3UO2A

Jac1 co-chaperone from saccharomyces cerevisiae
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
169
structure length
160
Chain Sequence
FTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of j-protein co-chaperone jac1 with fe-s scaffold isu is indispensable in vivo and conserved in evolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords J-type co-chaperone JAC1, mitochondrial
total genus 62
structure length 160
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3uo2A01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3uo2A02
2GUZA 2M6YA 1HDJA 1NZ6A 2CTQA 2PF4E 2LO1A 3BVOA 2RKHA 2DN9A 2QWOB 2N05A 1N4CA 2GUZB 3UO3A 1FAFA 1N1CA 2YUAA 1WJZA 2QWNB 2QWPB 3AG7A 1XBLA 1FPOA 3UO2A 2LGWA 2N04A 4RWUA 2KQXA 2OCHA 2QWQB 2QSAA 3UCSC 1BQ0A 2CTPA 1BQZA 2QWRB 2EJ7A 2Y4TA 2CTRA 3APOA 4J7ZA 4IT5A 2Y4UA 2YS8A 3APQA 2L6LA 2CUGA 1IURA 4J80A 2CTWA 2DMXA 1GH6A
chains in the Genus database with same CATH superfamily
1MG1A 3IGAC 4DU4A 3CRRA 4GX2A 4EEQA 1FZ9E 2YIBD 3P3NA 1YIJV 1KD1W 1J95A 3AG4C 3RYFB 1TAEA 1L1FA 1FS1A 5LMNB 1AJNA 2PFVA 4K8ZA 2MZWB 4WFBV 5IT9N 1Q5OA 1QVGU 1Q90D 2PFTA 2XAQA 2YS8A 1FZ0E 2UXCB 2IH3C 2E32A 2B5UA 1VQ5V 2Y48A 4TT3G 3KZIZ 4I0XA 1BL8A 4IL6Z 4I6JB 2JGDA 3BY6A 4M45A 1YF2A 2GTAA 5LGUA 4WFEA 4QPKA 3RMAA 4PDMA 3J27A 1JPXA 1GMGA 1ROPA 3ZHSA 1V9PA 4J42A 4F6EA 2XOKG 2ATKC 2X7RB 1JFFB 4TV9B 1JJOA 3M99B 4ZKIA 3ZEDA 3BA9A 4H37A 4RG8A 4KI4A 2IH1C 4M42A 1P7BA 4DV2B 1NR1A 2AHYA 3JATA 1YJWV 5D5QA 5IJ9A 5IYBO 2X6BA 4U3FH 4R50A 2OZMA 4RAIA 4E2LA 3HKEA 3CCUV 3N2KB 1WN7A 3BAAA 3N2GA 4M3TA 4LFBO 3CFPA 1IZ3A 5HFLA 5J2TB 3ZX6A 1LR1A 1E79G 3ABLC 2QA4V 3BCCH 3G67A 5EC2C 4DUZO 1FPOA 3G4SV 4ADOA 4FMTA 5C8YA 1M56C 4KFMA 1O9GA 4DV1B 2CGOA 2V1DA 3EVKA 4OX9O 3ZMTA 4KUMA 1TUBB 3T2MA 3E35A 4UVCA 4JI5B 2BTOA 4FZ1A 5DEDA 3AK1A 1QR8A 2OIEA 4X1IB 3SYCA 2G38A 1IXMA 4AKIA 3OGLB 2Y0IA 1HNZB 1MA1A 3AG7A 3BHPA 3MD0A 1XILA 2RN9A 3N27A 5LMUB 4CH6A 1GKFA 3CPWU 1XVBE 1S5LZ 2KG7B 2FKXA 4QNHB 2UXBO 1BZKA 2NLJC 4K0KO 3K04A 4BWAA 1YSCA 5LA6A 4H13B 1NVPD 1LUVA 1F4MA 3E22A 4H33A 1XDCA 4CH5A 3CX5F 4DTPA 4J2EA 2ZNJA 1S72V 3HP9A 4LF7O 2K9PA 2OCHA 5JQGA 4DU1A 3RYFA 3K5LA 3RVZA 2HHHB 3K03A 3BPZA 3R65A 1NKDA 4DR5B 2QXFA 2QTOA 1XVCE 4Q20A 3FAVA 3SYOA 4M3YA 2GUZB 5JCOA 1RM1C 2ZKOA 2JJ1G 5A9GA 1N34B 4OX9B 5KAIZ 4X64O 4MVZA 4L8JA 1UJWB 1N36B 3C6PB 2EILC 2HVJC 1JJ2U 4MVOA 3B8MA 3K06A 1SRYA 5IE9A 4FJKA 1HW7A 3JD3A 4B7KA 2JVDA 2KB1A 5GONA 3STZC 3E8GA 5FPRA 5CN0A 4O4HA 3A0HZ 1RFYA 1YCIA 1N32B 4DW0A 1AILA 1I5XA 3R66A 1H2LA 3ZRXA 2IJKA 2Q6AA 3ASNC 1NQTA 3JCUZ 3ML0A 3WB1A 3B09A 1L0LH 2P4KA 1ORQC 5EYPB 2Q68A 5LHGA 3ZRVA 2HR3A 3E8FA 4GUNA 4JI8B 3SQ2A 5JJEB 2JHPA 1FJGB 2BSKA 3SNNA 3JAKA 4FVMA 4JYCA 3CXCU 4MT8A 3ETGA 4PHZA 4O2BB 1UPGA 2VQEB 2R9IA 2DTUA 2GV9A 2WLMA 2QKCA 2E31A 2GTSA 4UCUA 4FJCC 4AKHA 1N8RW 5JJJB 5FLXN 2FB5A 1IG9A 3T1HO 5B1AB 2ETNA 2EZOA 2ADQB 1BHBA 2P67A 5H6RA 1PNMA 1FFXB 3TGUH 3DXRB 4BIZA 3L0MA 2OWOA 4LFCO 3RYIB 5KA5A 4GKJO 3OM3B 4IHJB 4DR2B 5LL6Y 5CBHA 5BXZA 4DV3B 4X1YB 1P7GA 1W0KG 3DTUB 2OIGA 1OV9A 2VQFB 2AZ2A 2PYLA 4E3SA 1FZ7E 2K5SA 1W2BU 1BGYH 4JI2B 1HNWB 4JZGA 5J2UB 3TXSA 1Q9XA 3FB6C 1G6UA 2NN4A 3GWKC 4PELA 4M3UA 3PJSK 3QEPA 5DN6G 4RQEA 3E2EA 4AKGA 1IDSA 3SJJA 3CE2A 3VQWA 1SF9A 2XAJA 3OUFA 4DTJA 3ABMC 3U10A 4WBNA 4ZBMA 4DK0A 3PN1A 1IXBA 2PZSA 4MVSA 4KL1A 2JS3A 1VQ4V 5E1AC 5CBFA 2UXCO 4CS2A 4X89A 1GM9A 4CH3A 1KP2A 1KMIZ 2QWNB 3H9VA 1XMQB 5BZBA 2P1MB 1Q6UA 1Q6IA 5LYJB 4XDKA 3W7WA 3AG2C 4D7TA 3X2QC 3NGIA 3QEXA 1RP3B 4GLXA 1Q82W 4LFCB 4QE7A 1WAZA 4NXMB 3DC5A 4LF6B 2CTQA 4LWSA 3G6BA 2CH7B 3RYCB 3JSNA 4MVRA 2LF3A 2OZSA 1XBLA 3LNNA 2BE3A 3QEIA 3HKCB 1YHQV 1NS1A 4WFFA 4BIOA 2UUCB 4TV9A 3CRMA 1MHYG 4PJ0Z 3QF7A 2ZDIC 2JJ2G 4ICGA 4ZHQA 3OGCC 2ZIOA 1EM1A 1QU7A 1YXBA 5LMUO 4AHCA 4CC6A 3P3PA 2JHCA 1M90W 5EYPA 3B77A 4KHYA 5IZ7A 4UVAA 3FKSG 1J5EB 4DXWA 3HKEB 2OVPB 1NEXB 3N2GB 2WA4A 1BS3A 1FXXA 3K08A 2WLIB 3HKDB 1FZ6E 5LOVB 2F23A 1NBMG 1BSMA 1FXVA 1H2MA 4WFGA 2A06H 3OUSA 4FJHA 3E22B 3RBZA 3ETQA 4MW3A 1VQ6V 1KKDA 1K34A 5EIBD 2LGQA 1K92A 5GTHZ 5JH7B 3L2OB 1Y66A 4JAVA 4AILC 1IBKB 2JDIG 1KC8W 1GM8A 1M57C 3CMEV 2XHBA 1WPXA 1MHZG 4NKGB 3K3WA 5IBKB 1DF4A 4FFBB 2A7WA 1NH2B 4JI0O 3B40A 2E3CA 1XL3C 4JAAA 4TSFG 3G80A 2VQEO 4PI0A 2Z3YA 4A5UB 1M56B 4R8CA 1F7YA 3ZBHA 4RUEA 1WJZA 2QKSA 1X4TA 4O2AA 2X6CA 5J9PC 4NXNO 4BW9A 3AG4B 3WG7B 5LA6B 1V55B 3VQYA 4TUYA 2EILB 4JI7B 4PA6A 2FYUH 1EFRG 4NTWA 5LXTA 4X62B 