1XMFE

Structure of mn(ii)-soaked apo methane monooxygenase hydroxylase crystals from m. capsulatus (bath)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Preparation and X-ray Structures of Metal-Free, Dicobalt and Dimanganese Forms of Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath)
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmfE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xmfE02
1FZ4E 1XVDE 4GAMC 1XVEE 1FYZE 1XVCE 1FZ7E 1MHYG 1XMGE 1FZ5E 1XMHE 1FZ8E 1MMOG 1XVFE 1FZ0E 1FZ1E 1XMFE 1XVBE 1MHZG 1XVGE 1XU3E 1FZIE 1XU5E 1MTYG 1FZ9E 1FZ2E 1FZHE 1FZ3E 1FZ6E
chains in the Genus database with same CATH superfamily
4M3WA 4DTMA 2VJ5A 4AKGA 3NCIA 1CLQA 2JHAA 1FYZE 1WAJA 2LF3A 2E32A 3LZJA 4DTRA 2K5SA 1XVCE 3QNOA 4M3YA 2P1QB 3L1NA 4FVMA 4X5MA 4J2BA 3SNNA 4B08A 3E4WA 3C6PB 2MZWB 3HGKE 4M41A 3L8BA 4ADNA 4FJGA 4FJXA 3N1EA 3J2PA 3LZIA 2DTUA 3CQ8A 1N1CA 2P1OB 3NHGA 4KI4A 4HCBA 3KD5E 4M3UA 3L2OB 2H4TA 5IREA 3NDKA 1XMFE 2ATQA 3C94A 3HGLA 3L0MA 3TAFA 4KHNA 4FJ9A 4KHSA 4AKIA 1MHZG 4QNDA 3SUOA 2B7MA 4AI6A 3SQ0A 3TABA 1FZ2E 4M45A 4M3RA 4RL5A 5IBKB 3SI6A 2FYOA 4DU1A 3S9HA 4DTUA 4I6JB 4FK2A 3E4YA 1XVDE 2JH8A 2P1PB 2RCUA 3BVOA 4I9QA 4M42A 2VJ4A 3WSOA 4FJJA 3SVIA 3KD1E 1XMGE 4IT5A 1JW2A 4DU4A 3N1BA 3OGKB 1FZ8E 2JHPA 2JH9A 4ICGC 4QNCA 3UO2A 2FW3A 1MMOG 3RWUA 2JHCA 4X5NA 3QEXA 4M3TA 3SQ4A 3SQ1A 4DTOA 2DY4A 2JQTA 4M3ZA 3TJYA 1XU3E 3RMBA 2DEBA 2RKHA 3MKSB 3SPYA 2E31A 1Q9XA 3HL8A 3OGLB 3NGIA 3QEIA 2HD0A 3LD8A 2OVQB 4FJ8A 4RG8A 4KHQA 3QESA 4EYWA 4KHWA 4GAMC 2B8IA 5H37A 3K2OA 4DTNA 3SUNA 4FJNA 3QNNA 2B1EA 3C6NB 1FZ7E 4JS5A 1FZ5E 3SUPA 3QETA 4FJKA 4FJ7A 4FK4A 3UO3A 1XMHE 1WAFA 2QXFA 1FXXA 4FJLA 3LDSA 4HCCA 1XVFE 2YB5A 1FZ0E 4E4BA 2MMBA 4KHUA 4E3SA 1FZ1E 4RNGA 3CFRA 3SQ2A 3NAEA 3RMCA 4J2AA 4FK0A 3SUQA 2OVRB 1FZIE 4DTPA 5IZ7A 3UIQA 2VIXA 4J2EA 2PFVA 2LF6A 3V7DB 1FZHE 2P5OA 1FZ3E 3QEPA 3QEWA 2OVPB 3C6OB 4AKHA 4DTJA 4ADOA 3SJJA 1FZ4E 1P22A 3TAEA 1XVEE 3QEVA 3SCXA 3TL8B 3RMAA 4FJMA 3CFPA 2JPNA 4KI6A 4M3XA 1MHYG 3C95A 3QERA 1IG9A 4EP9A 1FPOA 3SPZA 4FJ5A 4DU3A 1XL3C 2P5GA 2MW2A 3RMDA 3OGMB 4EPHA 4JRPA 2P1MB 4I9LA 1FS1A 3NE6A 1XVBE 3TAGA 3LDBA 1LDKE 1IH7A 3J27A 4JS4A 1Q9YA 2OYQA 1XVGE 4J2DA 3HP9A 2PFTA 4DTXA 4KHYA 4FJHA 1XU5E 1MTYG 2OZMA 1FZ9E 3CFOA 4JRQA 2OZSA 1FZ6E 4FJIA 2P1NB 1NEXB 4DTSA
