1XMFE

Structure of mn(ii)-soaked apo methane monooxygenase hydroxylase crystals from m. capsulatus (bath)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
publication title Preparation and X-ray Structures of Metal-Free, Dicobalt and Dimanganese Forms of Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath)
pubmed doi rcsb
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmfE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmfE02
1FYZE 1XVFE 1MHZG 1FZ8E 1FZ2E 1MMOG 4GAMC 1FZ0E 1FZ5E 1XVCE 1MHYG 1XU5E 1XMGE 1XMFE 1FZ7E 1FZ6E 1FZ1E 1FZIE 1XMHE 1FZ9E 1XU3E 1FZ4E 1MTYG 1XVDE 1FZHE 1XVGE 1XVBE 1XVEE 1FZ3E
chains in the Genus database with same CATH superfamily
2B8IA 4I9LA 3CFOA 2JQTA 2VJ4A 3V7DB 3SCXA 1MHZG 4DU1A 1IG9A 4FJIA 4AKGA 4DTPA 2DEBA 3NE6A 2LF3A 4FJ5A 4QNCA 3N1BA 2RCUA 2HD0A 3L8BA 1NEXB 2MW2A 4FJ9A 2DY4A 4J2AA 4FJLA 3HGLA 3J27A 5H37A 4ADNA 4JRQA 4M3RA 4B08A 5IREA 3C94A 2P1MB 3LZJA 1WAJA 1FZIE 3TAFA 3TAEA 3SQ4A 4FJ7A 4M3ZA 3J2PA 3NGIA 4I6JB 3SJJA 4FJGA 3UO3A 4FJHA 4M3WA 3K2OA 4M42A 4KHSA 3L1NA 4DTJA 3TAGA 1FZHE 3SUPA 2P1NB 4JRPA 2MMBA 2B1EA 4RL5A 4X5MA 3NAEA 1Q9YA 4FJJA 4AI6A 4AKIA 3N1EA 3LDBA 1XVFE 4DU3A 3SUNA 3SNNA 3UIQA 3SQ2A 4EYWA 2E31A 3RMDA 4M3YA 4AKHA 4FK4A 1FZ2E 2E32A 3OGKB 4RG8A 2QXFA 4J2BA 3OGLB 1FZ5E 1XVCE 2FW3A 3C6NB 3TJYA 3LDSA 3NDKA 2P1OB 1FZ7E 3SI6A 1FZ6E 3CFPA 1FZ1E 2OZSA 2PFVA 1XL3C 2MZWB 3QEXA 4FJXA 3LD8A 4HCBA 3LZIA 4DTSA 2RKHA 1XVDE 4EPHA 3HL8A 4DTRA 1XVBE 2B7MA 1N1CA 2VIXA 3E4YA 4FJMA 1FZ3E 3L2OB 3WSOA 1P22A 3OGMB 4DTMA 2LF6A 4E3SA 4FJKA 4KHYA 4IT5A 3NHGA 3UO2A 1FZ8E 4KHUA 3RMAA 2JH9A 4RNGA 3QEIA 3SPZA 4KHQA 2OVRB 4M3TA 2VJ5A 3KD5E 1MHYG 2OYQA 1XU5E 1FS1A 3BVOA 3C6OB 1XMGE 1FXXA 4JS4A 1XMFE 4M41A 4ADOA 4DTNA 4DTUA 3RWUA 3QEWA 2JHPA 1FPOA 3SQ1A 4M3UA 4J2DA 3QNNA 1FZ9E 1XU3E 3SUQA 4KHWA 2DTUA 1JW2A 3QESA 3QERA 4FJ8A 4KI6A 4J2EA 3HP9A 2ATQA 3RMCA 4KHNA 3HGKE 4ICGC 3QNOA 4HCCA 3E4WA 3MKSB 3CQ8A 1FYZE 4I9QA 2P1PB 4DU4A 4X5NA 3QEVA 4QNDA 2OVPB 3TL8B 2H4TA 4JS5A 3QETA 2JHCA 1MMOG 3C95A 3SPYA 2K5SA 4GAMC 3SVIA 1Q9XA 2JH8A 3QEPA 1FZ0E 2P5GA 2P5OA 2PFTA 2OVQB 4FK0A 3TABA 4KI4A 3NCIA 3CFRA 4DTOA 3SQ0A 1LDKE 1IH7A 2JHAA 4E4BA 1XMHE 4FJNA 4M3XA 5IBKB 4DTXA 3L0MA 3S9HA 4FVMA 2OZMA 3KD1E 1FZ4E 3RMBA 1MTYG 2P1QB 5IZ7A 1XVGE 4FK2A 1WAFA 1CLQA 4M45A 1XVEE 3SUOA 4EP9A 2FYOA 3C6PB 2YB5A 2JPNA
