1XMFE

Structure of mn(ii)-soaked apo methane monooxygenase hydroxylase crystals from m. capsulatus (bath)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Preparation and X-ray Structures of Metal-Free, Dicobalt and Dimanganese Forms of Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath)
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmfE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmfE02
1MMOG 1XVBE 1FZHE 1FZ4E 1XVGE 1FZ7E 1XMFE 1MHZG 1XVFE 1FZ9E 1FZ6E 1FZ0E 1XMGE 1MHYG 1MTYG 1XVDE 1XVCE 1FZ8E 1FZ3E 1XU5E 1XVEE 1FZ1E 1FZIE 1XU3E 1FYZE 1XMHE 4GAMC 1FZ5E 1FZ2E
chains in the Genus database with same CATH superfamily
2P1QB 1FS1A 3TJYA 4QNCA 2OVQB 2P1PB 4M3YA 4ADNA 3L1NA 4FJKA 1MHZG 4KHUA 2JHAA 2B7MA 1FZ6E 4RL5A 2OZMA 2PFVA 1XMGE 2DTUA 4AKGA 4J2AA 3QEXA 4B08A 4X5NA 3KD5E 3SJJA 1FZ3E 1XU5E 3SQ1A 2H4TA 3OGKB 3CQ8A 4DTSA 4AKHA 3TAEA 1FZIE 1XMHE 3NHGA 3QEVA 3BVOA 4EYWA 4DTOA 4E4BA 4KI4A 4FK4A 2E31A 1FZ2E 3UO2A 4EPHA 4FJLA 4M3UA 4JS4A 3C94A 3LZJA 3E4WA 1MMOG 4ICGC 3L2OB 3SCXA 4DTJA 1Q9YA 3SPZA 1XVFE 4EP9A 1FZ9E 3MKSB 3KD1E 4FK2A 1XL3C 3SUNA 4FJGA 4KHNA 1LDKE 2QXFA 5IBKB 3C6PB 3HP9A 3K2OA 1Q9XA 3QEWA 3S9HA 2OZSA 4J2EA 1JW2A 3CFOA 3UO3A 4DTXA 1XVDE 3N1EA 3QERA 3RMCA 3QEPA 4I9QA 4M45A 4DU3A 1XVEE 4FJHA 4KI6A 3LD8A 3L0MA 1IH7A 4M3TA 3NCIA 4GAMC 3HL8A 3E4YA 5IREA 3V7DB 1FZ5E 2RCUA 3OGLB 5H37A 4M41A 3SUQA 2DY4A 2HD0A 3WSOA 3NAEA 2MMBA 3NE6A 3N1BA 3L8BA 3TAGA 3RMDA 4DTRA 3QNOA 2LF6A 1XVBE 1FZHE 3QNNA 2RKHA 3HGKE 4J2BA 1XVGE 2B1EA 4FJ9A 1FZ7E 4JRPA 1XMFE 2ATQA 4QNDA 3NGIA 3SQ0A 3OGMB 2PFTA 4FK0A 4I6JB 3TABA 4HCCA 1FXXA 2JQTA 3J27A 1FPOA 1MHYG 3SQ2A 4FJMA 2FW3A 2YB5A 1MTYG 4FVMA 1WAJA 3QESA 3HGLA 1N1CA 2P1OB 5IZ7A 1XVCE 1FZ8E 3SUOA 2DEBA 2P1NB 4JRQA 3LDBA 4KHWA 4DU4A 3QETA 2E32A 4DTNA 2JH8A 1FYZE 2OVRB 3C95A 3UIQA 2K5SA 2OVPB 4RNGA 4FJJA 4M3RA 4KHSA 3RMAA 3SNNA 1NEXB 3TL8B 3SQ4A 3SUPA 3C6OB 3RMBA 4FJ8A 4I9LA 3CFRA 4J2DA 1FZ4E 4KHQA 4M3WA 3LZIA 4FJ5A 2B8IA 2P1MB 4M3ZA 4AKIA 2OYQA 4DTMA 3NDKA 1FZ0E 2JPNA 3QEIA 4FJNA 1P22A 2JH9A 4DTUA 2P5GA 4DTPA 2MW2A 3J2PA 2FYOA 3SVIA 4JS5A 4FJXA 2JHPA 3SPYA 2VJ4A 3C6NB 4E3SA 4KHYA 2VIXA 4ADOA 1IG9A 2LF3A 1FZ1E 4AI6A 1XU3E 3TAFA 4FJIA 4M42A 4DU1A 4M3XA 4X5MA 3RWUA 3LDSA 2P5OA 4FJ7A 2MZWB 4HCBA 1WAFA 4RG8A 3CFPA 3SI6A 1CLQA 4IT5A 2VJ5A 2JHCA
