3UO2A

Jac1 co-chaperone from saccharomyces cerevisiae
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
169
structure length
160
Chain Sequence
FTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords J-type co-chaperone JAC1, mitochondrial
publication title Interaction of j-protein co-chaperone jac1 with fe-s scaffold isu is indispensable in vivo and conserved in evolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 62
structure length 160
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3uo2A01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3uo2A02
2GUZA 1FAFA 2L6LA 2QWQB 2DMXA 1BQZA 2N05A 2QWOB 2CTQA 1N1CA 2LGWA 3APQA 1FPOA 2EJ7A 3UO3A 2YUAA 2QWNB 1HDJA 2QWPB 1WJZA 2KQXA 4J80A 3BVOA 2Y4UA 2N04A 4RWUA 2YS8A 1N4CA 2QWRB 3AG7A 4J7ZA 3APOA 2DN9A 2LO1A 1BQ0A 2CTWA 2CTPA 3UCSC 2QSAA 2PF4E 2GUZB 1XBLA 2Y4TA 1IURA 2CTRA 3UO2A 2OCHA 4IT5A 1GH6A 2M6YA 2CUGA 1NZ6A 2RKHA
chains in the Genus database with same CATH superfamily
2W6IG 2AGAA 3RYIB 4DTOA 4G27B 1P22A 3ASNB 3ZMVA 4O4HB 5KHJA 1H38A 4DR1B 5CA0B 1QR9A 5B5EZ 5KX5A 4K0KB 4HNAA 3SPJA 1IDSA 4M42A 4JTDB 4F6EA 5LXTA 4WF9V 5KA5A 4ZOLB 3SYAA 5LHIA 4KHNA 2ZT9B 3CP1A 3K06A 4HCBA 3K3WA 4LFBB 1F7YA 2GUZA 5H2FZ 1MHYG 1SA0B 2OYQA 3W7TA 3RYFB 4UB8Z 1OZ0A 3HL8A 3SQ4A 2ZE7A 2ZNIA 1FZ3E 1WB7A 2OZSA 2JS5A 3BVOA 2OIGA 2N04A 5JCOA 1OCRB 4UCSA 3HGLA 1IZ3A 3RT3C 2JHPA 2P7TC 3SI6A 4KHUA 4HZ3A 4LF4B 2P1NB 2HJDA 3QTCA 3JAKA 3WG7B 1CEZA 3L9DA 1IXMA 2X6BA 4J7JA 1K5QA 4NYKA 3OGMB 1LUWA 2LF3A 4JI8O 4PD4F 3RW0A 3ZRWB 3RYHA 4NXMO 1HDJA 1XU5E 1PP9H 3OGIB 1YJWV 2MMBA 2YI9A 4DUZO 5LA6A 3N1EA 3JAWB 3VOUA 1BHAA 4DR3O 3QNNA 2WLNA 3RMAA 1KBHA 3D3IA 2HFEC 3CXCU 4XDKA 4J41A 2XNDG 4DRXA 4YHHB 2VWKA 2DJVA 5J2TB 1K7DA 1RM1C 1SQGA 3U10A 5J2UA 4JASA 2JPNA 1CXZB 2YC0A 2EILB 4DW0A 1OCZC 4JI6O 1J5EB 3BFRA 4M45A 3EFFK 1TAEA 1FS0G 4NB5A 2Z5UA 1R6TA 4RWUA 2EIJB 3T1CA 2ZR3A 2UUCO 3C3TA 3STLC 4IIJB 2E5LO 3UCSC 2QKAA 4Z1VA 5AG2A 2OVRB 4X1YB 1WA8A 3QG5A 3SPIA 5A2QN 1VF5B 3UT5B 1CPYA 4J9ZB 4JYCA 3JD0A 1I5XA 5KHHA 