3UO2A

Jac1 co-chaperone from saccharomyces cerevisiae
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
169
structure length
160
Chain Sequence
b'FTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords J-type co-chaperone JAC1, mitochondrial
publication title Interaction of j-protein co-chaperone jac1 with fe-s scaffold isu is indispensable in vivo and conserved in evolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 62
structure length 160
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3uo2A01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3uo2A02
1N4CA 1XBLA 2OCHA 2N05A 2EJ7A 1N1CA 3BVOA 2QWRB 2QWOB 2CTQA 4J80A 3UO3A 1HDJA 2GUZA 2LGWA 3UCSC 2QWQB 1BQZA 2KQXA 1GH6A 3APOA 4J7ZA 3AG7A 2DN9A 2PF4E 2YUAA 3APQA 4RWUA 1BQ0A 2CTWA 2QWNB 3UO2A 2LO1A 2Y4UA 2CTRA 2QWPB 2L6LA 2N04A 2YS8A 2CTPA 2Y4TA 2M6YA 2DMXA 1NZ6A 2CUGA 2QSAA 1FAFA 2RKHA 4IT5A 1IURA 1FPOA 2GUZB 1WJZA
chains in the Genus database with same CATH superfamily
3SJQC 4B08A 1B06A 4O4IB 2HR3A 2P90A 5F2VO 3JASA 4DV4O 4JS4A 2P4KA 3UM7A 3RYCB 1XVBE 3WG7B 2P1PB 2XNDG 2B8IA 1DLBA 4ASUG 2EIMB 1P49A 1HNXO 1JW2A 4FVMA 3K06A 1PNLA 1I5YA 2YXHA 4EFBA 1Q6IA 3N27A 1NVPB 3FAVB 3L70H 4I9LA 4X5MA 2F93B 2DJVA 1LUVA 5LGTA 2HLDG 4EKWA 4I55A 3RYFB 1ZSPA 4QNHB 2B9ZA 2P1QB 1WP8A 4QE7A 1K33A 1N36O 5LYJA 4OX9B 3A0BZ 2OIEA 3C94A 3SGIA 1JFFB 3TAEA 4TUYA 4NXMO 4KI6A 1FPOA 4NTWA 3ZRXA 4MVSA 4LF5B 2GTAA 1CP9A 1BZKA 4RG8A 2OZMA 2EZPA 5H5NA 4XBFA 1YIJV 1LDKE 2F66C 1YVWA 2PTMA 5LMUO 1SA0B 2V4DA 3CJHB 4ZI7A 2ZIMA 4DR7O 2ADQB 1YI2V 1Q9XA 3IAYA 2Y0IA 2ZE6A 2RKHA 3SPZA 1Y74B 2XAJA 1TUBB 1JPXA 3OUSA 3BVOA 1FYJA 4FJ9A 4JYAB 4JI5O 1JFFA 3R65A 4B7EA 3JATB 4AQYO 3CP1A 4EPHA 2GTSA 2JVDA 1YZBA 1FFXA 1KECA 3HPLC 4O2BB 5IZ7A 1V54B 2UXDB 3SQ1A 4UCTA 1NZ6A 5FL7G 3MD0A 2EIKC 4KHYA 4TV9A 3T2MA 2F23A 1L0NH 1Y76B 1PP9H 4J2AA 1O9GA 2H3OA 2JEUA 2PI5A 5C8YB 1AB3A 2RDCA 4PD4F 2DYSB 4JRPA 4FK5C 5IT9N 1Y74A 2KQXA 3LDBA 1R3LC 2RMKB 4J7ZA 2P06A 4G27B 5J2UA 3OEHG 2MMBA 4FM2A 1QR8A 1R3JC 1E1QG 1SS3A 1QNMA 1BGYH 1OCOC 1VQ8V 2JQTA 4HNAB 4DUZB 4B3TB 1HW7A 3SPYA 1JOYA 5DEDA 1K73W 4RNGA 3FD9A 5IJ0A 2P7TC 3ABUA 1Y76A 1R73A 3B8NA 1HWYA 3OUFA 5K1XA 2BTQB 4TV8A 3ZCCA 2P5GA 4LFAO 3ASNB 3CFPA 4DV4B 2LFRA 2ZR3A 3K08A 4FJ5A 1XVDE 4CH6A 2YIAA 1HNXB 2IJKA 4LWSB 1R3KC 5JQGB 3QEXA 1JMKC 4FJLA 3SYAA 5KAIZ 3ETDA 1XILA 5LP6C 3E8FA 4QJFB 1KYOF 2Y48A 5LBQA 5KMGA 5CA0B 3TGUH 2YXYA 1OCCC 1NTZH 1OJHA 2DY4A 3A2FA 1KBHA 5KHHA 5DECA 1N36B 1AP6A 1WA8B 3CMEV 3AK3A 2YI9A 3VQYA 5KHKA 1MABG 4FPPA 4BIUA 3U0ZA 2Q4PA 4NXMB 1FZ9E 5H9CA 3ABKB 2QTOA 2Y4UA 1AI4A 1D5AA 1KMIZ 3W7UA 1AVMA 3STZC 4I9QA 2JDIG 3ZRVA 4FM1A 3FX7A 3AG3C 1FAFA 1KP3A 1K92A 2UUBO 3QETA 3PN1A 3STLC 3QEIA 3CCJV 5LMUB 4MTFA 1H2KA 4JV5O 1WPXA 2GHYA 1H38A 1MG1A 4DR7B 3P3PA 1FZ6E 4UCUA 3NDKA 1RPOA 4CBCA 2W0XA 5B1AC 4I9WA 3K59A 1VIBA 4JI5B 1NT2B 4ZIBA 2AZ2A 1M57B 2RCUA 4AQYB 4H13B 4O2AA 1K5SA 3JD1A 1CEZA 3SJBC 3D3IA 3LDSA 2YIBD 1PL4A 2GBOA 2YXLA 1KP2A 4LF4O 1SQQH 1H2NA 4FJIA 4W4LA 4DV0B 2YI8A 2VIXA 4FLUA 3LDEA 4YIPA 4LC1A 2FB5A 3OGLB 1M93A 2IBZH 4O4JA 5CB4B 5D5PA 1ZTEA 3RMCA 2ARHA 3RYHA 3CPWU 5L3DA 4D7TA 3TJYA 4LFCO 2QWOB 4LF7O 2CAZC 3CRCA 1SQVH 2P67A 3K0GA 2V1DA 1QHTA 4U3FH 4UXNA 3SPHA 2FYOA 3JALB 2MK3A 3WB2A 3BCCH 3V7DB 3T1HO 2V7QG 3CRRA 1M56C 3X2QC 3O65A 4DV6O 3WU2Z 1Q8IA 3GVMA 4RQFA 1S3JA 2B7MA 3ASOB 4CC6A 3M99B 4DTNA 1AROP 4F4LA 4FJNA 3IJ4A 4JI7B 3DXRA 3SYPA 1BQZA 3IGAC 2Q5ZA 1XHXA 5KUMA 1Q5OA 4FJ7A 1CXZB 2JHPA 2Q7GA 1YCIA 3ICXA 1SZXA 1K8AW 4MTXA 1QVFU 4PJ0Z 2ITCC 3JALA 3QO7A 3QG5A 4OXSA 4NTXA 1SRYA 1J5EB 4CC5A 1EN4A 1VARA 1FXHA 3E2EA 4W4KA 3FYEB 3ZN0A 5KHJA 3SUNA 3RBZA 4E4BA 3QO5A 1DF4A 4X20B 2PF4E 5A9GA 3I55V 4DU4A 3OE7G 4MT8A 3ZJZA 1AI5A 1FD9A 4JI0B 5LA6B 4LF9O 1NEXB 2ZNIA 3TXQA 2IJIA 2R9AA 4RUEA 3M8AA 5BMVA 4TQFA 1W0JG 3RT3C 1VF5B 1XMFE 2Q68A 1U97A 3SYQA 3APOA 1HP8A 2PZSA 2UUBB 4M3YA 4LF6O 2ILMA 4JV5B 2CUGA 4GLXA 5EBLC 1LR1A 1TAEA 3C3TA 1NH2B 5EZYA 2FKXA 2D3OW 5IJ9A 1RP3B 3N2GA 4UCOA 5KX5B 2JGDA 2KG7B 1NBMG 5BR8O 3JAKA 4O4LB 4RAIA 5IYZB 4X1IB 1VQNV 4E3SA 4Q20A 2YEVA 2ODMA 3BPZA 3NR7A 3QF7A 1WNSA 5AG2A 3BABA 1VQ4V 4UCVA 2HKOA 1WP7A 3S9HA 1YSCA 3SPJA 2JHCA 2A3QA 4P2ZA 3FB6C 4WBNB 4LF7B 3NCIA 4DTRA 4O4HB 3HKDB 2F4VB 1IBMO 4R6ZA 4QNCA 3SUQA 3SUPA 2A7WA 1XI1A 1GAXA 1FXKB 5IYZA 2Y69C 4GX2A 4I5SA 2B5UA 5LHIA 3HGLA 4FM0A 1QLEB 1ZAUA 3QEVA 2EIJC 3E35A 3T1YB 5GTIZ 3EFFK 3EHBB 2UXNA 2WLHA 5JJJB 4KHSA 4DTXA 4J41A 