chains in the Genus database with same CATH topology
2B8IA 4I9LA 3CFOA 2VJ4A 3V7DB 3SCXA 1MHZG 4DU1A 1IG9A 4FJIA 4AKGA 4DTPA 2DEBA 3NE6A 2LF3A 4FJ5A 4QNCA 3N1BA 2RCUA 2HD0A 3L8BA 1NEXB 4FJ9A 2DY4A 4J2AA 4FJLA 3HGLA 3J27A 5H37A 4ADNA 4JRQA 4M3RA 4B08A 5IREA 3C94A 2P1MB 3LZJA 1WAJA 1FZIE 3TAFA 3TAEA 3SQ4A 4FJ7A 4M3ZA 3J2PA 3NGIA 4I6JB 3SJJA 4FJGA 4M3WA 4FJHA 3K2OA 4M42A 4KHSA 3L1NA 4DTJA 3TAGA 1FZHE 3SUPA 2P1NB 4JRPA 2MMBA 2B1EA 4RL5A 4X5MA 3NAEA 1Q9YA 4FJJA 4AI6A 4AKIA 3N1EA 3LDBA 1XVFE 4DU3A 3SUNA 3SNNA 3UIQA 3SQ2A 4EYWA 2E31A 3RMDA 4M3YA 4AKHA 4FK4A 1FZ2E 2E32A 3OGKB 4RG8A 2QXFA 4J2BA 3OGLB 1FZ5E 1XVCE 2FW3A 3C6NB 3TJYA 3LDSA 3NDKA 2P1OB 1FZ7E 3SI6A 1FZ6E 3CFPA 1FZ1E 2OZSA 2PFVA 1XL3C 2MZWB 3QEXA 4FJXA 3LD8A 4HCBA 3LZIA 4DTSA 1XVDE 4EPHA 3HL8A 4DTRA 1XVBE 2B7MA 2VIXA 3E4YA 4FJMA 1FZ3E 3L2OB 3WSOA 1P22A 3OGMB 4DTMA 2LF6A 4E3SA 4FJKA 4KHYA 3NHGA 1FZ8E 4KHUA 3RMAA 2JH9A 4RNGA 3QEIA 3SPZA 4KHQA 2OVRB 4M3TA 2VJ5A 3KD5E 1MHYG 2OYQA 1XU5E 1FS1A 3C6OB 4JS4A 1XMGE 1FXXA 1XMFE 4M41A 4ADOA 4DTNA 4DTUA 3RWUA 3QEWA 2JHPA 3SQ1A 4M3UA 4J2DA 3QNNA 1FZ9E 1XU3E 3SUQA 4KHWA 2DTUA 3QESA 3QERA 4FJ8A 4KI6A 4J2EA 3HP9A 2ATQA 3RMCA 4KHNA 3HGKE 4HCCA 3QNOA 3E4WA 3MKSB 3CQ8A 1FYZE 4I9QA 2P1PB 4DU4A 4X5NA 3QEVA 4QNDA 2OVPB 3TL8B 2H4TA 4JS5A 3QETA 2JHCA 1MMOG 3C95A 3SPYA 4GAMC 3SVIA 1Q9XA 2JH8A 3QEPA 1FZ0E 2P5GA 2P5OA 2PFTA 2OVQB 4FK0A 3TABA 4KI4A 3NCIA 3CFRA 4DTOA 3SQ0A 1LDKE 1IH7A 2JHAA 4E4BA 1XMHE 4FJNA 4M3XA 5IBKB 4DTXA 3L0MA 3S9HA 4FVMA 2OZMA 3KD1E 1FZ4E 3RMBA 1MTYG 2P1QB 5IZ7A 1XVGE 4FK2A 1WAFA 1CLQA 4M45A 1XVEE 3SUOA 4EP9A 2FYOA 3C6PB 2YB5A 2JPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYZ E;  1XVF E;  1MHZ G;  1FZ8 E;  1FZ2 E;  1MMO G;  4GAM C;  1FZ0 E;  1FZ5 E;  1XVC E;  1MHY G;  1XU5 E;  1XMG E;  1XMF E;  1FZ7 E;  1FZ6 E;  1FZ1 E;  1FZI E;  1XMH E;  1FZ9 E;  1XU3 E;  1FZ4 E;  1MTY G;  1XVD E;  1FZH E;  1XVG E;  1XVB E;  1XVE E;  1FZ3 E; 
#chains in the Genus database with same CATH topology