3I56V 4X66O 1SQGA 3SR2C 1SA0B 1KECA 4FJ8A 1FZ2E 4F6RB 1FFXA 4JI1O 1QR9A 2Q69A 1JX9A 4B7EA 4NVPA 1DTOA 4FLUA 3ZHTA 5ITZB 3MDSA 2KKWA 1YTFD 5DM6V 2NR5A 1SQVH 3ZJZA 3CJHA 1GRJA 1XMOB 1SA0A 2GUZA 1YVWA 1EBOA 4KI6A 1SQFA 3CP1A 1VEWA 3E4YA 4M3WA 3RGBA 1FAFA 3RYHB 2P22C 3JD0A 2YUAA 5LHIA 1M93A 1FJGO 4DYLA 1NTZH 2EIJB 3B2EE 1N32O 4I50A 2CTRA 2H3OA 3SPHA 4QJFB 4IT5A 3QNNA 3SDLA 3N2KA 3ABKC 4GT1A 2CGNA 4NYKA 4MS2A 4I55B 4H44B 3P32A 2HHHO 1Q8IA 4B3TO 4NR1A 3ZIAG 3OTOO 4K3AA 3WU2Z 4YIPA 3QNOA 2YICA 2DYSB 4N21A 3LDDA 3ABLB 3JASA 2Y4TA 1M9NA 2Z0AA 2JRIA 1AR4A 4DR4O 2YB5A 3JAKB 2QWQB 3K5OA 3LZJA 1XL6A 2VS0A 1GAXA 2WLJA 2P1OB 3HKDA 1N36O 1B06A 4ZI7A 4MTXA 3OGKB 1K97A 3FAVB 1JCHA 3CEIA 4MVQA 2GBOA 2ZR3A 1VMGA 4DV5B 4UCSA 3FYIB 4NTYA 4DV3O 4J7JA 3DXRA 4KP4A 4LP8A 5KHKA 3APQA 1YEWA 2PGGA 3CSXA 3RYHA 1H2GA 3EFFK 3K5NA 1V54B 1AVMA 4FFBA 2VQFO 3QG5A 4J41A 4LF4O 1N0NA 2ITCC 3AG2B 4FK0A 3K0GA 4QNDA 4JI5O 3J80N 1S76D 2B1IA 2B1EA 3UO2A 1Y76B 1LUWA 1P49A 1FFTB 2Q7GA 3UCSC 1BHAA 2VJ5A 1K5SA 3JAMN 4EFBA 1HNZO 1Q86W 1FYJA 4LF9B 1R6KA 3MAQA 3NHGA 1NTKH 4BAYA 2XAHA 3D3QA 3NE6A 5IJ0A 2MK3A 5LOVA 2VJ4A 3OE7G 2QM4A 4DTSA 3VBBA 4DTMA 1YJ9V 5FPOA 1Q6HA 3CYOA 1QQCA 2YXHA 4TQFA 3E89A 3FB8C 1COWG 3H1JH 4F6RA 2X6AA 3I55V 4JPRA 4YHHO 4JYAB 4O4LA 4JRQA 1AI5A 5J2TA 4EB6B 1FYZE 4I5SA 1GM7A 1P22A 3VQVA 1VQMV 2R9AA 1XNRO 4JS4A 2XASA 4JYYA 3E4WA 5GONB 2UUBB 1N4CA 4F4LA 3ETEA 2EJRA 3GWOA 3L71H 2EX3A 3SJBC 4DU3A 2N04A 1FXKB 4J2BA 1AP5A 4YJ3B 1Y4MA 4J11A 2WPDG 3HGLA 1N33O 2QM8A 1VQ8V 5CA1A 3Q4HA 2JH8A 4FLVA 3FB7C 1K73W 2CH7A 3RYCA 5E79Z 3JAWB 5BMVB 1Y74A 1R3JC 4KXRA 1TA8A 2P5OA 1FZ5E 4UV9A 1X59A 4WFAV 1FXKC 4JI6O 4PA9A 1K7DA 3K9AA 1PP9H 3ZRWB 5F2VO 3G71V 2XUMA 3VQXA 1AJPA 1ENVA 5KHJA 5K1PA 5IDJA 3OGMB 3ZS8C 3LDSA 4TV8B 3C95A 4LF7B 1R6NA 4IYHA 4X88A 3RMBA 5L3DA 2YIAA 3F7YC 5JCOC 1H8EG 1B6QA 2UXBB 4DV0O 1QVFU 1E1RG 3THOA 1CP9A 4HBNA 1IBLB 1L0NH 4DUYO 2Q0AA 3FB5C 5AG2A 1PV0A 3IAYA 3U11A 4LFAO 3MHSC 2L6LA 4MVUA 3O65A 2B1GA 1VQLV 1W0JG 1AROP 4UV8A 2LW7A 2E75B 3RWUA 4QIWF 3JARA 4X62O 4DR3O 1U97A 1R3IC 1FZ4E 1K9MW 1H38A 1WA8A 1BT8A 1OCRC 5A2QN 2IJHA 4LF8B 4PI2A 3SPIA 4TOIA 5BY1A 2L35A 2IJJA 2F95B 5EK0A 1AI4A 4KHPO 5B1OA 3BVOA 3RYIA 2LQTA 4I0XB 4WF9V 4WCEV 4M41A 2EINC 3SPCA 3G6EV 2VRZA 3NAEA 4UCTA 1D5AA 3A0RA 1XI1A 5IY5C 2AW9A 2WLLB 3QO7A 1XHXA 3L72H 1WB7A 3H1KH 4KHNA 2BTQB 2RCVA 1US6A 3S3XA 3OD4A 5CA0A 2F93B 5B1BB 4LWSB 5B5EZ 5IYCO 4DTXA 1VF5B 4FJ7A 1VQKV 4B08A 3AG1C 2FYOA 3IC9A 4BR6A 4EYWA 4Z2WA 1AJQA 2IU3A 2Q4PA 3CMAV 2LJ2A 2QJ1A 4JYBA 2DYRB 4IIJB 3K5MA 4OPHA 4YXWG 5GTIZ 5DECA 1VQPV 1PD3A 3M8AA 5JVDA 4HAMA 2E5LO 2JS5A 1DK1A 5IY5B 1TVKA 3J81N 1SS3A 2YIDA 4U7NA 1F23A 2DWEC 5H2FZ 3ZMUA 2EIMC 5EZYB 4DR7B 4B3SB 3NDKA 4JTCB 4FJJA 3B8NA 1PL4A 4JI4B 2WSSG 4FM1A 4PDVA 1PNLA 2P06A 2ZQMA 1XNRB 1AR5A 2WA3A 4LF4B 3CB2A 1SQBH 4HNAA 1ZTEA 3TJTA 2DQ0A 2N05A 1KUQA 1WAJA 1SZTA 3OMNB 1XNQO 3JALB 4RQFA 4K35A 2PTMA 2P1QB 4JTDB 4AQYO 4FJ5A 3TAGA 3CRAA 1OCOB 1I7FA 2FMLA 4ICGC 4B3RB 4DV7O 3L8BA 2WLHA 1OCZC 1P84F 4DW1A 3U0ZA 1XMGE 2R70A 1NT2B 4ADNA 2HJFC 2JK5C 2YXLA 2ZXWC 5LYJA 4AI8A 4PA4A 2A3QA 1Q3EA 2DOSA 2P4VA 3JARB 1SETA 4M3ZA 2D3OW 3OAAG 4HCBA 4DR6B 3ASOC 1DGSA 2ZE5A 2PI5A 3HGKE 4XDJA 3SUOA 5KAFZ 1QLEB 2AXTZ 2N74A 1JFFA 3ABMB 4J2DA 2BSKB 1FXKA 4ASUG 1MNGA 4K8XA 1ZL8A 4X1KB 3S3WA 4DR4B 2LFSA 1VQNV 2W0FC 4D6TH 1OCCC 3H1IH 1V54C 4DRXA 1FS0G 2Q67A 3W7SA 1MTYG 3C6NB 4DO2A 4J9ZB 3LDBA 4JI7O 2UUCO 1EN4A 1KBHA 1Q9YA 2JPNA 1ZL8B 5EC1C 3ASOB 2P1PB 5KLVH 3IFXA 1WA8B 1SKVA 1XNQB 2CTPA 3LSSA 3UQ8A 5KMGA 2JIZG 3AG3C 3APOA 2IU0A 4JI8O 3KD5E 3K59A 4B3MO 2RDCA 3QERA 2HJDA 3OR6C 1H2SB 2V7QG 4IIJA 1FZ1E 4U3JA 4U7OA 5D5PA 2RKHA 3RMDA 2P6JA 1K3EA 1OCOC 4FLTA 1P4RA 1IBLO 3TETA 4O2BA 3ZMVA 4X1IA 3QVNA 5EBMC 2HD0A 1YI2V 5KA6A 4LFAB 5KMGB 4FLYA 1YITV 2Y69C 1RPRA 4IGGA 4TWKA 4QE9A 2AGAA 1N0JA 5CMUA 3LD8A 1D5NA 2DMXA 1A32A 4O4JB 3ZMZA 1VARA 3C94A 2ODMA 1WP8A 4FJLA 2XNDG 4IHJA 4JYAO 4TQDA 3L74H 2WAMA 3L1NA 3SJCC 3CS5A 2X0LA 3JALA 1QLNA 4UCRA 3MKSB 3RW0A 4DV4O 4X64B 5JJNB 2BCCH 1SC5B 4RNGA 4UXNA 2AZ0A 2ZM6B 1QBZA 1JW2A 3ZHVA 2A0LA 2LO1A 5KUMA 2YXYA 5K1XA 1VQ9V 3LDEA 2CDYA 2QWPB 3ASNB 2FTKA 3HPLC 1O9HA 3WSOA 5EBWC 2F4VO 5B66Z 1NJIW 2QSAA 3SVIA 3H1HH 4I9WA 3UM7A 2IW5A 4AI6A 5LGNA 2RCUA 4I9LA 1JOYA 3M7MX 1PKXA 3F5WC 1XMQO 4FJXA 1HNXO 4AQYB 1EZJA 4BW5A 1YJNV 4JAUA 1KYOF 1B3QA 1ZAUA 2Y0PA 2E74B 4X65O 5B1AC 1H2KA 3LDCA 1I5YA 4DV6B 2R9RB 3ZRWA 4M3XA 3D8CA 