3U10A 3LNNA 3VQWA 1K7DA 4GYCB 4OX9O 3D36C 4CZZA 2NNUA 2AXTZ 3MDSA 1JR9A 4DR1O 5LGNA 4I4TB 4ICGC 4LF5O 3CEIA 1URFA 4JGSA 3UT5B 2JRIA 3CXHF 2HJDA 2QKAA 2L35A 5J9PC 2P1MB 1H2LA 4F6RA 4JYBA 4IIJA 3JD3A 4MVZA 4PA3A 2ZDIC 2VWJA 1US6A 4J9ZB 1G8MA 2Q6AA 1N0JA 1XU5E 3SPCA 1L8DA 3IC7A 3SI6A 3QNEA 4KHPB 3RN4A 1GTOA 5FLXN 1N33O 2PYLA 4U7OA 2EINC 4GKKO 2YDEA 3WB1A 4DTSA 2DOSA 2RCVA 3RW0A 3SQ2A 2EBOA 4MVQA 4JI4B 4LF6B 1JJ2U 1I94B 1MMOG 5B1NA 1HDJA 1KU9A 4X1YB 1YITV 4BW5A 2CK3G 4B3RO 3ABMB 2MW2A 3SQ0A 1RSOA 4PDMA 1DGSA 1XREA 1THZA 3UO2A 2CH7A 1F7YA 3HKBA 3OT7A 2PGGA 4UUJC 4M3RA 3JASB 1PV0A 1KUQA 4DTJA 5IY5C 2JK5C 1KKCA 4J7KA 5BR8B 3ZRWA 2BTOA 4TQDA 1H8EG 3L73H 4IHJB 4FLZA 2WA3A 3ABLC 3JD4A 4DUZO 1COWG 4ZBMA 3QNOA 2A79B 3T4DA 4TT3G 4D7SA 2OCCC 2OIGA 4AKHA 2QKCA 4I55B 4Z1VA 2LFSA 1UFIA 3SJCC 4B3MB 2PFTA 4AI6A 2DYRB 1JCHA 2YIDA 3GWOA 1K9MW 1S76D 3FB5C 1E1RG 5LYJB 1IBMB 4JZGA 4TUYB 3E89A 1S5HC 4BIZA 2WAMA 3OD4A 1NU1H 2DMXA 2WA4A 3E8HA 4IHJA 3CWBH 3SUOA 4K35A 1YDXA 1TA8A 2ATQA 1YJ9V 4OPHA 1JVMA 1V55C 4ZI7B 1N0NA 3KG2A 1H2SB 3H1LH 3WB0A 1Q90D 2PYJA 1FXXA 2JH8A 3CCQV 4J2EA 2CTWA 4JS5A 1I08A 3UQ8A 1K97A 2QR4A 3U11A 4KFMA 2ETNA 4XDJA 1AJQA 1IDSA 2UUCO 4DR1B 1QBZA 4U7NA 2EJRA 4WCEV 5LP6A 2ITDC 4G28B 1FFXB 2VQFO 4DV5B 2EZOA 4FK4A 4NKGB 1XMQB 2WLJA 3WFVA 1B04A 4TV9B 1FJGO 3T4ZA 3KD5E 3HKCA 3AG1C 1S0VA 3CSXA 1HR0O 2DE0X 3ZHUA 1UPGA 5B1AB 2Q69A 4X88A 3K9SA 4UVCA 1N33B 2WLNA 4GKKB 3DSQA 5J2UB 4DR6B 1KC8W 1YJNV 1XMHE 5DN6G 1R6KA 4JYYA 1EN6A 3JSNA 1SKVA 4ADNA 4DR3B 2VJ4A 1YTFB 3ETEA 3ZX6A 2P1NB 1AILA 5CA1A 2RJZA 4B3RB 1DK1A 5IJ0B 4DV0O 2OCHA 3JD0A 3ZHVA 3CQ8A 1D2DA 2QKSA 3J7AU 4TV8B 4DV1B 4FJKA 5IWAB 2DN9A 1SQXH 2X7RB 2IH3C 3H1JH 3C6OB 5LGUA 3CMAV 4U3JA 1XNQB 1BHAA 1FZIE 4HCCA 2YIBA 2X6BA 4Z1MG 1M9NA 1F51A 3LUTB 2LGWA 3GWKC 3L74H 5J2TA 5KMGB 5CA3A 4PA4A 1OCZB 3AG4B 2F1MA 1ENVA 3D8CA 3BA9A 4UFZA 4JI7O 1RM1C 2IU0A 3ZIAG 2UXCB 3K04A 4LNUA 1OZ0A 2HEPA 3IFXA 2AHYA 5LHGA 4X66B 4WF9V 3UKMA 1OV9A 3MHSC 4EP9A 3SJAC 3S3WA 2OTJV 1SQPH 1SERA 4UV8A 1BCCH 3CCVV 3DTUB 2YC0A 3M7MX 2ZCEA 4JAUA 4NR1A 5JVDA 1J5EO 4DRXA 2UUAB 2QSAA 2OZSA 5CBFA 3WG7C 3HR0A 3JARA 4CS3A 4HZ3A 2FTKA 3CCSV 3WSOA 1K34A 2WLLA 2W6IG 2EIMC 4AKIA 1VF7A 2ZINA 3KCYA 2PFVA 4WFBV 4JRQA 4JI0O 4DV2O 2R9RB 4KI4A 1R6TA 1XOUA 3TETA 4UVBA 1S5JA 1K4CC 2UUCB 1HNZO 3SVIA 2X6CA 2XAFA 2M7WA 4PV1B 3ZRSA 4O2AB 2CTPA 2IW5A 5L3CA 4JI6B 2VQFB 3E22A 1IURA 5KLVH 3OTFA 2QTSA 2N05A 3OR6C 1FJGB 1EFRG 1WN7A 4JAVA 5E1AC 4RQEA 1HR0B 4BW9A 5LXTB 2E75B 4O4JB 2JPNA 3F5WC 3ABTA 2QGNA 4YHHB 3RYHB 1GKFA 3UIQA 3OEEG 1CLQA 1QQCA 2E74B 3NGIA 1BS3A 3QNNA 3RMBA 2O57A 1AI7A 5LMNO 5GW7A 2WWWA 1VQOV 4H33A 4PI0A 3P30A 2Q8VA 1F23A 3BRCA 4M42A 2VWKA 3O9OA 1TVKA 3J27A 3TAFA 4F6EA 1MMMA 5LXTA 1SQGA 4K0KO 4Q6GA 4BIOA 1Y6XA 1B6QA 2WSSG 3DXRB 2ADPA 2PI4A 4JTCB 2QWRB 4X65B 2FYUH 2LW7A 1R1BA 4CS2A 1FS1A 1VQPV 2F4VO 4UV9A 4KL1A 3J2PA 3VQXA 2XAGA 2XTAA 4A5UB 5A2QN 3CFOA 3ETGA 3TK1A 2YS8A 1NKDA 4MVMA 2EIJB 1NI8A 2DYSC 5LOVA 4X1KA 4WFHA 3W7XA 1M90W 4MVOA 1VQLV 3ZHRA 2R70A 1VQKV 2IU3A 2W0FC 3T1YO 3K58A 5EBWC 4YY3B 1XMGE 5FPRA 2QWQB 5L3FA 4UVAA 3TABA 1K3EA 3CRQA 2QEXV 1JQ0A 4XDLA 3LD8A 3CD6V 2P22C 1H8HG 5BMVB 5KHGA 4DR2B 2B1EA 4YJ3A 3VOUA 1WAZA 2LJ2A 4NTYA 1ORQC 1U96A 2ZM6B 2ZIOA 3E86A 1OHHG 2HVJC 4LH6A 1VF6C 3OAAG 4B3SB 1QVGU 3NE6A 3ASNC 3BEHA 1ROPA 3AG7A 3EVKA 1YF2A 3N1BA 3FFQA 3AK1A 4I7ZB 5K1PA 2OVRB 1XQ8A 1BE3H 5EZYB 4NXNB 3OFNG 4X62O 4DV2B 4M3XA 3D36A 3MAQA 3TL8B 3LZIA 1QLNA 4QGPA 5IJ9B 3K5NA 2EILC 2Q67A 1HNZB 3N2GB 4KHPO 4X8AA 4FLXA 2JGDB 3J81N 2A0LA 4ICGA 2XT9A 4QIWF 3Q4HA 2LGQA 3JAKB 3HGKE 1WAJA 4KUMA 4LCUC 4PDRA 2P1OB 4PI2A 4JI4O 1I94O 4UB8Z 3QEWA 2YEVB 2Q0OC 4BR6A 2OVPB 1LUWA 1DF5A 4MVUA 2ZDIA 1EZJA 1RPRA 3ZN1A 3CXCU 5CN0A 2CTQA 3ABKC 4FZ0A 2JIZG 3CFRA 5IDJA 3G6BA 4JI8O 1M4UA 4ZHQA 2IH1C 3A0RA 3FKSG 1BL8A 5KUKA 3MKSB 4H44B 1Q6HA 5LMNB 2XAQA 1Y4MA 3DGEA 1G6UA 5FPOA 3L71H 3RVYA 2DWDC 1GM9A 4QE9A 4R8CA 1P22A 1XVEE 1IXBA 1UJWB 2W6JG 3CX5F 1NJIW 1PD3A 2PUSA 4JI3B 4K0KB 2VS0A 1M57C 4TSFG 5TISZ 4RL5A 4RWUA 5CBGA 3H1IH 3T1CA 3E8BA 4B3MO 1VMGA 4JTDB 1VQ6V 1XUQA 3HKEA 3G67A 4WFGA 1XL3C 3ZMVA 3VBBA 3B40A 1RFYA 1WJZA 1R6NA 2GSMB 2Q9LA 4DTUA 4FLWA 3TJTA 3CCEV 3W7TA 4J42A 3QTCA 3B09A 4J10A 2AGAA 1OCRC 1S77D 1IXMA 4ZOLA 1GRJA 2IJHA 4F6RB 2JJ1G 4IIJB 4E4EA 1IBLO 1X59A 2Y4TA 2M6YA 3LSUA 4YJ2A 2WLMA 4DV3B 3ZHSA 1SQBH 4LFBB 1FZHE 2WLKA 2ZE5A 2CE4A 3CB2A 1P7GA 3DC5A 4YXWG 3THOA 3CYOA 3NAEA 4J7JA 