1XMFE

Structure of mn(ii)-soaked apo methane monooxygenase hydroxylase crystals from m. capsulatus (bath)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Preparation and X-ray Structures of Metal-Free, Dicobalt and Dimanganese Forms of Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath)
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmfE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmfE02
1MHZG 1FZ8E 1FZ6E 1XVDE 1XVFE 1FZHE 1FZ9E 1FZ3E 1XVCE 1FZ5E 1FZIE 1MHYG 1FZ2E 1FYZE 1FZ4E 4GAMC 1XVBE 1FZ7E 1MTYG 1XU3E 1XMHE 1FZ1E 1XMGE 1MMOG 1XU5E 1XVGE 1XVEE 1XMFE 1FZ0E
chains in the Genus database with same CATH superfamily
4KI6A 3SUQA 2LF3A 3V7DB 5IREA 3QEPA 3NCIA 1XVFE 3C6OB 3KD1E 1IH7A 4FJXA 4FK2A 1FZ9E 4DTJA 4KHWA 3L1NA 4FK0A 2RKHA 4DU3A 1FZIE 4FJMA 1FZ2E 2OVQB 3QEIA 4KHQA 3CFOA 2OVPB 2P5OA 2JHCA 2P5GA 4J2AA 2LF6A 3RWUA 4AKGA 2MZWB 3RMBA 4X5NA 1FZ7E 3NDKA 1MTYG 4FVMA 4ADOA 3LZJA 3SUPA 3NAEA 1IG9A 4M3TA 4FJNA 1WAJA 3E4WA 3SQ4A 4HCCA 3SUNA 3TAGA 4M41A 4I9QA 4FJIA 1P22A 2B1EA 4JS5A 4DTRA 3LDSA 2OZMA 3UO2A 1XVEE 3QNOA 4KHNA 3QNNA 3HP9A 2P1NB 3LZIA 1Q9XA 4FJJA 2DY4A 3QEVA 1MHZG 2FW3A 1WAFA 4FJKA 4FJGA 1XVDE 4ICGC 2H4TA 3S9HA 3SQ0A 1FZ3E 2VIXA 2K5SA 4KHSA 2PFTA 1FYZE 3LD8A 4AKHA 2ATQA 4M3WA 3HGKE 4KHUA 4RNGA 3CFRA 1FPOA 2MMBA 4GAMC 3QEXA 1XVBE 5IZ7A 4M3ZA 4DTOA 3SPYA 3C94A 3C6PB 2JHPA 4FJ5A 1Q9YA 1CLQA 3OGMB 2P1OB 3SVIA 4DTXA 1XMHE 4FJ8A 1MMOG 2E32A 4IT5A 2B8IA 2JH8A 1XL3C 4M45A 4FJ7A 3MKSB 4I9LA 4EYWA 1XMFE 1FZ0E 3CFPA 3QERA 4JRQA 4DTUA 1FZ8E 3E4YA 4J2DA 2YB5A 4ADNA 4DTSA 3QESA 2DTUA 4AKIA 4J2EA 5H37A 2MW2A 3RMCA 3RMDA 4RG8A 4EPHA 1FS1A 3NHGA 3QEWA 2JPNA 4I6JB 3J2PA 4DU1A 4HCBA 3C95A 1MHYG 2RCUA 3NE6A 4DU4A 4E3SA 4AI6A 3OGLB 4B08A 3TAEA 3J27A 1FZ4E 4M3UA 4M3YA 1FXXA 2OYQA 2VJ4A 3L0MA 3OGKB 3UIQA 4KI4A 2B7MA 3TAFA 4FJ9A 3WSOA 3SNNA 3KD5E 1FZ1E 4M42A 1XMGE 4EP9A 3NGIA 4KHYA 2VJ5A 2E31A 2DEBA 2QXFA 4FJHA 3K2OA 1XU5E 4J2BA 2JQTA 1XVGE 3SQ1A 4M3XA 2P1QB 3HL8A 3SI6A 5IBKB 3L8BA 1FZ6E 4E4BA 3SPZA 4DTNA 3C6NB 1FZHE 4JS4A 4FK4A 3SJJA 1XVCE 4FJLA 1LDKE 3RMAA 1FZ5E 3BVOA 2P1MB 3TJYA 2JH9A 3L2OB 3N1EA 4RL5A 4M3RA 3TABA 1JW2A 3TL8B 3QETA 3SUOA 2PFVA 4QNDA 3HGLA 3LDBA 1XU3E 2HD0A 1N1CA 4DTMA 3N1BA 2FYOA 2JHAA 4QNCA 4DTPA 3SQ2A 1NEXB 3CQ8A 3SCXA 4X5MA 2OVRB 2OZSA 3UO3A 4JRPA 2P1PB
