3L2OB

Structure-based mechanism of dimerization-dependent ubiquitination by the scffbx4 ubiquitin ligase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
308
structure length
274
Chain Sequence
AASTLTRLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVFFDYMAVYRMCCPYLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTTRRYSVIPQIQKVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-phase kinase-associated protein 1
publication title Structural basis of dimerization-dependent ubiquitination by the SCF(Fbx4) ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/cell cycle
total genus 69
structure length 274
sequence length 308
ec nomenclature
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00646 F-box F-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3l2oB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l2oB02
3BB1A 3CH5A 2IYWA 4B74A 1SVIA 2FSFA 1G1MA 1T5IA 3ICQB 2FFBA 4QKQA 2OO7A 2HF9A 1KI2A 1G41A 2VO1A 4ABYA 2G0TA 3CPHA 1XEWY 4KFTA 5FTMA 2ZR7A 1RIFA 2PZGA 2DWQA 1CJTC 4LHVA 1E2GA 2CJWA 2EWWA 2O52A 3PUYA 1FTSA 3DM5A 4IVPA 3RS5A 3I5YA 4MRSA 1J8YF 3KTAA 4TYPA 4GOJA 4XSGA 1TADA 4RZ3A 1T8TA 1UADA 3NEYA 2WM9B 3RLFA 3CNOA 1I4DD 2XITA 3AH8A 1AS2A 3VR5A 1E9SA 4D4JA 1HE1C 3QY0A 5H1YA 3CR7A 2PJRA 1OLOA 5G3YA 5EE9A 2ONJA 4IW3B 4DLTA 2A5DA 4X8MA 2P5SA 3EC2A 3D8BA 2IC5A 4ZV4A 2VRWA 3DKVA 8OHMA 3PUVA 3TKLA 2P1PB 4MYUA 3OGMB 3VR2A 2BMDA 1N25A 1U8ZA 4Q7MB 1Q1BA 2WOOA 3MG9A 2JGNA 3TUIC 4NYIR 1D6JA 3U6BA 2GCPA 1NNEA 3I4LA 4PSVA 4PHHA 1F2UA 1Q1EA 4Q4JA 1GKIA 1G7TA 3IIKA 3OF5A 2CLDX 4KYUA 5P21A 2IYSA 2PCJA 3K70D 5DISB 5ANRB 1DVRA 2HF8A 2NOAA 1FNNA 4Z8YA 4BLQA 2ZSBA 4PPQA 4EFMA 1P61B 3ND9A 2JLSA 5FBRB 2IUTA 4V0LA 3UMRA 1M8PA 3PEVA 2W0SA 1WA5A 4RD1A 2BJWA 4IEIA 1P6XA 1NL3A 2GJKA 2LKDA 3GJ8A 2FZLA 4GBMA 2FFAA 1XU4A 4LBVA 1G64A 4YQFA 3X1DA 1EK0A 4P0TA 5IHPA 1NJGA 1GVNB 2RCNA 4JL6A 3QNUA 2Q21A 1E4YA 3RS3A 3CRQA 1TAGA 4TSFD 3SBEA 3IUYA 5HKKA 1U2RA 2QM8A 3EPLA 4MKGA 4URYR 2BM1A 2GAAA 1Q21A 2VEDA 2ZJ5A 1DO2A 3U7EB 4OBEA 4Z1MA 5KPJA 1ELOA 1M7BA 3W90A 3TVTA 1E9DA 1P7CA 2QMUA 4P32A 2IX3A 1S4QA 4KCGA 1XBTA 5EP4A 1KI4A 1N5IA 2ZJZA 1VG1A 5AJVB 3NKVA 1LF0A 1O87A 4U7DA 1DAMA 4TMZA 4BFWA 5JHGB 2XB2A 2CE2X 3O8DA 2CL7X 1ZINA 2YZ2A 1CR4A 4KBGA 4BEBA 3TGPA 3ICEA 4JZKA 1B0UA 1IQPA 1HY3A 1YZGA 4OQNA 2CK3D 4MRRA 2ZU6A 1S1CA 3H2YA 4DEYA 1KY2A 3SJCA 1A2KC 1P9RA 2ORIA 3B9PA 4JBWA 1BMFA 1FW6A 1S8FA 1T3SA 4IOLA 4IVQA 4URVR 2GVDC 2QM7A 2PT7A 2C04A 2WPDA 4OQLA 3P26A 3AKCA 3LNCA 1XTKA 2RGDA 1KZ7B 3BH0A 2WMNB 4DCUA 4NYMQ 4I6JB 1G8YA 3VR6A 1MO4A 4M21A 4YMWA 4N0EA 1ZM3A 1QHIA 4A6PA 2ZUDA 1S3SA 1OH8A 2GF0A 4QNRA 3C5CA 1E3MA 5IBKB 2NO7A 1IJEA 1PZNA 2QTFA 3K1JA 4E09A 3B1ZA 1A7JA 1Q1QA 2HT6A 3CPEA 3VU9A 5C4MA 3THXA 4YMTA 4AK9A 2FEMA 1NY5A 2XNSA 3R8FA 2REBA 1Y63A 4PSAA 5TY0A 4CEJA 2J9RA 1KSJA 5CK4A 1VCOA 2IEZA 4UNRA 1OIWA 2F3TA 3B85A 2JLXA 1VCMA 4BFYA 2PX0A 4LJ5A 1XWIA 2IK8A 2OXRA 3KKQA 1QVRA 2ZJ2A 1NG1A 3K09A 2JASA 3B78A 4B44A 3I92A 2QT1A 3P4XA 2FEOA 3HDTA 4IOJA 3CB4A 3UXMA 3W6PA 3B2EA 3C4JA 1XD8A 2Q9CA 5A4JA 3VR3A 4KFUA 1KMHA 3NH6A 2ZRNA 5JWHA 1K5DA 2GCOA 1G16A 4AC9A 2J0UB 1XMJA 2PCLA 1MRSA 3GEIA 2ZAMA 3F8TA 2I1VB 1VCIA 1EFRD 1TQ2A 1W0JD 2BM0A 5SZJA 3VFDA 3WMEA 5IK2D 4JLKA 4JVLA 4DLYA 2LKCA 2QP3A 4OJKA 3ND8A 3TR0A 4DHEA 2OBLA 4TZ6A 4AI6A 3GLGB 3GP8A 2QG6A 3H86A 1BYIA 2PLFA 4PZZA 4QFMA 3AM1A 2ORWA 1DTSA 4A82A 2VF7A 2QSZA 3B82A 4L9SA 4TQ9A 4V0NA 4KVGA 4TTPA 2R2AA 2EYQA 1E1QD 4BFVA 1G291 1E2LA 1NY6A 5DO9A 4MRNA 1OHHA 3R7WB 1QHNA 3SYKA 1DE0A 4RZUA 1E6CA 1AZSC 1SVMA 5J4LA 4NU0A 3OAAA 5DSZA 1PJRA 1E9RA 2A5YB 2EQBA 2ZYVX 2NPFA 4DLUA 3RS7A 3OFNA 4Q1AA 3GJ0A 4X8OA 3MWJA 3MFYA 2YWEA 4Q4LA 3DMDA 4RCZA 1HQYE 5AJZA 4UNSA 1E9FA 1XJCA 1C9KA 1R0YA 3W6OA 2OXCA 2ANBA 4C0KA 2VHUA 4QHYA 4K46A 3R9IA 1Z6GA 3TLXA 4ZDJA 1OXVA 2G3YA 2ZU0C 5E7MA 5B58C 3O47A 5CYPA 1CJMA 3TQFA 4FD2A 5KSPA 3OZXA 2JDIA 1FFHA 4LYAA 1KI3A 1QHYA 3R8CA 3QJYA 3HU3A 1GL6A 2AKYA 4JL5A 2OLKA 2QT0A 1WDTA 4M9XA 3EAQA 1CR1A 3REFA 1OH5A 3D6TB 3EZ2A 3KL4A 4A2QA 3AF4A 3BFKA 4XWKA 3M6AA 2YV5A 2ZRGA 2O5VA 2F1JA 2WWHA 5C4GB 1XJQA 1ZM2A 2WSSA 4S35A 2XZOA 5DLQC 1Z08A 4ZIRA 2I3BA 3LLMA 2QGZA 3IDQA 3NWJA 5G40A 3JVUA 4B35A 2VH5R 2GAOA 4EUNA 4LWZA 1XEXB 4OHYA 2A5JA 4PHTA 2GA8A 5CM9C 4M1OA 4D2IA 1F48A 3LQRA 3GFPA 3PUWA 4Q02A 2WICA 1CJKC 1KK1A 3SBDA 1UAAA 5JSZB 3BS4A 1XTJA 5FL7A 2QTVB 1X8JA 2R8RA 3RS0A 1DAHA 2NPIA 1UBFA 3SYNA 1OFTA 2GBLA 3RRNA 4FMCB 4IXNA 3A6PC 2J3EA 5EZ6B 3I72A 4Q01A 1LB1B 1PLKA 4LHWA 2YWHA 1G3UA 1Z47A 1KI8A 2WKRA 2C96A 3EIQA 2C95A 5J4HA 1QG2A 5KO2A 2DFLA 3C5HA 2WWYA 1VTKA 4BGDA 3GLGE 4B48A 5GJWC 4HAXA 5CJ2A 4DSNA 1NN0A 1DEKA 4AKEA 1JEEA 1OIVA 3K70C 3QKSB 2IF2A 1IXSB 5JMTA 2B8WA 2D7DA 1B23P 2J41A 2VP0A 4LJ4A 3GD7A 3E2IA 4WW0A 3AGQA 4XD7A 1W4CA 2ZJYA 4BECA 2JLWA 2X2EA 1Q57A 3SFVA 1NVUQ 1ODFA 1QBKC 2A3RA 3D3QA 5ELXA 2OESA 4B2LA 1NJFA 1PLLA 3CNLA 5KOYA 4MKIA 3QE0A 1FL9A 2VP2A 2GETA 4TLBA 3PUXA 1WRBA 5GVRA 2REOA 3T12A 5SZHB 1RRPA 1GZSA 1CJUC 2MSEB 3C6NB 2O0KA 1QF9A 2QRZA 4JLDA 4JKIA 5FH9A 1ZP6A 1ZNWA 1KTVA 3IGFA 4YLGA 3PVSA 4AIIA 2OFOA 2IHBA 4L16A 4M4SA 