4X1KA 3C90A 2KSDA 4DTNA 3JD2A 4YJ2A 1RM1B 1EN6A 2H94A 4I9QA 3JD4A 1U96A 2AHZA 3RWRD 2QWOB 4FZ0A 2MW2B 1XREA 4Z1MG 4DUYB 4DTUA 3K9SA 3JASB 3WFVA 4GX5A 2BTQA 4C7UA 1WPBA 1Y67A 3A8TA 3B4SA 2EINB 1PPJH 4GCZA 4DK1A 2JGUA 5IYZA 2QE7G 2W0XA 4DR5O 2IJIA 1SQQH 1XUQA 3QTCA 3DC6A 2GDSA 4O4HB 1FZIE 1HR0B 1FXHA 5JWPA 3T1YO 1I94B 3CC4V 1PM9A 3MHHC 4UCOA 1MMOG 4LF5O 5LP6A 1BMFG 1DLBA 4OXSA 1NR7A 4EP9A 3TK1A 1QNMA 4DUZB 2LP7A 4ABMA 2RQ6A 4PA7A 1VQOV 1R3LC 3RN4A 3K58A 5J2UA 2QR4A 2JQTA 3TJYA 1XVFE 1XVGE 3J2PA 1Z5WA 4HNAB 2OTJV 2Q7EA 5GW7A 1S77D 1XVEE 4JV5B 1AI7A 2ZNIA 1RSOB 1I0HA 3SQ4A 2YEVA 4KHQA 3TAEA 1NZ6A 3K79A 4DR1B 2QKAA 2PY5A 4P9OA 4LC1A 2JGDB 4LF9O 1QLEC 3D36A 3OTFA 5H37A 2UU9O 5IYDO 4GZRB 3HL8A 1KU9A 3E83A 3FYEB 4I50B 3TABA 1UFIA 2IM9A 2GHYA 3K57A 1WNSA 3UIQA 4JGSA 3UT5A 1E1QG 3AG3B 4JI0B 3NCIA 3IC7A 2B9ZA 2UXNA 2OCCC 1YDXA 3ZN0A 3FX7A 4GKJB 1GTOA 2K1EA 3SYPA 3SI6A 1Y76A 5BR8B 2GSMB 5CA3A 3AG1B 1XMFE 5L3EA 1CEZA 5LMNO 3T4ZA 2Q7HA 1CLQA 2A9HA 4P9PA 3AK3A 3CRCA 3BEHA 4JV5O 3KG2A 4JI1B 2FW3A 2EJ7A 2ITDC 3RFRA 4CC5A 3C3SA 4P30A 1S0VA 4JF3A 2BOBC 5B1NA 4JI6B 3LNMB 5KHGA 1LDKE 4GAMC 3RVYA 5EIBC 2ARHA 2DY4A 4UCVA 3HKBB 4KHSA 4ZIBA 2Z5UA 4FLWA 4MTGA 1G8MA 3WB0A 5LGTA 3CC2V 5H9CA 2F66C 1K5QA 5HFMA 5JH7A 4DTRA 2DEBA 4LCUC 4FM2A 3P30A 1XMHE 5LBQA 1XEQA 5H5NA 1W59A 5LP6B 4B3TB 2JEUA 1M5IA 4CS3A 4X66B 3CQ8A 2LFRA 2QM7A 4CH4A 2Q9LA 1OHHG 4JI3B 3D36C 4KHPB 5C93A 5JVDB 1TVKB 3ZHUA 2F4VB 1IX9A 1IBMB 1K8AW 3CCEV 1S5HC 2OCCB 1PL0A 1WAFA 2HVKC 5FNVB 2C2AA 4GYCB 2JH9A 2ZM6O 3UO3A 3T1CA 4FPPA 4FIPC 4P2ZA 2ILMA 4DV5O 4LF5B 2DWDC 2QTSA 3EHBB 2KG7A 3KCYA 1BQ0A 1GN4A 4RL5A 3KD1E 4UFZA 3SGIA 2ZE7A 2EIMB 3OT7A 4WFHA 3SUNA 4FJNA 2QDOA 2ZE8A 2V4DA 4CS4A 3ZCCA 5FNVA 3TL8B 1L8DA 1F51A 4FJGA 2DQ3A 2IBZH 2P1NB 4L87A 4PV1B 4U3JB 3OEHG 2WWWA 1Y6XA 4EPHA 2ZINA 1YTFB 1NU1H 5JQGB 1WB8A 4O2AB 4CZZA 1KP3A 3F5TA 4X1YA 3QEVA 4DRXB 1THZA 3WB2A 5IYZB 3IJ4A 1S3JA 2Q0OC 4DR6O 1LNQA 2YC0A 2F1MA 2VWJA 3WG7C 4RUFA 1MSWD 1IVSA 3BFRA 3T1HB 2UXDO 5KX5B 5L3GA 3BRCA 1EN5A 1GK9A 3SPJA 1MMMA 4I7ZB 1ZWIC 1VIBA 1NVPB 3SUQA 2QWRB 3OFNG 4JI2O 1HNWO 3AEIA 3SPYA 2BOCC 1MZEA 5IJ9B 4G28B 4MVMA 1XVDE 2WLLA 1IURA 4EKWA 4DV1O 3CJHB 1HP8A 2CK3G 4JI4O 2MW2A 4Z1VA 1Q7YW 2VWKA 4X20B 2LW1A 3SJAC 4I4TA 3ABUA 4O4LB 2YI8A 1T5EA 2F43G 3AK2A 2CE4A 4LR3A 2XAFA 4FJMA 2WLKA 5H6QA 3HB3B 1I08A 1AP6A 2CTWA 4JS5A 4R6ZA 1ZUQA 2ZE6A 3S9HA 1OZ0A 4X20A 4W4KA 2UXXA 1G4YB 3SQ0A 4PDRA 1CXZB 3L9DA 3K0DA 3SPGA 3QESA 3JATB 4XBFA 3Q4HB 4DR1O 3J7AU 3SPZA 1Y74B 3E8BA 3HKCA 1URFA 2UU9B 4DR3B 1JMKC 1IH7A 3W7XA 5KX5A 4G27B 3CD6V 3C6OB 2HP8A 3SUPA 2EIJC 3OTOB 4JASA 2EZPA 3EXAA 4JRPA 5CBGA 4DR7O 2KQXA 4YY3O 2O57A 1AI6A 3HR0A 5LXTB 1BQZA 1N34O 2YEVB 3JYCA 4MTOA 1R6TA 2R72A 2LF6A 1Z2GA 4FJ9A 1M57B 1XOUA 4MSWC 1BE3H 1N33B 3SCXA 4G2KA 5BR8O 2DN9A 1VF6A 1SESA 4LF6O 2DJVA 3F7VC 2W6JG 2D2CB 2QGNA 4GKKO 4FM0A 4FLXA 3CCVV 2XT9A 3BA8A 2DE0X 2CUGA 1ZX3A 4ZHQB 4YJ2B 1OCRB 4JTAB 4Q6GA 1OCCB 1V55C 3JAWA 1VQ7V 2OVRB 4X9QA 2E76B 3LSQA 3CCLV 1FKAO 4M3RA 3CFOA 4J10A 3CWBH 2E5LB 1JA8A 1MSDA 4J9YB 4DTOA 4UVBA 3TCUA 1FZ8E 5B1BC 3RT3C 1GN2A 3QEWA 4FK5C 1R73A 2RNBA 3QO8A 1SQXH 5TISZ 1RSOA 4LBEC 2UUAO 4JI3O 4DV4B 1XQ8A 4LNUA 1QHTA 4UB8Z 4LH6A 5IWAO 2HLDG 2ZXWB 1DF5A 5B3SC 4O4IA 1GN6A 1HWYA 4FJIA 3OGIB 3ABKB 3TAFA 1GO3F 5KHHA 2W6IG 4YHHB 4LH7A 1BCCH 2M6YA 1TUEB 3FFQA 1H2NA 2ZD9A 3O9OA 1N1CA 1ZLZA 4UUJC 3A0BZ 4LNUB 3CFRA 2DYSC 2B8IA 1ZSPA 4HZ3A 2LGWA 3W7TA 1TUBA 4B3RO 4B3SO 2OYQA 4PDLA 1HR0O 2B7MA 4W4LA 1SERA 1VF7A 3CXHF 2Q8VA 4TUYB 2JHAA 3QETA 4OGQB 3CHXA 4QGPA 2OTLV 2QEXV 4X65B 1KQSU 1NH2D 1AB3A 2DYRC 2P7TC 4H0LB 2P5GA 3SYQA 3SQ1A 1OCZB 4FK4A 1PNKA 4E4BA 2YIBA 5KHIA 4E4EA 2EULA 3LSUA 2XAGA 3CRQA 5LP6C 5BMVA 4QNCA 1GH6A 4NB5A 2EIKB 3SJQC 1HDJA 3STLC 5L3CA 1MZFA 1XU3E 3QO5A 4K0KB 1GN3A 1XMOO 1JQ0A 1M1KW 3ABTA 2HEPA 2XTAA 1WP7A 1K4CC 1MABG 1K4DC 2UUAB 4HCCA 1SZXA 4D7SA 4J7KA 4PD4F 3RMCA 1H8HG 3BABA 3QNEA 4TV8A 3C3TA 4EFEA 2PI4A 2A79B 1S5JA 3SYAA 3NR7A 4NXMO 1FD9A 1NTMH 4LF8O 3KCXA 1F4NA 1KKCA 2ADPA 2FL4A 3VOUA 3OEEG 2MMBA 1IBMO 4ZOLB 2HKOA 2EIKC 2YDEA 5FL7G 3OR7C 3UKMA 3JCZA 4J7ZA 1J5EO 2UUBO 1VF6C 1Q43A 1WLEA 5L3BA 3ZHRA 2OT5A 4X8AA 2ATQA 5CA0B 3OMAB 1I94O 4J2AA 4KHUA 3V7DB 3E8HA 1TGOA 4CBCA 4MTFA 3I5DA 2RJZA 1CPYA 1OJHA 4B3MB 4ZOLA 4IYIA 2PUSA 3CCJV 5C8YB 3T4DA 1IBKO 1XU5E 5EBLC 4FLZA 1FZHE 2EBOA 2DW4A 2PF4E 2WLNA 1NI8A 3ZN1A 4YY3B 4QPJA 3DGEA 2ZT9B 2RMKB 1YZBA 1XL4A 4N23A 4WBNB 2Y4UA 