 3SSNA 4C76A 4CEIB 1A98A 1FRZA 3K4QA 3COWA 2GNOA 3N2ZB 2ENWA 3GCZA 4JRQA 2YUTA 5JRZA 2PCJA 2ZANA 1XVIA 1JQKA 1QLJA 3AY6A 3OIVA 1RABA 4YRDA 1PLJA 4RY9A 1U5CA 4EPYA 2Z6QA 1U1GA 4LJRA 4Q9NA 1M7BA 2Q5EA 1I6KA 2R79A 4Z7QB 1J0AA 3K0EA 2DPLA 1MEJA 2ISQA 4MOWA 1FW6A 1MC5A 3HVKA 5CX4A 4XKJA 3QKRB 3CUWA 3VOTA 4JR1A 5EXXA 4BJHB 3G0BA 4QRHA 4MVJI 3UK6A 2FPIB 2OZVA 4G8BA 4B6JA 2V6GA 4D81A 2X9NA 1DAIA 3GRAA 3NBUA 3TMKA 1VB5A 4H6XA 2I3DA 4B6SA 2ORWA 5DGIA 4DRZA 2P1ZA 1FUEA 1O95C 4RZHA 4ZC8A 3LWDA 4K9NA 4PWZA 1FTNA 2PN1A 1H2YA 1UWVA 2G6BA 2R44A 4NJMB 4TL8A 4Y0AA 3BGOS 4AIIA 5C5EA 1NT2A 3VR1A 1PE0A 4NG4A 3ZU2A 1TX4B 4DR3B 2BLLA 3R0QA 4EUEA 4B4UA 1E89A 4B2PA 1K27A 2OP0A 3DP9A 3F98A 4CQJA 1PU2A 4E5DA 1CQWA 3M5DA 2VXBA 3I4CA 1DT5A 1E6CA 2JJ2D 1NM5A 2VAPA 3QBEA 1TFRA 3C6ZA 2OGTA 1RPZA 1V5GA 4ZARA 3ID6C 1W2GA 2EOAA 5F78A 4MQEB 5HIMA 1EFVB 2ATCA 4J2AA 4YJKA 1BCRA 4KR9A 4ZU1X 1PR6A 4EIWA 2IC5A 5TE9A 2CJXA 3SHFA 4OM8A 4LOIA 5IN5A 5DHAA 5CVUA 3AVWA 1YGYA 3FR8A 3D3KA 4HS9A 3ZU5A 4M46A 3G7UA 5AK4A 2JLSA 3ZJ4A 5LDHA 3V7YA 1X15A 4KAXA 2CV0A 1H2ZA 3ZJTA 5E7MA 3QF7A 5EERA 1QC5A 5JCJD 5JYCA 3PQ4A 4IWXA 4IPTA 4K81B 4U7HA 2PMKA 2C07A 1JDJA 3IODA 5JQGA 5IDYA 2AL7A 2FP4B 2WKQA 4LTNA 5AKZA 3U3MA 5L7WA 4JLPA 5DP1A 3KZOA 1KMHA 1OFUX 4EJ0A 1V96A 4EA7A 4P4LA 2A1UA 3GLSA 3OJEA 4C0JA 3L49A 1XPUA 3LPLA 1D7OA 2E1PA 4JUDX 2BMDA 3BIJA 3HCRA 3FOZA 1X0XA 4Q3EA 3LCVB 5JC1A 1FVOA 3BH6A 3N53A 1PJLA 5E2IA 5TDHA 2AD5A 3LKZA 4NQZA 2C20A 5DCLA 1PUIA 3DTYA 2MW2A 3QUCA 2F9LA 1KEZA 4WKPA 2EG9A 3NYQA 1SRQA 1WTAA 1YMUA 1Z2OX 2WAXA 2OZSA 1DAHA 1VIDA 3UMGA 1ZUIA 4BMNA 2JKZA 4FZJA 3O5AA 2C00A 1KVRA 2FEOA 5EFZA 3AIKA 4R7TA 3Q3VA 3OE5A 2ZTVA 4QYXA 4OQLA 2A67A 3KYIB 3E5RA 5HGJA 9LDBA 2OYQA 3IAAA 2W9XA 1NXOA 1Y1LA 4A1OA 4HCCA 3GLIB 1CLQA 1TQDA 5DHRA 4FDTA 2C5AA 1Y5LA 3N2GB 1FS4A 1GN9A 4HATA 1QUFA 4LY0A 4BNDA 5DM70 3BYZA 4X8OA 5T4EA 1AN9A 3BK1A 4OD0A 3Q10A 4NENB 3MCAA 4JLSA 1E2QA 1GD1O 5BSUA 4C4TA 4HAZA 2PMWB 3UFXB 2WIKA 1QPBA 2NTYC 5CB0A 