5CMUA 1MZEA 1XL4A 2QXFA 1KB9F 2AHZA 3AK2A 4DW1A 4FJMA 4FIPC 3JCZA 4NYKA 3OW2U 1XU3E 3LDDA 3CC2V 3K03A 4DXWA 4DV5O 2GDSA 4Z2WA 2E31A 1XMQO 3AG1B 2MW2B 4RUFA 5EIBD 2EULA 2UXXA 5EIBC 5IE9A 3RMAA 1RSOB 2BSKB 2KSDA 4JPRA 2GUZA 2CH7B 3UCSC 3HKBB 5BXZA 3NXSA 4X62B 1VEWA 3EXAA 4FFBA 1Q7YW 3CE2A 1M5IA 1W2BU 2RQ6A 2QA4V 4P30A 4J2BA 1QCEA 5C93A 4DR4O 4FJGA 2CTRA 3SNNA 5B3SC 4PDLA 3SPGA 1PNKA 4R50A 5LL6Y 4DR6O 4J2DA 2D2CB 3ZRWB 4GCZA 1I0HA 2RNBA 1T5EA 5EYPA 2C2AA 4DR3O 2EIKB 3UO3A 1MA1A 1IBKB 3A0HZ 1QU7A 3E4YA 1HNWO 1D5NA 2NN4A 4MSWC 2F43G 4WFAV 5IYCO 4KHNA 2BSKA 4WFFA 4LH7A 4FLVA 2LO1A 5B1BC 1FS0G 2BE3A 1FKAO 4DV1O 4KHWA 3R66A 4NB5A 4HAMA 4X89A 4M3UA 5IWAO 1GM8A 5IYDO 4JI8B 3TCUA 3RVZA 4E2LA 2G38A 1XNQO 1OCOB 1AI6A 3K5MA 3ZMSA 1JJOA 4LP8A 4MTOA 5JH7A 2ZD9A 4NVPA 4DV7O 4DU3A 1ZX3A 1Q3EA 3HP9A 3CC4V 1NH2D 2AZ0A 1WPBA 4YIOA 1AR5A 1FZ0E 2E32A 4RO2A 4IT5A 2P6JA 4GX0A 4K8ZA 2BCCH 5H37A 4X5NA 1RM1B 3QO8A 4LF8B 1IX9A 2OTLV 5KAFZ 2DQ0A 2UXCO 3JSLA 1KQSU 1LNQA 3JAWA 1P4RA 2E5LO 3OR7C 4X66O 1NQTA 2VRZA 1V9PA 2A06H 5LP6B 1Z2GA 2ZR2A 3ML0A 2HHHO 1SQFA 1OCCB 2UUAO 5KA5A 1IBLB 4I50A 3DC6A 3HKCB 2EX3A 1ZLZA 4X64B 3TXSA 4JAAA 5BZBA 3ZMZA 5JCOC 4R7CA 2QWPB 1FXKC 1F4MA 2XASA 1QLEC 3OGCC 2P4VA 2ZE8A 1E79G 5JJEB 3AG3B 1AJPA 2B1GA 3H9VA 4JI6O 4HBNA 4ABMA 1EM1A 4O4IA 4KHQA 5EK0A 4DK0A 4EYWA 3HB3B 5CA1B 3RYCA 3LSSA 4N23A 2ZXWC 3BHPA 1Y67A 3BY6A 4CH5A 3OTOB 3RGBA 1A32A 3K79A 4QPJA 5ITZB 4DR4B 4YHHO 3FAVA 3SPIA 3CRMA 4BAYA 3MHHC 2QM7A 1AR4A 4U3JB 4QNDA 3ZBHA 1GO3F 3RYFA 4L8JA 4GKJO 2LP7A 4M3WA 1ZUQA 1XNRO 3CC7V 3CCMV 4FJHA 1HNWB 1MZFA 2X6AA 3CS5A 3SYCA 2XUMA 3CCLV 5J2TB 1EN5A 3OMAB 2VQEB 4WFEA 1FZ3E 1NTMH 1DTOA 2BOBC 3L0MA 5ITZA 1XHZA 4JF3A 4PA6A 5L3BA 4LNUB 1XEQA 4X65O 4IYIA 1AR1B 2OWOA 1SA0A 2YICA 5KHIA 5JWPA 3SR2C 3G71V 4AILC 3CJHA 2UXBO 3ABMC 1N4CA 3F7YC 4DV7B 1M56B 1MTYG 2FL4A 3X2QB 1L0LH 3L72H 5JVDB 1TUBA 4DRXB 3N2KB 1FZ5E 1NTKH 3FYIB 1TGOA 3ETQA 5IBKB 2QDOA 3LNMB 3JARB 2LF6A 4LR3A 3JATA 4YY3O 1MNGA 1JX9A 2WLLB 4N21A 1PPJH 1Q6UA 4CH3A 3FB7C 3B4SA 2XOKG 4DK1A 3RWUA 4O2BA 1BHBA 1IVSA 1G4YB 4G2KA 4GT1A 2E5LB 4DR2O 3OMNB 3LDCA 5LHHA 2ZM6O 3G6EV 4JZ2A 5C8YA 1FZ2E 5H6RA 5D5QA 3E22B 2QWNB 2HHHB 3AG2C 3N2KA 3QVNA 4B3SO 5GTHZ 4L87A 2DYRC 5L3GA 1EBOA 4GZRB 4OGQB 1AP5A 1FYZE 2WPDG 2ZE7A 2K5SA 5EC2C 4NXNO 4HNAA 2EILB 2DTUA 1K4DC 5GONB 4FMTA 4H0LB 1NVPD 4DUYO 2DEBA 1VF6A 4MS2A 1FZ7E 2BTQA 2Q0AA 3ZS8C 1P84F 1Q9YA 2EJ7A 3AEIA 1PM9A 4JI2O 4PDVA 1TVKB 3JCUZ 1BMFG 1XVCE 1GH6A 3H1HH 4M45A 4GX1A 2KKWA 1GN2A 4LWSA 5CBHA 5JQGA 3K5LA 2E3CA 4FJXA 2Q7EA 2JH9A 4OPAA 3E8GA 5GONA 1XMOO 2JGUA 1Q81W 5IREA 1Q82W 2JEXA 3BAAA 5CA0A 1PKXA 3CCRV 2ZQMA 4GKJB 1SETA 3K0DA 1XNRB 3OGIB 3IC9A 3NHGA 4FLYA 1WA8A 3TAGA 4KHUA 2IM9A 5LOVB 1XDCA 4X1KB 4CH4A 1YHQV 4JI3O 4DU1A 1NR1A 2R72A 2HP8A 3GB7C 1AJNA 3OMIB 4P9OA 3RMDA 3FB8C 2DWEC 1M1KW 1H2MA 1FZ1E 1YTFD 1V54C 3LZJA 2FMLA 4YJ3B 3L8BA 2UXBB 2Y69B 1BQ0A 3VQVA 4B7KA 2JS5A 2L6LA 1OCRB 1J95A 2N74A 4GUNA 1FZ8E 3BFRA 2HG5C 3RWRD 2AW9A 5HFMA 1N32O 4FJ8A 2HD0A 1MSDA 1YXBA 3P3NA 2YSUB 4J11A 4ZKIA 5IYBO 5JJNB 4DV3O 4DYLA 1Y66A 3LSQA 4FLTA 4LFBO 3H1KH 4UCSA 2YB5A 3K5OA 2JJ2G 4KXRA 1YJWV 4FZ1A 1MOFA 3ZHQA 4DTOA 2ZKOA 1WAFA 2ZT9B 3Q4HB 1OCZC 3AG4C 1S72V 4LFAB 5CB4A 3OGMB 2H94A 4EEQA 3K57A 4HCBA 1SC5B 4JI1O 1Q86W 1GK9A 5HFLA 2CDYA 3W7SA 1VQ7V 1N8RW 3N1EA 3E4WA 5EBMC 4M3TA 4P9PA 1O9HA 2ZNJA 5FNVB 3C90A 2NLJC 1BT8A 3SQ4A 5B3SB 3A8TA 4HYOA 1XBLA 1SF9A 1MHYG 4DUYB 2EINB 4QPKA 1K5QA 1Z5VA 4ZHQB 4PELA 3SCXA 2LQTA 3RYIB 1FZ4E 2H4TA 4FK2A 2WLIB 3J80N 4FJJA 2CGNA 2F95B 1IBKO 4JI2B 4GAMC 4JYCA 1KD1W 1GN4A 2B1IA 1MSWD 5B1BB 3CRAA 2QM8A 4UCRA 1N1CA 2XHBA 4X9QA 4UB6Z 5FNVA 5L3EA 1ZL8B 1BSMA 1XMOB 2UU9O 2PY5A 3ZHTA 5IY5B 2HFEC 5E79Z 1GMGA 3HKEB 2Z5UA 2XAHA 1L1FA 1VQMV 4CS4A 3CCUV 3RYIA 1WLEA 3G4SV 3CHXA 4PA7A 4X20A 1P7BA 2OVQB 2MZWB 3ABLB 3E83A 4IL6Z 2WLIA 5H2FZ 3P32A 5LA6A 4PA9A 2OCCB 4TOIA 4ZOLB 1SZTA 4DR5O 2E76B 5B1OA 1KKDA 2BOCC 1IZ3A 3ZMTA 2QJ1A 4YJ2B 1W0KG 1GM7A 4EB6B 1N34O 3F7VC 4EFEA 4LF8O 1ZL8A 4AHCA 1EZVH 4I0XB 1WB8A 1Z5WA 3G80A 3C6NB 2GV9A 4LF4B 1XL6A 1MHZG 4FFKA 1VQ5V 4GX5A 4XDKA 2QE7G 3C3SA 2KB1A 3JAMN 1S5LZ 2IJJA 1N32B 3JYCA 3C6PB 1W59A 4LFCB 2N04A 1V55B 3QERA 5EC1C 1FXVA 2QM4A 5KX5A 2K1EA 4X64O 1F4NA 2KG7A 2GUZB 4EB6A 1FFTB 1NR7A 4O4LA 3SYOA 4X1IA 4FFBB 2VJ5A 2HJFC 4I0XA 2LW1A 3T1HB 4J80A 4AI8A 2X0LA 4LBEC 4DV6B 5BY1A 4FK0A 4K8XA 3S3XA 1CPYA 2JHAA 4I6JB 2Q7HA 3SJJA 1ZWIC 3ASOC 3QEPA 2NR5A 