5IREA 4NXNB 4GX0A 2UXDB 4X5NA 4FK2A 4X5MA 3UT5B 3GB7C 3HKBA 5CA1B 2Q73A 4ZI7B 5L3FA 3X2QB 2ZDIA 1VP7A 4OPAA 3L70H 5CB4B 3N1BA 3ZRSA 5KUKA 3CCQV 3TXQA 3D3IA 4GX1A 2Q5ZA 3A2FA 4GKKB 3N1EA 2H4TA 3T1YB 2WLIA 4EB6A 2YI9A 1D2DA 3CCRV 1AR1B 4I55A 1RPOA 4R7CA 5EZYA 2CAZC 3H01A 3ZHQA 3JSLA 3OW2U 4FFKA 3CC7V 2H8PC 2PYJA 3GVMA 5CB4A 4DV7B 1Q81W 5LHHA 3L73H 2VIXA 1EZVH 4I4TB 4YJ3A 3ICXA 3OMIB 5IJ0B 2M7WA 1KB9F 3FD9A 5ITZA 1R3KC 2Y69B 3JD1A 1SQPH 4DV0B 5B3SB 2ZR2A 3ETDA 1XHZA 3KKYA 1HNXB 2ZCEA 2OVQB 3CCSV 3LZIA 3E86A 4XDLA 4O4IB 2JEXA 2NNUA 4UB6Z 3NXSA 1JVMA 3CCMV 5IWAB 1FZ3E 4DV6O 1M4UA 3DSQA 1G1XB 3L75H 1Z5VA 4JZ2A 4DR2O 3H1LH 1B04A 4O4JA 3W7UA 1JR9A 2ZIMA 1K33A 2P90A 3ZMSA 3LUTB 4MW8A 1MOFA 4RWUA 4PA3A 2YSUB 3K2OA 4KHWA 4DV2O 2HFEC 4BIUA 2HG5C 4LFBB 1R1BA 4NTXA 4HYOA 4RO2A 4YIOA 4J80A 1QCEA
chains in the Genus database with same CATH topology
2GUZA 2M6YA 1HDJA 1NZ6A 2CTQA 2PF4E 2LO1A 3BVOA 2RKHA 2DN9A 2QWOB 2N05A 1N4CA 2GUZB 3UO3A 1FAFA 1N1CA 2YUAA 1WJZA 2QWNB 2QWPB 3AG7A 1XBLA 1FPOA 3UO2A 2LGWA 2N04A 4RWUA 2KQXA 2OCHA 2QWQB 2QSAA 3UCSC 1BQ0A 2CTPA 1BQZA 2QWRB 2EJ7A 2Y4TA 2CTRA 3APOA 4J7ZA 4IT5A 2Y4UA 2YS8A 3APQA 2L6LA 2CUGA 1IURA 4J80A 2CTWA 2DMXA 1GH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUZ A;  2M6Y A;  1HDJ A;  1NZ6 A;  2CTQ A;  2PF4 E;  2LO1 A;  3BVO A;  2RKH A;  2DN9 A;  2QWO B;  2N05 A;  1N4C A;  2GUZ B;  3UO3 A;  1FAF A;  1N1C A;  2YUA A;  1WJZ A;  2QWN B;  2QWP B;  3AG7 A;  1XBL A;  1FPO A;  3UO2 A;  2LGW A;  2N04 A;  4RWU A;  2KQX A;  2OCH A;  2QWQ B;  2QSA A;  3UCS C;  1BQ0 A;  2CTP A;  1BQZ A;  2QWR B;  2EJ7 A;  2Y4T A;  2CTR A;  3APO A;  4J7Z A;  4IT5 A;  2Y4U A;  2YS8 A;  3APQ A;  2L6L A;  2CUG A;  1IUR A;  4J80 A;  2CTW A;  2DMX A;  1GH6 A; 
#chains in the Genus database with same CATH topology
 1MG1 A;  3IGA C;  4DU4 A;  3CRR A;  4GX2 A;  4EEQ A;  1FZ9 E;  2YIB D;  3P3N A;  1YIJ V;  1KD1 W;  1J95 A;  3AG4 C;  3RYF B;  1TAE A;  1L1F A;  1FS1 A;  5LMN B;  1AJN A;  2PFV A;  4K8Z A;  2MZW B;  4WFB V;  5IT9 N;  1Q5O A;  1QVG U;  1Q90 D;  2PFT A;  2XAQ A;  2YS8 A;  1FZ0 E;  2UXC B;  2IH3 C;  2E32 A;  2B5U A;  1VQ5 V;  2Y48 A;  4TT3 G;  3KZI Z;  4I0X A;  1BL8 A;  4IL6 Z;  4I6J B;  2JGD A;  3BY6 A;  4M45 A;  1YF2 A;  2GTA A;  5LGU A;  4WFE A;  4QPK A;  3RMA A;  4PDM A;  3J27 A;  1JPX A;  1GMG A;  1ROP A;  3ZHS A;  1V9P A;  4J42 A;  4F6E A;  2XOK G;  2ATK C;  2X7R B;  1JFF B;  4TV9 B;  1JJO A;  3M99 B;  4ZKI A;  3ZED A;  3BA9 A;  4H37 A;  4RG8 A;  4KI4 A;  2IH1 C;  4M42 A;  1P7B A;  4DV2 B;  1NR1 A;  2AHY A;  3JAT A;  1YJW V;  5D5Q A;  5IJ9 A;  5IYB O;  2X6B A;  4U3F H;  4R50 A;  2OZM A;  4RAI A;  4E2L A;  3HKE A;  3CCU V;  3N2K B;  1WN7 A;  3BAA A;  3N2G A;  4M3T A;  4LFB O;  3CFP A;  1IZ3 A;  5HFL A;  5J2T B;  3ZX6 A;  1LR1 A;  1E79 G;  3ABL C;  2QA4 V;  3BCC H;  3G67 A;  5EC2 C;  4DUZ O;  1FPO A;  3G4S V;  4ADO A;  4FMT A;  5C8Y A;  1M56 C;  4KFM A;  1O9G A;  4DV1 B;  2CGO A;  2V1D A;  3EVK A;  4OX9 O;  3ZMT A;  4KUM A;  1TUB B;  3T2M A;  3E35 A;  4UVC A;  4JI5 B;  2BTO A;  4FZ1 A;  5DED A;  3AK1 A;  1QR8 A;  2OIE A;  4X1I B;  3SYC A;  2G38 A;  1IXM A;  4AKI A;  3OGL B;  2Y0I A;  1HNZ B;  1MA1 A;  3AG7 A;  3BHP A;  3MD0 A;  1XIL A;  2RN9 A;  3N27 A;  5LMU B;  4CH6 A;  1GKF A;  3CPW U;  1XVB E;  1S5L Z;  2KG7 B;  2FKX A;  4QNH B;  2UXB O;  1BZK A;  2NLJ C;  4K0K O;  3K04 A;  4BWA A;  1YSC A;  5LA6 A;  4H13 B;  1NVP D;  1LUV A;  1F4M A;  3E22 A;  4H33 A;  1XDC A;  4CH5 A;  3CX5 F;  4DTP A;  4J2E A;  2ZNJ A;  1S72 V;  3HP9 A;  4LF7 O;  2K9P A;  2OCH A;  5JQG A;  4DU1 A;  3RYF A;  3K5L A;  3RVZ A;  2HHH B;  3K03 A;  3BPZ A;  3R65 A;  1NKD A;  4DR5 B;  2QXF A;  2QTO A;  1XVC E;  4Q20 A;  3FAV A;  3SYO A;  4M3Y A;  2GUZ B;  5JCO A;  1RM1 C;  2ZKO A;  2JJ1 G;  5A9G A;  1N34 B;  4OX9 B;  5KAI Z;  4X64 O;  4MVZ A;  4L8J A;  1UJW B;  1N36 B;  3C6P B;  2EIL C;  2HVJ C;  1JJ2 U;  4MVO A;  3B8M A;  3K06 A;  1SRY A;  5IE9 A;  4FJK A;  1HW7 A;  3JD3 A;  4B7K A;  2JVD A;  2KB1 A;  5GON A;  3STZ C;  3E8G A;  5FPR A;  5CN0 A;  4O4H A;  3A0H Z;  1RFY A;  1YCI A;  1N32 B;  4DW0 A;  1AIL A;  1I5X A;  3R66 A;  1H2L A;  3ZRX A;  2IJK A;  2Q6A A;  3ASN C;  1NQT A;  3JCU Z;  3ML0 A;  3WB1 A;  3B09 A;  1L0L H;  2P4K A;  1ORQ C;  5EYP B;  2Q68 A;  5LHG A;  3ZRV A;  2HR3 A;  3E8F A;  4GUN A;  4JI8 B;  3SQ2 A;  5JJE B;  2JHP A;  1FJG B;  2BSK A;  3SNN A;  3JAK A;  