3G0HA 1O94C 1E9EA 2HEGA 4TMYA 5IT0A 4I5IA 3VTKA 3Q8LA 4QDXA 5DTIA 1OXKB 2BHTA 2CYCA 2VSXA 4IOKA 3F74A 3JYOA 9ABPA 4MKZA 1U8UA 1SG0A 2AXEA 4MPPA 5KYNA 4WH0A 3DTVA 4JELA 4C0KA 5J2TA 2A5GA 4C04A 4Y30A 3U9TA 2DCMA 2EXXA 3R6LA 1DI0A 2WOJA 4FYXA 3UUEA 5HQTA 4IIVA 4PLPA 4O2BF 5D6OA 3G85A 4HDAA 4LHXA 1XIVA 5JSYA 1MX3A 1XMSA 4KP7A 4DBVO 2ZIUB 3BXFA 3NHZA 4F5YA 2PX0A 2RAVA 1G9XA 5BRJA 2B21A 4BKUA 1FYXA 3NGXA 4D4IA 3NBQA 4EHNA 5L3VA 4BLOA 1FSFA 1J23A 2VOEA 3K73O 3TGLA 1GU7A 1KI1A 1XZNA 3H3FA 5B1YA 1EFKA 1Z74A 2J48A 4RESA 1DXQA 3RIGA 1ZFNA 3ORRA 1VXRA 2A9RA 3DMDA 4R1QA 1WXFA 2VQ3A 5I8WA 5A06A 3TRJA 4PX2A 5L45A 4JVNA 1GKKA 1UMBB 2BGRA 3HL0A 2UYQA 1DQRA 1HI9A 3WB0A 4ND7A 2A3NA 1N2GA 3UJ6A 3BRWA 1MH1A 5CT8A 4CIAA 3MWEA 3RJZA 1PNTA 1L9XA 3HFSA 3GLKA 2BN4A 2H2DA 4M9QA 5IAKA 4CM4A 1DX4A 1CRLA 3TLKA 1OY1A 4UNNA 4HDRB 3MJCA 4G67A 3FJYA 4PN7A 4G5HA 1W52X 3CIOA 4GLFA 3WLRA 5KPJA 3DLHA 2X5KO 2ZYVX 2QGNA 3CKMA 3L5OA 4EWLA 1DRJA 1NNUA 2X4LA 4QDUA 4WZBA 1OTHA 3O4JA 2EBWA 3ONWA 4GPD1 1BHO1 1QBKC 2GH1A 1YZVA 4BCBA 5SICE 1G8GA 3C7KA 4KQFA 4W82A 1KO5A 3I2FA 5JO9A 5AM5A 3TLMA 3GFFA 3H65A 4DG8A 1NPYA 2HFKA 3H84A 4LYJA 4URZR 2YWCA 3B3GA 4F2PA 1G41A 4GQBA 1YZNA 3ZHTA 1JEOA 2OHJA 4FR0A 4FT4A 1GPMA 4Q4AB 4YIKA 1M1NB 3W1VA 5K6RA 4MI6A 4UHBA 3WISA 4ERXA 1R0KA 2IH4A 5AVSA 2ABWA 4YXWA 4FK2A 2XCIA 5BYJA 1CY4A 4CZ2A 1PS0A 2V5UA 3PQ7A 4IH1A 4R2LA 1Z5NA 3ZEIA 1JG3A 3TVTA 1DEKA 3RLIA 1AC5A 1QO0D 3P9SA 3ZZTA 2WZBA 5DOVA 1IN6A 1SCUB 1VJ5A 3BB3A 3G88A 1JA1A 4IIGA 5JCZA 1DWUA 2ODTX 3V2HA 3EXAA 5C8DA 3DEZA 3S9HA 1DIAA 1TYAE 1DXYA 2AK2A 2WJ4A 2IDKA 3CUKA 3OOHA 3HBAA 4NE2A 4ZOBA 4ZOLA 1GPH1 2J0UB 4ZKDA 3OY7A 5B1DA 4DCUA 1MRZA 2AOTB 4N5DA 3HDTA 1NQUA 1KNQA 4HLUA 1MJHA 1K08A 2HIMA 3DM5A 3W6UA 3GDGA 3ZBUA 1NTRA 4DGQA 2C5EA 2Y1CA 1E5LA 2RBGA 3M1LA 3UJAA 5EWLA 4TYQA 3L0IB 3S81A 1UZAA 1F2UA 5EY5B 4C5BA 2BFCB 4M3YA 4FUTA 5EJ8A 3ROEA 2I34A 5CDGA 4GG1A 3HB5X 5FA5A 2PXHA 5B1IA 5KJFA 2YWFA 3AHIA 5DULA 1QBGA 2XBLA 3A4MA 4FYHA 4KOAA 