1FZ1E 3E86A 2UXBB 5HFLA 2EZPA 2WLHA 3OE7G 4CC6A 5FLXN 4DU3A 3OW2U 4ZHQA 4TOIA 2Y69C 1K8AW 4FJMA 1PNLA 4KXRA 3KCXA 1QLEC 4EPHA 4UCOA 5IDJA 5B1NA 1G4YB 1KECA 5ITZB 3LDDA 2QWNB 3E8BA 4JS5A 3JARB 2WA3A 4TV9A 3D3QA 5L3CA 2H4TA 1CLQA 4OGQB 1SESA 5IJ0A 3ABKB 3E35A 3FB7C 1JW2A 1JJ2U 1MOFA 5IZ7A 2OCCC 4P9PA 2OVQB 1NR1A 4GLXA 4IT5A 1UFIA 3D36A 3QETA 4CH6A 3FYEB 4LF6O 3LSUA 2KG7B 1UJWB 1YJNV 4FJGA 1VQNV 3JD2A 2WAMA 1OJHA 2QTOA 3FYIB 3QF7A 3SYOA 2UXCB 4GX0A 2HG5C 1KP2A 2IH1C 1M57C 3K79A 3BEHA 3UM7A 3X2QB 1XVFE 3JALB 3ABMC 1HNWO 2IM9A 4AKHA 3H01A 2HVJC 2Z3YA 3N27A 5BR8O 1Y76A 1FZ9E 1VQ7V 2DE0X 3W7WA 4DR5B 2P90A 4JV5O 1AR5A 2UXXA 1JOYA 2FW3A 5H37A 1N0NA 3KD1E 1WN7A 3OM3B 1XNRO 2EBOA 3K9SA 3B40A 1V9PA 2VQEO 3CCQV 4PA9A 1YHQV 1G8MA 3G67A 3JAMN 1YVWA 2EINC 4FFBA 4DV4O 1NQTA 5BMVB 3A2FA 2NR5A 1BMFG 4LWSA 2A7WA 4LCUC 4PI0A 2GTAA 3JATA 1XBLA 4U3JB 3CJHA 2E74B 1HNXO 5LGUA 4IYIA 3QEVA 2JJ2G 1F4NA 3RYHB 3I55V 2OTJV 3TAEA 1BQZA 5DECA 1N32O 1GN3A 1BHBA 1YDXA 1H2GA 3K58A 4KL1A 2JJ1G 3ZRXA 2BSKA 4WFBV 4YJ2A 1S77D 2V4DA 5JVDA 3U11A 2IU0A 3RMCA 4DRXB 4O2AA 2QR4A 4EYWA 2ADPA 4JI8B 1FJGO 4NXMB 4LF7B 4DUZB 4AHCA 1XUQA 1WAZA 4E4EA 1FPOA 4I6JB 4DR3B 5CMUA 2FB5A 1FS1A 4L87A 2JEUA 3LDBA 1MMMA 1KYOF 4LC1A 4OPHA 1RPOA 1IXBA 1JR9A 1NKDA 4KHYA 2DY4A 2BOCC 4MTXA 2P1QB 4JI6B 3S3WA 3AK1A 2Y48A 2UUCB 1NU1H 2PGGA 2E5LB 3QO5A 1XHZA 2BTQB 4RNGA 4FJLA 3OUFA 3CMAV 1VQ5V 3WSOA 4CC5A 4B3MO 3D8CA 1VQMV 4MSWC 1SF9A 2YI8A 1DGSA 1FXXA 3HKBB 3LSSA 2VIXA 3ASOB 3EHBB 5LHHA 4KI6A 1OHHG 3THOA 4TT3G 5EZYA 5KUKA 1NVPB 1XL3C 3ZX6A 3HKDA 3E2EA 2QJ1A 3CRCA 4O4LB 2OIEA 5GTHZ 1YZBA 2KSDA 5IY5B 5LHGA 2YEVB 2PFVA 1XVGE 1FZ2E 2B1GA 4RL5A 3CX5F 3JSLA 3WB2A 4FJIA 2JRIA 3H1HH 4TUYA 2V7QG 4CH5A 2HHHB 3RFRA 1FXKA 2Y0PA 4I0XA 3MD0A 5B66Z 5LOVA 4X5MA 3RWRD 2WLIA 4CS3A 4FK2A 3ETGA 4AI6A 4LF6B 2JDIG 1S0VA 3NE6A 3QERA 4MVRA 3RGBA 4TV8A 1XVEE 1NI8A 3L74H 3L72H 2W6JG 4EB6B 1M4UA 3QEIA 2P22C 3F5WC 3CEIA 3HB3B 2FYUH 3L0MA 5K1XA 3OFNG 3G71V 2ARHA 2WPDG 4M3YA 3W7XA 1US6A 3RMBA 1N4CA 4FK4A 2X0LA 1X4TA 1L0NH 