chains in the Genus database with same CATH topology
4KI6A 3SUQA 2LF3A 3V7DB 5IREA 3QEPA 3NCIA 1XVFE 3C6OB 3KD1E 1IH7A 4FJXA 4FK2A 1FZ9E 4DTJA 4KHWA 3L1NA 4FK0A 4DU3A 1FZIE 4FJMA 1FZ2E 2OVQB 3QEIA 4KHQA 3CFOA 2OVPB 2P5OA 2JHCA 2P5GA 4J2AA 2LF6A 3RWUA 4AKGA 2MZWB 3RMBA 4X5NA 1FZ7E 3NDKA 1MTYG 4FVMA 4ADOA 3LZJA 3SUPA 3NAEA 1IG9A 4M3TA 4FJNA 1WAJA 3E4WA 3SQ4A 4HCCA 3SUNA 3TAGA 4M41A 4I9QA 4FJIA 1P22A 2B1EA 4JS5A 4DTRA 3LDSA 2OZMA 3QNOA 1XVEE 4KHNA 3QNNA 3HP9A 2P1NB 3LZIA 1Q9XA 4FJJA 2DY4A 3QEVA 1MHZG 2FW3A 1WAFA 4FJKA 4FJGA 1XVDE 3S9HA 2H4TA 3SQ0A 1FZ3E 2VIXA 4KHSA 2PFTA 1FYZE 3LD8A 4AKHA 2ATQA 4M3WA 3HGKE 4KHUA 4RNGA 3CFRA 3QEXA 2MMBA 4GAMC 1XVBE 5IZ7A 4M3ZA 4DTOA 3SPYA 3C94A 3C6PB 2JHPA 4FJ5A 1Q9YA 1CLQA 3OGMB 2P1OB 3SVIA 4DTXA 1XMHE 4FJ8A 1MMOG 2E32A 2B8IA 2JH8A 1XL3C 4M45A 4FJ7A 3MKSB 4I9LA 4EYWA 1XMFE 1FZ0E 3CFPA 3QERA 4JRQA 4DTUA 1FZ8E 3E4YA 4J2DA 2YB5A 4ADNA 4DTSA 3QESA 2DTUA 4AKIA 4J2EA 5H37A 3RMCA 3RMDA 4RG8A 4EPHA 1FS1A 3NHGA 3QEWA 2JPNA 4I6JB 3J2PA 4DU1A 4HCBA 3C95A 1MHYG 2RCUA 3NE6A 4DU4A 4E3SA 4AI6A 3OGLB 4B08A 3TAEA 3J27A 1FZ4E 4M3UA 4M3YA 1FXXA 2OYQA 2VJ4A 3L0MA 3OGKB 3UIQA 4KI4A 2B7MA 3TAFA 4FJ9A 3WSOA 3SNNA 3KD5E 1FZ1E 4M42A 1XMGE 4EP9A 3NGIA 4KHYA 2VJ5A 2E31A 2DEBA 2QXFA 4FJHA 3K2OA 1XU5E 4J2BA 1XVGE 3SQ1A 4M3XA 3HL8A 2P1QB 3SI6A 5IBKB 3L8BA 1FZ6E 4E4BA 3SPZA 4DTNA 3C6NB 1FZHE 4JS4A 4FK4A 3SJJA 1XVCE 4FJLA 1LDKE 3RMAA 1FZ5E 2P1MB 3TJYA 2JH9A 3L2OB 3N1EA 4RL5A 4M3RA 3TABA 3TL8B 3QETA 3SUOA 2PFVA 4QNDA 3HGLA 3LDBA 1XU3E 2HD0A 4DTMA 3N1BA 2FYOA 2JHAA 4QNCA 4DTPA 3SQ2A 1NEXB 3CQ8A 3SCXA 4X5MA 2OVRB 2OZSA 4JRPA 2P1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHZ G;  1FZ8 E;  1FZ6 E;  1XVD E;  1XVF E;  1FZH E;  1FZ9 E;  1FZ3 E;  1XVC E;  1FZ5 E;  1FZI E;  1MHY G;  1FZ2 E;  1FYZ E;  1FZ4 E;  4GAM C;  1XVB E;  1FZ7 E;  1MTY G;  1XU3 E;  1XMH E;  1FZ1 E;  1XMG E;  1MMO G;  1XU5 E;  1XVG E;  1XVE E;  1XMF E;  1FZ0 E; 
#chains in the Genus database with same CATH topology