chains in the Genus database with same CATH topology
4M3WA 4DTMA 2VJ5A 4AKGA 3NCIA 1CLQA 2JHAA 1FYZE 1WAJA 2LF3A 2E32A 3LZJA 4DTRA 3QNOA 1XVCE 4M3YA 2P1QB 3L1NA 4FVMA 4X5MA 4J2BA 3SNNA 4B08A 3E4WA 3C6PB 2MZWB 3HGKE 4M41A 3L8BA 4ADNA 4FJGA 4FJXA 3N1EA 3J2PA 3LZIA 2DTUA 3CQ8A 2P1OB 3NHGA 4KI4A 4HCBA 3KD5E 4M3UA 3L2OB 2H4TA 5IREA 3NDKA 1XMFE 2ATQA 3C94A 3HGLA 3L0MA 3TAFA 4KHNA 4FJ9A 4KHSA 4AKIA 1MHZG 4QNDA 3SUOA 2B7MA 4AI6A 3SQ0A 3TABA 1FZ2E 4M45A 4M3RA 4RL5A 5IBKB 3SI6A 2FYOA 4DU1A 3S9HA 4DTUA 4I6JB 4FK2A 3E4YA 1XVDE 2JH8A 2P1PB 2RCUA 4M42A 4I9QA 2VJ4A 3WSOA 4FJJA 3SVIA 3KD1E 1XMGE 4DU4A 3N1BA 3OGKB 1FZ8E 2JHPA 2JH9A 4QNCA 2FW3A 1MMOG 3RWUA 2JHCA 4X5NA 3QEXA 4M3TA 3SQ4A 3SQ1A 4DTOA 2DY4A 4M3ZA 3TJYA 1XU3E 3RMBA 2DEBA 3MKSB 3SPYA 2E31A 1Q9XA 3HL8A 3OGLB 3NGIA 3QEIA 2HD0A 3LD8A 2OVQB 4FJ8A 4RG8A 4KHQA 3QESA 4EYWA 4KHWA 4GAMC 2B8IA 5H37A 3K2OA 4DTNA 3SUNA 4FJNA 3QNNA 2B1EA 3C6NB 1FZ7E 4JS5A 1FZ5E 3SUPA 3QETA 4FJKA 4FJ7A 4FK4A 1XMHE 1WAFA 2QXFA 1FXXA 4FJLA 3LDSA 4HCCA 1XVFE 2YB5A 1FZ0E 4E4BA 2MMBA 4KHUA 4E3SA 1FZ1E 4RNGA 3CFRA 3SQ2A 3NAEA 3RMCA 4J2AA 4FK0A 3SUQA 2OVRB 1FZIE 4DTPA 5IZ7A 3UIQA 2VIXA 4J2EA 2PFVA 2LF6A 3V7DB 1FZHE 2P5OA 1FZ3E 3QEPA 3QEWA 3C6OB 2OVPB 4AKHA 4DTJA 4ADOA 3SJJA 1FZ4E 1P22A 3TAEA 1XVEE 3QEVA 3SCXA 3TL8B 3RMAA 4FJMA 3CFPA 2JPNA 4KI6A 4M3XA 1MHYG 3C95A 3QERA 1IG9A 4EP9A 3SPZA 4FJ5A 4DU3A 1XL3C 2P5GA 3RMDA 3OGMB 4EPHA 4JRPA 2P1MB 4I9LA 1FS1A 3NE6A 1XVBE 3TAGA 3LDBA 1LDKE 1IH7A 3J27A 4JS4A 1Q9YA 2OYQA 1XVGE 4J2DA 3HP9A 2PFTA 4DTXA 4KHYA 4FJHA 1XU5E 1MTYG 2OZMA 1FZ9E 3CFOA 4JRQA 2OZSA 1FZ6E 4FJIA 2P1NB 1NEXB 4DTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ4 E;  1XVD E;  4GAM C;  1XVE E;  1FYZ E;  1XVC E;  1FZ7 E;  1MHY G;  1XMG E;  1FZ5 E;  1XMH E;  1FZ8 E;  1MMO G;  1XVF E;  1FZ0 E;  1FZ1 E;  1XMF E;  1XVB E;  1MHZ G;  1XVG E;  1XU3 E;  1FZI E;  1XU5 E;  1MTY G;  1FZ9 E;  1FZ2 E;  1FZH E;  1FZ3 E;  1FZ6 E; 
#chains in the Genus database with same CATH topology