4FVM A;  4JYC A;  3CXC U;  4MT8 A;  3ETG A;  4PHZ A;  4O2B B;  1UPG A;  2VQE B;  2R9I A;  2DTU A;  2GV9 A;  2WLM A;  2QKC A;  2E31 A;  2GTS A;  4UCU A;  4FJC C;  4AKH A;  1N8R W;  5JJJ B;  5FLX N;  2FB5 A;  1IG9 A;  3T1H O;  5B1A B;  2ETN A;  2EZO A;  2ADQ B;  1BHB A;  2P67 A;  5H6R A;  1PNM A;  1FFX B;  3TGU H;  3DXR B;  4BIZ A;  3L0M A;  2OWO A;  4LFC O;  3RYI B;  5KA5 A;  4GKJ O;  3OM3 B;  4IHJ B;  4DR2 B;  5LL6 Y;  5CBH A;  5BXZ A;  4DV3 B;  4X1Y B;  1P7G A;  1W0K G;  3DTU B;  2OIG A;  1OV9 A;  2VQF B;  2AZ2 A;  2PYL A;  4E3S A;  1FZ7 E;  2K5S A;  1W2B U;  1BGY H;  4JI2 B;  1HNW B;  4JZG A;  5J2U B;  3TXS A;  1Q9X A;  3FB6 C;  1G6U A;  2NN4 A;  3GWK C;  4PEL A;  4M3U A;  3PJS K;  3QEP A;  5DN6 G;  4RQE A;  3E2E A;  4AKG A;  1IDS A;  3SJJ A;  3CE2 A;  3VQW A;  1SF9 A;  2XAJ A;  3OUF A;  4DTJ A;  3ABM C;  3U10 A;  4WBN A;  4ZBM A;  4DK0 A;  3PN1 A;  1IXB A;  2PZS A;  4MVS A;  4KL1 A;  2JS3 A;  1VQ4 V;  5E1A C;  5CBF A;  2UXC O;  4CS2 A;  4X89 A;  1GM9 A;  4CH3 A;  1KP2 A;  1KMI Z;  2QWN B;  3H9V A;  1XMQ B;  5BZB A;  2P1M B;  1Q6U A;  1Q6I A;  5LYJ B;  4XDK A;  3W7W A;  3AG2 C;  4D7T A;  3X2Q C;  3NGI A;  3QEX A;  1RP3 B;  4GLX A;  1Q82 W;  4LFC B;  4QE7 A;  1WAZ A;  4NXM B;  3DC5 A;  4LF6 B;  2CTQ A;  4LWS A;  3G6B A;  2CH7 B;  3RYC B;  3JSN A;  4MVR A;  2LF3 A;  2OZS A;  1XBL A;  3LNN A;  2BE3 A;  3QEI A;  3HKC B;  1YHQ V;  1NS1 A;  4WFF A;  4BIO A;  2UUC B;  4TV9 A;  3CRM A;  1MHY G;  4PJ0 Z;  3QF7 A;  2ZDI C;  2JJ2 G;  4ICG A;  4ZHQ A;  3OGC C;  2ZIO A;  1EM1 A;  1QU7 A;  1YXB A;  5LMU O;  4AHC A;  4CC6 A;  3P3P A;  2JHC A;  1M90 W;  5EYP A;  3B77 A;  4KHY A;  5IZ7 A;  4UVA A;  3FKS G;  1J5E B;  4DXW A;  3HKE B;  2OVP B;  1NEX B;  3N2G B;  2WA4 A;  1BS3 A;  1FXX A;  3K08 A;  2WLI B;  3HKD B;  1FZ6 E;  5LOV B;  2F23 A;  1NBM G;  1BSM A;  1FXV A;  1H2M A;  4WFG A;  2A06 H;  3OUS A;  4FJH A;  3E22 B;  3RBZ A;  3ETQ A;  4MW3 A;  1VQ6 V;  1KKD A;  1K34 A;  5EIB D;  2LGQ A;  1K92 A;  5GTH Z;  5JH7 B;  3L2O B;  1Y66 A;  4JAV A;  4AIL C;  1IBK B;  2JDI G;  1KC8 W;  1GM8 A;  1M57 C;  3CME V;  2XHB A;  1WPX A;  1MHZ G;  4NKG B;  3K3W A;  5IBK B;  1DF4 A;  4FFB B;  2A7W A;  1NH2 B;  4JI0 O;  3B40 A;  2E3C A;  1XL3 C;  4JAA A;  4TSF G;  3G80 A;  2VQE O;  4PI0 A;  2Z3Y A;  4A5U B;  1M56 B;  4R8C A;  1F7Y A;  3ZBH A;  4RUE A;  1WJZ A;  2QKS A;  1X4T A;  4O2A A;  2X6C A;  5J9P C;  4NXN O;  4BW9 A;  3AG4 B;  3WG7 B;  5LA6 B;  1V55 B;  3VQY A;  4TUY A;  2EIL B;  4JI7 B;  4PA6 A;  2FYU H;  1EFR G;  4NTW A;  5LXT A;  4X62 B;  3I56 V;  4X66 O;  1SQG A;  3SR2 C;  1SA0 B;  1KEC A;  4FJ8 A;  1FZ2 E;  4F6R B;  1FFX A;  4JI1 O;  1QR9 A;  2Q69 A;  1JX9 A;  4B7E A;  4NVP A;  1DTO A;  4FLU A;  3ZHT A;  5ITZ B;  3MDS A;  2KKW A;  1YTF D;  5DM6 V;  2NR5 A;  1SQV H;  3ZJZ A;  3CJH A;  1GRJ A;  1XMO B;  1SA0 A;  2GUZ A;  1YVW A;  1EBO A;  4KI6 A;  1SQF A;  3CP1 A;  1VEW A;  3E4Y A;  4M3W A;  3RGB A;  1FAF A;  3RYH B;  2P22 C;  3JD0 A;  2YUA A;  5LHI A;  1M93 A;  1FJG O;  4DYL A;  1NTZ H;  2EIJ B;  3B2E E;  1N32 O;  4I50 A;  2CTR A;  2H3O A;  3SPH A;  4QJF B;  4IT5 A;  3QNN A;  3SDL A;  3N2K A;  3ABK C;  4GT1 A;  2CGN A;  4NYK A;  4MS2 A;  4I55 B;  4H44 B;  3P32 A;  2HHH O;  1Q8I A;  4B3T O;  4NR1 A;  3ZIA G;  3OTO O;  4K3A A;  3WU2 Z;  4YIP A;  3QNO A;  2YIC A;  2DYS B;  4N21 A;  3LDD A;  3ABL B;  3JAS A;  2Y4T A;  1M9N A;  2Z0A A;  2JRI A;  1AR4 A;  4DR4 O;  2YB5 A;  3JAK B;  2QWQ B;  3K5O A;  3LZJ A;  1XL6 A;  2VS0 A;  1GAX A;  2WLJ A;  2P1O B;  3HKD A;  1N36 O;  1B06 A;  4ZI7 A;  4MTX A;  3OGK B;  1K97 A;  3FAV B;  1JCH A;  3CEI A;  4MVQ A;  2GBO A;  2ZR3 A;  1VMG A;  4DV5 B;  4UCS A;  3FYI B;  4NTY A;  4DV3 O;  4J7J A;  3DXR A;  4KP4 A;  4LP8 A;  5KHK A;  3APQ A;  1YEW A;  2PGG A;  3CSX A;  3RYH A;  1H2G A;  3EFF K;  3K5N A;  1V54 B;  1AVM A;  4FFB A;  2VQF O;  3QG5 A;  4J41 A;  4LF4 O;  1N0N A;  2ITC C;  3AG2 B;  4FK0 A;  3K0G A;  4QND A;  4JI5 O;  3J80 N;  1S76 D;  2B1I A;  2B1E A;  3UO2 A;  1Y76 B;  1LUW A;  1P49 A;  1FFT B;  2Q7G A;  3UCS C;  1BHA A;  2VJ5 A;  1K5S A;  3JAM N;  4EFB A;  1HNZ O;  1Q86 W;  1FYJ A;  4LF9 B;  1R6K A;  3MAQ A;  3NHG A;  1NTK H;  4BAY A;  2XAH A;  3D3Q A;  3NE6 A;  5IJ0 A;  2MK3 A;  5LOV A;  2VJ4 A;  3OE7 G;  2QM4 A;  4DTS A;  3VBB A;  4DTM A;  1YJ9 V;  5FPO A;  1Q6H A;  3CYO A;  1QQC A;  2YXH A;  4TQF A;  3E89 A;  3FB8 C;  1COW G;  3H1J