 2B8I A;  4I9L A;  3CFO A;  2JQT A;  2VJ4 A;  3V7D B;  3SCX A;  1MHZ G;  4DU1 A;  1IG9 A;  4FJI A;  4AKG A;  4DTP A;  2DEB A;  3NE6 A;  2LF3 A;  4FJ5 A;  4QNC A;  3N1B A;  2RCU A;  2HD0 A;  3L8B A;  1NEX B;  2MW2 A;  4FJ9 A;  2DY4 A;  4J2A A;  4FJL A;  3HGL A;  3J27 A;  5H37 A;  4ADN A;  4JRQ A;  4M3R A;  4B08 A;  5IRE A;  3C94 A;  2P1M B;  3LZJ A;  1WAJ A;  1FZI E;  3TAF A;  3TAE A;  3SQ4 A;  4FJ7 A;  4M3Z A;  3J2P A;  3NGI A;  4I6J B;  3SJJ A;  4FJG A;  3UO3 A;  4FJH A;  4M3W A;  3K2O A;  4M42 A;  4KHS A;  3L1N A;  4DTJ A;  3TAG A;  1FZH E;  3SUP A;  2P1N B;  4JRP A;  2MMB A;  2B1E A;  4RL5 A;  4X5M A;  3NAE A;  1Q9Y A;  4FJJ A;  4AI6 A;  4AKI A;  3N1E A;  3LDB A;  1XVF E;  4DU3 A;  3SUN A;  3SNN A;  3UIQ A;  3SQ2 A;  4EYW A;  2E31 A;  3RMD A;  4M3Y A;  4AKH A;  4FK4 A;  1FZ2 E;  2E32 A;  3OGK B;  4RG8 A;  2QXF A;  4J2B A;  3OGL B;  1FZ5 E;  1XVC E;  2FW3 A;  3C6N B;  3TJY A;  3LDS A;  3NDK A;  2P1O B;  1FZ7 E;  3SI6 A;  1FZ6 E;  3CFP A;  1FZ1 E;  2OZS A;  2PFV A;  1XL3 C;  2MZW B;  3QEX A;  4FJX A;  3LD8 A;  4HCB A;  3LZI A;  4DTS A;  2RKH A;  1XVD E;  4EPH A;  3HL8 A;  4DTR A;  1XVB E;  2B7M A;  1N1C A;  2VIX A;  3E4Y A;  4FJM A;  1FZ3 E;  3L2O B;  3WSO A;  1P22 A;  3OGM B;  4DTM A;  2LF6 A;  4E3S A;  4FJK A;  4KHY A;  4IT5 A;  3NHG A;  3UO2 A;  1FZ8 E;  4KHU A;  3RMA A;  2JH9 A;  4RNG A;  3QEI A;  3SPZ A;  4KHQ A;  2OVR B;  4M3T A;  2VJ5 A;  3KD5 E;  1MHY G;  2OYQ A;  1XU5 E;  1FS1 A;  3BVO A;  3C6O B;  1XMG E;  1FXX A;  4JS4 A;  1XMF E;  4M41 A;  4ADO A;  4DTN A;  4DTU A;  3RWU A;  3QEW A;  2JHP A;  1FPO A;  3SQ1 A;  4M3U A;  4J2D A;  3QNN A;  1FZ9 E;  1XU3 E;  3SUQ A;  4KHW A;  2DTU A;  1JW2 A;  3QES A;  3QER A;  4FJ8 A;  4KI6 A;  4J2E A;  3HP9 A;  2ATQ A;  3RMC A;  4KHN A;  3HGK E;  4ICG C;  3QNO A;  4HCC A;  3E4W A;  3MKS B;  3CQ8 A;  1FYZ E;  4I9Q A;  2P1P B;  4DU4 A;  4X5N A;  3QEV A;  4QND A;  2OVP B;  3TL8 B;  2H4T A;  4JS5 A;  3QET A;  2JHC A;  1MMO G;  3C95 A;  3SPY A;  2K5S A;  4GAM C;  3SVI A;  1Q9X A;  2JH8 A;  3QEP A;  1FZ0 E;  2P5G A;  2P5O A;  2PFT A;  2OVQ B;  4FK0 A;  3TAB A;  4KI4 A;  3NCI A;  3CFR A;  4DTO A;  3SQ0 A;  1LDK E;  1IH7 A;  2JHA A;  4E4B A;  1XMH E;  4FJN A;  4M3X A;  5IBK B;  4DTX A;  3L0M A;  3S9H A;  4FVM A;  2OZM A;  3KD1 E;  1FZ4 E;  3RMB A;  1MTY G;  2P1Q B;  5IZ7 A;  1XVG E;  4FK2 A;  1WAF A;  1CLQ A;  4M45 A;  1XVE E;  3SUO A;  4EP9 A;  2FYO A;  3C6P B;  2YB5 A;  2JPN A; 
#chains in the Genus database with same CATH homology