5GJWC 3TL6A 3ZY4A 1ORTA 3ZCUA 1AKWA 3RS3A 5JWRA 1Y4DE 2P9EA 4FEGA 4BBJA 1CQZA 4OH7A 1BE0A 4IGAA 4TMFA 4A8JA 1WF6A 1DG1G 2I2AA 4YI5A 4AWBA 3EGVA 4YRSA 1TM4E 2QYHA 2P69A 3DPIA 3EIOA 3F5QA 1QCCA 1SELA 1ZW6A 2A5DA 2Q8NA 3WKCA 3HM2A 3K8ZA 2X6QA 3O1JC 2X40A 1U4OA 1DNPA 4IIJB 5DBHX 2Q28A 2CLDX 5H0IA 4TWAA 1CZHA 3PP8A 2EDAA 2O07A 4LX8A 3AR3A 4KQKA 4L4UA 4CKBA 2QTNA 2QKYA 1BEEA 4M0FA 1KO7A 4WAUA 2HD0A 1V41E 4HAOA 1DELA 2YHIB 3N8DA 3ZS8A 4G5YA 5H8WA 4MWCA 1IYZA 2VSYA 1KMMA 3QXHA 1ULZA 5JZSA 3CH6A 2I4MA 3FJ1A 3P9CA 1P1HA 4DUGD 3L8FA 1E2MA 4RZ2A 3IEXA 5FUYA 1P5HA 1T5DX 3UC5A 4OJYA 3TQHA 1O89A 5C81A 4JU8A 2HA7A 3FBTA 4XVCA 3HZZA 5GIOE 1ZM9A 3A9WA 1ZR2A 5CDFA 2C82A 3KWJA 4X00A 4RJTA 2ZTHA 5BORA 2XPCA 1AF4A 2HK9A 2ZT7A 5U4XA 3KX2A 4YXWD 5F77A 1N1DA 1M6WA 3F6BX 4K05A 2PGNA 1OZGA 4K86A 3N0TA 4GKBA 1MO2A 2J6IA 2FNAA 4HVAA 5E9QA 5T8KC 3WHIA 5JJ5A 5KQMA 4GNKA 1SIOA 2SNIE 5C8ZA 4YC7A 5TQ0A 4F38A 3UTCA 2P79A 3GAMA 4LZPA 5FI0B 5BOSB 4RNDB 2V6IA 3FCEA 1DQNA 4FFOA 4Z9BA 3UWKA 4OAQA 2P9YA 2GRAA 1A69A 3M3HA 4MAFA 3BGVA 5LLSA 1ODIA 2FW8A 4BAUA 1WY5A 2ES4A 3FD8A 3QPDA 1VHDA 4Z4HA 1JHOA 1SZPA 4FHZA 1AUVA 1YL5A 1TZBA 5ULLA 5KYGA 1JR2A 2IEZA 4RCYA 4W1QA 4NU6A 1FPOA 2BMAA 4ARVA 1W48A 5IT4A 1CS0B 1K5DA 2FWIA 3Q7SA 5BVGB 2MR6A 4EYQA 5AVOA 4WCFA 4QPPA 4K9PA 4EF6A 1OXXK 5AOCA 5A4JA 4HNGA 1UADA 2ZSFA 3HN6A 4HX2A 2EGGA 2YXPX 3FSGD 3RTGA 2C9MA 3TW4A 2YRXA 5LMNB 4Q4HB 4A9AA 2VSFA 3Q6MA 5U9CA 1AZTA 4MLCA 3GUVA 4LGCA 2B9EA 4KDCA 3MMNA 1E1QD 1TCBA 1TU4A 1XOIA 2AMYA 2QMQA 4LJ8A 4OGLA 3VUEA 4ZK6A 5JS1A 2E55A 3NAMA 5JJLA 2EIHA 1S8AA 4ZANA 2JD2A 1E98A 5LYJB 1VP3A 1ZM7A 4QXQA 3IVCA 4DV7B 3UH1A 2C4WA 3M4NA 5LKAA 2CUZA 2B6HA 2XVAA 1SIUA 3M6LA 2JHCA 4GX0A 4C0QC 1HSZA 3K9QO 1A2QA 4JI3B 5KX5F 4ALMA 3EODA 2Q3BA 3F4BA 4D43A 2H4ZA 4NESA 4L5JA 1QH0A 2DQZA 5E38A 1KFBB 2JD1A 1G1AA 5LC1A 4D2IA 4MWOA 1Q1EA 3ISTA 1JHRA 2FEKA 3TRHA 4EX7A 2ZJBA 2NSYA 2QAJA 1V9CA 2HR1A 1A27A 3ZWVA 1KWKA 3ZVKA 4WBXC 1A9QA 2AF3C 4WGGA 3A1EA 2P6MA 1FYFA 