H;  4F6R A;  2X6A A;  3I55 V;  4JPR A;  4YHH O;  4JYA B;  4O4L A;  4JRQ A;  1AI5 A;  5J2T A;  4EB6 B;  1FYZ E;  4I5S A;  1GM7 A;  1P22 A;  3VQV A;  1VQM V;  2R9A A;  1XNR O;  4JS4 A;  2XAS A;  4JYY A;  3E4W A;  5GON B;  2UUB B;  1N4C A;  4F4L A;  3ETE A;  2EJR A;  3GWO A;  3L71 H;  2EX3 A;  3SJB C;  4DU3 A;  2N04 A;  1FXK B;  4J2B A;  1AP5 A;  4YJ3 B;  1Y4M A;  4J11 A;  2WPD G;  3HGL A;  1N33 O;  2QM8 A;  1VQ8 V;  5CA1 A;  3Q4H A;  2JH8 A;  4FLV A;  3FB7 C;  1K73 W;  2CH7 A;  3RYC A;  5E79 Z;  3JAW B;  5BMV B;  1Y74 A;  1R3J C;  4KXR A;  1TA8 A;  2P5O A;  1FZ5 E;  4UV9 A;  1X59 A;  4WFA V;  1FXK C;  4JI6 O;  4PA9 A;  1K7D A;  3K9A A;  1PP9 H;  3ZRW B;  5F2V O;  3G71 V;  2XUM A;  3VQX A;  1AJP A;  1ENV A;  5KHJ A;  5K1P A;  5IDJ A;  3OGM B;  3ZS8 C;  3LDS A;  4TV8 B;  3C95 A;  4LF7 B;  1R6N A;  4IYH A;  4X88 A;  3RMB A;  5L3D A;  2YIA A;  3F7Y C;  5JCO C;  1H8E G;  1B6Q A;  2UXB B;  4DV0 O;  1QVF U;  1E1R G;  3THO A;  1CP9 A;  4HBN A;  1IBL B;  1L0N H;  4DUY O;  2Q0A A;  3FB5 C;  5AG2 A;  1PV0 A;  3IAY A;  3U11 A;  4LFA O;  3MHS C;  2L6L A;  4MVU A;  3O65 A;  2B1G A;  1VQL V;  1W0J G;  1ARO P;  4UV8 A;  2LW7 A;  2E75 B;  3RWU A;  4QIW F;  3JAR A;  4X62 O;  4DR3 O;  1U97 A;  1R3I C;  1FZ4 E;  1K9M W;  1H38 A;  1WA8 A;  1BT8 A;  1OCR C;  5A2Q N;  2IJH A;  4LF8 B;  4PI2 A;  3SPI A;  4TOI A;  5BY1 A;  2L35 A;  2IJJ A;  2F95 B;  5EK0 A;  1AI4 A;  4KHP O;  5B1O A;  3BVO A;  3RYI A;  2LQT A;  4I0X B;  4WF9 V;  4WCE V;  4M41 A;  2EIN C;  3SPC A;  3G6E V;  2VRZ A;  3NAE A;  4UCT A;  1D5A A;  3A0R A;  1XI1 A;  5IY5 C;  2AW9 A;  2WLL B;  3QO7 A;  1XHX A;  3L72 H;  1WB7 A;  3H1K H;  4KHN A;  2BTQ B;  2RCV A;  1US6 A;  3S3X A;  3OD4 A;  5CA0 A;  2F93 B;  5B1B B;  4LWS B;  5B5E Z;  5IYC O;  4DTX A;  1VF5 B;  4FJ7 A;  1VQK V;  4B08 A;  3AG1 C;  2FYO A;  3IC9 A;  4BR6 A;  4EYW A;  4Z2W A;  1AJQ A;  2IU3 A;  2Q4P A;  3CMA V;  2LJ2 A;  2QJ1 A;  4JYB A;  2DYR B;  4IIJ B;  3K5M A;  4OPH A;  4YXW G;  5GTI Z;  5DEC A;  1VQP V;  1PD3 A;  3M8A A;  5JVD A;  4HAM A;  2E5L O;  2JS5 A;  1DK1 A;  5IY5 B;  1TVK A;  3J81 N;  1SS3 A;  2YID A;  4U7N A;  1F23 A;  2DWE C;  5H2F Z;  3ZMU A;  2EIM C;  5EZY B;  4DR7 B;  4B3S B;  3NDK A;  4JTC B;  4FJJ A;  3B8N A;  1PL4 A;  4JI4 B;  2WSS G;  4FM1 A;  4PDV A;  1PNL A;  2P06 A;  2ZQM A;  1XNR B;  1AR5 A;  2WA3 A;  4LF4 B;  3CB2 A;  1SQB H;  4HNA A;  1ZTE A;  3TJT A;  2DQ0 A;  2N05 A;  1KUQ A;  1WAJ A;  1SZT A;  3OMN B;  1XNQ O;  3JAL B;  4RQF A;  4K35 A;  2PTM A;  2P1Q B;  4JTD B;  4AQY O;  4FJ5 A;  3TAG A;  3CRA A;  1OCO B;  1I7F A;  2FML A;  4ICG C;  4B3R B;  4DV7 O;  3L8B A;  2WLH A;  1OCZ C;  1P84 F;  4DW1 A;  3U0Z A;  1XMG E;  2R70 A;  1NT2 B;  4ADN A;  2HJF C;  2JK5 C;  2YXL A;  2ZXW C;  5LYJ A;  4AI8 A;  4PA4 A;  2A3Q A;  1Q3E A;  2DOS A;  2P4V A;  3JAR B;  1SET A;  4M3Z A;  2D3O W;  3OAA G;  4HCB A;  4DR6 B;  3ASO C;  1DGS A;  2ZE5 A;  2PI5 A;  3HGK E;  4XDJ A;  3SUO A;  5KAF Z;  1QLE B;  2AXT Z;  2N74 A;  1JFF A;  3ABM B;  4J2D A;  2BSK B;  1FXK A;  4ASU G;  1MNG A;  4K8X A;  1ZL8 A;  4X1K B;  3S3W A;  4DR4 B;  2LFS A;  1VQN V;  2W0F C;  4D6T H;  1OCC C;  3H1I H;  1V54 C;  4DRX A;  1FS0 G;  2Q67 A;  3W7S A;  1MTY G;  3C6N B;  4DO2 A;  4J9Z B;  3LDB A;  4JI7 O;  2UUC O;  1EN4 A;  1KBH A;  1Q9Y A;  2JPN A;  1ZL8 B;  5EC1 C;  3ASO B;  2P1P B;  5KLV H;  3IFX A;  1WA8 B;  1SKV A;  1XNQ B;  2CTP A;  3LSS A;  3UQ8 A;  5KMG A;  2JIZ G;  3AG3 C;  3APO A;  2IU0 A;  4JI8 O;  3KD5 E;  3K59 A;  4B3M O;  2RDC A;  3QER A;  2HJD A;  3OR6 C;  1H2S B;  2V7Q G;  4IIJ A;  1FZ1 E;  4U3J A;  4U7O A;  5D5P A;  2RKH A;  3RMD A;  2P6J A;  1K3E A;  1OCO C;  4FLT A;  1P4R A;  1IBL O;  3TET A;  4O2B A;  3ZMV A;  4X1I A;  3QVN A;  5EBM C;  2HD0 A;  1YI2 V;  5KA6 A;  4LFA B;  5KMG B;  4FLY A;  1YIT V;  2Y69 C;  1RPR A;  4IGG A;  4TWK A;  4QE9 A;  2AGA A;  1N0J A;  5CMU A;  3LD8 A;  1D5N A;  2DMX A;  1A32 A;  4O4J B;  3ZMZ A;  1VAR A;  3C94 A;  2ODM A;  1WP8 A;  4FJL A;  2XND G;  4IHJ A;  4JYA O;  4TQD A;  3L74 H;  2WAM A;  3L1N A;  3SJC C;  3CS5 A;  2X0L A;  3JAL A;  1QLN A;  4UCR A;  3MKS B;  3RW0 A;  4DV4 O;  4X64 B;  5JJN B;  2BCC H;  1SC5 B;  4RNG A;  4UXN A;  2AZ0 A;  2ZM6 B;  1QBZ A;  1JW2 A;  3ZHV A;  2A0L A;  2LO1 A;  5KUM A;  2YXY A;  5K1X A;  1VQ9 V;  3LDE A;  2CDY A;  2QWP B;  3ASN B;  2FTK A;  3HPL C;  1O9H A;  3WSO A;  5EBW C;  2F4V O;  5B66 Z;  1NJI