 4KI6 A;  3SUQ A;  2LF3 A;  3V7D B;  5IRE A;  3QEP A;  3NCI A;  1XVF E;  3C6O B;  3KD1 E;  1IH7 A;  4FJX A;  4FK2 A;  1FZ9 E;  4DTJ A;  4KHW A;  3L1N A;  4FK0 A;  2RKH A;  4DU3 A;  1FZI E;  4FJM A;  1FZ2 E;  2OVQ B;  3QEI A;  4KHQ A;  3CFO A;  2OVP B;  2P5O A;  2JHC A;  2P5G A;  4J2A A;  2LF6 A;  3RWU A;  4AKG A;  2MZW B;  3RMB A;  4X5N A;  1FZ7 E;  3NDK A;  1MTY G;  4FVM A;  4ADO A;  3LZJ A;  3SUP A;  3NAE A;  1IG9 A;  4M3T A;  4FJN A;  1WAJ A;  3E4W A;  3SQ4 A;  4HCC A;  3SUN A;  3TAG A;  4M41 A;  4I9Q A;  4FJI A;  1P22 A;  2B1E A;  4JS5 A;  4DTR A;  3LDS A;  2OZM A;  3UO2 A;  1XVE E;  3QNO A;  4KHN A;  3QNN A;  3HP9 A;  2P1N B;  3LZI A;  1Q9X A;  4FJJ A;  2DY4 A;  3QEV A;  1MHZ G;  2FW3 A;  1WAF A;  4FJK A;  4FJG A;  1XVD E;  4ICG C;  2H4T A;  3S9H A;  3SQ0 A;  1FZ3 E;  2VIX A;  2K5S A;  4KHS A;  2PFT A;  1FYZ E;  3LD8 A;  4AKH A;  2ATQ A;  4M3W A;  3HGK E;  4KHU A;  4RNG A;  3CFR A;  1FPO A;  2MMB A;  4GAM C;  3QEX A;  1XVB E;  5IZ7 A;  4M3Z A;  4DTO A;  3SPY A;  3C94 A;  3C6P B;  2JHP A;  4FJ5 A;  1Q9Y A;  1CLQ A;  3OGM B;  2P1O B;  3SVI A;  4DTX A;  1XMH E;  4FJ8 A;  1MMO G;  2E32 A;  4IT5 A;  2B8I A;  2JH8 A;  1XL3 C;  4M45 A;  4FJ7 A;  3MKS B;  4I9L A;  4EYW A;  1XMF E;  1FZ0 E;  3CFP A;  3QER A;  4JRQ A;  4DTU A;  1FZ8 E;  3E4Y A;  4J2D A;  2YB5 A;  4ADN A;  4DTS A;  3QES A;  2DTU A;  4AKI A;  4J2E A;  5H37 A;  2MW2 A;  3RMC A;  3RMD A;  4RG8 A;  4EPH A;  1FS1 A;  3NHG A;  3QEW A;  2JPN A;  4I6J B;  3J2P A;  4DU1 A;  4HCB A;  3C95 A;  1MHY G;  2RCU A;  3NE6 A;  4DU4 A;  4E3S A;  4AI6 A;  3OGL B;  4B08 A;  3TAE A;  3J27 A;  1FZ4 E;  4M3U A;  4M3Y A;  1FXX A;  2OYQ A;  2VJ4 A;  3L0M A;  3OGK B;  3UIQ A;  4KI4 A;  2B7M A;  3TAF A;  4FJ9 A;  3WSO A;  3SNN A;  3KD5 E;  1FZ1 E;  4M42 A;  1XMG E;  4EP9 A;  3NGI A;  4KHY A;  2VJ5 A;  2E31 A;  2DEB A;  2QXF A;  4FJH A;  3K2O A;  1XU5 E;  4J2B A;  2JQT A;  1XVG E;  3SQ1 A;  4M3X A;  2P1Q B;  3HL8 A;  3SI6 A;  5IBK B;  3L8B A;  1FZ6 E;  4E4B A;  3SPZ A;  4DTN A;  3C6N B;  1FZH E;  4JS4 A;  4FK4 A;  3SJJ A;  1XVC E;  4FJL A;  1LDK E;  3RMA A;  1FZ5 E;  3BVO A;  2P1M B;  3TJY A;  2JH9 A;  3L2O B;  3N1E A;  4RL5 A;  4M3R A;  3TAB A;  1JW2 A;  3TL8 B;  3QET A;  3SUO A;  2PFV A;  4QND A;  3HGL A;  3LDB A;  1XU3 E;  2HD0 A;  1N1C A;  4DTM A;  3N1B A;  2FYO A;  2JHA A;  4QNC A;  4DTP A;  3SQ2 A;  1NEX B;  3CQ8 A;  3SCX A;  4X5M A;  2OVR B;  2OZS A;  3UO3 A;  4JRP A;  2P1P B; 
#chains in the Genus database with same CATH homology