2HH9A 2P2CA 3FCUB 1HY3A 1UKCA 1UBRS 2H63A 3IOCA 3T6KA 3DFZA 1VG8A 4EK9A 4B5LA 3Q6NA 3QE0A 5DT9A 3P96A 1R5NA 5CG1A 3OF3A 1SKYB 3G2JA 4NJEB 2D5CA 1I4WA 1PIWA 4WADA 1WXWA 4XLZA 4OXYA 3ZHUA 2YQ4A 5A2GA 2HLHA 1JJ7A 4PZZA 4RF5A 3NGLA 2Z57A 3UOAB 3I58A 2OCGA 3NC1C 3S8YA 3CZQA 1DGQA 1GGJA 3NETA 4YT5A 4JNKA 1WB4A 1QIHA 2WJ6A 3VNRA 1P1BA 3KAQA 3ST7A 2MYUA 2XVZA 3CF4A 1Y9EA 2R6JA 1CUAA 2O20A 2A78A 1IPHA 4AY5A 2EJUA 4I4TB 1N3IA 1Z2NX 4NV3A 1I3OA 1BXRB 1A71A 1JAIA 1E4OA 4Z7NB 5HXAA 1QRTA 5TC4A 1ZGGA 2A5YB 5KJCA 2O8CA 2H7VA 4FU0A 4GBMA 1P6XA 1OFIA 2E5FA 5TB5A 1GQQA 3L7BA 2HRRA 3OE7A 3A6GA 2BBOA 3OIGA 3OC0A 2ZJZA 3AIIA 4UNIA 1H8EA 3W77A 2DEUA 4RZXA 4E5SA 2N42A 3QKSA 3VR2A 1QDEA 2K4MA 4E2WA 2ZZMA 2PZAA 2Q1XA 4RABA 3ZYCA 3MJDA 4ABTA 1BX1A 4AX8A 1SBHA 1OPXA 3ABRB 4FGKA 3WL6A 5EIOA 1ESEA 1HE4A 2E4AA 3CX8A 4BFXA 4PXSA 4NWIA 5GINE 5LZ5A 4XVUA 4WHMA 3NBXX 3FNGA 2PGAA 2QE6A 1KU6A 2OBXA 3KYDA 4LMPA 4NATA 1KSGA 4BYGA 3WBKA 2P5OA 2EW1A 1WHTA 3FLBA 3OOSA 4IHJA 5SZJA 3TZBA 1G0OA 3C85A 5EMLA 3BHJA 2R5FA 5FCDA 2XUJA 3RSLA 5FPKA 1XT6A 2R96A 3AWDA 2QUJA 3I53A 3MRXA 3NM4A 3OPXA 3PKZA 1JXOA 4HAVA 4JVOA 1FZIE 4P4TA 5EOVA 1U3GA 1V3TA 1IHUA 4ND2A 2X0EA 3KALA 1FL9A 1XCLA 2QXTA 3O0TA 1ZONA 3MTBA 4MTCA 5IPFA 4QZVA 2H6EA 5FDFA 1ZN9A 3N58A 2DHQA 4LFAB 2QYTA 5JVDB 3K4PA 1HQKA 3AR4A 1S7CA 2Q7DA 4EABA 2I80A 4ENRA 2DH5A 3UJ3X 5CBKA 3LHSA 5FV4A 3AY3A 3JZDA 4HLUC 2ZU0C 4QWWA 3HJAA 3U7HB 4FEAA 1V4NA 5FTJA 2C2KA 3TQIA 4TS4A 5IM4A 3V4RA 1K66A 3FX2A 4OXNA 3ZVLA 4C4ZA 2EATA 3W8EA 1SIWA 3MM4A 1RC8A 1UFOA 5GMOA 3D6HA 3AF1A 2II6A 4AF7A 3E3MA 2ZREA 4GMHA 2OZLA 3UCEA 2VIXA 4AZWA 2A0FA 2DUWA 2ZW9A 3UMJA 3CW2A 4IDBA 5IH3A 1LK0A 1WG8A 3N3BC 5EE1A 5FUMA 4ZHQA 2GQ0A 1Q5PA 3K0HA 3DFMA 1U0HC 2OGSA 2RI1A 1WW2A 1SH7A 2QY9A 3QITA 1OIWA 4I1SA 3PNLA 2P2YA 3RYHB 1M67A 5JD3A 3D0OA 5EZQA 5FOSA 1MB2A 5HIAA 3U4HA 4MQ6A 1P1IA 1OXUA 5IJ9B 1Q7GA 3LHKA 3Q5GA 1MORA 4G41A 5HILA 1XMFE 1T9AA 3RYIB 5F7OA 1U2ZA 2WEKA 3OQIB 4GI5A 2EW2A 3RVNA 1P2FA 4M1YA 