3TNFA 1XPOA 2D7CA 2MSDB 2QL6A 2C98A 2JLUA 2XXAB 3QSYA 3W8NA 4DB4A 2F1HA 4U02A 2IXFA 4GZMA 4MUAA 4A0HA 3F0TA 2DY1A 4X8LA 3SQXA 3GPLA 3VNVA 4QBFA 4CW7A 1GRQA 2OFXA 1BMFD 1P4SA 5KDDA 3L0OA 3VAAA 1Q44A 4HUQB 4ASUA 4JYCA 3I62A 1PLJA 1N6KA 2OAP1 4BLRA 3QKTA 1AKYA 1KJWA 2WPDD 1KNQA 1WBBA 1FZQA 3Q72A 3WNCA 3VR4A 4TMXA 2YINC 1JR3E 2AN9A 5BYJA 2Q9AA 4PQRA 2J5XA 1CU1A 3FTQA 3NVAA 4GMXA 5HE8A 1EX6A 1I2MA 3TVDA 4Q7KA 5HPYB 4FMBB 1T6NA 3W9YA 3ZLJA 1OE0A 4OL0A 3I73A 4CYMA 2WIAA 4HAUA 2J0UA 3ZZ0A 4HAWA 3WMFA 4ESVA 1AQUA 4R7ZA 5EUQB 3AB3A 3I1FA 2AD1A 4ZDKA 2QSYA 2F9LA 2IXEA 2H7VA 2Z6VA 3BC1A 1XTSA 1G6OA 3GEHA 3P4YA 4DVGA 1YR6A 1VECA 2AK3A 4Q1DA 3OESA 1TMKA 3PITA 4FMDB 2CDNA 3GLGA 3BRWD 3QVUA 3TSOA 1YU9A 1TF7A 2AWOA 2P6UA 3K0FB 4HLCA 3TUJC 4RKFA 1W36B 1D9XA 1R5OA 3KTAB 2PMKA 4OYHA 3W5JA 3FHOA 4WXPA 2IWHA 2QBYB 3HPQA 1XX6A 2IYQA 4LPKA 1SVLA 1UEIA 5JZVA 1QZXA 5FPHA 1SXJB 1U98A 4JLNA 3GCGA 4YDHB 1YVDA 2A2ZA 4YONB 3ZZUA 1MO6A 3GEEA 4PC1A 2GXAA 2QAJA 5HZKA 1R4AA 1Q20A 3QEOA 3FHTA 1G3RA 2DFTA 1JALA 4DLWA 2ZM5A 1VYVA 3TE6A 3IIMA 3Q7PA 3OHMA 2F6RA 3A36A 1O3YA 4EQ6B 1N5JA 4XIGS 1GTVA 4B3CA 4O0MA 1IN6A 1W2GA 4HATA 1E99A 4K81B 5DYIA 2P5TB 5DYGA 4P4SA 3B60A 2WBLC 3HJNA 3LV8A 1OHHD 4G3XA 2IYRA 3VQTA 4II7A 1Z5ZA 4PC2A 4HZUB 1GIAA 2R6AA 1KHTA 3OAAD 1OFIA 5CLLA 4C7OB 2JEOA 4JVMA 3T1QA 4WOPA 3RRZA 3OFND 1YZNA 2X77A 1II8B 3CNNA 5E7IA 2PBRA 2ZUBA 3GFTA 2DWOA 3KQHA 1J7KA 4A15A 1JR3A 3CRVA 3IO3A 3GLFB 4CEHB 2JATA 2ZVPX 2NO9A 4DDVA 4R71A 4XJXA 4I4LA 4F4JA 1JAIA 1ZC4A 2J1LA 3CKLA 2PX3A 2HDNB 4AD8A 3LBNA 1DO0A 2FSIA 1OJLA 1D2EA 4TZ0A 3LBHA 4D80A 3K8YA 2BIFA 4D0LB 3IHLA 1S1MA 3L0SA 1N0VC 5LB2A 4S2EA 3H4MA 2V4ZA 1R0WA 4KAXA 2AKAB 3AVOA 4LJ9A 3MRSA 1XEXA 2JDID 1HUQA 3AP1A 4LBYA 4GT1A 5CJPA 4U5XA 4FCTA 1NN3A 2QEQA 3KUCA 1RC8A 1AS3A 4PPGA 4NMMA 5JSZA 1NIPA 1AK2A 1OB5A 4LYFA 3QF4B 2GRJA 3OEHA 1NLFA 2GJAA 2WSSD 4FINA 2BEKA 5BXQC 2WWIA 5IDVA 1UKVY 2ODBA 1PVOA 2ATXA 3KX2A 3G5UA 3ASYA 1ZUIA 2EFGA 2E1RA 4I1SA 2QP9X 3GLHB 3UWOA 4JYBA 1KI9A 3B5JA 5CITA 1UBCA 1OFHA 2YJTD 4POAA 2OG2A 5JI2E 1E2HA 1KNXA 2QMEA 1HV8A 1HYQA 1ZCBA 4ITRC 3RRYA 3BH7A 1E2MA 5FL7D 1NP6A 5SZIA 1C1YA 4FWTA 3AGPA 3QKSA 5F98A 1BIFA 1CR2A 1R8QA 2IYTA 2D2EA 1GKUB 1ZNZA 3DVLA 2WMOB 4TTQA 3AVPA 2KBEA 4HB4A 1XZQA 1QRAA 1AS0A 1SXJE 2C9CA 3NHAA 2DFKB 3PEYA 1GFIA 4LV6A 1JXMA 1SVKA 1KSGA 3LO5A 2UVQA 2Q9BA 2GTPA 3L8YA 4BASA 1E96A 4LC1A 2ZRMA 5JFGA 2FN4A 3ZQJA 2B8TA 1E0AA 2GILA 1HH4A 2VHCA 1XP8A 2GZHA 2R6FA 4KSCA 5K8UA 1OB2A 4Q7JB 1IOZA 2H18A 2RHDA 3IBYA 4LDJA 3THYA 3CX7A 2QZ4A 4XD7D 2XXAA 1XTRA 2WJIA 5A0FA 5B57C 2VLIA 5CB8A 3AF0A 5HCIA 2ZE5A 2DCUA 3ZVLA 3AEZA 4QOSA 1OYWA 3CM0A 2HV8A 4Q1FA 4HUQA 2IWRA 1IY2A 1OV4A 4V0ME 2ZI4A 4GZLA 3RWMB 4YMUA 4PANA 1T8UA 2ZRCA 4ON9A 5F3WB 2BDTA 1GNQA 4L5BA 4GMDA 2F55A 2BC9A 4XH9B 4JS0A 4GRAA 4DSUA 4NCIA 5DH9A 4B32A 4BUJA 2OBMA 3GLFE 5KDLA 1F5NA 2HCBA 3TW4A 4O25A 4L9WA 5L3SB 4N1AA 1G19A 1T3LA 3BFVA 3U5ZB 3CX8A 2NMVA 3QKUA 4F38A 4P31A 2O8DB 2B92A 4LRWA 3I32A 4UXIA 4ASUD 1TTTA 5JJIA 3BGWA 1VIYA 1EFCA 2CVHA 2N1BA 3CWQA 3LVQE 1AJEA 5EE3A 2AL7A 1N6PA 3AP3A 4RD0A 4K8OA 2NO1A 2ERXA 2A7QA 5KHOC 3BIFA 2FG5A 3ECCA 1R8SA 4C0HA 1PUJA 2REXB 3K0FA 3MKSB 2IYLD 3P32A 2H17A 3Q8XB 4ZCMA 3WYFA 2YVUA 4BFXA 3NBFA 4KHZA 4EPTA 2QBYA 2VTKA 4IEEA 2GF9A 4CGZA 2BCJQ 3O8RA 1MT0A 5CB6A 1SXJA 3QVVA 2ATVA 3KQNA 3K0AB 1KO1A 3GLHE 3WNDA 3A37A 2KE5A 3RABA 2OAQ1 1RFLA 1Z6AA 2OCPA 3SEAA 2NO0A 4QC2A 1EG7A 2J7KA 3DMNA 3M0EA 2QAGB 5FOTA 2ZS9A 2VHTA 4BLPA 4FXPA 1IN8A 2VIIA 4EQ6A 3I61A 4EAQA 4Q1BA 5B64A 1DG3A 1SHZA 4DRZA 1P9NA 2QRNA 4A0RA 4IKEA 2E9SA 3PQCA 4P4UA 5JHHB 2QTHA 1VG0B 4D4LA 5IT5A 4ZCLA 1GAJA 3PEWA 4OI4A 1XMIA 3SI7A 1GG2A 2HXYA 4HZUA 4OHZA 2UZ3A 3FYHA 1BO6A 3T34A 1X8LA 2MMCA 3K09C 4B2IA 4V0MA 5CIQA 4Q1EA 4C7OA 2NO6A 1R0ZA 3ZYCA 3VTKA 3FGNA 4ZIRB 4G01B 4RY2A 5FUXA 2BBSA 4BE7B 1II8A 3HR7A 1Z28A 4MUBA 4ZKDA 4XWOA 4JLOA 1M6NA 2R6GA 5EXTA 1UEJA 1CULC 5FUVA 3GLFA 4CEHA 3RS4A 4NPHA 4ZDIA 1NKTA 2DPXA 4KFSA 3Q7QA 2WWWA 1NVVQ 2C5LA 4W9MC 1Z22A 4JVSB 3ZVNA 1KZGB 2Z4RA 1YZTA 2RGCA 4G1UC 4I1VA 4H1VA 3EASA 3UANA 4A9AA 1XTIA 1GRNA 1JR3D 1KDRA 1T0HB 1N6LA 3ZS8A 3M1IA 4N3NA 5HZHA 1I4LD 5GVSA 1A82A 1DAIA 4BQSA 2FA9A 4OQFA 3GJ7A 4P3YA 4CEIB 2O8EB 1VYUA 2YC4C 3QF4A 4PO8A 3NTUA 1AM4D 1EFUA 3UG6A 4HB0A 1DOAA 1MOZA 3BAFA 1WMSA 2Z83A 2OM2A 5EP2A 1QHHA 2H92A 3WP0A 3EPKA 2ZJBA 3VKWA 5EE1A 4P4TA 3CH4B 2P1QB 3GLHA 4RSGA 3HYTA 3R9WA 3SYLA 5DI3B 3UMSA 1ZC3A 2IYUA 2BHRA 4A2PA 3TAUA 3P20A 1EXMA 2Z0MA 5AWFC 4G5QA 3FDIA 5TMPA 4ACAA 3VKHA 1AGRA 4C9BA 1ZD8A 3OEHD 1LV7A 3KJGA 3RRMA 5K8IA 3IEVA 2P1OB 2QGNA 1M1YE 2QUZA 1II0A 2FU5C 2PZEA 4KODA 1YQTA 1P22A 1X1RA 1RJ9B 4PTLA 1Q22A 3K9LA 4YXWA 2J46A 4M9QA 3FVQA 1JQLB 3SJAA 4LV8B 4BFUA 5LB4A 4TMWA 4QGHA 4PO1A 4NYIQ 3E5HA 5DNYB 3DDCA 3T5DA 1T3HA 2PJZA 1GOTA 4A8JB 3NEJA 3JVVA 4PAQA 2J0QA 1KIMA 5FTKA 1TX4B 2GESA 4MGIR 3MCAA 4CF7A 2ONKA 3KXIA 2ZQ5A 1OF1A 3W5IA 4BZQA 3CF2A 4Q03A 5F2EA 1WF3A 3BBPA 1V5WA 4G0NA 1N3BA 1JJ7A 1M34E 3HU1A 3CPJB 3K9HA 4M22A 3RVBA 4D4MA 4TMKA 1Z0FA 1W4AA 1JI0A 5E4FA 2WJGA 1EFTA 3LVRE 4M1WA 2J0SA 1NSFA 4IDOA 1S9HA 2CCKA 3EA0A 1SVWA 