5EYPB 2A9HA 4WBNA 4JI1B 4FJCC 4O4HA 2K9PA 2ZXWB 3HKDA 3KCXA 4KP4A 3L1NA 1IH7A 4TWKA 5JCOA 3I56V 1FXKA 2DQ3A 1XVGE 3BA8A 1G1XB 1QR9A 3APQA 3OTOO 4DTMA 2FW3A 2DW4A 1X4TA 1NS1A 3ZMUA 3K3WA 3K2OA 2Z3YA 3HL8A 2LF3A 4ADOA 3F5TA 1GN3A 3D3QA 4M41A 1TUEB 1XVFE 3KZIZ 4BWAA 5B5EZ 4D6TH 4MW3A 1H2GA 5JH7B 3W7WA 3B8MA 3SDLA 3OGKB 4LF9B 1JA8A 2Y0PA 1PL0A 1VP7A 1B3QA 4K3AA 2CGOA 3L75H 5H6QA 4DTPA 2VQEO 4JYAO 4IGGA 4JASA 4I4TA 1Q43A 3JD2A 3B2EE 4MTGA 3L2OB 2UU9B 2ATKC 3C95A 1IG9A 3UT5A 4H37A 2UXDO 3K9AA 4C7UA 4DW0A 3JAWB 1R3IC 2OT5A 4JTAB 2H8PC 4MVRA 4MW8A 5DM6V 1WB7A 5KA6A 2YUAA 1I7FA 2OYQA 2RN9A 3RFRA 3L9DA 4PHZA 4DR5B 3H01A 3ZEDA 2R9IA 2Z0AA 4J9YB 4I50B 3I5DA 2Q73A 2P5OA 1N34B 4DO2A 1YEWA 3QESA 4IYHA 3KKYA 3KD1E 2JS3A 4B3TO 4AKGA 4X1YA 3OM3B 4M3ZA 1I5XA 1VQ9V 5B66Z 1SESA 2HVKC 3B77A 1PNMA 3AG2B 3PJSK 1GN6A
chains in the Genus database with same CATH topology
1N4CA 1XBLA 2OCHA 2N05A 2EJ7A 1N1CA 3BVOA 2QWRB 2QWOB 2CTQA 4J80A 3UO3A 1HDJA 2GUZA 2LGWA 3UCSC 2QWQB 1BQZA 2KQXA 1GH6A 3APOA 4J7ZA 3AG7A 2DN9A 2PF4E 2YUAA 3APQA 4RWUA 1BQ0A 2CTWA 2QWNB 3UO2A 2LO1A 2Y4UA 2CTRA 2QWPB 2L6LA 2N04A 2YS8A 2CTPA 2Y4TA 2M6YA 2DMXA 1NZ6A 2CUGA 2QSAA 1FAFA 2RKHA 4IT5A 1IURA 1FPOA 2GUZB 1WJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4C A;  1XBL A;  2OCH A;  2N05 A;  2EJ7 A;  1N1C A;  3BVO A;  2QWR B;  2QWO B;  2CTQ A;  4J80 A;  3UO3 A;  1HDJ A;  2GUZ A;  2LGW A;  3UCS C;  2QWQ B;  1BQZ A;  2KQX A;  1GH6 A;  3APO A;  4J7Z A;  3AG7 A;  2DN9 A;  2PF4 E;  2YUA A;  3APQ A;  4RWU A;  1BQ0 A;  2CTW A;  2QWN B;  3UO2 A;  2LO1 A;  2Y4U A;  2CTR A;  2QWP B;  2L6L A;  2N04 A;  2YS8 A;  2CTP A;  2Y4T A;  2M6Y A;  2DMX A;  1NZ6 A;  2CUG A;  2QSA A;  1FAF A;  2RKH A;  4IT5 A;  1IUR A;  1FPO A;  2GUZ B;  1WJZ A; 
#chains in the Genus database with same CATH topology
 3SJQ C;  4B08 A;  1B06 A;  4O4I B;  2HR3 A;  2P90 A;  5F2V O;  3JAS A;  4DV4 O;  4JS4 A;  2P4K A;  3UM7 A;  3RYC B;  1XVB E;  3WG7 B;  2P1P B;  2XND G;  2B8I A;  1DLB A;  4ASU G;  2EIM B;  1P49 A;  1HNX O;  1JW2 A;  4FVM A;  3K06 A;  1PNL A;  1I5Y A;  2YXH A;  4EFB A;  1Q6I A;  3N27 A;  1NVP B;  3FAV B;  3L70 H;  4I9L A;  4X5M A;  2F93 B;  2DJV A;  1LUV A;  5LGT A;  2HLD G;  4EKW A;  4I55 A;  3RYF B;  1ZSP A;  4QNH B;  2B9Z A;  2P1Q B;  1WP8 A;  4QE7 A;  1K33 A;  1N36 O;  5LYJ A;  4OX9 B;  3A0B Z;  2OIE A;  3C94 A;  3SGI A;  1JFF B;  3TAE A;  4TUY A;  4NXM O;  4KI6 A;  1FPO A;  4NTW A;  3ZRX A;  4MVS A;  4LF5 B;  2GTA A;  1CP9 A;  1BZK A;  4RG8 A;  2OZM A;  2EZP A;  5H5N A;  4XBF A;  1YIJ V;  1LDK E;  2F66 C;  1YVW A;  2PTM A;  5LMU O;  1SA0 B;  2V4D A;  3CJH B;  4ZI7 A;  2ZIM A;  4DR7 O;  2ADQ B;  1YI2 V;  1Q9X A;  3IAY A;  2Y0I A;  2ZE6 A;  2RKH A;  3SPZ A;  1Y74 B;  2XAJ A;  1TUB B;  1JPX A;  3OUS A;  3BVO A;  1FYJ A;  4FJ9 A;  4JYA B;  4JI5 O;  1JFF A;  3R65 A;  4B7E A;  3JAT B;  4AQY O;  3CP1 A;  4EPH A;  2GTS A;  2JVD A;  1YZB A;  1FFX A;  1KEC A;  3HPL C;  4O2B B;  5IZ7 A;  1V54 B;  2UXD B;  3SQ1 A;  4UCT A;  1NZ6 A;  5FL7 G;  3MD0 A;  2EIK C;  4KHY A;  4TV9 A;  3T2M A;  2F23 A;  1L0N H;  1Y76 B;  1PP9 H;  4J2A A;  1O9G A;  2H3O A;  2JEU A;  2PI5 A;  5C8Y B;  1AB3 A;  2RDC A;  4PD4 F;  2DYS B;  4JRP A;  4FK5 C;  5IT9 N;  1Y74 A;  2KQX A;  3LDB A;  1R3L C;  2RMK B;  4J7Z A;  2P06 A;  4G27 B;  5J2U A;  3OEH G;  2MMB A;  4FM2 A;  1QR8 A;  1R3J C;  1E1Q G;  1SS3 A;  1QNM A;  1BGY H;  1OCO C;  1VQ8 V;  2JQT A;  4HNA B;  4DUZ B;  4B3T B;  1HW7 A;  3SPY A;  1JOY A;  5DED A;  1K73 W;  4RNG A;  3FD9 A;  5IJ0 A;  2P7T C;  3ABU A;  1Y76 A;  1R73 A;  3B8N A;  1HWY A;  3OUF A;  5K1X A;  2BTQ B;  4TV8 A;  3ZCC A;  2P5G A;  4LFA O;  3ASN B;  3CFP A;  4DV4 B;  2LFR A;  2ZR3 A;  3K08 A;  4FJ5 A;  1XVD E;  4CH6 A;  2YIA A;  1HNX B;  2IJK A;  4LWS B;  1R3K C;  5JQG B;  3QEX A;  1JMK C;  4FJL A;  3SYA A;  5KAI Z;  3ETD A;  1XIL A;  5LP6 C;  3E8F A;  4QJF B;  1KYO F;  2Y48 A;  5LBQ A;  5KMG A;  5CA0 B;  3TGU H;  2YXY A;  1OCC C;  1NTZ H;  1OJH A;  2DY4 A;  3A2F A;  1KBH A;  5KHH A;  5DEC A;  1N36 B;  1AP6 A;  1WA8 B;  3CME V;  3AK3 A;  2YI9 A;  3VQY A;  5KHK A;  1MAB G;  4FPP A;  4BIU A;  3U0Z A;  2Q4P A;  4NXM B;  1FZ9 E;  5H9C A;  3ABK B;  2QTO A;  2Y4U A;  1AI4 A;  1D5A A;  1KMI Z;  3W7U A;  1AVM A;  3STZ C;  4I9Q A;  2JDI G;  3ZRV A;  4FM1 A;  3FX7 A;  3AG3 C;  1FAF A;  1KP3 A;  1K92 A;  2UUB O;  3QET A;  3PN1 A;  3STL C;  3QEI A;  3CCJ V;  