4LOKA 5CX1A 4HZGA 1IIRA 4MQLA 5EE0A 3WHKA 9ATCA 5KB3A 2Z56A 4ZZ2A 3TIVA 1PG2A 4R9NA 3F9CA 1XA3A 3VJRA 2HWWA 4H7PA 5CA0A 3QTTA 1TEHA 3H05A 5JZ9A 1EVQA 3IV9A 2WHEA 1XA0A 4GEKA 3LQ4A 3VNQA 1T2EA 5K0EA 2R6CA 2QEQA 2DPXA 2PZEA 1CUDA 5DGTA 5HJ2A 4A0FA 5JNSA 3HP7A 4FQ5A 2QLFA 4F9GA 3U4QB 4ZU6X 4FIZA 1XRSB 1SU6A 2FE4A 4ZCRA 3AYXB 4GOOD 1V16A 3JVEA 3WWYA 4FBMA 4ZO6A 5HDBB 3SQXA 3NFYA 1REQA 1HEUA 1VI2A 2XNKA 1YFKA 3EZ6A 3LBIA 1I80A 1SHZA 1DTSA 1FZ7E 1YR1A 3OCUA 4PSAA 1YS9A 2OV6A 2WHPA 1QE0A 3ZWQA 5AVZA 3EVNA 5CBPA 3CEMA 4RG8A 2I2DA 3IBYA 3H2YA 1NIPA 1KETA 3CEHA 3NX4A 3T38A 3THYB 5CR9A 3L6UA 2WR8A 4JK3A 4ILKA 4NFSA 3L8EA 1C3XA 1CPYA 4PYNA 5C2JB 4Z6KA 5IEBA 4L07A 3CUVA 2BH2A 4N3GA 5ECDA 1DZIA 3KJFA 3HTXA 1P29A 4CU5A 2GLTA 5JG7A 3KTAA 4E5NA 2P2DA 3LQYA 4YAOA 1WO8A 5JD4A 1LTHR 3L4JA 3VXKA 4JC4A 1FFXA 1ZCZA 3QVGB 4IUYA 4YLEA 4KHYA 1ZD2P 3GRVA 4MW9A 1XQYA 1J06A 2GLXA 2HQRA 2JIBA 1BCSA 3AEUA 3PR1A 2WUDA 2FPRA 1M7HA 2C2BA 3VAYA 4F96A 1YNOA 3U9SA 1H3EA 1H1DA 3CZ5A 2A0XA 4IS2A 3BBPA 5FWAA 3TRKA 4DSNA 1VGRA 3V4VB 1M5TA 3X1KA 1X7GA 3EG9A 5FULA 3CNHA 3I61A 1WF3A 1Q12A 1Z25A 2BFMA 2Y1DA 2Z4TA 3SI7A 1ZH2A 2WIJA 1Y33E 3Q85A 1ES9A 4JA2A 3M5CA 3GMTA 3SQ2A 1QV9A 1T9HA 1Z5PA 5AKIA 3HKBB 3LA6A 2J9GA 9LDTA 3KHTA 1KY2A 5YASA 4B74A 3RUIA 2RGBA 3MJEA 4HG2A 1CJSA 4OYLA 5DNVA 1BDIA 5EN4A 1EXDA 2FWMX 1OA1A 1Q1NA 4WA8A 3T1NA 3LO5A 2C5HA 4HO1X 4OHFA 1FTSA 1N8NA 1UL1X 2J3MA 2ZRIA 1ZJZA 3A1UA 3I28A 1W4ZA 1XEXA 3DOHA 1MV5A 2BEWB 2QLTA 4M0KA 2XY4A 2G1UA 4JLVA 3WMXA 3ZNNA 3QV2A 4EY3A 3TE6A 5I7UA 4L95C 1UEJA 3HO8A 1YI8A 1AVTA 2XDAA 4MWGA 3KHKA 5ESDA 3UJCA 3NRJA 4S04A 3VKFA 3LGSA 4CPDA 1NL3A 3QX7A 3VYRB 1T9CA 2C5FA 3JWIA 1W0KD 5EQFA 1DC4A 3T5GA 3TSZA 1CP3A 3EC7A 4ZYUA 4EJMA 1UKBA 2IYWA 2FMKA 3MJFA 1GPKA 3HGTA 4LF4B 3W4JA 2R1TA 3IBGA 1NX6A 1GOTA 3QTBA 2VF2A 1X2BA 3SF8A 5M34A 1TYEB 4KQHA 3PNKA 3ES9A 2PSFA 3QKRA 1P1CA 5ELMA 3SBDA 3WDMA 2ZBPA 3PZBA 4PZDA 2I3AA 3R74A 4D6XA 4EW2A 1EHCA 1HOTA 2FW3A 1YDFA 4RFLA 1F12A 1SCNE 