3AVXA 5BWMA 1EX7A 4ESHA 4NCHA 5LBIA 2R65A 2VP6A 4RD3A 2GBLC 2XNDA 5L3SA 1NMYA 2C78A 1OW3B 3CW2A 1R2QA 5JI3E 4MH0R 3U3OA 4XVQA 2P0EA 2XX3A 5JEDA 2C2HA 5TXGA 3BD9A 2O8DA 2HLDA 1TU4A 2Q0HA 2B7BA 5IK2A 1K6MA 4W7SA 4GOXA 4JLAA 3UWKA 3EZ9A 2W6JA 3B13B 3KJEA 3KUDA 4PZYA 2RGEA 3CZPA 3TBKA 1XZPA 1FP6A 1R0XA 2A30A 1BYUA 3BB3A 3AKYA 4DCSA 4C0AC 4NP6A 4C0BA 4F4CA 1G20E 2UKDA 4HB2A 1AIPA 2FOLA 2OHFA 3Q5DA 4QXAA 4PR0A 3SDZA 5IF9A 3AVTA 1S3GA 3DL0A 1N5LA 3MD0A 3K9GA 4B3XA 1ZCAA 1W49A 3W3ZB 4QJ3A 1G8FA 5EXXA 1N6RA 4GSYA 3A58B 4A4DA 1ZJ6A 4ARZB 3LQQA 4B2PA 3ADCA 3L0IB 1ZW6A 1W4RA 3ZDQA 2VSXA 2KI5A 3FMPB 1IY0A 3MWYW 4NE2A 4RD6A 1J2JA 2YOGA 3K0AA 3NXSA 3W6NA 3GLIB 1ZD9A 5FPYA 3VX4A 4C0QC 5C18A 4NHOA 1MO5A 4P4SB 4NZYA 2D62A 1OSNA 3FMFA 3QXJA 1ZAKA 2WJVA 3AP2A 4WBSA 1IN5A 3QOFA 3CO5A 1JECA 1G3IA 4ZDWA 3AF1A 2QAGA 3KXKA 4PHGA 4GNKA 4RJLA 1W36D 4QRHA 2WAXA 4HYYA 3PXGA 2XTMA 4B3BA 1WP9A 3T35A 2O8BB 4PSKA 2GEUA 4PQFA 1DADA 5KNDA 1NG9A 1GNPA 1C4OA 3FKQA 3NC1C 3KB2A 3UKDA 1GSIA 3WP1B 2GJSA 3ADKA 1SXJD 3S1AA 2A78A 1W47A 1YHNA 5C1BA 2ZRLA 3FFAA 5DI9A 1KJZA 1Q0UA 3FFBA 3LH5A 1JEDA 3U7GA 3L0PA 4LK2A 3U44B 3H1TA 5L3RA 4MGYR 4C0LA 3BXZA 1NVWQ 3PV0A 1ZU4A 1K8RA 4GI7A 4RKEA 4ZI3A 1GDDA 5H68A 2JJ1A 4TTRA 1P5ZB 5E3HA 1I4TD 2OV2A 3MGCA 1TL7C 1T9HA 4DLSA 2AR7A 2ODWA 2YWFA 3EXAA 3WBKA 3FOZA 2ECKA 4KLNA 2R9VA 4WZBE 1IJFA 4W5HA 2FFQA 4W5WA 3LW8A 3ZVRA 4F92B 2XGJA 2XOKA 2OFWA 3A4MA 4DB2A 1XPRA 1QHSA 2OZEA 1PV4A 1SGWA 2FPLA 1RW4A 4U00A 4V0KA 3FPAA 4TMVA 2QMOA 2O0JA 2ZREA 2OSBA 4XTCS 4LJ6A 3EIEA 4B34A 2VP5A 2RMKA 1WCV1 3B9QA 3FMIA 3JZMA 4A1FA 4C30A 4BEJA 1JNYA 2ZI6A 2EWVA 3IPXA 1P9WA 3QENA 4UQOA 4QHSA 3REGA 1KYIA 2G88A 1SQ5A 2UZIR 3KQKA 2XAUA 3B1XA 4OJQA 1UBEA 2IS1A 3X1ZA 4CEIA 4QBGB 2O8EA 4HDOB 1G4UR 2IL1A 2OE2A 2IYXA 1XEWX 2IHYA 1U90A 4L8GA 1KJYA 3SFZA 5CIWA 3CWZA 1TQ4A 1U81A 4Q00A 3CX6A 2AXNA 4EPVA 5BN5A 3THWB 5J5CA 2WWXA 1ZNXA 4EDHA 2IUSA 3PR1A 121PA 5DI3A 1TUIA 2ZJOA 5BQ5A 1FX0B 3BB4A 1OPXA 3F3YA 3A1WA 1U94A 1OT3A 1UJ2A 4O3MA 1FS1A 2ODNA 3D31A 4C0JA 5BN4A 2G1KA 5J4YA 2FSHA 1DAKA 2GCNA 5G53C 4HZIA 4LHXA 3QBVA 3GLIE 4RZ2A 3CR8A 2WSMA 3THYB 1RJ9A 2V6IA 1KDPA 2ZJ8A 3DM9B 3L82B 1BOFA 1W7AA 2JLQA 2IS6A 1UBGA 4UJ3A 2AX4A 4BZPA 5JLJA 3ZH9B 5JWRA 3R9XA 1KO7A 2V3CC 2F43B 1JB1A 2OCBA 4PPNA 1Z0DA 2EFEB 5EXPA 4Q1CA 1EESA 1E1RA 4DLZA 4A8JA 2VP9A 5AUPB 4UNPA 3MLEA 2QQEA 1E2IA 4PX9A 1X1SA 3C8UA 2OVPB 4IOKA 4BFZA 4HLDA 1NBME 1R7RA 1LY1A 4Q21A 1H65A 1LTQA 3KKMA 4YMSA 1G8PA 1N2CE 4YXWD 2ANCA 3C16C 3IHWA 4OK5A 3UPUA 4KLZA 4RD4A 3QI2A 1L4UA 2ZANA 1UKZA 2OCAA 5H8WA 1XD9A 2DWPA 3KB1A 1UDWA 2O0HA 5LD2B 2DR3A 3ZIAA 3DPUA 4LPSA 4Q48A 2XJ4A 1X6VA 4PHFA 2W83A 3TMKA 1N5KA 2FGJA 3JZAA 3R20A 3T15A 1ZIOA 4R98A 3WNBA 1CF4A 3N5CA 2V1UA 1G7SA 1KY3A 4OQMA 5FPSA 1COWA 3J81k 1E94E 1VIAA 4NCKA 2D3WA 1GP2A 3LWNA 5KUTA 2XTZA 3SQWA 1J90A 1E2KA 1ZBDA 2V54A 4M1SA 3QXSA 4OI2A 4M9SA 2YOFA 3U7FB 4OI0A 2ZRJA 4KXFB 3KDSE 4ZPXA 4LHYA 1Z29A 2BCGY 1KDTA 2O8FB 1FPMA 3EZFA 5L3QB 1JPNA 1D5CA 1NF3A 4Q4AB 3LX8A 5E7JA 5BW8A 3VHXA 1L2TA 4HLUA 1YZQA 2YWGA 4MDEA 4IOMA 4PC7A 2VHQA 1CLUA 2P3SA 3DOFA 2XNDD 3OE7A 5DGXA 1RKBA 3DHWC 4WVFA 3OIWA 3T5GA 4A2WA 2RGAA 1LS1A 5JWOA 4IFBA 2VHJA 2GNOA 1JR6A 5FUWA 2HLDD 2L0XA 4ARZA 1SVOA 3BH6A 3FWYA 4CDGA 4JKYA 4ERNA 4L4UA 5DE3A 5DHAA 2Q3MA 4URUR 2FH5B 5F9HA 2W6JD 1BH2A 1E2FA 1XB2A 5C2JB 4JLJA 2CXXA 2BMEA 3GLIA 4H1UA 5DIFA 2ZRPA 5AR1A 3WHLA 2P6RA 4TYYA 2ZS8A 1E98A 1FNMA 3QUSA 3PFIA 1KO4A 2MSCB 5FPTA 4TYNA 3FKSA 3SR0A 3WBJA 1T5LA 2OEPA 1RYFA 2QPOA 4KYIB 2QP4A 3IO5A 4MRPA 1JJVA 3AF2A 1KMQA 2O8BA 3CUEF 2FPMA 2ZUCA 4RZXA 3MJRA 3T1TA 5KYKA 4FI3C 4DUGA 1NN5A 3DZDA 1NBMA 4NYJR 3LDAA 1YZUA 4QGFA 2ORVA 4QL3A 5TV2A 1CIPA 2CHGA 4Y0AA 3WRYC 4AYTA 4QM6A 3QXCA 4TL6A 2QA5A 3PG5A 2X2FA 1Q3TA 2NZ8A 2RGXA 3VMFA 4JBXA 4D0GA 3U44A 1H8EA 1T0JB 3AVUA 3TK1A 4R9UC 3KFXA 2ZRHA 4Y0VA 4DXAA 5HR5A 1P73A 1TUEA 5HTKA 1GL9B 1NEXB 1DAEA 3LAWA 3Q3JB 4MRVA 2GVZC 4AWXA 4JT4A 4D25A 3RHFA 1OIXA 1ZYUA 1MH1A 1XJ0A 3CRMA 1CS4C 3LD9A 1CJVC 1VPLA 3BORA 5LDDC 3EPHA 1JXOA 1U0JA 4HAYA 4AKGA 1NMZA 5J40A 4GP7A 3WHKA 3V4RA 4UXHA 1E9EA 1MO3A 2GXUA 4DLVA 1IY1A 4R2HA 1TNDA 1U0HC 2ZETA 1KI7A 4O2LA 3U2QA 3I5XA 4DZZA 5KTYA 2JIZA 4QBIA 4GL2A 4MKHA 2A5FA 5FI1B 1XXHE 1YKSA 2JJ1D 1QHHB 5FR2A 4AKIA 1W36C 5AJWA 2OVQB 1WE2A 4CRWB 2ZYWX 4UXJA 3ZD6A 4MGZR 2NG1A 4RD2A 4B47A 4Q18A 4URXR 2IBMA 5DN6A 1SHKA 2GWHA 1Z3IX 5G3ZA 3U3MA 4KVAA 1TQ6A 2FF7A 3I8SA 5FTLA 1SXJC 2DYKA 2P65A 2ZRFA 1JAHA 3VNUA 1E69A 2XOKD 3V00A 2Q6TA 1SZPA 3C14C 2PT5A 1TF2A 5UKDA 1P2VA 2VQSA 3QEJA 4FW9A 5K8LA 3ADBA 1KDOA 2JLRA 3TRFA 3THWA 3H84A 1ZM4A 2FGKA 3BERA 3E70C 4F91B 3U4QA 1IAQA 5FOUA 5HE9A 1T4GA 1IBRA 1FX0A 1QVAA 2G9NA 1U0LA 4HAZA 1A1VA 1MRNA 3N70A 1G3MA 2V1XA 2BJVA 1KKLA 2RAPA 4MA4A 1E2NA 4BRWA 4FCVA 1N0WA 4Q9HA 2H16A 3EG5A 3W34A 4DSTA 2ZIAA 4OHXA 3BWDD 1RE0A 1VDZA 4IHQA 3DKPA 3BK7A 2C03A 4GP6A 1ESMA 3KZ1E 4G5OA 1ZNYA 1CXZA 1HE8B 2ZSFA 5B2ZA 3MWLA 1XCPA 2FX3A 4XSHA 2F43A 3T1VA 5FBLB 1DBSA 2Y8EA 4NCNA 3T06B 4BZXA 3LY5A 3BFXA 2F1IA 3AUXA 4B6EA 2P1MB 3O8CA 3PIRA 4AKHA 4RCYA 2VSFA 4XVRA 1M74A 1E79A 1FUUA 4QBHA 4JVNA 3SHWA 