5LMU B;  4MTF A;  1H2K A;  4JV5 O;  1WPX A;  2GHY A;  1H38 A;  1MG1 A;  4DR7 B;  3P3P A;  1FZ6 E;  4UCU A;  3NDK A;  1RPO A;  4CBC A;  2W0X A;  5B1A C;  4I9W A;  3K59 A;  1VIB A;  4JI5 B;  1NT2 B;  4ZIB A;  2AZ2 A;  1M57 B;  2RCU A;  4AQY B;  4H13 B;  4O2A A;  1K5S A;  3JD1 A;  1CEZ A;  3SJB C;  3D3I A;  3LDS A;  2YIB D;  1PL4 A;  2GBO A;  2YXL A;  1KP2 A;  4LF4 O;  1SQQ H;  1H2N A;  4FJI A;  4W4L A;  4DV0 B;  2YI8 A;  2VIX A;  4FLU A;  3LDE A;  4YIP A;  4LC1 A;  2FB5 A;  3OGL B;  1M93 A;  2IBZ H;  4O4J A;  5CB4 B;  5D5P A;  1ZTE A;  3RMC A;  2ARH A;  3RYH A;  3CPW U;  5L3D A;  4D7T A;  3TJY A;  4LFC O;  2QWO B;  4LF7 O;  2CAZ C;  3CRC A;  1SQV H;  2P67 A;  3K0G A;  2V1D A;  1QHT A;  4U3F H;  4UXN A;  3SPH A;  2FYO A;  3JAL B;  2MK3 A;  3WB2 A;  3BCC H;  3V7D B;  3T1H O;  2V7Q G;  3CRR A;  1M56 C;  3X2Q C;  3O65 A;  4DV6 O;  3WU2 Z;  1Q8I A;  3GVM A;  4RQF A;  1S3J A;  2B7M A;  3ASO B;  4CC6 A;  3M99 B;  4DTN A;  1ARO P;  4F4L A;  4FJN A;  3IJ4 A;  4JI7 B;  3DXR A;  3SYP A;  1BQZ A;  3IGA C;  2Q5Z A;  1XHX A;  5KUM A;  1Q5O A;  4FJ7 A;  1CXZ B;  2JHP A;  2Q7G A;  1YCI A;  3ICX A;  1SZX A;  1K8A W;  4MTX A;  1QVF U;  4PJ0 Z;  2ITC C;  3JAL A;  3QO7 A;  3QG5 A;  4OXS A;  4NTX A;  1SRY A;  1J5E B;  4CC5 A;  1EN4 A;  1VAR A;  1FXH A;  3E2E A;  4W4K A;  3FYE B;  3ZN0 A;  5KHJ A;  3SUN A;  3RBZ A;  4E4B A;  3QO5 A;  1DF4 A;  4X20 B;  2PF4 E;  5A9G A;  3I55 V;  4DU4 A;  3OE7 G;  4MT8 A;  3ZJZ A;  1AI5 A;  1FD9 A;  4JI0 B;  5LA6 B;  4LF9 O;  1NEX B;  2ZNI A;  3TXQ A;  2IJI A;  2R9A A;  4RUE A;  3M8A A;  5BMV A;  4TQF A;  1W0J G;  3RT3 C;  1VF5 B;  1XMF E;  2Q68 A;  1U97 A;  3SYQ A;  3APO A;  1HP8 A;  2PZS A;  2UUB B;  4M3Y A;  4LF6 O;  2ILM A;  4JV5 B;  2CUG A;  4GLX A;  5EBL C;  1LR1 A;  1TAE A;  3C3T A;  1NH2 B;  5EZY A;  2FKX A;  2D3O W;  5IJ9 A;  1RP3 B;  3N2G A;  4UCO A;  5KX5 B;  2JGD A;  2KG7 B;  1NBM G;  5BR8 O;  3JAK A;  4O4L B;  4RAI A;  5IYZ B;  4X1I B;  1VQN V;  4E3S A;  4Q20 A;  2YEV A;  2ODM A;  3BPZ A;  3NR7 A;  3QF7 A;  1WNS A;  5AG2 A;  3BAB A;  1VQ4 V;  4UCV A;  2HKO A;  1WP7 A;  3S9H A;  1YSC A;  3SPJ A;  2JHC A;  2A3Q A;  4P2Z A;  3FB6 C;  4WBN B;  4LF7 B;  3NCI A;  4DTR A;  4O4H B;  3HKD B;  2F4V B;  1IBM O;  4R6Z A;  4QNC A;  3SUQ A;  3SUP A;  2A7W A;  1XI1 A;  1GAX A;  1FXK B;  5IYZ A;  2Y69 C;  4GX2 A;  4I5S A;  2B5U A;  5LHI A;  3HGL A;  4FM0 A;  1QLE B;  1ZAU A;  3QEV A;  2EIJ C;  3E35 A;  3T1Y B;  5GTI Z;  3EFF K;  3EHB B;  2UXN A;  2WLH A;  5JJJ B;  4KHS A;  4DTX A;  4J41 A;  3U10 A;  3LNN A;  3VQW A;  1K7D A;  4GYC B;  4OX9 O;  3D36 C;  4CZZ A;  2NNU A;  2AXT Z;  3MDS A;  1JR9 A;  4DR1 O;  5LGN A;  4I4T B;  4ICG C;  4LF5 O;  3CEI A;  1URF A;  4JGS A;  3UT5 B;  2JRI A;  3CXH F;  2HJD A;  2QKA A;  2L35 A;  5J9P C;  2P1M B;  1H2L A;  4F6R A;  4JYB A;  4IIJ A;  3JD3 A;  4MVZ A;  4PA3 A;  2ZDI C;  2VWJ A;  1US6 A;  4J9Z B;  1G8M A;  2Q6A A;  1N0J A;  1XU5 E;  3SPC A;  1L8D A;  3IC7 A;  3SI6 A;  3QNE A;  4KHP B;  3RN4 A;  1GTO A;  5FLX N;  1N33 O;  2PYL A;  4U7O A;  2EIN C;  4GKK O;  2YDE A;  3WB1 A;  4DTS A;  2DOS A;  2RCV A;  3RW0 A;  3SQ2 A;  2EBO A;  4MVQ A;  4JI4 B;  4LF6 B;  1JJ2 U;  1I94 B;  1MMO G;  5B1N A;  1HDJ A;  1KU9 A;  4X1Y B;  1YIT V;  4BW5 A;  2CK3 G;  4B3R O;  3ABM B;  2MW2 A;  3SQ0 A;  1RSO A;  4PDM A;  1DGS A;  1XRE A;  1THZ A;  3UO2 A;  2CH7 A;  1F7Y A;  3HKB A;  3OT7 A;  2PGG A;  4UUJ C;  4M3R A;  3JAS B;  1PV0 A;  1KUQ A;  4DTJ A;  5IY5 C;  2JK5 C;  1KKC A;  4J7K A;  5BR8 B;  3ZRW A;  2BTO A;  4TQD A;  1H8E G;  3L73 H;  4IHJ B;  4FLZ A;  2WA3 A;  3ABL C;  3JD4 A;  4DUZ O;  1COW G;  4ZBM A;  3QNO A;  2A79 B;  3T4D A;  4TT3 G;  4D7S A;  2OCC C;  2OIG A;  4AKH A;  2QKC A;  4I55 B;  4Z1V A;  2LFS A;  1UFI A;  3SJC C;  4B3M B;  2PFT A;  4AI6 A;  2DYR B;  1JCH A;  2YID A;  3GWO A;  1K9M W;  1S76 D;  3FB5 C;  1E1R G;  5LYJ B;  1IBM B;  4JZG A;  4TUY B;  3E89 A;  1S5H C;  4BIZ A;  2WAM A;  3OD4 A;  1NU1 H;  2DMX A;  2WA4 A;  3E8H A;  4IHJ A;  3CWB H;  3SUO A;  4K35 A;  1YDX A;  1TA8 A;  2ATQ A;  1YJ9 V;  4OPH A;  1JVM A;  1V55 C;  4ZI7 B;  1N0N A;  3KG2 A;  1H2S B;  3H1L H;  3WB0 A;  1Q90 D;  2PYJ A;  1FXX A;  2JH8 A;  3CCQ V;  4J2E A;  2CTW A;  4JS5 A;  1I08 A;  3UQ8 A;  1K97 A;  2QR4 A;  3U11 A;  4KFM A;  2ETN A;  4XDJ A;  1AJQ A;  1IDS A;  2UUC O;  4DR1 B;  1QBZ A;  4U7N A;  2EJR A;  4WCE V;  5LP6 A;  2ITD C;  4G28 B;  