chains in the Genus database with same CATH topology
2P1QB 1FS1A 3TJYA 4QNCA 2OVQB 2P1PB 4M3YA 4ADNA 3L1NA 4FJKA 1MHZG 4KHUA 2JHAA 2B7MA 1FZ6E 4RL5A 2OZMA 2PFVA 1XMGE 2DTUA 4AKGA 4J2AA 3QEXA 4B08A 4X5NA 3KD5E 3SJJA 1FZ3E 1XU5E 3SQ1A 2H4TA 3OGKB 3CQ8A 4DTSA 4AKHA 3TAEA 1FZIE 1XMHE 3NHGA 3QEVA 4EYWA 4DTOA 4E4BA 4KI4A 4FK4A 2E31A 1FZ2E 4EPHA 4FJLA 4M3UA 4JS4A 3C94A 3LZJA 3E4WA 1MMOG 3L2OB 3SCXA 4DTJA 1Q9YA 3SPZA 1XVFE 4EP9A 1FZ9E 3MKSB 3KD1E 4FK2A 1XL3C 3SUNA 4FJGA 4KHNA 1LDKE 2QXFA 5IBKB 3C6PB 3HP9A 3K2OA 1Q9XA 3QEWA 3S9HA 2OZSA 4J2EA 3CFOA 4DTXA 1XVDE 3N1EA 3QERA 3RMCA 3QEPA 4I9QA 4M45A 4DU3A 1XVEE 4FJHA 4KI6A 3LD8A 3L0MA 1IH7A 4M3TA 3NCIA 4GAMC 3HL8A 3E4YA 5IREA 3V7DB 1FZ5E 2RCUA 3OGLB 5H37A 4M41A 3SUQA 2DY4A 2HD0A 3WSOA 3NAEA 2MMBA 3NE6A 3N1BA 3L8BA 3TAGA 3RMDA 4DTRA 3QNOA 2LF6A 1XVBE 1FZHE 3QNNA 3HGKE 4J2BA 1XVGE 2B1EA 4FJ9A 1FZ7E 4JRPA 1XMFE 2ATQA 4QNDA 3NGIA 3SQ0A 3OGMB 2PFTA 4FK0A 4I6JB 3TABA 4HCCA 1FXXA 3J27A 1MHYG 3SQ2A 4FJMA 2FW3A 2YB5A 1MTYG 4FVMA 1WAJA 3QESA 3HGLA 2P1OB 5IZ7A 1XVCE 1FZ8E 3SUOA 2DEBA 2P1NB 4JRQA 3LDBA 4KHWA 4DU4A 3QETA 2E32A 4DTNA 2JH8A 1FYZE 2OVRB 3C95A 3UIQA 2OVPB 4RNGA 4FJJA 4M3RA 4KHSA 3RMAA 3SNNA 1NEXB 3TL8B 3SQ4A 3SUPA 3C6OB 3RMBA 4FJ8A 4I9LA 3CFRA 4J2DA 1FZ4E 4KHQA 4M3WA 3LZIA 4FJ5A 2B8IA 2P1MB 4M3ZA 4AKIA 2OYQA 4DTMA 3NDKA 1FZ0E 2JPNA 3QEIA 4FJNA 1P22A 2JH9A 4DTUA 2P5GA 4DTPA 3J2PA 2FYOA 3SVIA 4JS5A 4FJXA 2JHPA 3SPYA 2VJ4A 3C6NB 4E3SA 4KHYA 2VIXA 4ADOA 1IG9A 2LF3A 1FZ1E 4AI6A 1XU3E 3TAFA 4FJIA 4M42A 4DU1A 4M3XA 4X5MA 3RWUA 3LDSA 2P5OA 4FJ7A 2MZWB 4HCBA 1WAFA 4RG8A 3CFPA 3SI6A 1CLQA 2VJ5A 2JHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMO G;  1XVB E;  1FZH E;  1FZ4 E;  1XVG E;  1FZ7 E;  1XMF E;  1MHZ G;  1XVF E;  1FZ9 E;  1FZ6 E;  1FZ0 E;  1XMG E;  1MHY G;  1MTY G;  1XVD E;  1XVC E;  1FZ8 E;  1FZ3 E;  1XU5 E;  1XVE E;  1FZ1 E;  1FZI E;  1XU3 E;  1FYZ E;  1XMH E;  4GAM C;  1FZ5 E;  1FZ2 E; 
#chains in the Genus database with same CATH topology