3CIOA 3U3RA 4E5UA 5AUOB 3RNLA 4C2TA 4QNMA 3ZS9A 4LI0A 4A0FA 1E0JA 3E1SA 4DC9A 4WZAE 4DDUA 1KI1A 3AKEA 3LFUA 1A4RA 4LCBA 1D2MA 4OI1A 2ZXUA 2RH5A 1TF5A 721PA 1X86B 2JAQA 4B75A 1XMSA 1HTWA 2IF0A 4DWJA 1ZUNB 2BV3A 3A4LA 2GJ9A 4WIAA 2GXSA 3ZVMA 1WQ1R 3IQXA 1XTQA 1Z6YA 3GJ5A 1E1RD 1TEVA 2CL0X 3SN6A 3IQWA 1R6BX 4A36A 4NL4H 3K0CA 2ZAOA 4RFSB 3X1WA 1XXHA 2GK7A 2VF8A 1DARA 3CBQA 1QG4A 1FUKA 2W6ID 1Z6TA 1YR9A 2CL6X 1YR7A 1ZMXA 2NTYC 5A5GA 1I2DA 2PEYA 2C77A 4G5RA 2ZRAA 1YZLA 1G8GA 3VHLB 3ZQ6A 4AG6A 1P72A 1ZIPA 5FOSA 4TYWA 1D2NA 3CLVA 1S9DA 2BMFA 2NGRA 1P2SA 2AWNA 1IXZA 3LXRA 5GJCA 4A0GA 4TLAA 2RGNA 3HWSA 4LYHA 3ZIAD 2O8FA 5L3QA 4KI0A 3GJXC 3O8BA 4Q4AA 4ZO4A 3ZZTA 1HT2E 1UF9A 3QPVA 1U9IA 4DJTA 1HEIA 1FQKA 5KNCA 1RVDA 4URZR 3NH9A 1COWD 2GDJA 4US1R 4Q5IA 2ZE6A 2G83A 3DZ8A 1L8QA 2ZR9A 3QKRB 2NZJA 2ODEA 2EYUA 3F5FA 3Q9LA 2A9KA 3OEEA 1NMXA 2BVNA 3B1YA 1KKMA 4P33A 4LX0A 4HDQB 2EVWX 1F3OA 4B3DA 1SKYB 4FWIB 2IS4A 5D3QA 3L8ZA 1U8AA 1GITA 4TMTA 2YC2C 5AJYA 3M4YA 4BFTA 1W46A 3S1AB 4WA7A 3V9PA 4GDFA 2D74A 2ZE7A 1MR3F 1F6BA 3MWKA 5TDHA 4XVUA 3OE7D 4EKDA 1AZTA 4UNQA 4NYMR 2IXGA 4DBLC 5EE5B 4TWZA 4N0DA 3IKJA 5EXSA 4MQBA 3B8HA 3PENA 4NDZA 1OH6A 2BBWA 4CT4B 2WVJA 4TQAA 421PA 4E22A 4LYJA 3CRRA 2Z4SA 2EFDB 1F60A 4MDFA 3KXLA 4BFSA 1Z8FA 2DHRA 1W5TA 3A4NA 1U99A 1EFHA 4D4KA 1XRJA 2LWIA 3GJ3A 2YOHA 3TSZA 3KFVA 3Q5EA 3FKSD 521PA 2OLJA 1D9ZA 2P1NB 1ZUHA 2WAYA 4M53A 5AJXA 3TAHA 3RAPR 1L4YA 2CHQA 4UNNA 1E32A 3OGLB 4B71A 4IJMA 3C6OB 1UPTA 2G1JA 2B6HA 1KOFA 3UIEA 3LW7A 4GPTA 4B6FA 1AA9A 1AN0A 3QF7A 2J7PA 3V4FA 5JCZA 2IS2A 1BKDR 1N6NA 3GJ6A 2W2XA 4DUGD 4EJSA 1E0KA 1NBMD 1VHTA 1GKYA 3HPRA 5M04A 1VG8A 4PQYA 2HXSA 2AFIE 1CKEA 2QPTA 3BOSA 4LSGA 5TB5A 2ZYTX 2CCGA 1ZM7A 4TN1A 2FMXA 2D2FA 1M7GA 3K0EA 1H8ED 4KJZA 2JJ8A 4CZ2A 2SHKA 3KJIA 3RYTC 4FN5A 3U6KA 4EFLA 4Q9LA 4GOKA 4TLDA 1J99A 3RANA 1HT1E 2FNAA 4QGAA 1W44A 1E9CA 4NCJA 1D8TA 1II9A 2QE7A 1TU3A 3OIUA 4A92A 4OK3A 1A5TA 2WZQA 5E95A 3B1WA 1F2TB 1FTNA 5IRCD 4URWR 4Q9KA 3RS2A 1CRQA 1V43A 621PA 4I1OA 2QQ0A 4WZ6A 1EWQA 1KK0A 4D6PA 1OXTA 4BLOA 5F9FA 2OCYC 4Z54A 1CTQA 1Z2CA 1G5PA 2LCFA 1IONA 4X8HA 2JIZD 2WJHA 3MMPA 2HEIA 1S0UA 5GADl 4MITA 2QAGC 2FJUA 3DOEA 2MMGA 4KSBA 4Q4HB 2E87A 5AUNB 3KQUA 1TEXA 1US8B 3LLUA 3HR8A 5GJVC 1RZ3A 2AHOA 5FPKA 5DN6D 4US2R 1XPUA 3THOA 3QG1A 1XDBA 2F9MA 5CDFE 4KU4A 3L2OB 1SKYE 1XFAA 3TSWA 2GZAA 4TLEA 4R2IA 3SNHA 3N2IA 4IFEA 3KKOA 4TLCA 3NC0C 4DKXA 4OQXA 4PPFA 4ZI2A 1YJ5A 3NIBA 1KO8A 1P60A 4NKRA 2PZFA 3AVQA 4AY2A 1N6HA 5GJBA 2W58A 4F7WA 2J59A 2JCSA 2NQ2C 1GUAA 3LA6A 3P27A 1E9AA 4NTZA 3K9NA 4M1KA 4PAOA 1UDXA 5FOWA 1KSFX 2R6CA 3QBTA 5JRZA 1R5BA 2JLYA 1ZU5A 3EX7C 2DFNA 3GQBA 1Z0JA 3MJHA 1QHXA 5FUYA 2I1QA 2QORA 2ZRBA 4D26A 1LFDB 1YRAA 4EPYA 1DS6A 4PC6A 2C8VA 5FTJA 2CLSA 2QNRA 3ONWA 5AUQA 2WOJA 2HT1A 1KI6B 1ETUA 4JL8A 4LV5B 2ZSAA 2PEZA 3VR1A 4BWYA 1HQCA 3DEFA 4JLBA 1NN1A 5HCNA 2IYVA 1L7VC 1FMJA 4RFSA 3G0HA 4LY6A 1Z0KA 3B1VA 2JJ2A 3TJZA 5C46F 4TL9A 1E79D 1X8KA 2G77B 2RGBA 1E2EA 2IYYA 3V7DB 4D81A 4B33A 3EZ7A 3UK6A 2YNMA 3RDPA 1GRRA 2OUKA 1JQJC 4Q9IA 3FE2A 2ZR0A 4HEJA 3UATA 1UFQA 1DPFA 2D4HA 2V7QA 4HLQB 2YKGA 3NBZC 4OK6A 4KITB 1CRPA 5JS8A 2ZITA 1ZVQA 1Y3AA 1SKQA 3HU2A 3AVWA 3TIFA 1NVXQ 2N46A 1G8HA 5FBVB 3EC1A 5J47A 1VMAA 4EPRA 3W3AA 1LW7A 1XD2B 2BKEA 2CNWA 4JJKA 2VPPA 3QKRA 3K70B 1CR0A 3P1JA 2VBCA 5TARA 1H8HA 4IRUB 4JJZA 2XJ9A 1FMLA 4Q7LA 1R10A 4TQUS 1M7HA 5CDFA 3TH5A 3VX3A 4TL8A 3AVYA 1J8MF 1OFUX 1RRFA 4E03A 4W5JA 2W00A 4B76A 4A8JC 3HP1A 4BLSA 2G6BA 2V6JA 1N6OA 4NONA 4A6XA 5EP3A 2IEYA 1XMVA 1G3QA 2H57A 2VP4A 2VYFA 1HA3A 5FOXA 2CBZA 2CE7A 3FB4A 2ZROA 3NDPA 2DB3A 4FCWA 2EFHB 3OEED 2FFHA 4LJYA 3SJBA 1GM5A 4G5GA 2XEXA 3RC3A 2ZJAA 3LRPA 2Z5FA 1YR8A 2GEDA 2RKOA 3NBXX 4LGMA 4M9ZA 4HAVA 4ACBA 2VSOA 3ZD7A 2Z43A 2J87A 2J0VA 2IT1A 1ESNA 2E32A 2XZPA 1XF9A 1R5NA 1K5GA 4WAUA 1QDEA 1WXQA 1ZD1A 1OXSC 1YZKA 3MSXA 6Q21A 1E2PA 3U60B 4DLXA 2ZI3A 2PLRA 3QPWA 3LXXA 4B43A 2HYDA 3AV0B 4MGKR 1IXRC 4XOIA 3SS8A 2WJJA 2KBFA 2QROA 1KAGA 1VYTA 3MUFA 5EE0A 5JJLA 2P2LA 3I3SR 1UKEA 5JECA 2OILA 4Q9JA 3PUZA 1AQYA 2D06A 2H5EA 2W0MA 1OKKA 221PA 4HLUC 1G9XA 3A1VA 3FHCB 3PEUA 2V8OA 3QQ5A 3IPYA 1PUIA 2AXPA 3SC3A 3SHFA 2BEJA 2GZDA 1XEFA 1Q3HA 2BMJA 4PC3A 2YYZA 4RVCA 4IDHA 2DBYA 2B7CA 2J7PD 2GEVA 3KKPA 4BPBA 5BN3A 4MKFA 2C9YA 1DG1G 5FR1A 4DCVA 3U4QB 4JLPA 3UMFA 1F2TA 4AURA 1RYHA 2KSQA 2HJVA 2WV9A 3QG5A 2ZE8A 4DSOA 3SE0A 4EIWA 4DLRA 2P67A 1X3SA 5EJEA 3CRW1 2AK2A 3ZGXA 5JBQA 5EP1A 2WJYA 4E07A 2EU8A 3QXHA 1RPZA 3PJRA 4PXAA 2O8CB 1NI3A 3IIJA 4EFNA 1W48A 1P2TA 2QMHA 4EPWA 2Q3FA 3RSLA 3LBIA 4ZCIA 2RHMA 3CONA 1TQDA 2ZRDA 3CF6R 1ONBA 4LBWA 2IUUA 2BBTA 3NHBA 3C15C 4Q4HA 4UJ5A 3U7HB 2H1LA 3IILA 5HKKD 4DDWA 4NBSA 1US8A 2CMKA 2QE7D 4XWAA 5AK0A 4LOAA 2N42A 2XSZA 1MV5A 4Q19A 4Z1MD 5L3VA 1S2MA 4LJAA 4EPXA 3IBGA 1FQJA 3EWAA 5KSZA 1G5TA 1W0KA 4PFSA 2ZS7A 3G82C 3WSOA 5TVKA 3U61B 4O2RA 3W8RA 4C0SA 2BKUA 4TT3A 2W6IA 3EW9A 1HURA 1P75A 3ASZA 1JPJA 3T1OA 3GJ4A 1IN7A 4HUTA 4YMVA 1NSTA 3OIYA 2XZLA 4YDSA 4OKSA 1EGAA 3RC8A 4BRUA 2H8KA 2IA5A 2NIPA 2XTNA 3EWSA 4JSTA 4MYCA 5SZKB 3SZRA 4C3ZA 4LZZA 5KNBA 1Z63A 2B21A 2A5GA 4IDPA 