1FFX B;  2VQF O;  4DV5 B;  2EZO A;  4FK4 A;  4NKG B;  1XMQ B;  2WLJ A;  3WFV A;  1B04 A;  4TV9 B;  1FJG O;  3T4Z A;  3KD5 E;  3HKC A;  3AG1 C;  1S0V A;  3CSX A;  1HR0 O;  2DE0 X;  3ZHU A;  1UPG A;  5B1A B;  2Q69 A;  4X88 A;  3K9S A;  4UVC A;  1N33 B;  2WLN A;  4GKK B;  3DSQ A;  5J2U B;  4DR6 B;  1KC8 W;  1YJN V;  1XMH E;  5DN6 G;  1R6K A;  4JYY A;  1EN6 A;  3JSN A;  1SKV A;  4ADN A;  4DR3 B;  2VJ4 A;  1YTF B;  3ETE A;  3ZX6 A;  2P1N B;  1AIL A;  5CA1 A;  2RJZ A;  4B3R B;  1DK1 A;  5IJ0 B;  4DV0 O;  2OCH A;  3JD0 A;  3ZHV A;  3CQ8 A;  1D2D A;  2QKS A;  3J7A U;  4TV8 B;  4DV1 B;  4FJK A;  5IWA B;  2DN9 A;  1SQX H;  2X7R B;  2IH3 C;  3H1J H;  3C6O B;  5LGU A;  3CMA V;  4U3J A;  1XNQ B;  1BHA A;  1FZI E;  4HCC A;  2YIB A;  2X6B A;  4Z1M G;  1M9N A;  1F51 A;  3LUT B;  2LGW A;  3GWK C;  3L74 H;  5J2T A;  5KMG B;  5CA3 A;  4PA4 A;  1OCZ B;  3AG4 B;  2F1M A;  1ENV A;  3D8C A;  3BA9 A;  4UFZ A;  4JI7 O;  1RM1 C;  2IU0 A;  3ZIA G;  2UXC B;  3K04 A;  4LNU A;  1OZ0 A;  2HEP A;  3IFX A;  2AHY A;  5LHG A;  4X66 B;  4WF9 V;  3UKM A;  1OV9 A;  3MHS C;  4EP9 A;  3SJA C;  3S3W A;  2OTJ V;  1SQP H;  1SER A;  4UV8 A;  1BCC H;  3CCV V;  3DTU B;  2YC0 A;  3M7M X;  2ZCE A;  4JAU A;  4NR1 A;  5JVD A;  1J5E O;  4DRX A;  2UUA B;  2QSA A;  2OZS A;  5CBF A;  3WG7 C;  3HR0 A;  3JAR A;  4CS3 A;  4HZ3 A;  2FTK A;  3CCS V;  3WSO A;  1K34 A;  2WLL A;  2W6I G;  2EIM C;  4AKI A;  1VF7 A;  2ZIN A;  3KCY A;  2PFV A;  4WFB V;  4JRQ A;  4JI0 O;  4DV2 O;  2R9R B;  4KI4 A;  1R6T A;  1XOU A;  3TET A;  4UVB A;  1S5J A;  1K4C C;  2UUC B;  1HNZ O;  3SVI A;  2X6C A;  2XAF A;  2M7W A;  4PV1 B;  3ZRS A;  4O2A B;  2CTP A;  2IW5 A;  5L3C A;  4JI6 B;  2VQF B;  3E22 A;  1IUR A;  5KLV H;  3OTF A;  2QTS A;  2N05 A;  3OR6 C;  1FJG B;  1EFR G;  1WN7 A;  4JAV A;  5E1A C;  4RQE A;  1HR0 B;  4BW9 A;  5LXT B;  2E75 B;  4O4J B;  2JPN A;  3F5W C;  3ABT A;  2QGN A;  4YHH B;  3RYH B;  1GKF A;  3UIQ A;  3OEE G;  1CLQ A;  1QQC A;  2E74 B;  3NGI A;  1BS3 A;  3QNN A;  3RMB A;  2O57 A;  1AI7 A;  5LMN O;  5GW7 A;  2WWW A;  1VQO V;  4H33 A;  4PI0 A;  3P30 A;  2Q8V A;  1F23 A;  3BRC A;  4M42 A;  2VWK A;  3O9O A;  1TVK A;  3J27 A;  3TAF A;  4F6E A;  1MMM A;  5LXT A;  1SQG A;  4K0K O;  4Q6G A;  4BIO A;  1Y6X A;  1B6Q A;  2WSS G;  3DXR B;  2ADP A;  2PI4 A;  4JTC B;  2QWR B;  4X65 B;  2FYU H;  2LW7 A;  1R1B A;  4CS2 A;  1FS1 A;  1VQP V;  2F4V O;  4UV9 A;  4KL1 A;  3J2P A;  3VQX A;  2XAG A;  2XTA A;  4A5U B;  5A2Q N;  3CFO A;  3ETG A;  3TK1 A;  2YS8 A;  1NKD A;  4MVM A;  2EIJ B;  1NI8 A;  2DYS C;  5LOV A;  4X1K A;  4WFH A;  3W7X A;  1M90 W;  4MVO A;  1VQL V;  3ZHR A;  2R70 A;  1VQK V;  2IU3 A;  2W0F C;  3T1Y O;  3K58 A;  5EBW C;  4YY3 B;  1XMG E;  5FPR A;  2QWQ B;  5L3F A;  4UVA A;  3TAB A;  1K3E A;  3CRQ A;  2QEX V;  1JQ0 A;  4XDL A;  3LD8 A;  3CD6 V;  2P22 C;  1H8H G;  5BMV B;  5KHG A;  4DR2 B;  2B1E A;  4YJ3 A;  3VOU A;  1WAZ A;  2LJ2 A;  4NTY A;  1ORQ C;  1U96 A;  2ZM6 B;  2ZIO A;  3E86 A;  1OHH G;  2HVJ C;  4LH6 A;  1VF6 C;  3OAA G;  4B3S B;  1QVG U;  3NE6 A;  3ASN C;  3BEH A;  1ROP A;  3AG7 A;  3EVK A;  1YF2 A;  3N1B A;  3FFQ A;  3AK1 A;  4I7Z B;  5K1P A;  2OVR B;  1XQ8 A;  1BE3 H;  5EZY B;  4NXN B;  3OFN G;  4X62 O;  4DV2 B;  4M3X A;  3D36 A;  3MAQ A;  3TL8 B;  3LZI A;  1QLN A;  4QGP A;  5IJ9 B;  3K5N A;  2EIL C;  2Q67 A;  1HNZ B;  3N2G B;  4KHP O;  4X8A A;  4FLX A;  2JGD B;  3J81 N;  2A0L A;  4ICG A;  2XT9 A;  4QIW F;  3Q4H A;  2LGQ A;  3JAK B;  3HGK E;  1WAJ A;  4KUM A;  4LCU C;  4PDR A;  2P1O B;  4PI2 A;  4JI4 O;  1I94 O;  4UB8 Z;  3QEW A;  2YEV B;  2Q0O C;  4BR6 A;  2OVP B;  1LUW A;  1DF5 A;  4MVU A;  2ZDI A;  1EZJ A;  1RPR A;  3ZN1 A;  3CXC U;  5CN0 A;  2CTQ A;  3ABK C;  4FZ0 A;  2JIZ G;  3CFR A;  5IDJ A;  3G6B A;  4JI8 O;  1M4U A;  4ZHQ A;  2IH1 C;  3A0R A;  3FKS G;  1BL8 A;  5KUK A;  3MKS B;  4H44 B;  1Q6H A;  5LMN B;  2XAQ A;  1Y4M A;  3DGE A;  1G6U A;  5FPO A;  3L71 H;  3RVY A;  2DWD C;  1GM9 A;  4QE9 A;  4R8C A;  1P22 A;  1XVE E;  1IXB A;  1UJW B;  2W6J G;  3CX5 F;  1NJI W;  1PD3 A;  2PUS A;  4JI3 B;  4K0K B;  2VS0 A;  1M57 C;  4TSF G;  5TIS Z;  4RL5 A;  4RWU A;  5CBG A;  3H1I H;  3T1C A;  3E8B A;  4B3M O;  1VMG A;  4JTD B;  1VQ6 V;  1XUQ A;  3HKE A;  3G67 A;  4WFG A;  1XL3 C;  3ZMV A;  3VBB A;  3B40 A;  1RFY A;  1WJZ A;  1R6N A;  2GSM B;  2Q9L A;  4DTU A;  4FLW A;  3TJT A;  3CCE V;  3W7T A;  4J42 A;  3QTC