 4M3W A;  4DTM A;  2VJ5 A;  4AKG A;  3NCI A;  1CLQ A;  2JHA A;  1FYZ E;  1WAJ A;  2LF3 A;  2E32 A;  3LZJ A;  4DTR A;  2K5S A;  1XVC E;  3QNO A;  4M3Y A;  2P1Q B;  3L1N A;  4FVM A;  4X5M A;  4J2B A;  3SNN A;  4B08 A;  3E4W A;  3C6P B;  2MZW B;  3HGK E;  4M41 A;  3L8B A;  4ADN A;  4FJG A;  4FJX A;  3N1E A;  3J2P A;  3LZI A;  2DTU A;  3CQ8 A;  1N1C A;  2P1O B;  3NHG A;  4KI4 A;  4HCB A;  3KD5 E;  4M3U A;  3L2O B;  2H4T A;  5IRE A;  3NDK A;  1XMF E;  2ATQ A;  3C94 A;  3HGL A;  3L0M A;  3TAF A;  4KHN A;  4FJ9 A;  4KHS A;  4AKI A;  1MHZ G;  4QND A;  3SUO A;  2B7M A;  4AI6 A;  3SQ0 A;  3TAB A;  1FZ2 E;  4M45 A;  4M3R A;  4RL5 A;  5IBK B;  3SI6 A;  2FYO A;  4DU1 A;  3S9H A;  4DTU A;  4I6J B;  4FK2 A;  3E4Y A;  1XVD E;  2JH8 A;  2P1P B;  2RCU A;  3BVO A;  4I9Q A;  4M42 A;  2VJ4 A;  3WSO A;  4FJJ A;  3SVI A;  3KD1 E;  1XMG E;  4IT5 A;  1JW2 A;  4DU4 A;  3N1B A;  3OGK B;  1FZ8 E;  2JHP A;  2JH9 A;  4ICG C;  4QNC A;  3UO2 A;  2FW3 A;  1MMO G;  3RWU A;  2JHC A;  4X5N A;  3QEX A;  4M3T A;  3SQ4 A;  3SQ1 A;  4DTO A;  2DY4 A;  2JQT A;  4M3Z A;  3TJY A;  1XU3 E;  3RMB A;  2DEB A;  2RKH A;  3MKS B;  3SPY A;  2E31 A;  1Q9X A;  3HL8 A;  3OGL B;  3NGI A;  3QEI A;  2HD0 A;  3LD8 A;  2OVQ B;  4FJ8 A;  4RG8 A;  4KHQ A;  3QES A;  4EYW A;  4KHW A;  4GAM C;  2B8I A;  5H37 A;  3K2O A;  4DTN A;  3SUN A;  4FJN A;  3QNN A;  2B1E A;  3C6N B;  1FZ7 E;  4JS5 A;  1FZ5 E;  3SUP A;  3QET A;  4FJK A;  4FJ7 A;  4FK4 A;  3UO3 A;  1XMH E;  1WAF A;  2QXF A;  1FXX A;  4FJL A;  3LDS A;  4HCC A;  1XVF E;  2YB5 A;  1FZ0 E;  4E4B A;  2MMB A;  4KHU A;  4E3S A;  1FZ1 E;  4RNG A;  3CFR A;  3SQ2 A;  3NAE A;  3RMC A;  4J2A A;  4FK0 A;  3SUQ A;  2OVR B;  1FZI E;  4DTP A;  5IZ7 A;  3UIQ A;  2VIX A;  4J2E A;  2PFV A;  2LF6 A;  3V7D B;  1FZH E;  2P5O A;  1FZ3 E;  3QEP A;  3QEW A;  2OVP B;  3C6O B;  4AKH A;  4DTJ A;  4ADO A;  3SJJ A;  1FZ4 E;  1P22 A;  3TAE A;  1XVE E;  3QEV A;  3SCX A;  3TL8 B;  3RMA A;  4FJM A;  3CFP A;  2JPN A;  4KI6 A;  4M3X A;  1MHY G;  3C95 A;  3QER A;  1IG9 A;  4EP9 A;  1FPO A;  3SPZ A;  4FJ5 A;  4DU3 A;  1XL3 C;  2P5G A;  2MW2 A;  3RMD A;  3OGM B;  4EPH A;  4JRP A;  2P1M B;  4I9L A;  1FS1 A;  3NE6 A;  1XVB E;  3TAG A;  3LDB A;  1LDK E;  1IH7 A;  3J27 A;  4JS4 A;  1Q9Y A;  2OYQ A;  1XVG E;  4J2D A;  3HP9 A;  2PFT A;  4DTX A;  4KHY A;  4FJH A;  1XU5 E;  1MTY G;  2OZM A;  1FZ9 E;  3CFO A;  4JRQ A;  2OZS A;  1FZ6 E;  4FJI A;  2P1N B;  1NEX B;  4DTS A; 
#chains in the Genus database with same CATH homology