W;  2QSA A;  3SVI A;  3H1H H;  4I9W A;  3UM7 A;  2IW5 A;  4AI6 A;  5LGN A;  2RCU A;  4I9L A;  1JOY A;  3M7M X;  1PKX A;  3F5W C;  1XMQ O;  4FJX A;  1HNX O;  4AQY B;  1EZJ A;  4BW5 A;  1YJN V;  4JAU A;  1KYO F;  1B3Q A;  1ZAU A;  2Y0P A;  2E74 B;  4X65 O;  5B1A C;  1H2K A;  3LDC A;  1I5Y A;  4DV6 B;  2R9R B;  3ZRW A;  4M3X A;  3D8C A;  4X1K A;  3C90 A;  2KSD A;  4DTN A;  3JD2 A;  4YJ2 A;  1RM1 B;  1EN6 A;  2H94 A;  4I9Q A;  3JD4 A;  1U96 A;  2AHZ A;  3RWR D;  2QWO B;  4FZ0 A;  2MW2 B;  1XRE A;  4Z1M G;  4DUY B;  4DTU A;  3K9S A;  3JAS B;  3WFV A;  4GX5 A;  2BTQ A;  4C7U A;  1WPB A;  1Y67 A;  3A8T A;  3B4S A;  2EIN B;  1PPJ H;  4GCZ A;  4DK1 A;  2JGU A;  5IYZ A;  2QE7 G;  2W0X A;  4DR5 O;  2IJI A;  1SQQ H;  1XUQ A;  3QTC A;  3DC6 A;  2GDS A;  4O4H B;  1FZI E;  1HR0 B;  1FXH A;  5JWP A;  3T1Y O;  1I94 B;  3CC4 V;  1PM9 A;  3MHH C;  4UCO A;  1MMO G;  4LF5 O;  5LP6 A;  1BMF G;  1DLB A;  4OXS A;  1NR7 A;  4EP9 A;  3TK1 A;  1QNM A;  4DUZ B;  2LP7 A;  4ABM A;  2RQ6 A;  4PA7 A;  1VQO V;  1R3L C;  3RN4 A;  3K58 A;  5J2U A;  2QR4 A;  2JQT A;  3TJY A;  1XVF E;  1XVG E;  3J2P A;  1Z5W A;  4HNA B;  2OTJ V;  2Q7E A;  5GW7 A;  1S77 D;  1XVE E;  4JV5 B;  1AI7 A;  2ZNI A;  1RSO B;  1I0H A;  3SQ4 A;  2YEV A;  4KHQ A;  3TAE A;  1NZ6 A;  3K79 A;  4DR1 B;  2QKA A;  2PY5 A;  4P9O A;  4LC1 A;  2JGD B;  4LF9 O;  1QLE C;  3D36 A;  3OTF A;  5H37 A;  2UU9 O;  5IYD O;  4GZR B;  3HL8 A;  1KU9 A;  3E83 A;  3FYE B;  4I50 B;  3TAB A;  1UFI A;  2IM9 A;  2GHY A;  3K57 A;  1WNS A;  3UIQ A;  4JGS A;  3UT5 A;  1E1Q G;  3AG3 B;  4JI0 B;  3NCI A;  3IC7 A;  2B9Z A;  2UXN A;  2OCC C;  1YDX A;  3ZN0 A;  3FX7 A;  4GKJ B;  1GTO A;  2K1E A;  3SYP A;  3SI6 A;  1Y76 A;  5BR8 B;  2GSM B;  5CA3 A;  3AG1 B;  1XMF E;  5L3E A;  1CEZ A;  5LMN O;  3T4Z A;  2Q7H A;  1CLQ A;  2A9H A;  4P9P A;  3AK3 A;  3CRC A;  3BEH A;  4JV5 O;  3KG2 A;  4JI1 B;  2FW3 A;  2EJ7 A;  2ITD C;  3RFR A;  4CC5 A;  3C3S A;  4P30 A;  1S0V A;  4JF3 A;  2BOB C;  5B1N A;  4JI6 B;  3LNM B;  5KHG A;  1LDK E;  4GAM C;  3RVY A;  5EIB C;  2ARH A;  2DY4 A;  4UCV A;  3HKB B;  4KHS A;  4ZIB A;  2Z5U A;  4FLW A;  4MTG A;  1G8M A;  3WB0 A;  5LGT A;  3CC2 V;  5H9C A;  2F66 C;  1K5Q A;  5HFM A;  5JH7 A;  4DTR A;  2DEB A;  4LCU C;  4FM2 A;  3P30 A;  1XMH E;  5LBQ A;  1XEQ A;  5H5N A;  1W59 A;  5LP6 B;  4B3T B;  2JEU A;  1M5I A;  4CS3 A;  4X66 B;  3CQ8 A;  2LFR A;  2QM7 A;  4CH4 A;  2Q9L A;  1OHH G;  4JI3 B;  3D36 C;  4KHP B;  5C93 A;  5JVD B;  1TVK B;  3ZHU A;  2F4V B;  1IX9 A;  1IBM B;  1K8A W;  3CCE V;  1S5H C;  2OCC B;  1PL0 A;  1WAF A;  2HVK C;  5FNV B;  2C2A A;  4GYC B;  2JH9 A;  2ZM6 O;  3UO3 A;  3T1C A;  4FPP A;  4FIP C;  4P2Z A;  2ILM A;  4DV5 O;  4LF5 B;  2DWD C;  2QTS A;  3EHB B;  2KG7 A;  3KCY A;  1BQ0 A;  1GN4 A;  4RL5 A;  3KD1 E;  4UFZ A;  3SGI A;  2ZE7 A;  2EIM B;  3OT7 A;  4WFH A;  3SUN A;  4FJN A;  2QDO A;  2ZE8 A;  2V4D A;  4CS4 A;  3ZCC A;  5FNV A;  3TL8 B;  1L8D A;  1F51 A;  4FJG A;  2DQ3 A;  2IBZ H;  2P1N B;  4L87 A;  4PV1 B;  4U3J B;  3OEH G;  2WWW A;  1Y6X A;  4EPH A;  2ZIN A;  1YTF B;  1NU1 H;  5JQG B;  1WB8 A;  4O2A B;  4CZZ A;  1KP3 A;  3F5T A;  4X1Y A;  3QEV A;  4DRX B;  1THZ A;  3WB2 A;  5IYZ B;  3IJ4 A;  1S3J A;  2Q0O C;  4DR6 O;  1LNQ A;  2YC0 A;  2F1M A;  2VWJ A;  3WG7 C;  4RUF A;  1MSW D;  1IVS A;  3BFR A;  3T1H B;  2UXD O;  5KX5 B;  5L3G A;  3BRC A;  1EN5 A;  1GK9 A;  3SPJ A;  1MMM A;  4I7Z B;  1ZWI C;  1VIB A;  1NVP B;  3SUQ A;  2QWR B;  3OFN G;  4JI2 O;  1HNW O;  3AEI A;  3SPY A;  2BOC C;  1MZE A;  5IJ9 B;  4G28 B;  4MVM A;  1XVD E;  2WLL A;  1IUR A;  4EKW A;  4DV1 O;  3CJH B;  1HP8 A;  2CK3 G;  4JI4 O;  2MW2 A;  4Z1V A;  1Q7Y W;  2VWK A;  4X20 B;  2LW1 A;  3SJA C;  4I4T A;  3ABU A;  4O4L B;  2YI8 A;  1T5E A;  2F43 G;  3AK2 A;  2CE4 A;  4LR3 A;  2XAF A;  4FJM A;  2WLK A;  5H6Q A;  3HB3 B;  1I08 A;  1AP6 A;  2CTW A;  4JS5 A;  4R6Z A;  1ZUQ A;  2ZE6 A;  3S9H A;  1OZ0 A;  4X20 A;  4W4K A;  2UXX A;  1G4Y B;  3SQ0 A;  4PDR A;  1CXZ B;  3L9D A;  3K0D A;  3SPG A;  3QES A;  3JAT B;  4XBF A;  3Q4H B;  4DR1 O;  3J7A U;  3SPZ A;  1Y74 B;  3E8B A;  3HKC A;  1URF A;  2UU9 B;  4DR3 B;  1JMK C;  1IH7 A;  3W7X A;  5KX5 A;  4G27 B;  3CD6 V;  3C6O B;  2HP8 A;  3SUP A;  2EIJ C;  3OTO B;  4JAS A;  2EZP A;  3EXA A;  4JRP A;  5CBG A;  4DR7 O;  2KQX A;  4YY3 O;  2O57 A;  1AI6 A;  3HR0 A;  5LXT B;  1BQZ A;  1N34 O;  2YEV B;  3JYC A;  