 2P1Q B;  1FS1 A;  3TJY A;  4QNC A;  2OVQ B;  2P1P B;  4M3Y A;  4ADN A;  3L1N A;  4FJK A;  1MHZ G;  4KHU A;  2JHA A;  2B7M A;  1FZ6 E;  4RL5 A;  2OZM A;  2PFV A;  1XMG E;  2DTU A;  4AKG A;  4J2A A;  3QEX A;  4B08 A;  4X5N A;  3KD5 E;  3SJJ A;  1FZ3 E;  1XU5 E;  3SQ1 A;  2H4T A;  3OGK B;  3CQ8 A;  4DTS A;  4AKH A;  3TAE A;  1FZI E;  1XMH E;  3NHG A;  3QEV A;  3BVO A;  4EYW A;  4DTO A;  4E4B A;  4KI4 A;  4FK4 A;  2E31 A;  1FZ2 E;  3UO2 A;  4EPH A;  4FJL A;  4M3U A;  4JS4 A;  3C94 A;  3LZJ A;  3E4W A;  1MMO G;  4ICG C;  3L2O B;  3SCX A;  4DTJ A;  1Q9Y A;  3SPZ A;  1XVF E;  4EP9 A;  1FZ9 E;  3MKS B;  3KD1 E;  4FK2 A;  1XL3 C;  3SUN A;  4FJG A;  4KHN A;  1LDK E;  2QXF A;  5IBK B;  3C6P B;  3HP9 A;  3K2O A;  1Q9X A;  3QEW A;  3S9H A;  2OZS A;  4J2E A;  1JW2 A;  3CFO A;  3UO3 A;  4DTX A;  1XVD E;  3N1E A;  3QER A;  3RMC A;  3QEP A;  4I9Q A;  4M45 A;  4DU3 A;  1XVE E;  4FJH A;  4KI6 A;  3LD8 A;  3L0M A;  1IH7 A;  4M3T A;  3NCI A;  4GAM C;  3HL8 A;  3E4Y A;  5IRE A;  3V7D B;  1FZ5 E;  2RCU A;  3OGL B;  5H37 A;  4M41 A;  3SUQ A;  2DY4 A;  2HD0 A;  3WSO A;  3NAE A;  2MMB A;  3NE6 A;  3N1B A;  3L8B A;  3TAG A;  3RMD A;  4DTR A;  3QNO A;  2LF6 A;  1XVB E;  1FZH E;  3QNN A;  2RKH A;  3HGK E;  4J2B A;  1XVG E;  2B1E A;  4FJ9 A;  1FZ7 E;  4JRP A;  1XMF E;  2ATQ A;  4QND A;  3NGI A;  3SQ0 A;  3OGM B;  2PFT A;  4FK0 A;  4I6J B;  3TAB A;  4HCC A;  1FXX A;  2JQT A;  3J27 A;  1FPO A;  1MHY G;  3SQ2 A;  4FJM A;  2FW3 A;  2YB5 A;  1MTY G;  4FVM A;  1WAJ A;  3QES A;  3HGL A;  1N1C A;  2P1O B;  5IZ7 A;  1XVC E;  1FZ8 E;  3SUO A;  2DEB A;  2P1N B;  4JRQ A;  3LDB A;  4KHW A;  4DU4 A;  3QET A;  2E32 A;  4DTN A;  2JH8 A;  1FYZ E;  2OVR B;  3C95 A;  3UIQ A;  2K5S A;  2OVP B;  4RNG A;  4FJJ A;  4M3R A;  4KHS A;  3RMA A;  3SNN A;  1NEX B;  3TL8 B;  3SQ4 A;  3SUP A;  3C6O B;  3RMB A;  4FJ8 A;  4I9L A;  3CFR A;  4J2D A;  1FZ4 E;  4KHQ A;  4M3W A;  3LZI A;  4FJ5 A;  2B8I A;  2P1M B;  4M3Z A;  4AKI A;  2OYQ A;  4DTM A;  3NDK A;  1FZ0 E;  2JPN A;  3QEI A;  4FJN A;  1P22 A;  2JH9 A;  4DTU A;  2P5G A;  4DTP A;  2MW2 A;  3J2P A;  2FYO A;  3SVI A;  4JS5 A;  4FJX A;  2JHP A;  3SPY A;  2VJ4 A;  3C6N B;  4E3S A;  4KHY A;  2VIX A;  4ADO A;  1IG9 A;  2LF3 A;  1FZ1 E;  4AI6 A;  1XU3 E;  3TAF A;  4FJI A;  4M42 A;  4DU1 A;  4M3X A;  4X5M A;  3RWU A;  3LDS A;  2P5O A;  4FJ7 A;  2MZW B;  4HCB A;  1WAF A;  4RG8 A;  3CFP A;  3SI6 A;  1CLQ A;  4IT5 A;  2VJ5 A;  2JHC A; 
#chains in the Genus database with same CATH homology