5EHGA 4CV0A 3CS3A 2NSLA 3RU7A 3R44A 2G8LA 3F5DA 3UGJA 4RLFA 2QQFA 3ANMA 4OP3A 5IS2A 2IU6A 1J39A 5JFGA 2C97A 3KOOA 4QX6A 2JLZA 1R3DA 5IAOA 1TIPA 3HDHA 4H1HA 4TUYF 1WMDA 1XHLA 3L8YA 3NHPA 3OZVA 4AF6A 5T7BA 2WI8A 2B8EA 3ZV4A 1KJZA 4UPEA 4DJJA 3ONDA 1JQDA 3AP3A 2RJ3A 1UBCA 1K98A 3GF4A 2BMFA 4JLDA 3AIMA 4GLJA 4GMDA 4K87A 3ZDQA 4CCYA 5KINB 4N41A 1UXGA 2OHFA 4JQOA 4L0MA 3E2IA 1T2FA 3GEHA 5SYAA 3IKVA 2VH1A 2SKDA 1E69A 2ZRQA 4XWWA 2Z6VA 3FGNA 2ZSDA 1CUEA 1VL8A 1J7KA 1EFDN 2R8ZA 4HDRA 4R98A 1MG5A 2BFPA 4RMGA 5AKEA 1AKEA 2WF7A 5E95A 3K0SA 2PIAA 5EG5A 4MR9A 1BVUA 3D7SA 2ECOA 5L3SB 3ZGNA 1Z6ZA 2EG5A 1QHHA 2VJAA 4N40A 3ONFA 4N9QA 5IBRA 3ZQ4A 5AUPB 5CDHA 1Z7WA 2VOJA 4PQEA 1SGWA 3CISA 1OWOA 4S0ZA 3D6AA 3EA4A 1EH5A 5ALNA 1P9RA 5IWAB 3MA0A 3RBXA 3ISVA 4ZVTA 4MCIA 3UOWA 1RACA 4FW8A 1GFSA 2OAEA 4BLSA 2HT1A 3FYDA 3ZZ1A 1M1YA 4H31A 2X7XA 1Q0QA 3VHXB 1R27A 2R85A 3LVBA 3NR2A 1MRNA 2GFIA 3OH8A 3W2GA 5PGMA 3E7WA 1NLUA 4QC2A 4B6QA 1VMAA 3BSYA 4MVYA 4BMSA 2B99A 1Z29A 3NE6A 2YIVX 3PUZA 5CT6A 2DRIA 2BDTA 1W93A 1JDSA 1YU9A 2VPQA 4TRJA 5TMBA 2BC9A 2I0FA 4HPXB 1WU8A 5B1EA 2AG8A 4AJEA 4GKKB 2QRJA 3RSSA 1QE3A 4NABA 1SAYA 5JAOA 4O4IA 2RH8A 1U6KA 3C6QA 2JLWA 4V38A 1MFZA 2YW9A 2H4XA 1ILWA 3BJRA 1B0PA 3W3AA 1LBTA 3IDAA 1H6AA 1Y6RA 5K8LA 2I8CA 4CIVA 1K1EA 2XCUA 3ZDYB 4WY5A 5FOQA 4R6XA 2JAUA 4O1MA 5JARA 1Z63A 3HDJA 4TMVA 2E89A 2XAAA 4Q05A 1WXEA 1DWPA 4JLBA 4Q7MB 1QWSA 3PNOA 2C78A 2FSVA 4M9UA 3OQPA 1YHYA 4IDAA 1ZWKA 2C7VA 3AC0A 2IZ1A 1V1JA 4NQRA 2VLBA 5ALKA 1S2OA 1XX6A 4FONA 1NXXA 2Y66A 1BJKA 5AQEA 1MX9A 5DE3A 3S40A 3VPFA 4F0JA 1UZLA 5B3JA 1UKEA 3NOOA 5AHXA 3CBQA 3KR9A 4GOLD 3DMYA 1T2CA 3DAGA 5EC8A 3HNRA 3U39A 5JRJA 3W5AA 4LBVA 1TJ3A 3AUXA 2Q6TA 1L4BA 3PTAA 3ZHXA 3AU9A 4S1NA 2EQAA 4INJA 4ZVRA 2GETA 1LFAA 4LSZA 1NF2A 3S1AB 3BMNB 1LWOA 4BLRA 1OASA 4M98A 1EGAA 4NV0A 2P4UA 4ZEOA 5ESWA 3V48A 3OPNA 4PSCA 5DT2A 2B5WA 3TBFA 2AG1A 3EXIB 1XMXA 3A10A 6REQB 2DG2A 1KQNA 4OQYA 5IW8A 3HKEB 3CNNA 3HQ4O 3JARB 1YA4A 3MTAA 4UPVA 