A;  3B09 A;  4J10 A;  2AGA A;  1OCR C;  1S77 D;  1IXM A;  4ZOL A;  1GRJ A;  2IJH A;  4F6R B;  2JJ1 G;  4IIJ B;  4E4E A;  1IBL O;  1X59 A;  2Y4T A;  2M6Y A;  3LSU A;  4YJ2 A;  2WLM A;  4DV3 B;  3ZHS A;  1SQB H;  4LFB B;  1FZH E;  2WLK A;  2ZE5 A;  2CE4 A;  3CB2 A;  1P7G A;  3DC5 A;  4YXW G;  3THO A;  3CYO A;  3NAE A;  4J7J A;  5CMU A;  1MZE A;  1XL4 A;  2QXF A;  1KB9 F;  2AHZ A;  3AK2 A;  4DW1 A;  4FJM A;  4FIP C;  3JCZ A;  4NYK A;  3OW2 U;  1XU3 E;  3LDD A;  3CC2 V;  3K03 A;  4DXW A;  4DV5 O;  2GDS A;  4Z2W A;  2E31 A;  1XMQ O;  3AG1 B;  2MW2 B;  4RUF A;  5EIB D;  2EUL A;  2UXX A;  5EIB C;  5IE9 A;  3RMA A;  1RSO B;  2BSK B;  2KSD A;  4JPR A;  2GUZ A;  2CH7 B;  3UCS C;  3HKB B;  5BXZ A;  3NXS A;  4X62 B;  1VEW A;  3EXA A;  4FFB A;  1Q7Y W;  3CE2 A;  1M5I A;  1W2B U;  2RQ6 A;  2QA4 V;  4P30 A;  4J2B A;  1QCE A;  5C93 A;  4DR4 O;  4FJG A;  2CTR A;  3SNN A;  5B3S C;  4PDL A;  3SPG A;  1PNK A;  4R50 A;  5LL6 Y;  4DR6 O;  4J2D A;  2D2C B;  3ZRW B;  4GCZ A;  1I0H A;  2RNB A;  1T5E A;  5EYP A;  2C2A A;  4DR3 O;  2EIK B;  3UO3 A;  1MA1 A;  1IBK B;  3A0H Z;  1QU7 A;  3E4Y A;  1HNW O;  1D5N A;  2NN4 A;  4MSW C;  2F43 G;  4WFA V;  5IYC O;  4KHN A;  2BSK A;  4WFF A;  4LH7 A;  4FLV A;  2LO1 A;  5B1B C;  1FS0 G;  2BE3 A;  1FKA O;  4DV1 O;  4KHW A;  3R66 A;  4NB5 A;  4HAM A;  4X89 A;  4M3U A;  5IWA O;  1GM8 A;  5IYD O;  4JI8 B;  3TCU A;  3RVZ A;  4E2L A;  2G38 A;  1XNQ O;  1OCO B;  1AI6 A;  3K5M A;  3ZMS A;  1JJO A;  4LP8 A;  4MTO A;  5JH7 A;  2ZD9 A;  4NVP A;  4DV7 O;  4DU3 A;  1ZX3 A;  1Q3E A;  3HP9 A;  3CC4 V;  1NH2 D;  2AZ0 A;  1WPB A;  4YIO A;  1AR5 A;  1FZ0 E;  2E32 A;  4RO2 A;  4IT5 A;  2P6J A;  4GX0 A;  4K8Z A;  2BCC H;  5H37 A;  4X5N A;  1RM1 B;  3QO8 A;  4LF8 B;  1IX9 A;  2OTL V;  5KAF Z;  2DQ0 A;  2UXC O;  3JSL A;  1KQS U;  1LNQ A;  3JAW A;  1P4R A;  2E5L O;  3OR7 C;  4X66 O;  1NQT A;  2VRZ A;  1V9P A;  2A06 H;  5LP6 B;  1Z2G A;  2ZR2 A;  3ML0 A;  2HHH O;  1SQF A;  1OCC B;  2UUA O;  5KA5 A;  1IBL B;  4I50 A;  3DC6 A;  3HKC B;  2EX3 A;  1ZLZ A;  4X64 B;  3TXS A;  4JAA A;  5BZB A;  3ZMZ A;  5JCO C;  4R7C A;  2QWP B;  1FXK C;  1F4M A;  2XAS A;  1QLE C;  3OGC C;  2P4V A;  2ZE8 A;  1E79 G;  5JJE B;  3AG3 B;  1AJP A;  2B1G A;  3H9V A;  4JI6 O;  4HBN A;  4ABM A;  1EM1 A;  4O4I A;  4KHQ A;  5EK0 A;  4DK0 A;  4EYW A;  3HB3 B;  5CA1 B;  3RYC A;  3LSS A;  4N23 A;  2ZXW C;  3BHP A;  1Y67 A;  3BY6 A;  4CH5 A;  3OTO B;  3RGB A;  1A32 A;  3K79 A;  4QPJ A;  5ITZ B;  4DR4 B;  4YHH O;  3FAV A;  3SPI A;  3CRM A;  4BAY A;  3MHH C;  2QM7 A;  1AR4 A;  4U3J B;  4QND A;  3ZBH A;  1GO3 F;  3RYF A;  4L8J A;  4GKJ O;  2LP7 A;  4M3W A;  1ZUQ A;  1XNR O;  3CC7 V;  3CCM V;  4FJH A;  1HNW B;  1MZF A;  2X6A A;  3CS5 A;  3SYC A;  2XUM A;  3CCL V;  5J2T B;  1EN5 A;  3OMA B;  2VQE B;  4WFE A;  1FZ3 E;  1NTM H;  1DTO A;  2BOB C;  3L0M A;  5ITZ A;  1XHZ A;  4JF3 A;  4PA6 A;  5L3B A;  4LNU B;  1XEQ A;  4X65 O;  4IYI A;  1AR1 B;  2OWO A;  1SA0 A;  2YIC A;  5KHI A;  5JWP A;  3SR2 C;  3G71 V;  4AIL C;  3CJH A;  2UXB O;  3ABM C;  1N4C A;  3F7Y C;  4DV7 B;  1M56 B;  1MTY G;  2FL4 A;  3X2Q B;  1L0L H;  3L72 H;  5JVD B;  1TUB A;  4DRX B;  3N2K B;  1FZ5 E;  1NTK H;  3FYI B;  1TGO A;  3ETQ A;  5IBK B;  2QDO A;  3LNM B;  3JAR B;  2LF6 A;  4LR3 A;  3JAT A;  4YY3 O;  1MNG A;  1JX9 A;  2WLL B;  4N21 A;  1PPJ H;  1Q6U A;  4CH3 A;  3FB7 C;  3B4S A;  2XOK G;  4DK1 A;  3RWU A;  4O2B A;  1BHB A;  1IVS A;  1G4Y B;  4G2K A;  4GT1 A;  2E5L B;  4DR2 O;  3OMN B;  3LDC A;  5LHH A;  2ZM6 O;  3G6E V;  4JZ2 A;  5C8Y A;  1FZ2 E;  5H6R A;  5D5Q A;  3E22 B;  2QWN B;  2HHH B;  3AG2 C;  3N2K A;  3QVN A;  4B3S O;  5GTH Z;  4L87 A;  2DYR C;  5L3G A;  1EBO A;  4GZR B;  4OGQ B;  1AP5 A;  1FYZ E;  2WPD G;  2ZE7 A;  2K5S A;  5EC2 C;  4NXN O;  4HNA A;  2EIL B;  2DTU A;  1K4D C;  5GON B;  4FMT A;  4H0L B;  1NVP D;  4DUY O;  2DEB A;  1VF6 A;  4MS2 A;  1FZ7 E;  2BTQ A;  2Q0A A;  3ZS8 C;  1P84 F;  1Q9Y A;  2EJ7 A;  3AEI A;  1PM9 A;  4JI2 O;  4PDV A;  1TVK B;  3JCU Z;  1BMF G;  1XVC E;  1GH6 A;  3H1H H;  4M45 A;  4GX1 A;  2KKW A;  1GN2 A;  4LWS A;  5CBH A;  5JQG A;  3K5L A;  2E3C A;  4FJX A;  2Q7E A;  2JH9 A;  4OPA A;  3E8G A;  5GON A;  1XMO O;  2JGU A;  1Q81 W;  5IRE A;  1Q82 W;  2JEX A;  3BAA A;  5CA0 A;  1PKX A;  3CCR V;  2ZQM A;  4GKJ B;  1SET A;  3K0D A;  1XNR B;  3OGI B;  3IC9 A;  3NHG A;  4FLY A;  1WA8 A;  3TAG A;  4KHU A;  2IM9 