 2B8I A;  4I9L A;  3CFO A;  2VJ4 A;  3V7D B;  3SCX A;  1MHZ G;  4DU1 A;  1IG9 A;  4FJI A;  4AKG A;  4DTP A;  2DEB A;  3NE6 A;  2LF3 A;  4FJ5 A;  4QNC A;  3N1B A;  2RCU A;  2HD0 A;  3L8B A;  1NEX B;  4FJ9 A;  2DY4 A;  4J2A A;  4FJL A;  3HGL A;  3J27 A;  5H37 A;  4ADN A;  4JRQ A;  4M3R A;  4B08 A;  5IRE A;  3C94 A;  2P1M B;  3LZJ A;  1WAJ A;  1FZI E;  3TAF A;  3TAE A;  3SQ4 A;  4FJ7 A;  4M3Z A;  3J2P A;  3NGI A;  4I6J B;  3SJJ A;  4FJG A;  4M3W A;  4FJH A;  3K2O A;  4M42 A;  4KHS A;  3L1N A;  4DTJ A;  3TAG A;  1FZH E;  3SUP A;  2P1N B;  4JRP A;  2MMB A;  2B1E A;  4RL5 A;  4X5M A;  3NAE A;  1Q9Y A;  4FJJ A;  4AI6 A;  4AKI A;  3N1E A;  3LDB A;  1XVF E;  4DU3 A;  3SUN A;  3SNN A;  3UIQ A;  3SQ2 A;  4EYW A;  2E31 A;  3RMD A;  4M3Y A;  4AKH A;  4FK4 A;  1FZ2 E;  2E32 A;  3OGK B;  4RG8 A;  2QXF A;  4J2B A;  3OGL B;  1FZ5 E;  1XVC E;  2FW3 A;  3C6N B;  3TJY A;  3LDS A;  3NDK A;  2P1O B;  1FZ7 E;  3SI6 A;  1FZ6 E;  3CFP A;  1FZ1 E;  2OZS A;  2PFV A;  1XL3 C;  2MZW B;  3QEX A;  4FJX A;  3LD8 A;  4HCB A;  3LZI A;  4DTS A;  1XVD E;  4EPH A;  3HL8 A;  4DTR A;  1XVB E;  2B7M A;  2VIX A;  3E4Y A;  4FJM A;  1FZ3 E;  3L2O B;  3WSO A;  1P22 A;  3OGM B;  4DTM A;  2LF6 A;  4E3S A;  4FJK A;  4KHY A;  3NHG A;  1FZ8 E;  4KHU A;  3RMA A;  2JH9 A;  4RNG A;  3QEI A;  3SPZ A;  4KHQ A;  2OVR B;  4M3T A;  2VJ5 A;  3KD5 E;  1MHY G;  2OYQ A;  1XU5 E;  1FS1 A;  3C6O B;  4JS4 A;  1XMG E;  1FXX A;  1XMF E;  4M41 A;  4ADO A;  4DTN A;  4DTU A;  3RWU A;  3QEW A;  2JHP A;  3SQ1 A;  4M3U A;  4J2D A;  3QNN A;  1FZ9 E;  1XU3 E;  3SUQ A;  4KHW A;  2DTU A;  3QES A;  3QER A;  4FJ8 A;  4KI6 A;  4J2E A;  3HP9 A;  2ATQ A;  3RMC A;  4KHN A;  3HGK E;  4HCC A;  3QNO A;  3E4W A;  3MKS B;  3CQ8 A;  1FYZ E;  4I9Q A;  2P1P B;  4DU4 A;  4X5N A;  3QEV A;  4QND A;  2OVP B;  3TL8 B;  2H4T A;  4JS5 A;  3QET A;  2JHC A;  1MMO G;  3C95 A;  3SPY A;  4GAM C;  3SVI A;  1Q9X A;  2JH8 A;  3QEP A;  1FZ0 E;  2P5G A;  2P5O A;  2PFT A;  2OVQ B;  4FK0 A;  3TAB A;  4KI4 A;  3NCI A;  3CFR A;  4DTO A;  3SQ0 A;  1LDK E;  1IH7 A;  2JHA A;  4E4B A;  1XMH E;  4FJN A;  4M3X A;  5IBK B;  4DTX A;  3L0M A;  3S9H A;  4FVM A;  2OZM A;  3KD1 E;  1FZ4 E;  3RMB A;  1MTY G;  2P1Q B;  5IZ7 A;  1XVG E;  4FK2 A;  1WAF A;  1CLQ A;  4M45 A;  1XVE E;  3SUO A;  4EP9 A;  2FYO A;  3C6P B;  2YB5 A;  2JPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...