4KBFA 1P2UA 3CF0A 3FMOB 4LHZA 5CM8B 5KPDA 2ZI9A 4PO9A 1XXHB 1OH7A 3B6EA 4AYWA 1LS6A 2QENA 4RFVA 5KDOA 3VKGA 4HSEA 4C2UA 4JIMA 1U8YA 3WYGA 1E2JA 5JS7A 4D82A 4KO8A 1P3JA 2ZSEA 2ZYUX 2WTUA 1Z2AA 5FL3A 3C7KA 1VCNA 2ZVQX 4KV9A 4TYQA 5D3MB 3EPJA 2C99A 3GMTA 1KI6A 1MABB 2QN6A 4Q47A 1DAFA 2WWFA 4LJ8A 2BWJA 3RSOA 4I81A 1P62B 2GXQA 4OHWA 1BS1A 4DT1B 4C4PA 4FMCF 2R6DA 1UM8A 1KSHA 1DAGA 1Z83A 1KK2A 4JLMA 1G18A 4YC7A 5LPNA 1G6HA 4ILEA 1VKJA 1N6IA 2BBOA 4IDQA 4FIDA 3IEUA 1AGPA 2BOVA 2FSGA 4V0OA 5K8TA 2CEAA 4UKDA 2HYIC 4QJ4A 3C6PB 2CJWB 2RGGA 5CK5A 3WYAA 2KB0A 4BLTA 1DELA 1GWNA 1RRCA 1NLYA 2P6NA 1EWRA 2JJ2D 3A1UA 3CZQA 2ZI7A 2AFHE 2TMKA 4LUCA 3RWOA 4JMPA 1XCMA 4V02A 1XD2A 1LDKE 5L8VA 3K53A 1S96A 2ERYA 2HJGA 2PH1A 1G7RA 3PCRB 4I99A 3R7WA 2VA8A 1W5SA 4L15A 1Q1ZA 3I8XA 2V7QD 1IHUA 5FBWB 4V03A 1W1WA 1N0UA 1CP2A 1FP7A 2J45A 4B3FX 3A1TA 1UKYA 2E31A 1QHGA 4OHVA 2QY9A 3N2EA 2HUPA 5EZ5A 4WXRA 2V55B 1F2UB 3KKNA 4AYXA 5J4VA 2FE4A 1KK3A 2X8AA 2GHIA 1ZM9A 4Q4JB 2W2VA 1LNZA 5FI0B 4DDTA 5JEEA 4M8NE 2CNWD 1M2OB 1TPZA 2KWIA 1FOEB 5CYOA 2ZRKA 4LBZA 2ZI5A 2K5UA 2WWGA 3A1SA 3WMGA 2GJ8A 1GILA 1H8HD 4IVRA 1W2HA 3AUYA 2ZTSA 4PAMA 2GK6A 2WHXA 1T91A 1Z07A 2CVFA 1MKYA 821PA 4TSFA 3SOPA 5LD2C 4EJSB 3K0SA 3NG1A 4KFRA 3K0CC 4B73A 2ZEJA 2F7SA 3WXMA 2JLVA 3TQCA 5KSOA 2PL3A 5JCPA 3ETLA 3DO6A 4M0LA 4Z8XA 1E0SA 3EA5A 4PZLA 1NIJA 2ZPTX 2IYZA 2R44A 4M1MA 1GNRA 2QU8A 4I1UA 1G21E 4Q66C 4M1TA 4MYHA 5EQTA 4CIDA 2ASEA 2JLZA 1ANKA 4GFDA 1NKSA 3MAAC 2FPKA 2CK3A 2RGNC 1NRJB 2CLCX 4US0R 3KJHA 2Q3HA 5FTNA 1KGDA 2F3RA 4FMDF 1U9IC 5CLQA 1E4VA 3H0KA 1SULA 2FWRA 4D0NA 4JSYA 4DEXA 5BYKA 3AF3A 2GKSA 4NH0A 4QG7A 4HB3A 3AKDA 2G0NA 4J0QA 3U3JA 2FDCA 3A8TA 1OXXK 4CVNA 4MYTA 2I4IA 4F93B 2JA1A 4QJ5A 3NDBB 1ZRHA 1Q12A 2EW1A 1G4AE 1G7CA 2CHVA 1OKKD 3EIHA 4G5SA 5J4KA 2OBNA 3EARA 5EUMA 4HI0E 2R62A 1OYYA 2YHSA 3L43A 4LC0A 5JRJA 1VG9B 2O8CA 1E2DA 5FOVA 1J70A 4JLVA 3Q85A 3OIVA 4TL7A 5FBQB 3T61A 4DCTA 3QPUA 4B3GA 4H9GA 2ZSDA 3SU8A 4F4IA 1XNJA 3NBYC 1Z6XA 3U3KA 5H70A 2HCJB 3HYRA 3AQ4A 1XCGB 1Z0AA 3TR5A 4IXMA 3SJZA 4IDNA 2OT3B 2QI9C 3BE4A 4QGGA 3X2SA 4QM7A 4NYJQ 2XB4A 1VHLA 1G17A 5B30A 1E9BA 3BJIC 3VU9B 3THXB 1CEEA 4LJ7A 1SVSA 4JT2A 2OVRB 1A2BA 5JJKA 1NLZA 3WRXC 3LX5A 4CEJB 3QIAA 1RRGA 1W4BA 1IM2A 3GFOA 4XTRA 4CT5A 2FV8A 3UG7A 1IN4A 1LF5A 5FFMA 4JBYA 1EFRA 1W0JA 2FZ4A 2IW3A 3KQLA 2VL7A 1YRBA 2F1RA 3X1YA 4DIDA 2EFCB 5G41A 1JBKA 4EJSC 2XSZD 2W2TA 1OXUA 4M2LA 1YE8A 3QXXA 4ZKEA 4DIEA 3X1XA 1W0KD 3OGKB 2C9OA 1KO5A 1Z0IA 2X1VA 3TW8B 1KMHB 3AVVA 2CCJA 2WKQA 3TUZC 1WB9A 3WY9A 4AG5A 2GCOB 1WBDA 2RB4A 2WKPA 1NVVR 2ZRIA 4TT3D 5KU1A 1E2QA 1LVGA 1E1QA 2WIBA 5KSYA 3C41J 4DCNA 4HDCA 5D3MA 2PMDA 2AD5A 1AKEA 4QHTA 2KJQA 3ZJYA 1MABA 5DHFA 2V9PA 4M1YA 4Z51A 2QPAA 1GL7A 1G5RA 2X19A 1CBUA 4DT1A 3ADDA 3B7GA 3D7MA 3EZ6A 1KAOA 1Z06A
chains in the Genus database with same CATH superfamily
3CH5A 2IYWA 1OGIA 1M8KA 4B74A 2RGRA 1MC5A 2XQVA 2Z5VA 4U7PB 5E9AA 1BEUB 3E4CA 3JAKA 4KE9A 4CIYA 1T5IA 4N3GA 1WTCA 1VA4A 2HF9A 3GH1A 2VO1A 4WN9A 3DQQA 1YS2X 2BFPA 3CPHA 2Z5GA 2IRWA 3S7ZA 3PA8A 5FTMA 2BSQA 1POXA 3NBUA 2R6HA 4ESEA 3C3AA 2Y0PA 2I4OA 4LHVA 2CJWA 2O52A 4IVPA 1EIWA 1FTSA 3DM5A 3I5YA 4TYPA 1J8YF 5LA6B 1P18A 3GG9A 4XGNA 4DPLA 1A98A 2VDQB 1TADA 4RZ3A 1T8TA 3H1AA 4FZJA 2K5SA 3NEYA 3VR5A 3WIBA 3CNOA 3AH8A 1AG9A 4BMDA 3HBAA 4IILA 4P7JA 3A7DA 3GOQA 5ES4B 2V3WA 4YUVA 3E9NA 2W8BB 1RLIA 4O4HF 1FFDA 2A5DA 2P5SA 2DT8A 5EJ4A 3OKCA 1D1PA 4CLRA 3TJMA 1PZEA 1NMQA 2AQ8A 3EC2A 2MWMA 4PSCA 3IJPA 1MB0A 4OMFG 5TS2A 4RGQA 4DZTA 4RABA 2VRWA 1B4DA 3TKLA 3U31A 4YWJA 1VJDA 1O0CA 2ZRQA 1M5TA 4U5QA 2H63A 3BZUA 5E3JA 1Q1BA 1SUCA 1BVRA 1ONSA 3MG9A 1GPMA 2MTBA 5LZ7A 3TXXA 3U6BA 3I4LA 1LPMA 1UJ6A 3DXYA 1Q1EA 4ODIA 3ZZNA 4ZN6A 5LQKA 2EL9A 1GKIA 1G7TA 4WCFB 4HH0A 3VO2A 3OF5A 3FX2A 4J2TA 2CLDX 3GI1A 4G1FA 4X3CA 5EMNA 4CG3A 1QXSA 3IPLA 2IYSA 2ZJ3A 4HO1X 3AEYA 2BP7A 1VPWA 2R97A 4NAUA 5AXCA 1Y42X 2KPOA 3FVRA 1T9BA 3MCVA 2C2XA 1YFZA 5BV0A 1QQTA 1WV0A 1LQ2A 2GZ2A 3LDUA 1QH0A 1U4SA 2NOAA 3RFCA 3AR4A 2ZIVB 4CV3A 1HFKA 2WSBA 4ZHQF 1U28A 4BLQA 2FR1A 3QX8A 2F62A 1Y4DE 2I33A 4PPQA 1OFVA 4ZV9A 4EFMA 2VBFA 5AOBA 3ND9A 1HQKA 2JLSA 4X63A 2PDAA 3EMVA 4ZU3A 3HFGA 4YO7A 4QARA 3UMRA 3DBLA 5AW0A 2W0SA 3G2MA 1X7DA 5LP1A 4O4LF 1NQWA 3OKAA 1OI3A 4KXLA 1DLJA 2MMBA 1GR0A 1O5OA 1X7YB 2R8PA 4GBMA 4WFIA 4G1BA 4L4RA 3WB1A 3PXUA 2PZLA 4JV5B 2QTLA 4QU5A 1UMBA 1YI1A 1JWAB 4JH0A 4MUEA 2YNMC 5FORA 1GTG1 3ZCRA 3VPAA 5IHPA 2CF5A 3DXXA 4RG8A 3B3AA 3CH6A 3EBPA 4O4JA 1GNSA 3MC1A 3QV2A 2X5OA 5DWQA 3UTCA 3WR5A 3C94A 1E4YA 5H82A 3EXG2 3RS3A 3L4EA 2Q4EA 1VIDA 2HA5A 1TAGA 4K6MA 3L7YA 3SBEA 3F8SA 2H5IA 2O20A 1A96A 4FYMA 3TVYA 5K03A 3EPLA 4PBTA 5I6DA 5AICA 4OQYA 1B8PA 4I5FA 2D5CA 1DO2A 2NV2B 2ZJ5A 4OBEA 2LGJA 3U7EB 5A0TA 1FSPA 2B25A 2EKZA 3TVTA 2DUMA 2JAOA 3ZCTA 4M3WA 3ANLA 4OXKA 1JIQA 3TOZA 4M1EA 3TIIA 3AIKA 3MQ2A 4K5QA 1VG1A 1WG8A 1W87A 1SKBA 1A9YA 3NKVA 4J4HA 1LF0A 1O87A 5AJVB 5HRUA 1KMNA 3MUEA 4TM8A 1TC1A 1GR1A 4FIZA 4H17A 4TMZA 3WAGA 2XB2A 2IIPA 2FMFA 1UZMA 4H7EA 4F46A 3TGPA 4JZKA 4ISBA 5AM2A 1E5XA 3SVIA 1ONNA 3F7NA 3I76A 3ELWA 4OQNA 1PBTA 2CK3D 