 4M3W A;  4DTM A;  2VJ5 A;  4AKG A;  3NCI A;  1CLQ A;  2JHA A;  1FYZ E;  1WAJ A;  2LF3 A;  2E32 A;  3LZJ A;  4DTR A;  3QNO A;  1XVC E;  4M3Y A;  2P1Q B;  3L1N A;  4FVM A;  4X5M A;  4J2B A;  3SNN A;  4B08 A;  3E4W A;  3C6P B;  2MZW B;  3HGK E;  4M41 A;  3L8B A;  4ADN A;  4FJG A;  4FJX A;  3N1E A;  3J2P A;  3LZI A;  2DTU A;  3CQ8 A;  2P1O B;  3NHG A;  4KI4 A;  4HCB A;  3KD5 E;  4M3U A;  3L2O B;  2H4T A;  5IRE A;  3NDK A;  1XMF E;  2ATQ A;  3C94 A;  3HGL A;  3L0M A;  3TAF A;  4KHN A;  4FJ9 A;  4KHS A;  4AKI A;  1MHZ G;  4QND A;  3SUO A;  2B7M A;  4AI6 A;  3SQ0 A;  3TAB A;  1FZ2 E;  4M45 A;  4M3R A;  4RL5 A;  5IBK B;  3SI6 A;  2FYO A;  4DU1 A;  3S9H A;  4DTU A;  4I6J B;  4FK2 A;  3E4Y A;  1XVD E;  2JH8 A;  2P1P B;  2RCU A;  4M42 A;  4I9Q A;  2VJ4 A;  3WSO A;  4FJJ A;  3SVI A;  3KD1 E;  1XMG E;  4DU4 A;  3N1B A;  3OGK B;  1FZ8 E;  2JHP A;  2JH9 A;  4QNC A;  2FW3 A;  1MMO G;  3RWU A;  2JHC A;  4X5N A;  3QEX A;  4M3T A;  3SQ4 A;  3SQ1 A;  4DTO A;  2DY4 A;  4M3Z A;  3TJY A;  1XU3 E;  3RMB A;  2DEB A;  3MKS B;  3SPY A;  2E31 A;  1Q9X A;  3HL8 A;  3OGL B;  3NGI A;  3QEI A;  2HD0 A;  3LD8 A;  2OVQ B;  4FJ8 A;  4RG8 A;  4KHQ A;  3QES A;  4EYW A;  4KHW A;  4GAM C;  2B8I A;  5H37 A;  3K2O A;  4DTN A;  3SUN A;  4FJN A;  3QNN A;  2B1E A;  3C6N B;  1FZ7 E;  4JS5 A;  1FZ5 E;  3SUP A;  3QET A;  4FJK A;  4FJ7 A;  4FK4 A;  1XMH E;  1WAF A;  2QXF A;  1FXX A;  4FJL A;  3LDS A;  4HCC A;  1XVF E;  2YB5 A;  1FZ0 E;  4E4B A;  2MMB A;  4KHU A;  4E3S A;  1FZ1 E;  4RNG A;  3CFR A;  3SQ2 A;  3NAE A;  3RMC A;  4J2A A;  4FK0 A;  3SUQ A;  2OVR B;  1FZI E;  4DTP A;  5IZ7 A;  3UIQ A;  2VIX A;  4J2E A;  2PFV A;  2LF6 A;  3V7D B;  1FZH E;  2P5O A;  1FZ3 E;  3QEP A;  3QEW A;  3C6O B;  2OVP B;  4AKH A;  4DTJ A;  4ADO A;  3SJJ A;  1FZ4 E;  1P22 A;  3TAE A;  1XVE E;  3QEV A;  3SCX A;  3TL8 B;  3RMA A;  4FJM A;  3CFP A;  2JPN A;  4KI6 A;  4M3X A;  1MHY G;  3C95 A;  3QER A;  1IG9 A;  4EP9 A;  3SPZ A;  4FJ5 A;  4DU3 A;  1XL3 C;  2P5G A;  3RMD A;  3OGM B;  4EPH A;  4JRP A;  2P1M B;  4I9L A;  1FS1 A;  3NE6 A;  1XVB E;  3TAG A;  3LDB A;  1LDK E;  1IH7 A;  3J27 A;  4JS4 A;  1Q9Y A;  2OYQ A;  1XVG E;  4J2D A;  3HP9 A;  2PFT A;  4DTX A;  4KHY A;  4FJH A;  1XU5 E;  1MTY G;  2OZM A;  1FZ9 E;  3CFO A;  4JRQ A;  2OZS A;  1FZ6 E;  4FJI A;  2P1N B;  1NEX B;  4DTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...