4WFGA 1MZFA 2YDEA 1HNWB 4LF8O 5BR8B 2JHAA 3K5LA 3NAEA 2IBZH 4P9OA 2XAJA 3CFPA 2QKCA 5B1AC 3ZMSA 2L6LA 1F4MA 2BE3A 4GKJB 1BZKA 2YXYA 3DGEA 4YIOA 3UO3A 4YIPA 4JYBA 4DR4B 3CJHB 4F6RB 1XL4A 2FTKA 3E4WA 1XNRB 3OMAB 1KMIZ 1TUBA 4UV8A 1WPBA 2VQEB 3BPZA 1SETA 5BY1A 1AB3A 3MHHC 4O2BB 3MAQA 1Q3EA 1EFRG 1S5HC 3KKYA 4DV4B 4FZ0A 4K3AA 2JH9A 4J7KA 1FFXA 1W0KG 4UCTA 2RQ6A 5FNVA 4QNDA 4H0LB 5JVDB 3P30A 1VMGA 1HNXB 1GN2A 1G1XB 3OR7C 2G38A 4O2AB 5IE9A 4G2KA 3T2MA 2YB5A 1MABG 3OMIB 2R9RB 2PY5A 5CB4A 3N1BA 5CBGA 1GRJA 1V54B 1FXHA 4UV9A 1J5EO 4MS2A 2PYJA 2E31A 4JPRA 1WP7A 3AK2A 3MHSC 1GM9A 3TXQA 5LP6C 2LGWA 3AG3B 1Y4MA 1GM8A 4J80A 3UIQA 2KB1A 4E4BA 1T5EA 1FKAO 1JQ0A 3C95A 2ODMA 5E79Z 1EN6A 1FJGB 5KA6A 3T1YO 5IJ9A 5FPOA 2R70A 4DV5B 1IURA 3WB1A 4JI7O 2H94A 1JJOA 2HLDG 4J11A 4WFHA 2YIBD 5IYCO 4JGSA 3FAVB 3MKSB 3B2EE 2A06H 2B9ZA 2CTQA 4J42A 2WLMA 3ABLC 4FJJA 4MVSA 4QPJA 3SDLA 2Q0OC 3SPCA 4TSFG 3JCZA 1H2MA 1M56C 2RN9A 2IH3C 3AG2C 1TVKB 2MZWB 1EN4A 4X89A 4XDJA 3E22B 1V55C 4FMTA 3LDEA 4WBNA 1NR7A 4FJHA 3CC7V 4H33A 1ZTEA 1SC5B 4Q6GA 3C6PB 4MT8A 1E1QG 4J2DA 4NTXA 2XT9A 1LR1A 3KG2A 3H1JH 4DK0A 2GHYA 4QNCA 1S3JA 2LW1A 1JX9A 1YF2A 2QWRB 3SQ1A 5KMGA 2Q7EA 4BIZA 3AEIA 1XVBE 4I9LA 4Z2WA 4M3ZA 3CE2A 1XMQO 2BCCH 3RYCA 4QE7A 4IGGA 4JTAB 3P3NA 1VQ4V 3SR2C 2ATKC 2DOSA 4ZKIA 3CFRA 3R65A 4X64O 4HAMA 1VP7A 4LH7A 1FXKB 3ETQA 3CD6V 4I0XB 1URFA 5KAIZ 1AR4A 3J80N 2OZMA 3N2KA 2KKWA 3ASNC 4QJFB 2RJZA 2C2AA 3KZIZ 4YY3B 3HP9A 3DC6A 4B08A 1W59A 2P67A 3J27A 2LFRA 2HKOA 3JD3A 1I7FA 4DR5O 1IBLO 2CUGA 5IWAO 1Z5WA 1R3KC 3Q4HB 1NJIW 1YTFB 5J9PC 3E83A 4YJ3A 4D7SA 2EZOA 1NH2D 3K08A 3ZHQA 3BAAA 4FJXA 3ZRVA 5LMUO 3CCJV 3I5DA 1JFFB 3NXSA 2JEXA 4PA4A 1OV9A 4DR2B 4UFZA 2Q6AA 2QKSA 1JMKC 3QO8A 4FJNA 4FLYA 4KHSA 1OCRC 2QEXV 5GONA 1BT8A 3WG7C 4LF8B 3QO7A 2H3OA 2JGDA 3CPWU 1FZIE 3ZHUA 2OTLV 4AILC 1WPXA 1A32A 4KFMA 4MTFA 4CBCA 1QVGU 1Z5VA 4LFAO 2F1MA 5EIBC 4K35A 3CRAA 5E1AC 4DW1A 2B5UA 2P5GA 2VS0A 4JI3O 3I56V 2CGOA 5CBHA 3TAGA 2YUAA 3AK3A 5IREA 2ZD9A 4LF7O 3K5NA 3T4DA 3O9OA 1PNKA 1XMOO 1K5SA 