3GFQA 4F06A 1MA3A 5IASA 1FYVA 1S1CA 2PL9A 2CUNA 1Q74A 2BTOA 2NXJA 3H2YA 3L7JA 4XX0A 3UWSA 3SJCA 4BKOA 1P9RA 2IE8A 4TUYB 3RK0A 1JU4A 3ZXSA 1T3SA 4BUZA 4IOLA 4CMIB 4YRCA 1FW6A 4GH5A 4HX5A 1L5FA 3O21A 3ESZA 2BFCA 2PIDA 1XTVA 3GT0A 2Q9UA 3D7RA 1U8FO 2C04A 2WPDA 3K5WA 4LDPA 4OQLA 4BU0A 4S12A 4XPIB 3LNCA 2GEFA 1Y1RA 3T5TA 2DETA 4WLEA 1H3FA 1POWA 4NYMQ 4QDKA 3M6FA 4F5ZA 4N0EA 2F9FA 5ALOA 3A4TA 4A6PA 5EVJA 4B5KA 1S3SA 2EF1A 2G0AA 3C5CA 3AUKA 1SG6A 1H85A 3F3KA 3H7IA 5AVSA 4BKRA 1PZNA 3A05A 4EEZA 4EG7A 3B1ZA 1Q1QA 2VTEA 1HYHA 4ZRMA 3N0TA 3TLGB 3W9BA 1H3EA 3R8FA 4FJ7A 1GUZA 4PSAA 4CEJA 1PZXA 3QWHA 3MK31 4GQBA 4R81A 3HXKA 2IZ1A 3PWTA 1DC6A 1RHUA 1RWOA 2IK8A 3GRZA 2ISCA 5CVEA 2ZJ2A 5GINE 4MO9A 2SKEA 1P2DA 2HXGA 1UWCA 2JASA 3B78A 3I92A 3E18A 4XIYA 3JQGA 3P4XA 2FEOA 3KPWA 1XLTA 2AH5A 4QYWA 3ANXA 3RMDA 4IGAA 3UXMA 3W6PA 1XD8A 5HQ3A 1SC1A 3VR3A 4KFUA 3TW8A 5C7OO 2I7TA 3AF6A 2AI3A 3NH6A 5AI4A 5K3DA 4R8MA 2HH9A 2GM9A 1VPEA 2X2OA 3FCAA 3HNOA 2JIOA 3Q1KA 5IJ0B 1C3LA 1XMJA 3N58A 1XVUA 1H3NA 3RARA 1ESEA 1PEAA 4ETMA 4N47A 1TA0A 2VRNA 3EFOB 1EVKA 4EELA 5JH7A 1Y8QB 4HX2A 4RE6A 3H9JA 4E70A 5SZJA 4CKBB 2PPVA 2ODPA 4ZAVA 4JVLA 3IR5A 4MWGA 5I5EA 1XFDA 2I6QA 1A2OA 2LKCA 2QP3A 5A5VA 2A9QA 2H4TA 2YHIB 2HRQA 4HBZA 1QSGA 1QIKA 3IA2A 4HJRA 2TYSB 2JK1A 2O50A 2QG6A 4MEJA 5AOCA 1MJNA 4DBZA 2W4MA 3GP8A 1IZYA 2GDZA 4QFMA 4DXDA 2IV2X 3HRHA 5CT6A 1DTSA 2QSZA 3B82A 4L9SA 4QT4A 3QLVC 4Y6RA 3CE6A 3OPXA 1U9CA 2YXDA 1CUHA 2AMVA 1TEZA 1TTPB 1NXWA 5THKA 3GYBA 3RUCA 3RASA 3RYHA 4BO9A 1G291 5AKLA 5DO9A 1YJCA 2GKOA 1OHHA 4LWQA 1P0CA 2P2ZA 3R7WB 3C6XA 3ZY2A 4DTNA 3SYKA 4RZUA 1E6CA 1AZSC 1J23A 1FRNA 4GKVA 4JC8A 4CIBA 2B8NA 5EIXA 2B1RA 1MNAA 1W19A 2EX1A 3GRVA 4FYXA 2V7BA 4O0LA 4A3SA 1IVNA 4TMFA 5LA6A 1PJRA 1A9XB 3ZHVA 2NPFA 3PNPA 2OSVA 3NM6B 3RS7A 4CM9D 4X6UA 4MIKA 2O1SA 1NR1A 3GJ0A 1C3EA 1VI2A 1D04A 2Y3IA 4P3XA 3NAGA 2W8BA 3OSUA 1OASA 4UVEA 1XJCA 2IOHA 1C9KA 1L5KA 1ES9A 2ZYAA 3W6OA 3I9MA 1NWHA 2OXCA 2ANBA 3R0JA 4C0KA 1WU8A 2QUIA 1BOOA 1Q9YA 2HREA 2VHUA 3HACA 2SBTA 5CW1A 4YGYA 4IIVA 2EATA 3DEYX 5EMLA 1OXVA 1KDYA 4QUGA 5B58C 4FGJA 1YAJA 1CJMA 1F6WA 1PT8A 3GU3A 3JAMA 4FD2A 2GPBA 1VSVA 2JDIA 1V8BA 1FFHA 1PR9A 2YMMA 2HUNA 4ZVKA 4EHNA 1FDTA 3S2EA 2QR3A 4NAHA 4ZD6A 1Z4PX 1WDTA 3PPYA 3KUUA 2RIRA 2G09A 4WCFA 4XB2A 4HVLA 4G65A 2BM9A 4TV8F 1WWKA 4NMXB 3E7DA 3D6TB 3EZ2A 2WJZB 3KL4A 4ND6A 5B58T 5JY1A 2BFDB 2C0QA 3DOUA 3PFNA 4X6YA 3PXBA 3T5MA 1CF2O 2W6OA 1SHJA 2O5VA 2F1JA 4BX3A 2WSSA 4LTMA 1QTNA 3E9RA 5CTAA 1YJ8A 2PKEA 3H3JA 3VR2D 4DIMA 4DM7A 4HQKA 2XA9A 4ZIRA 2QGZA 2ZT7A 1CS0B 2MOKA 2R66A 2PD4A 4B35A 1B43A 1D0VA 2XUQA 3JQQA 2W70A 3N8DA 4BIMA 4RTSA 2VF4X 3OZUA 2GA8A 4PHTA 3FTNA 3BULA 1U6JA 3PUWA 1R00A 2DULA 2FW8A 1JJFA 3QPDA 4G0OA 3V2UA 1X7YA 1W96A 4JUAA 3OJ0A 4N7RA 3QLTA 1Y9JA 1SUIA 3BS4A 3H1BA 4JIGA 2QTVB 1U31A 5ALLA 1R8JA 1RAEA 4JGIA 2ZUWA 2NPIA 1C7RA 1XZKA 1F12A 1V6SA 1OFTA 3CNHA 3DHEA 3NHSA 4WL0A 2RAVA 2QRPA 4UATA 5IJAA 4DWWA 4Q7QA 4R2WA 5EZ6B 2UUAB 3CU5A 4P3PA 1LB1B 1J1ZA 4IGKA 5ALTA 5K6AA 1BXKA 1G3UA 1Z47A 3HRKA 4KE6A 4PBRA 1EGVB 2BLNA 3QERA 1I3CA 1QG2A 1X7WB 3H5OA 1RJFA 1MT3A 1O94A 3F6CA 1JDVA 3LWZA 4IZIA 2RCYA 3SAJA 4MQMA 2HA0A 4P4LA 4HAXA 4XE5A 3MN1A 4OIFA 3EE6A 1P3DA 2XA1A 4CLDA 2ZVJA 3LA8A 3K70C 2IF2A 1JA0A 2OR3A 3ILVA 2B8WA 4EPHA 2D7DA 4X1IB 3TF5A 2M1ZA 2F3QA 2J41A 3JQ7B 4P36A 2FP3A 4XJVA 5J5AA 4X94A 3TZKA 4EATA 3E2IA 4C21A 4WW0A 2QJFA 2C92A 2O0LA 4RGYA 4Q82A 4OB8A 1KYQA 2HQBA 2X0IA 4GYKA 1Q57A 3JALB 2NU8A 3ZUGA 2JJYA 2PFVA 1DRJA 2ZBQA 1AZLA 4FTWA 1AK1A 4TUYA 4CMIA 1NJFA 1NYLA 2VP3A 3CNLA 3HXPA 1NE2A 4MKIA 4AVYA 5IWCA 1K4KA 2PNFA 5I9NA 3FI0A 3T12A 1F1JA 1WRBA 2REOA 3QEVA 2D1YA 3HA2A 4KL8S 5ADVA 3PGA1 5IFKA 2PMFA 2MSEB 4XPIA 4JLDA 3G23A 1HOXA 3RUIA 5FH9A 4Q37A 2JCBA 3RNOA 4Q05A 4HWRA 1K92A 2OFOA 2IHBA 1UT6A 4M4SA 1XPOA 5AOAA 1GFWA 2MSDB 3QMWA 4CCSA 5JSUA 2XXAB 2WFZA 1OA1A 1P8JA 3QSYA 2F1HA 5DNDA 1HSZA 4Y9SA 3SQXA 2DY1A 1PNVA 1JVBA 3N2KB 5L6MB 4R9VA 5CA1B 3TLGA 1BMFD 4OP1A 1P4SA 5JV5A 3ZC3A 1SEPA 3WGIA 1B16A 1NC1A 3ON5A 1J2TA 3MTIA 1N6KA 1LI7A 2OAP1 4LRYA 4QX6A 3CLTD 3H05A 3HB5X 4AWAA 1EKXA 1KNQA 2YIJA 5I8PA 1ZKMA 3H9UA 1WBBA 3GGJA 3Q72A 3WNCA 3VR4A 4TMXA 5BR8B 2GCIA 3ROQA 3WDSA 1T2AA 1JR3E 4ALNA 3BSWA 1N2ZA 2O19A 1MV8A 4ZT6A 2I7VA 1V5EA 3RTGA 3IE2A 3GRKA 3ED1A 2AYXA 1NONA 4KC0A 1ZOLA 4WACA 3W9YA 4BYMA 5P8WA 2EKPA 4BO2A 1OBFO 4D9FA 1L3CA 5IJ0A 3MINB 2QRJA 1AVTA 1LK0A 3KJZA 4HAUA 4HAWA 1R1DA 1QJ4A 2Q62A 7REQB 3LTNC 1F0YA 4TV9B 3I1FA 2OYQA 1P0PA 1VJ1A 2PRYA 3RU2A 1TB4A 1Y8QA 1DC4A 4FNOA 2F9LA 4ZVOA 4CKBA 3BC1A 1XTSA 1G6OA 4OLAA 1HYBA 2PT6A 3D3JA 2YHIA 3IP8A 2AK3A 4RF3A 4MW6A 5EJ6A 1TMKA 4MOWA 1KBQA 2CDNA 1T1SA 1GAWA 1VSQA 3K5PA 3NEAA 2P6UA 1LI4A 3K0FB 1JAZA 1O9BA 3GRPA 2CFSA 2C9BA 2YR0A 3PICA 2PMKA 2GNPA 3H65A 4LOIA 1Z8NA 3FHOA 4M7OA 1LU9A 2W5UA 1ADYA 3M89A 3EVGA 5ESWA 1RQLA 4W5OA 3IE1A 1TIPA 2AT1A 4OH7A 1U98A 4JLNA 3KWFA 4M9CA 3NGIA 2ETVA 5ESRA 4CKZA 4AMVA 4U8HA 4C0WA 2A2ZA 7MHTA 1XROA 3A0UA 1NV8A 4QATA 1LPAB 2PKXA 1ZX1A 5IX8A 4DV5B 4PC1A 2J3LA 3E03A 2H08A 4JLWA 5IULC 2GPAA 1FBTA 4II3A 5LIRA 4AQDA 5T67A 3H2HA 1A9XA 5KMGB 3ZHTA 