A;  5LOV B;  1XDC A;  4X1K B;  4CH4 A;  1YHQ V;  4JI3 O;  4DU1 A;  1NR1 A;  2R72 A;  2HP8 A;  3GB7 C;  1AJN A;  3OMI B;  4P9O A;  3RMD A;  3FB8 C;  2DWE C;  1M1K W;  1H2M A;  1FZ1 E;  1YTF D;  1V54 C;  3LZJ A;  2FML A;  4YJ3 B;  3L8B A;  2UXB B;  2Y69 B;  1BQ0 A;  3VQV A;  4B7K A;  2JS5 A;  2L6L A;  1OCR B;  1J95 A;  2N74 A;  4GUN A;  1FZ8 E;  3BFR A;  2HG5 C;  3RWR D;  2AW9 A;  5HFM A;  1N32 O;  4FJ8 A;  2HD0 A;  1MSD A;  1YXB A;  3P3N A;  2YSU B;  4J11 A;  4ZKI A;  5IYB O;  5JJN B;  4DV3 O;  4DYL A;  1Y66 A;  3LSQ A;  4FLT A;  4LFB O;  3H1K H;  4UCS A;  2YB5 A;  3K5O A;  2JJ2 G;  4KXR A;  1YJW V;  4FZ1 A;  1MOF A;  3ZHQ A;  4DTO A;  2ZKO A;  1WAF A;  2ZT9 B;  3Q4H B;  1OCZ C;  3AG4 C;  1S72 V;  4LFA B;  5CB4 A;  3OGM B;  2H94 A;  4EEQ A;  3K57 A;  4HCB A;  1SC5 B;  4JI1 O;  1Q86 W;  1GK9 A;  5HFL A;  2CDY A;  3W7S A;  1VQ7 V;  1N8R W;  3N1E A;  3E4W A;  5EBM C;  4M3T A;  4P9P A;  1O9H A;  2ZNJ A;  5FNV B;  3C90 A;  2NLJ C;  1BT8 A;  3SQ4 A;  5B3S B;  3A8T A;  4HYO A;  1XBL A;  1SF9 A;  1MHY G;  4DUY B;  2EIN B;  4QPK A;  1K5Q A;  1Z5V A;  4ZHQ B;  4PEL A;  3SCX A;  2LQT A;  3RYI B;  1FZ4 E;  2H4T A;  4FK2 A;  2WLI B;  3J80 N;  4FJJ A;  2CGN A;  2F95 B;  1IBK O;  4JI2 B;  4GAM C;  4JYC A;  1KD1 W;  1GN4 A;  2B1I A;  1MSW D;  5B1B B;  3CRA A;  2QM8 A;  4UCR A;  1N1C A;  2XHB A;  4X9Q A;  4UB6 Z;  5FNV A;  5L3E A;  1ZL8 B;  1BSM A;  1XMO B;  2UU9 O;  2PY5 A;  3ZHT A;  5IY5 B;  2HFE C;  5E79 Z;  1GMG A;  3HKE B;  2Z5U A;  2XAH A;  1L1F A;  1VQM V;  4CS4 A;  3CCU V;  3RYI A;  1WLE A;  3G4S V;  3CHX A;  4PA7 A;  4X20 A;  1P7B A;  2OVQ B;  2MZW B;  3ABL B;  3E83 A;  4IL6 Z;  2WLI A;  5H2F Z;  3P32 A;  5LA6 A;  4PA9 A;  2OCC B;  4TOI A;  4ZOL B;  1SZT A;  4DR5 O;  2E76 B;  5B1O A;  1KKD A;  2BOC C;  1IZ3 A;  3ZMT A;  2QJ1 A;  4YJ2 B;  1W0K G;  1GM7 A;  4EB6 B;  1N34 O;  3F7V C;  4EFE A;  4LF8 O;  1ZL8 A;  4AHC A;  1EZV H;  4I0X B;  1WB8 A;  1Z5W A;  3G80 A;  3C6N B;  2GV9 A;  4LF4 B;  1XL6 A;  1MHZ G;  4FFK A;  1VQ5 V;  4GX5 A;  4XDK A;  2QE7 G;  3C3S A;  2KB1 A;  3JAM N;  1S5L Z;  2IJJ A;  1N32 B;  3JYC A;  3C6P B;  1W59 A;  4LFC B;  2N04 A;  1V55 B;  3QER A;  5EC1 C;  1FXV A;  2QM4 A;  5KX5 A;  2K1E A;  4X64 O;  1F4N A;  2KG7 A;  2GUZ B;  4EB6 A;  1FFT B;  1NR7 A;  4O4L A;  3SYO A;  4X1I A;  4FFB B;  2VJ5 A;  2HJF C;  4I0X A;  2LW1 A;  3T1H B;  4J80 A;  4AI8 A;  2X0L A;  4LBE C;  4DV6 B;  5BY1 A;  4FK0 A;  4K8X A;  3S3X A;  1CPY A;  2JHA A;  4I6J B;  2Q7H A;  3SJJ A;  1ZWI C;  3ASO C;  3QEP A;  2NR5 A;  5EYP B;  2A9H A;  4WBN A;  4JI1 B;  4FJC C;  4O4H A;  2K9P A;  2ZXW B;  3HKD A;  3KCX A;  4KP4 A;  3L1N A;  1IH7 A;  4TWK A;  5JCO A;  3I56 V;  1FXK A;  2DQ3 A;  1XVG E;  3BA8 A;  1G1X B;  1QR9 A;  3APQ A;  3OTO O;  4DTM A;  2FW3 A;  2DW4 A;  1X4T A;  1NS1 A;  3ZMU A;  3K3W A;  3K2O A;  2Z3Y A;  3HL8 A;  2LF3 A;  4ADO A;  3F5T A;  1GN3 A;  3D3Q A;  4M41 A;  1TUE B;  1XVF E;  3KZI Z;  4BWA A;  5B5E Z;  4D6T H;  4MW3 A;  1H2G A;  5JH7 B;  3W7W A;  3B8M A;  3SDL A;  3OGK B;  4LF9 B;  1JA8 A;  2Y0P A;  1PL0 A;  1VP7 A;  1B3Q A;  4K3A A;  2CGO A;  3L75 H;  5H6Q A;  4DTP A;  2VQE O;  4JYA O;  4IGG A;  4JAS A;  4I4T A;  1Q43 A;  3JD2 A;  3B2E E;  4MTG A;  3L2O B;  2UU9 B;  2ATK C;  3C95 A;  1IG9 A;  3UT5 A;  4H37 A;  2UXD O;  3K9A A;  4C7U A;  4DW0 A;  3JAW B;  1R3I C;  2OT5 A;  4JTA B;  2H8P C;  4MVR A;  4MW8 A;  5DM6 V;  1WB7 A;  5KA6 A;  2YUA A;  1I7F A;  2OYQ A;  2RN9 A;  3RFR A;  3L9D A;  4PHZ A;  4DR5 B;  3H01 A;  3ZED A;  2R9I A;  2Z0A A;  4J9Y B;  4I50 B;  3I5D A;  2Q73 A;  2P5O A;  1N34 B;  4DO2 A;  1YEW A;  3QES A;  4IYH A;  3KKY A;  3KD1 E;  2JS3 A;  4B3T O;  4AKG A;  4X1Y A;  3OM3 B;  4M3Z A;  1I5X A;  1VQ9 V;  5B66 Z;  1SES A;  2HVK C;  3B77 A;  1PNM A;  3AG2 B;  3PJS K;  1GN6 A; 
#chains in the Genus database with same CATH homology
 1N4C A;  1XBL A;  2OCH A;  2N05 A;  2EJ7 A;  1N1C A;  3BVO A;  2QWR B;  2QWO B;  2CTQ A;  4J80 A;  3UO3 A;  1HDJ A;  2GUZ A;  2LGW A;  3UCS C;  2QWQ B;  1BQZ A;  2KQX A;  1GH6 A;  3APO A;  4J7Z A;  3AG7 A;  2DN9 A;  2PF4 E;  2YUA A;  3APQ A;  4RWU A;  1BQ0 A;  2CTW A;  2QWN B;  3UO2 A;  2LO1 A;  2Y4U A;  2CTR A;  2QWP B;  2L6L A;  2N04 A;  2YS8 A;  2CTP A;  2Y4T A;  2M6Y A;  2DMX A;  1NZ6 A;  2CUG A;  2QSA A;  1FAF A;  2RKH A;  4IT5 A;  1IUR A;  1FPO A;  2GUZ B;  1WJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...