2VJQA 1MNAA 1SJ9A 4BMZA 1TK2A 3FUUA 1G18A 1FP1D 3C6KA 3FG9A 1RAIA 2O1EA 3W8DA 3WVNA 4BFTA 5EKSA 1CD5A 4NPCA 2HPAA 4UATA 4G23A 5KVQA 2CJYA 1E1QA 3QTLA 2I33A 5CK4A 2Z09A 1Z39A 4OQFA 1C0KA 4BJ6A 3EW7A 3S1SA 1I4OA 4PNZA 3VHLB 1X1TA 4Q9LA 1JEQA 3SM3A 2DLCX 1ZN2A 4OQDA 4QEKA 4CUJA 4HDCA 4KWHA 2I2FA 1N7JA 4N0MA 3ZWWA 4EH1A 1IXRC 3KDPA 3DNPA 3E3LA 3VRHA 4BZPA 1QE5A 3C48A 1CQXA 3QXXA 4UE6A 2FW6A 1EEXB 4GE3A 1T2VA 3KNZA 4JU9A 1RXUA 3EQ2A 3MERA 4M0EA 1TVMA 3GGJA 4YR7A 3SUOA 5K5EA 1MO3A 2Q5QA 3I2JA 4D7AA 2QTRA 3EC1A 3UXMA 2CK3D 2ZUWA 5J2TF 1RKVA 2JC3A 1ZY2A 5EYPA 2KX7A 3G8BA 1VGQA 3TFQA 3M9LA 1RAGA 1K4KA 3SS9X 1WAFA 4WN9B 3V7NA 5EKXA 3UWOA 1U0FA 1N2JA 3V2GA 3QUQA 1QDLB 1SQ5A 2HBQA 4PX9A 3CNQS 3G68A 1TA4A 3HZRA 1YZYA 4M1OA 3TG2A 1F5SA 4HBGA 4UFOA 4URUR 3RC1A 3TPFA 3TQTA 1ODTC 1KMNA 2BFAA 2C5BA 4JHXA 4JP1A 5BRAA 2YNMD 2Q4TA 1EI9A 4OKSA 4W9MC 3G5LA 1QP8A 1WMAA 2VUUA 4JITA 2G82A 2QYSA 3R6WA 5EQTA 1UDWA 2WJJA 3DOOA 4JFAA 5BWBA 3GDFA 3JZIA 4WXYB 4XOIA 2CMFA 2IYNA 2VDRB 2NUAB 2I7XA 1I3NA 2QN3A 4Z0PA 2FI1A 4LS3A 4OBXA 3GPLA 2FE1A 2Y76A 3NALA 2QLLA 2G83A 3QU9A 1NUQA 2XDQA 4K9SA 2BGLA 4AQDA 3B5EA 2AV6A 1FF9A 2G76A 2V6MA 4E15A 2HF9A 4MLDA 1E2GA 2YN0A 4ND1A 1R0YA 3K6KA 4DQLA 3ETLA 3EVCA 4NXMB 3MT8A 4J1QA 1FLVA 1USWA 5H7XA 3GFBA 4F8YA 1L2TA 3ZE6A 4FD2A 3R6TA 1XXLA 2PZFA 4HDKA 1DTWB 1II9A 2D1FA 2PYDA 4RZSA 4U0JA 1J8YF 2QR2A 3OBBA 3WLIA 3BQNB 4GHWA 5TF4A 4EHLA 3RFXA 2QZ9A 1DFGA 1RIIA 2W6ZA 4NR0A 4WE3A 3Q8MA 1SEPA 3KEOA 3EIUA 1WSDA 4P7KA 4V0QA 4D98A 5BR4A 1EGVB 1WL8A 1PTJC 2PUGA 3HDGA 4CV3A 3KB1A 1G6Q1 4P33A 2QA5A 3ZWKA 4RY8A 4UOZA 4WERA 2JFVA 3ZXXA 3RC2A 2VJDA 1KR5A 3OOJA 1Z73A 2GEVA 1EWRA 1YIAA 5DBEX 2HYDA 4Y6SA 1V9LA 4HNVA 3EGWA 3WLOA 2ZBUA 2IIPA 3MWJA 4MQUA 2I91A 4Q19A 3G17A 1IDOA 2P2GA 4S2UA 5J5AA 4RTLA 1VE5A 1Y48E 2R1ZA 2C7OA 1ZLXA 2H54A 1QHYA 1PDOA 2EP7A 3AEQB 1SHLA 3RI3A 3UBTA 2FQWA 2WTNA 3HYCA 1PT9A 2Q2WA 5DI3B 4YAIA 1G3MA 4D8XA 1KK3A 2JK1A 4AN4A 4Z5XA 4BLTA 4HB0A 2G0NA 2XTAA 4P84A 2NZJA 