4E3WA 2QUKA 4I6GA 3IIMA 4DA0A 1JG6A 2NQ8A 4P6VF 1EFLA 4B3CA 3S68A 2Y76A 4O0MA 3KRTA 4RSHA 1GPLA 2XWJI 1VP3A 1W2GA 1E99A 1CJSA 1C3VA 2X5KO 4Z0HO 2P5TB 1ODJA 1PT9A 3E2PA 3GJRA 2A33A 2I6SA 5LJIA 2OGSA 3QE9Y 4B5LA 1YONA 3C8MA 3OWOA 3VQTA 4IZHA 4MQ5A 4II7A 1Y5MA 2PSFA 2HV9A 3WGOA 3KETA 2VPXA 3E9MA 1LJLA 4HZUB 4MKZA 2RGYA 1SOWA 1KHTA 4BEWA 4GE0A 1I7NA 5FA5A 3TFWA 3HY6A 1FZ2E 3RRZA 2H4JA 4EB8A 4B6QA 5EINA 5IJZA 5TPZA 1Q7EA 3FB1A 3OPNA 4J2DA 3IEKA 4JB8A 2E5WA 2ZUBA 3GFTA 2DWOA 1D03A 2EDCA 1JR3A 3LX4A 5JYBA 4M8LA 5KTSA 4OLJA 1X14A 1JEAA 2NO9A 1H9BA 2H7YA 1J09A 2PHZA 4FUQA 2J1LA 2HDNB 1V4VA 3GLUA 4Z9YA 2YVKA 3G9TA 3BWVA 1VGVA 3RVKA 1J8VA 5MFZA 4BO8A 2BCEA 3LBHA 4UBMA 1XO1A 3TSYA 1UOEA 3O95A 2YXLA 1CS0A 5GGXA 1ADCA 1D1QA 3UGTA 1EX1A 2L82A 5AVQA 1NDQA 2PZAA 1HUQA 4FOPA 1OUMA 5D7BA 1O89A 4GT1A 1XN1A 1NN3A 1NBHA 3KUCA 3N59A 2X4DA 4GMHA 1DJMA 1NR7A 4NMMA 5CEEA 2JVIA 4EBFA 1L5SA 1CPYA 5H16A 2IH4A 2QTVA 4YS6A 2QHXA 3FYCA 4QVIA 5ICFA 2ZWMA 2GRJA 3OEHA 1D1SA 2BEKA 2PUBA 3O3MB 3PGJA 2WWIA 3E9DA 3NB0A 4F5EA 3JQAB 1Y9AA 4DQLA 4M3NA 1FYXA 2R7KA 3WJ7A 2ATXA 2GRAA 3C7TA 3DE6X 1ZUIA 2PV7A 3DOIA 3KX2A 3WYEA 2E1RA 1BVUA 2EWMA 2QP9X 2XF8A 4QPPA 1LBTA 5REQB 3W7BA 2AOTB 1ISPA 1OFHA 4NF2A 3RUDA 3I83A 2F00A 3N5KA 3WRVA 8LDHA 1X7WA 3QEWA 2JFWA 3R5KA 3RBVA 3TLZA 1EP3B 1XQ6A 1V41E 5CGZA 1HV8A 5DGIA 1UBJS 5EFZA 4ITRC 3RRYA 4BL5A 4EW3A 3SQ2A 1Z82A 1C1YA 2HNAA 3F7TA 3KZMA 4ZOBA 5BYBA 1SCDA 1WTAA 3UICA 1M6VB 3ELUA 4QFBA 2F8TA 1R8QA 2D2EA 1X8XA 4ZZ1A 3JYHA 4X1IA 3JQ7A 3D8UA 1IYZA 2R11A 3ENQA 1HMPA 2IKSA 5EHXA 3TQIA 2BKVA 1A1SA 1PNRA 4GWGA 4XIFA 2X0FA 1AS0A 4H4EA 5TX7A 4O59O 4B3MB 2DFKB 3IVGA 4NIMA 2YS6A 3LPCA 4FHZA 3JALA 4W6ZA 5CH5A 1BFDA 2PRSA 2RKHA 1KSGA 3BDVA 5A03A 1QFXA 3LO5A 3V6LA 1P3Y1 1X1AA 1SQGA 3BQ9A 3DOCA 1WNTA 3GGDA 2GTPA 4IINA 3V2HA 1QDLB 1B6GA 2ZRMA 4NHEA 1KZ6A 2EKBA 5E2IA 5HK8A 2BISA 5BT9A 4BQPA 1EJ0A 1U8TA 2CUKA 2FPWA 3M2TA 1B8VA 1OCEA 1XP8A 2VHCA 3KO8A 4EH1A 3GARA 5HOQA 5HSGA 1YGYA 3N6RA 1OB2A 4B4WA 2CMFA 4Q7JB 2QI9F 4DTJA 4NJEB 4MLCA 1XNQB 4XD7D 2XXAA 4IX9A 2BUCA 4GYWA 1XTRA 2QM0A 4AJ1A 5CB8A 3O0DA 5A0FA 4MUYA 4Y3UA 3O4JA 3O1LA 5HCIA 2OYCA 2IXDA 3N2KA 2FSVA 2DCUA 2FUKA 3D4BA 3HV0A 5CA1A 3CM0A 3S8EA 1ZIXA 2EGHA 4RESA 3K7EA 2FPXA 2IWRA 1OV4A 2C1EA 4JEHA 3G68A 2PJUA 4PANA 1AV6A 3P2IA 4ZGWA 1K8QA 2QOEA 5F3WB 2BDTA 1E1YA 1U3TA 5F4BA 4F11A 4MLPA 2WIKA 5C35A 1VHQA 2PUWA 5KYXB 4NCIA 5CIYA 4BUJA 2OWEA 5L7YA 1N2BA 1KR2A 2TSYB 3PLNA 4AMUA 4GLOA 4TKUB 4BX2A 4HCCA 1IBCA 4L9WA 1ZLXA 4F2DA 2HA6A 3M5CA 5L3SB 3EQZA 2Y92A 1YA6A 2NMVA 3QKUA 4U8GA 4Q0MA 3QYPA 4P31A 3ZGNA 1KZ4A 2VYVD 5JDCC 3ZU3A 4E7PA 4QICA 3IJ5A 2ZJ7A 4LRWA 3MINA 4M36A 4ASUD 4G0MA 1GA4A 2CVHA 4QXMA 3S5JA 2B99A 1G42A 3SIXA 7REQA 4L5IA 4TV9A 1AJEA 3ZKWB 2H2HA 5EE3A 1BHQ1 1IIRA 4G1VA 3EFEA 2XIQA 5D1NA 2EJVA 4IHAA 5DYWA 2ERXA 3RFFA 2GEBA 5KHOC 5E8RA 4YUZA 1GCIA 1QK4A 2GMWA 3PRKE 2FG5A 4MCIA 4QYMA 1R8SA 3P9ZA 5T57A 1DWUA 1PUJA 4OXIA 4QEKA 3T4PA 4UMEA 4C0HA 1KEKA 1P1HA 2ZWVA 3K0FA 3L01A 1Q6YA 1M67A 3KOXA 2PS3A 5IC4A 1E3SA 1J56A 1F8GA 2YZ7A 3WYFA 4EPTA 2JI8A 3V5NA 4TTSA 1XVFE 2V65A 5AKGA 1MT0A 1I8TA 1P7PA 2VWQA 1Z4NA 3AWIA 2QLTA 4KR2A 5A2GA 2R48A 3QVVA 1Z4QA 4LHSA 1KO1A 4IXDA 4KPUB 2WJWA 3TQRA 4OLHA 2PMCA 3DBIA 3EXIB 2KE5A 4QUJA 2OAQ1 1N1DA 1YQGA 5LP6B 4QC2A 4DHWA 1EYZA 2HSZA 3D1VA 3TIVA 3K92A 1S3IA 4J3JA 5KMGA 4Z7NB 5FOTA 2ZS9A 5T8KA 3AWDA 5DK4A 2Q7DA 3I61A 1GSHA 4GDMA 5KVCA 3VPHA 4RTNA 2IU0A 1GLGA 6ABPA 3MD9A 1CUEA 4BV8A 1Q6ZA 2QRNA 4PG8A 3W5SA 4HWSA 4BX8A 4P4UA 5JHHB 1VG0B 3VHQA 1GAQA 4LJKA 2H4XA 5DHQA 5DWDA 1HNXB 2VTBB 3DR3A 3AZPA 4IQFA 3RS8A 1WSAA 1VRVA 2Q5EA 4OI4A 1ML4A 5FD8A 4H1TA 1AQ6A 3HCAA 4YHBA 3RG2A 4BFCA 1ZD5A 1VE9A 3FYSA 5HW0A 2M32A 4HZUA 3A28A 2QN7A 2Q6KA 3DLAA 3DUWA 5DMXA 3T34A 4AO8A 3UVEA 2OZPA 2G08A 4YDRA 5B1HA 3U48A 1U1CA 4ZO6A 3K3PA 1C5KA 3DA8A 1DCMA 3FGNA 3PDWA 3VTKA 4XR9A 1MRZA 4DAOA 3PFBA 3AIOA 4PWZA 2WQZA 1Z28A 1L9KA 3KT3A 3SJJA 1PJZA 1RRKA 4JLOA 1B15A 1Y1TA 1HXHA 3W0LB 4AP5A 3RS4A 8ATCA 5JIBA 3A1CA 5DCYA 2MT9A 5JSYA 3UN1A 4GZ5A 3ER9A 4ZVVA 4DLNA 3I2HA 4Z86A 3VYSB 3UUEA 1YO6A 3GUZA 2DPXA 2WJPA 2H52A 3Q7QA 3AHHA 4W9MC 1J25A 3CV3A 2A9PA 3KOYA 2Q5QA 3TM4A 3CKKA 4GYJA 3DO5A 3FGPA 1SQFA 3JVDA 2JIMA 1N3IA 1GT6A 4L22A 1XDUA 2C59A 2VWPA 1ZK1A 3NZEA 3EASA 3P2KA 4ROTA 1Z56C 2JBAB 4L2IB 2C4KA 3F9CA 3PGXA 3YASA 3K35A 5ELMA 4DS3A 1WSWA 4EUSA 3ACCA 2H2DA 3VZQA 3QPCA 4I1RA 2IEIA 1BQ4A 2WG2A 4DGQA 1V4BA 4PIVA 1BGXT 1PQWA 3BWMA 3MJEA 2O2CA 2YC4C 1CY8A 4B45A 3UG6A 1TKCA 1AM4D 1EFUA 3IXQA 3QVKA 4U2CA 4UUNA 5KYYB 3A31A 3AYXB 2Y05A 4TXLA 2FRVA 2JJMA 4P81A 5IAGA 5JCOA 3WKDA 5KNDH 2Z83A 2OM2A 3JQAA 5EP2A 1P1JA 1XKXA 1XHFA 3NHUA 3WP0A 4CCYB 4FGWA 2PZKA 5EMJA 4R84A 5JO9A 4P4TA 2NZXA 5CJJA 1L4GA 3CH4B 2P1QB 3QU5A 4HFJA 4RSGA 5REQA 3TZHA 1HT3A 2AOTA 2FY8A 4RVFA 2DTXA 3KSBC 2JFNA 5ILOA 3EK2A 1E5TA 3D4OA 5M29A 4M60A 1PFUA 2CUZA 1M0SA 3OOSA 4MROA 1FUYB 3FNHA 5EZSA 3KWJA 4G5QA 3FDIA 1I9CA 3B3QA 3A25A 3IOYA 4C9BA 5K8IA 1A72A 1LV7A 1V96A 2H00A 3KJGA 3RRMA 1KRHA 1ZPDA 1CYEA 1RYDA 4EG3A 4LSWA 1KRXA 1ECLA 2VXYA 4GWKA 1II0A 4ZEXA 1F9AA 5PNTA 2FU5C 5JS1A 1REQB 