 2P1Q B;  1FS1 A;  3TJY A;  4QNC A;  2OVQ B;  2P1P B;  4M3Y A;  4ADN A;  3L1N A;  4FJK A;  1MHZ G;  4KHU A;  2JHA A;  2B7M A;  1FZ6 E;  4RL5 A;  2OZM A;  2PFV A;  1XMG E;  2DTU A;  4AKG A;  4J2A A;  3QEX A;  4B08 A;  4X5N A;  3KD5 E;  3SJJ A;  1FZ3 E;  1XU5 E;  3SQ1 A;  2H4T A;  3OGK B;  3CQ8 A;  4DTS A;  4AKH A;  3TAE A;  1FZI E;  1XMH E;  3NHG A;  3QEV A;  4EYW A;  4DTO A;  4E4B A;  4KI4 A;  4FK4 A;  2E31 A;  1FZ2 E;  4EPH A;  4FJL A;  4M3U A;  4JS4 A;  3C94 A;  3LZJ A;  3E4W A;  1MMO G;  3L2O B;  3SCX A;  4DTJ A;  1Q9Y A;  3SPZ A;  1XVF E;  4EP9 A;  1FZ9 E;  3MKS B;  3KD1 E;  4FK2 A;  1XL3 C;  3SUN A;  4FJG A;  4KHN A;  1LDK E;  2QXF A;  5IBK B;  3C6P B;  3HP9 A;  3K2O A;  1Q9X A;  3QEW A;  3S9H A;  2OZS A;  4J2E A;  3CFO A;  4DTX A;  1XVD E;  3N1E A;  3QER A;  3RMC A;  3QEP A;  4I9Q A;  4M45 A;  4DU3 A;  1XVE E;  4FJH A;  4KI6 A;  3LD8 A;  3L0M A;  1IH7 A;  4M3T A;  3NCI A;  4GAM C;  3HL8 A;  3E4Y A;  5IRE A;  3V7D B;  1FZ5 E;  2RCU A;  3OGL B;  5H37 A;  4M41 A;  3SUQ A;  2DY4 A;  2HD0 A;  3WSO A;  3NAE A;  2MMB A;  3NE6 A;  3N1B A;  3L8B A;  3TAG A;  3RMD A;  4DTR A;  3QNO A;  2LF6 A;  1XVB E;  1FZH E;  3QNN A;  3HGK E;  4J2B A;  1XVG E;  2B1E A;  4FJ9 A;  1FZ7 E;  4JRP A;  1XMF E;  2ATQ A;  4QND A;  3NGI A;  3SQ0 A;  3OGM B;  2PFT A;  4FK0 A;  4I6J B;  3TAB A;  4HCC A;  1FXX A;  3J27 A;  1MHY G;  3SQ2 A;  4FJM A;  2FW3 A;  2YB5 A;  1MTY G;  4FVM A;  1WAJ A;  3QES A;  3HGL A;  2P1O B;  5IZ7 A;  1XVC E;  1FZ8 E;  3SUO A;  2DEB A;  2P1N B;  4JRQ A;  3LDB A;  4KHW A;  4DU4 A;  3QET A;  2E32 A;  4DTN A;  2JH8 A;  1FYZ E;  2OVR B;  3C95 A;  3UIQ A;  2OVP B;  4RNG A;  4FJJ A;  4M3R A;  4KHS A;  3RMA A;  3SNN A;  1NEX B;  3TL8 B;  3SQ4 A;  3SUP A;  3C6O B;  3RMB A;  4FJ8 A;  4I9L A;  3CFR A;  4J2D A;  1FZ4 E;  4KHQ A;  4M3W A;  3LZI A;  4FJ5 A;  2B8I A;  2P1M B;  4M3Z A;  4AKI A;  2OYQ A;  4DTM A;  3NDK A;  1FZ0 E;  2JPN A;  3QEI A;  4FJN A;  1P22 A;  2JH9 A;  4DTU A;  2P5G A;  4DTP A;  3J2P A;  2FYO A;  3SVI A;  4JS5 A;  4FJX A;  2JHP A;  3SPY A;  2VJ4 A;  3C6N B;  4E3S A;  4KHY A;  2VIX A;  4ADO A;  1IG9 A;  2LF3 A;  1FZ1 E;  4AI6 A;  1XU3 E;  3TAF A;  4FJI A;  4M42 A;  4DU1 A;  4M3X A;  4X5M A;  3RWU A;  3LDS A;  2P5O A;  4FJ7 A;  2MZW B;  4HCB A;  1WAF A;  4RG8 A;  3CFP A;  3SI6 A;  1CLQ A;  2VJ5 A;  2JHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...