 4KI6 A;  3SUQ A;  2LF3 A;  3V7D B;  5IRE A;  3QEP A;  3NCI A;  1XVF E;  3C6O B;  3KD1 E;  1IH7 A;  4FJX A;  4FK2 A;  1FZ9 E;  4DTJ A;  4KHW A;  3L1N A;  4FK0 A;  4DU3 A;  1FZI E;  4FJM A;  1FZ2 E;  2OVQ B;  3QEI A;  4KHQ A;  3CFO A;  2OVP B;  2P5O A;  2JHC A;  2P5G A;  4J2A A;  2LF6 A;  3RWU A;  4AKG A;  2MZW B;  3RMB A;  4X5N A;  1FZ7 E;  3NDK A;  1MTY G;  4FVM A;  4ADO A;  3LZJ A;  3SUP A;  3NAE A;  1IG9 A;  4M3T A;  4FJN A;  1WAJ A;  3E4W A;  3SQ4 A;  4HCC A;  3SUN A;  3TAG A;  4M41 A;  4I9Q A;  4FJI A;  1P22 A;  2B1E A;  4JS5 A;  4DTR A;  3LDS A;  2OZM A;  3QNO A;  1XVE E;  4KHN A;  3QNN A;  3HP9 A;  2P1N B;  3LZI A;  1Q9X A;  4FJJ A;  2DY4 A;  3QEV A;  1MHZ G;  2FW3 A;  1WAF A;  4FJK A;  4FJG A;  1XVD E;  3S9H A;  2H4T A;  3SQ0 A;  1FZ3 E;  2VIX A;  4KHS A;  2PFT A;  1FYZ E;  3LD8 A;  4AKH A;  2ATQ A;  4M3W A;  3HGK E;  4KHU A;  4RNG A;  3CFR A;  3QEX A;  2MMB A;  4GAM C;  1XVB E;  5IZ7 A;  4M3Z A;  4DTO A;  3SPY A;  3C94 A;  3C6P B;  2JHP A;  4FJ5 A;  1Q9Y A;  1CLQ A;  3OGM B;  2P1O B;  3SVI A;  4DTX A;  1XMH E;  4FJ8 A;  1MMO G;  2E32 A;  2B8I A;  2JH8 A;  1XL3 C;  4M45 A;  4FJ7 A;  3MKS B;  4I9L A;  4EYW A;  1XMF E;  1FZ0 E;  3CFP A;  3QER A;  4JRQ A;  4DTU A;  1FZ8 E;  3E4Y A;  4J2D A;  2YB5 A;  4ADN A;  4DTS A;  3QES A;  2DTU A;  4AKI A;  4J2E A;  5H37 A;  3RMC A;  3RMD A;  4RG8 A;  4EPH A;  1FS1 A;  3NHG A;  3QEW A;  2JPN A;  4I6J B;  3J2P A;  4DU1 A;  4HCB A;  3C95 A;  1MHY G;  2RCU A;  3NE6 A;  4DU4 A;  4E3S A;  4AI6 A;  3OGL B;  4B08 A;  3TAE A;  3J27 A;  1FZ4 E;  4M3U A;  4M3Y A;  1FXX A;  2OYQ A;  2VJ4 A;  3L0M A;  3OGK B;  3UIQ A;  4KI4 A;  2B7M A;  3TAF A;  4FJ9 A;  3WSO A;  3SNN A;  3KD5 E;  1FZ1 E;  4M42 A;  1XMG E;  4EP9 A;  3NGI A;  4KHY A;  2VJ5 A;  2E31 A;  2DEB A;  2QXF A;  4FJH A;  3K2O A;  1XU5 E;  4J2B A;  1XVG E;  3SQ1 A;  4M3X A;  3HL8 A;  2P1Q B;  3SI6 A;  5IBK B;  3L8B A;  1FZ6 E;  4E4B A;  3SPZ A;  4DTN A;  3C6N B;  1FZH E;  4JS4 A;  4FK4 A;  3SJJ A;  1XVC E;  4FJL A;  1LDK E;  3RMA A;  1FZ5 E;  2P1M B;  3TJY A;  2JH9 A;  3L2O B;  3N1E A;  4RL5 A;  4M3R A;  3TAB A;  3TL8 B;  3QET A;  3SUO A;  2PFV A;  4QND A;  3HGL A;  3LDB A;  1XU3 E;  2HD0 A;  4DTM A;  3N1B A;  2FYO A;  2JHA A;  4QNC A;  4DTP A;  3SQ2 A;  1NEX B;  3CQ8 A;  3SCX A;  4X5M A;  2OVR B;  2OZS A;  4JRP A;  2P1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...