3LLVA 2IHNA 1FZ1E 2AN1A 1X1RA 1NAHA 3AM5A 4IIBA 1RJ9B 4BO7A 4AY6A 2XGGA 1A71A 4R16A 3T7JA 5JCXA 1NKVA 1TYEB 3NHFA 3M6WA 4LV8B 1MAAA 4TMWA 5HKBA 2GAJA 4IFIA 1U11A 2FEWB 3F97A 4H4DA 2FWAA 4RE5A 5EIFA 2H48A 1V25A 2I3AA 4A8JB 2KM1A 2J0QA 1KIMA 3C7AA 5FTKA 2GESA 1BXZA 4HX9A 3MCAA 4ZMSA 4EOGA 2ONKA 4Y2HA 5D7NA 3HJGA 1JR4A 4D1YA 4BB9A 2ZSIA 4NJEA 1OF1A 3W5IA 1K9SA 3L8CA 2RHHA 3DVQX 5IMBA 3CF2A 3RBAA 1PD0A 5BQOA 3BBPA 3O3CA 1J2YA 5C1DA 2GPJA 4RZHA 4D4MA 2GWRA 5IUJC 1Z0FA 2V7EA 1QVWA 4P80A 1NNEA 2OCIA 1BWQA 3EVNA 1W4AA 2HJWA 3IQFA 1R8XA 1RHKA 1JI0A 2EHJA 3I23A 2WJGA 5C5CA 2Q5IA 3A6GA 2OXTA 4NEHB 5B2FA 4UTXA 5BT8A 5KJFA 1A5BB 2P75A 2Q41A 5EZYB 3EGDB 3C3BA 3L4BA 1NSFA 2FUNB 3AR2A 3OETA 2DBQA 3ZEAA 1S9HA 1UWLA 1TE2A 3AVXA 1SVWA 5KYXA 1OTYA 4YY3B 3DF7A 4RXTA 1P2BA 2BUBA 5CDUA 3OIFA 2RKBA 4JMLA 2GBLC 4TKUA 4HQLA 3R7SA 5FDFA 3ZOKA 3JQFA 4G56A 1FVOA 5JNTA 5L3SA 3EIWA 3AUTA 3JY6A 1FP4B 4XVQA 4I8DA 2DPGA 5H9VA 5IREA 3FHJA 4Y1RB 4RIFA 5H8WA 1ID1A 1SXHA 3WLHA 1BVHA 1C1DB 4UVHA 2P2CA 4GOXA 5DXJA 1G2QA 4YWHA 1DT3A 3OICA 5I3CA 4Y2XA 3CC8A 2RGEA 3CZPA 3ZKWA 3U16A 4YRTA 4L9RA 2A30A 3HA3A 4RHCA 1EUZA 1GLVA 2AN5A 3AKYA 2R87A 3AZQA 3EZYA 3NJ8A 4ND7A 3W1WA 1JDSA 4C0BA 4C0AC 3OUTA 2UKDA 1YK0A 4UEKA 1AIPA 4QXAA 2B1EA 4YUYA 4RULA 4PR0A 3DL0A 1AQIA 1ZN7A 4BN4A 1PD1A 3C3PA 1W49A 4PNPA 2WHEA 3FNGA 3OSZA 4UDXX 2QZ9A 4ZZIA 4M1ZA 4MJXA 5BNWA 4RTJA 5EXXA 2P9CA 3FNRA 1TW2A 4W8OA 3ZDZB 4A4DA 1FMFA 2CDCA 3D7SA 2GK4A 1PW7A 3NBQA 3BE5A 4OHPA 1ZW6A 2RB5A 3PE6A 4Z7OB 4IS3A 4INZA 4M7WA 4KI4A 2KI5A 3FMPB 2YOGA 1L7MA 3GLIB 2P4UA 3H04A 3G8BA 4KPUA 4P0QB 5C18A 3P0FA 1TAQA 4LDAA 4NHOA 3EXIA 5KU7A 5LP6A 5TS3A 2WJVA 4WBSA 4EYSA 3QOFA 4R2KA 4IDDA 1ENPA 4ZDWA 3Q98A 3KXKA 3OZSA 4RJLA 1T4MA 4GNKA 2UYCA 2QV0A 3ER8A 2R6JA 2WAXA 1MA0A 3I1IA 2J6IA 4OFXA 5JS6A 5BR4A 3EDYA 2X4IA 1Y1QA 3ZWCA 3KQTA 4PQFA 1X2BA 1XCBA 2P6PA 1X1BA 1C4OA 3NC1C 5E8JA 4MV5A 1N92A 2GJSA 3ADKA 3IAAA 1NPDA 4KN9S 5A4AA 2BHSA 3A3OA 3S1AA 1KR5A 1VKZA 2F1OA 2QJWA 5C1BA 4CNBA 3KYDB 2VTBA 5DI9A 4LDNA 4XAQA 3PQ2A 2QU7A 3RUEA 4HYTA 1XZFA 4XZ3A 2QX9A 1JEDA 4X9XA 1XJWA 3VSEA 1IWBB 4B7ZA 4TTAA 3I4FA 1YD7A 5A6VA 3HO1A 5L3RA 4C0LA 3EN0A 4MPTA 4YJDA 1NVWQ 1ZU4A 3S44A 1W4ZA 4AECA 1T9GR 2FUEA 2BHTA 5IC6A 2CUTA 3UCXA 4KXQA 4RTQA 1TYBE 2IXTA 4YV2A 1I4TD 1UK6A 1EI9A 2OV2A 4KHPB 3MGCA 3TQSA 1BS9A 4PLZA 5DCLA 4BP9A 4WJLA 3GAFA 1PGNA 4CM1A 1ZN9A 5ALSA 5LXTF 1O6ZA 2GZ1A 1IJFA 4WZZA 3RWUA 1MXHA 1IB0A 2FFQA 1CY2A 2Y67A 2JVJA 3LW8A 3OH8A 4P35A 4QRIA 2C9ZA 4H3KB 4OTZA 4Q9AA 2OFWA 3ZVRA 2XGJA 1CETA 3C97A 1QHSA 2Q6LA 1PV4A 1RW4A 3CX3A 4JP1A 2FW6A 3DE1X 1G9TA 1Q83A 1DCTA 2JPNA 2QRKA 2OSBA 4XTCS 3EIEA 1SQ0A 2VP5A 4JLSA 4QNNA 4X41A 4JRPA 2Q07A 5C34B 2JANA 3EXHB 4A1FA 4C30A 3MJFA 4X60A 2JBAA 1WZIA 2M2IA 1L4BA 4OLBA 2WTBA 5HXAA 4DZRA 1BAPA 4B4KA 2G88A 3HO8A 5BW4A 1ARZA 1W88B 1YR1A 2P5YA 2UUPA 1IOVA 2IS1A 4UASA 4G8DA 1DZIA 3LL7A 1XR3A 4GKBA 5KYYA 2XHZA 3JPYA 1FUEA 3U13A 1KYZA 4NH4A 1XEWX 4L8GA 1KQPA 2XDYA 2YBDA 2ZIGA 5DX0A 4CCYA 1ZNQO 5CIWA 3CWZA 3OIGA 4K6OA 2QZPA 1ZD4A 1F4VA 1DWOA 1KZ9A 2GX6A 3CX6A 3IQIX 4W99A 3QA3E 2W6CX 5I01A 2BD0A 2ORED 5CFZA 1T5HX 121PA 3FCEA 3H19A 4RO0A 3I30X 4D8YA 4BIIA 3VU1A 4IYJA 4HTFB 1JH8A 5E9JA 3SZ3A 1OT3A 3N7UA 1DEXA 2Q7XA 1XVCE 5C0OE 2JAWA 4O3MA 4BBAA 2GBIA 5JAZA 6YASA 3NTRA 4C0JA 3BK1A 4GC5A 3T4UA 1CG6A 3VPFA 4KQ1A 1IJKA 1L7RA 1K27A 2ON6A 1NURA 3MTJA 4DJJA 5A2QA 1YQWA 5J4YA 2FI1A 1U80A 5G53C 5TQ0B 1REQA 2GPTA 3BXXA 4JN6B 1RZRA 2Q7OE 3GLIE 1OI2A 1PDVA 2R7NA 5DBGA 3S2UA 3CR8A 2YV2A 5ECWA 4CG2A 3THYB 2VPIA 1RJ9A 3DM9B 4E94A 3L82B 1W7AA 3FYUB 4BQRA 4EBBA 4Z0TA 3CQ8A 2VNJA 5G0WA 5JDIA 1U0NA 1KO7A 1FE8A 1JB1A 2IX9A 4PPNA 5EXPA 1DKMA 4Q1CA 4MQLA 1E1RA 4A8JA 2G82A 4L57A 4AY4A 3MLEA 4MVJH 4I7EA 5D6OA 2QQEA 1E2IA 4LOLA 3NC4A 1MVOA 3C8UA 4EJSC 4IXWA 3KXPA 3U9TA 4MVJG 3WK7A 3ZY6A 1VKNA 2GFHA 1MX9A 4HLDA 3OG9A 1MFPA 2LR0A 3G3EA 1H65A 4IS2A 1AQNA 1LTQA 3KKMA 2JS7A 4DPMA 2IOFA 4YXWD 3B2QA 2I80A 1B26A 2WU4A 3IHWA 5JU6A 4J6FA 2JH8A 4YXFA 3FA2A 4RD4A 2IYAA 3PNBA 2ZANA 1U8XX 2CLKB 2EIHA 5BNFA 3ESXA 3GUYA 3HCWA 3SI6A 4BXOA 3KB1A 1MENA 2O0HA 1L8OA 4K1LA 4TS1A 4F56A 3KLBA 3DPUA 4LPSA 5EZYA 3EGDA 2XJ4A 4KVZA 4OOEA 5HF6A 1W25A 3HFRA 4TXHA 3R20A 3S5UA 5D84A 1ZIOA 3DFKA 5BUSA 4DMGA 2R751 1BDBA 1I24A 4LEIA 4I3GA 3P52A 2HK8A 3LIIA 1QYCA 3EXHC 2P91A 3C1OA 1FP4A 4TWRA 4J7CA 1D2HA 4JQSA 1CDDA 1O57A 2D3WA 2IPAB 2IZ6A 2YX1A 1GP2A 3LWNA 5SY9A 2W2LA 3R9XA 1J90A 3IRVA 3PRHA 4Y1RA 3TRJA 3FPKA 1R0LA 1VLHA 4OI0A 1C1DA 1PQ4A 4JUFA 3W1VA 2HMUA 4ZPXA 3WKCA 1QR2A 5AQ1A 3QVOA 1Q1AA 3DT6A 3FZGA 1WXIA 1NBEA 1PYOA 3E61A 3TSAA 1FPMA 3D6NB 4BNIA 1PBNA 5L3QB 1KPIA 3IDZA 1JPNA 4Q4AB 4UAVA 2QZSA 1L2TA 4E5VA 1YZQA 2BM8A 4G9BA 1R88A 5GTDA 4I0WB 5JC1A 3DE3X 1PCXA 3LECA 4IOMA 4PC7A 5TPWA 4ZGBA 4R0NA 4R1OA 3DOFA 4DR2B 3DULA 3OE7A 3OT4A 3DHWC 5DGXA 2XDAA 2G06A 2MINB 2XE4A 3V1LA 3T5GA 3K9FC 1LS1A 3RWBA 3DC2A 1YB5A 2OBXA 4FR2A 4M87A 1H4VB 2GNOA 4MW2A 1JR6A 3CA8A 4HDNB 5KYUB 1OPRA 4RNCA 4JK3A 1PNQA 2JFVA 3FWYA 5IK2D 4JKYA 5K0LA 5DE3A 5DHAA 5COAA 1N34B 3COSA 4XJTA 1RXCA 4JLJA 4D74A 1RXEA 2V45A 2XNHA 5K05A 5DIFA 3GLIA