4MTO A;  1R6T A;  2R72 A;  2LF6 A;  1Z2G A;  4FJ9 A;  1M57 B;  1XOU A;  4MSW C;  1BE3 H;  1N33 B;  3SCX A;  4G2K A;  5BR8 O;  2DN9 A;  1VF6 A;  1SES A;  4LF6 O;  2DJV A;  3F7V C;  2W6J G;  2D2C B;  2QGN A;  4GKK O;  4FM0 A;  4FLX A;  3CCV V;  2XT9 A;  3BA8 A;  2DE0 X;  2CUG A;  1ZX3 A;  4ZHQ B;  4YJ2 B;  1OCR B;  4JTA B;  4Q6G A;  1OCC B;  1V55 C;  3JAW A;  1VQ7 V;  2OVR B;  4X9Q A;  2E76 B;  3LSQ A;  3CCL V;  1FKA O;  4M3R A;  3CFO A;  4J10 A;  3CWB H;  2E5L B;  1JA8 A;  1MSD A;  4J9Y B;  4DTO A;  4UVB A;  3TCU A;  1FZ8 E;  5B1B C;  3RT3 C;  1GN2 A;  3QEW A;  4FK5 C;  1R73 A;  2RNB A;  3QO8 A;  1SQX H;  5TIS Z;  1RSO A;  4LBE C;  2UUA O;  4JI3 O;  4DV4 B;  1XQ8 A;  4LNU A;  1QHT A;  4UB8 Z;  4LH6 A;  5IWA O;  2HLD G;  2ZXW B;  1DF5 A;  5B3S C;  4O4I A;  1GN6 A;  1HWY A;  4FJI A;  3OGI B;  3ABK B;  3TAF A;  1GO3 F;  5KHH A;  2W6I G;  4YHH B;  4LH7 A;  1BCC H;  2M6Y A;  1TUE B;  3FFQ A;  1H2N A;  2ZD9 A;  3O9O A;  1N1C A;  1ZLZ A;  4UUJ C;  3A0B Z;  4LNU B;  3CFR A;  2DYS C;  2B8I A;  1ZSP A;  4HZ3 A;  2LGW A;  3W7T A;  1TUB A;  4B3R O;  4B3S O;  2OYQ A;  4PDL A;  1HR0 O;  2B7M A;  4W4L A;  1SER A;  1VF7 A;  3CXH F;  2Q8V A;  4TUY B;  2JHA A;  3QET A;  4OGQ B;  3CHX A;  4QGP A;  2OTL V;  2QEX V;  4X65 B;  1KQS U;  1NH2 D;  1AB3 A;  2DYR C;  2P7T C;  4H0L B;  2P5G A;  3SYQ A;  3SQ1 A;  1OCZ B;  4FK4 A;  1PNK A;  4E4B A;  2YIB A;  5KHI A;  4E4E A;  2EUL A;  3LSU A;  2XAG A;  3CRQ A;  5LP6 C;  5BMV A;  4QNC A;  1GH6 A;  4NB5 A;  2EIK B;  3SJQ C;  1HDJ A;  3STL C;  5L3C A;  1MZF A;  1XU3 E;  3QO5 A;  4K0K B;  1GN3 A;  1XMO O;  1JQ0 A;  1M1K W;  3ABT A;  2HEP A;  2XTA A;  1WP7 A;  1K4C C;  1MAB G;  1K4D C;  2UUA B;  4HCC A;  1SZX A;  4D7S A;  4J7K A;  4PD4 F;  3RMC A;  1H8H G;  3BAB A;  3QNE A;  4TV8 A;  3C3T A;  4EFE A;  2PI4 A;  2A79 B;  1S5J A;  3SYA A;  3NR7 A;  4NXM O;  1FD9 A;  1NTM H;  4LF8 O;  3KCX A;  1F4N A;  1KKC A;  2ADP A;  2FL4 A;  3VOU A;  3OEE G;  2MMB A;  1IBM O;  4ZOL B;  2HKO A;  2EIK C;  2YDE A;  5FL7 G;  3OR7 C;  3UKM A;  3JCZ A;  4J7Z A;  1J5E O;  2UUB O;  1VF6 C;  1Q43 A;  1WLE A;  5L3B A;  3ZHR A;  2OT5 A;  4X8A A;  2ATQ A;  5CA0 B;  3OMA B;  1I94 O;  4J2A A;  4KHU A;  3V7D B;  3E8H A;  1TGO A;  4CBC A;  4MTF A;  3I5D A;  2RJZ A;  1CPY A;  1OJH A;  4B3M B;  4ZOL A;  4IYI A;  2PUS A;  3CCJ V;  5C8Y B;  3T4D A;  1IBK O;  1XU5 E;  5EBL C;  4FLZ A;  1FZH E;  2EBO A;  2DW4 A;  2PF4 E;  2WLN A;  1NI8 A;  3ZN1 A;  4YY3 B;  4QPJ A;  3DGE A;  2ZT9 B;  2RMK B;  1YZB A;  1XL4 A;  4N23 A;  4WBN B;  2Y4U A;  5IRE A;  4NXN B;  4GX0 A;  2UXD B;  4X5N A;  4FK2 A;  4X5M A;  3UT5 B;  3GB7 C;  3HKB A;  5CA1 B;  2Q73 A;  4ZI7 B;  5L3F A;  3X2Q B;  2ZDI A;  1VP7 A;  4OPA A;  3L70 H;  5CB4 B;  3N1B A;  3ZRS A;  5KUK A;  3CCQ V;  3TXQ A;  3D3I A;  4GX1 A;  2Q5Z A;  3A2F A;  4GKK B;  3N1E A;  2H4T A;  3T1Y B;  2WLI A;  4EB6 A;  2YI9 A;  1D2D A;  3CCR V;  1AR1 B;  4I55 A;  1RPO A;  4R7C A;  5EZY A;  2CAZ C;  3H01 A;  3ZHQ A;  3JSL A;  3OW2 U;  4FFK A;  3CC7 V;  2H8P C;  2PYJ A;  3GVM A;  5CB4 A;  4DV7 B;  1Q81 W;  5LHH A;  3L73 H;  2VIX A;  1EZV H;  4I4T B;  4YJ3 A;  3ICX A;  3OMI B;  5IJ0 B;  2M7W A;  1KB9 F;  3FD9 A;  5ITZ A;  1R3K C;  2Y69 B;  3JD1 A;  1SQP H;  4DV0 B;  5B3S B;  2ZR2 A;  3ETD A;  1XHZ A;  3KKY A;  1HNX B;  2ZCE A;  2OVQ B;  3CCS V;  3LZI A;  3E86 A;  4XDL A;  4O4I B;  2JEX A;  2NNU A;  4UB6 Z;  3NXS A;  1JVM A;  3CCM V;  5IWA B;  1FZ3 E;  4DV6 O;  1M4U A;  3DSQ A;  1G1X B;  3L75 H;  1Z5V A;  4JZ2 A;  4DR2 O;  3H1L H;  1B04 A;  4O4J A;  3W7U A;  1JR9 A;  2ZIM A;  1K33 A;  2P90 A;  3ZMS A;  3LUT B;  4MW8 A;  1MOF A;  4RWU A;  4PA3 A;  2YSU B;  3K2O A;  4KHW A;  4DV2 O;  2HFE C;  4BIU A;  2HG5 C;  4LFB B;  1R1B A;  4NTX A;  4HYO A;  4RO2 A;  4YIO A;  4J80 A;  1QCE A; 
#chains in the Genus database with same CATH homology
 2GUZ A;  2M6Y A;  1HDJ A;  1NZ6 A;  2CTQ A;  2PF4 E;  2LO1 A;  3BVO A;  2RKH A;  2DN9 A;  2QWO B;  2N05 A;  1N4C A;  2GUZ B;  3UO3 A;  1FAF A;  1N1C A;  2YUA A;  1WJZ A;  2QWN B;  2QWP B;  3AG7 A;  1XBL A;  1FPO A;  3UO2 A;  2LGW A;  2N04 A;  4RWU A;  2KQX A;  2OCH A;  2QWQ B;  2QSA A;  3UCS C;  1BQ0 A;  2CTP A;  1BQZ A;  2QWR B;  2EJ7 A;  2Y4T A;  2CTR A;  3APO A;  4J7Z A;  4IT5 A;  2Y4U A;  2YS8 A;  3APQ A;  2L6L A;  2CUG A;  1IUR A;  4J80 A;  2CTW A;  2DMX A;  1GH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...