1EDDA 4X24A 1DAOA 3VAAA 3EPJA 1H05A 5ALEA 3VR4D 4A0SA 1IM5A 4IQ4A 2NO9A 4B9EA 1U2DA 2JFZA 3QWHA 2FR8C 3TZLA 3SOZA 4US1R 4PGAA 2DKNA 1WV0A 2CJWB 4R1MA 3MOIA 1YDMA 2AJCA 2ZAMA 1JLHA 2FRDA 3LDFA 3VA7A 5DLYA 2PS3A 3WL5A 1RI1A 5ES4B 4CLHA 2BI8A 4NCKA 2JFYA 3OZUA 1RHMA 521PA 2O1XA 8MHTA 4X61A 1HDGO 5GVSA 3MCZA 4YJ3B 2OTCA 2DF8A 1ZYUA 1IK4A 2CXXA 2YJ3A 3LAWA 3T1VA 1YC5A 1XDGA 3IHLA 2Y4OA 3JWEA 1KP3A 3Q6IA 4GD3Q 5M5BA 2DHDA 3DFIA 4KO4S 2GSWA 3T12A 1NY6A 2AR9A 1R4AA 2FPXA 2JDID 3AR2A 1F1JA 1U7ZA 3EUEA 3PITA 4MB0A 4HDSA 4GL4A 4PNPA 4JR0A 2B4YA 4QUAA 5AHRA 3KDAA 3L46A 1Q1QA 2QPTA 2J7PD 4XQGA 3WIBA 3D64A 2VP2A 1CUVA 1PNRA 3ACCA 3PR3A 4TLEA 4BQQA 5KYTA 4D0RA 3WWEA 3L7LA 1G7CA 3LD8A 2GAJA 2QTWB 3AKYA 3DKKA 2QRHA 1F8UA 3L1UA 2ZIVB 4HQFA 4LRYA 4LYDA 4UHDA 3PL5A 4V1CB 2YCLA 2FOLA 2VPXA 1A9YA 4GPIB 3FGOA 3ZY5A 5K6AA 3D6VA 4MV4A 1K06A 3GJ6A 1NF9A 3E22B 1RWBA 4AJ1A 4CFSA 1E2FA 2IW3A 3DE5X 2WTXA 1KJ9A 4HTFA 3RT7A 1MXHA 1A88A 1UZNA 2AXQA 2AXNA 2QTCA 4XIJA 5BSEA 5ALPA 3V8PA 3LKDA 1CZKA 4QREA 1VHJA 4H7HA 1ACLA 4Q01A 4OJKA 4JC0A 3SHQA 1ETUA 1QU2A 4BN5A 2KQUA 2OBLA 2XUAA 3CNLA 5B3JC 3FETA 3GZNA 4C29A 1ZDMA 5LXTB 3QUAA 5TQJA 3NTUA 4PZLA 2LKDA 1PSZA 2HNKA 1E32A 3OPMA 5KTYA 2JVIA 4I8DA 1B6GA 1CR0A 1P62B 4AP9A 4PZ0A 1QKKA 4ZQFA 1QV6A 4E2XA 4HPJB 5EESA 3FCOA 2XUIA 4Z8XA 3QLVA 4PG7A 3UB4A 3PEEA 1T8PA 4BQPA 3GL9A 4H1WA 2JPDA 3O4IA 1QRDA 1VCIA 5BNFA 1W36C 1XRLA 2H4JA 5HX7A 3EVTA 3M6VA 1A1VA 4Z0NA 3PB3A 4W63A 2ID8A 1RC1A 5MFZA 4EBBA 2SKEA 3QWBA 4DSTA 2CXUA 4OLBA 5K3EA 2BEJA 1WLSA 2HMVA 2QMYA 3MJHA 2DP4E 4OOEA 1O9BA 1SHTX 1W1UA 1Y0BA 4NG5A 3WOVA 4B4VA 5D3QA 4R51A 3IE1A 3ZGYA 4ZZ0A 4OSPA 3MHTA 2P35A 4AJ9A 3Q9UA 2ASVA 3EIFA 3U2QA 3PF8A 2G80A 6PFKA 5A9SB 2WMNB 2WHPB 2X5JO 4KLCA 2C98A 3UWDA 3M6FA 2FMTA 1D1SA 4FDVA 1N3BA 2PCLA 3N7AA 4LKOA 1OLUA 1YRAA 4YP1A 4F11A 4G4SO 3I6ZA 5EIEA 3GARA 1DWOA 4X44A 3ZHYA 4PG6A 2WE8A 1UBFA 3INTA 1LF0A 4ESOA 3RSFA 1JNXX 5E1DA 4GM1A 3SXJA 1C0LA 4OK5A 5A6SB 2HCTA 1N6PA 4LJKA 2Y05A