4O4IB 2EULA 2EILC 3K9AA 1ZL8A 3J7AU 4O4JB 2B8IA 2EIJC 1GN4A 4IHJB 5L3BA 1BE3H 1YCIA 1K4DC 4UVCA 4X62O 4GUNA 3ICXA 3K5OA 3B09A 1SZXA 4FPPA 5KHIA 4C7UA 3BCCH 1ZLZA 2R72A 3B8MA 2P4VA 2Q8VA 3OUSA 3JASB 3F7YC 4UCUA 4DO2A 1WB8A 4X1IA 1K33A 3BA8A 3LDCA 3RMDA 1DF4A 2WLLB 2ITCC 4PA3A 1K92A 3E8GA 1I08A 4FZ1A 3OT7A 2CH7A 3T1YB 2E3CA 4LF9O 4GZRB 2R9AA 4DV2B 4N23A 4WBNB 4JI7B 5C8YA 2D3OW 4QE9A 2UXDO 4M3TA 1SZTA 1NS1A 4CH3A 4DR6B 1XDCA 1K73W 2P6JA 1R3IC 4DTPA 1FZHE 3ABKC 2F93B 4DR7B 2ZNJA 1SKVA 4PHZA 3SPGA 2JHCA 1MSDA 4FJCC 2FKXA 2LP7A 1TUEB 3TJTA 5KHKA 3NR7A 2EX3A 4GT1A 3A0HZ 1J95A 4QNHB 3VQWA 2CTPA 1VF7A 4UVBA 1PPJH 1Y74B 2HHHO 1IH7A 2YSUB 3RN4A 2F66C 2YICA 4QGPA 2XHBA 3TGUH 2VRZA 1GKFA 1MSWD 5IYBO 3TETA 2O57A 5B3SB 4LP8A 4I55A 1ENVA 1PKXA 4DU4A 4RO2A 3X2QC 4JAAA 1XMQB 2DQ0A 5DEDA 4KP4A 5L3GA 1XMFE 4NKGB 2IJHA 1THZA 3CS5A 3NHGA 2YIDA 4MTGA 4X64B 5EIBD 4M41A 2NN4A 1H2NA 3BRCA 3IAYA 3QEXA 4DV6O 5KX5B 1VEWA 1WLEA 2A3QA 3SYCA 3J81N 4HNAB 1BL8A 1XEQA 1FZ4E 5LXTB 1XVCE 3HKCA 5LGNA 1XNQO 2XUMA 1QBZA 4JI4O 4MVUA 1IBLB 1ZSPA 1QLNA 3HGKE 3RVZA 4GKJO 5IWAB 4E2LA 1R73A 1MNGA 2GUZB 4D6TH 4FJ5A 4DR4O 5JJNB 3FB5C 2ZKOA 2P1MB 2YIBA 2LF6A 5LMUB 4MVQA 5EYPA 2WA4A 4Z1MG 5KHGA 2A0LA 2Q69A 1ORQC 5LGTA 4DV3O 1SS3A 1XL6A 3JAKB 1F23A 3SPYA 2CTRA 1GM7A 1E79G 4FJ8A 1OCCC 3SUQA 2ZDIA 1K3EA 3C6OB 5LA6B 3RBZA 2PUSA 1AR1B 4YXWG 3QNEA 4LFAB 5EBLC 1Q81W 3IC9A 5JJJB 4X20A 4LNUA 3SPHA 4UB6Z 4RAIA 1OCCB 3RWUA 1Q6HA 4JI3B 1I0HA 4J9YB 5JWPA 2RKHA 3E8HA 5J2UB 4BW9A 2DMXA 3P32A 1MHZG 4B3RO 2W0XA 1N33B 4DV5O 1XMOB 2P06A 3RVYA 1KUQA 1WA8B 5EBMC 1LDKE 1BCCH 4X62B 4AQYO 1AI7A 3CCVV 4FM0A 5IYZA 3L70H 4N21A 2LJ2A 3UQ8A 5C8YB 3P3PA 1AI4A 3ZMUA 3A8TA 5EK0A 4KHPO 3N2GA 4FK0A 3CCLV 3DSQA 4ZHQB 3ASOC 1Q5OA 1HR0B 3W7UA 2JK5C 1VARA 2OT5A 3OMNB 2ZCEA 2WLKA 3FKSG 4LF9B 1COWG 2ZE6A 1H2SB 1Q6IA 3TCUA 1WNSA 4TV9B 2UXDB 2A79B 5IJ0B 2ZE5A 3SJJA 3QEWA 3SNNA 5EC2C 2UUBO 4J2BA 5IY5C 2P1PB 2XAFA 4UUJC 4JS4A 4X1KA 2LQTA 4BR6A 2YXLA 2AXTZ 4X9QA 4EKWA 4LBEC 4PDLA 3JD1A 2A9HA 2QDOA 3IJ4A 3WB0A 4YY3O 3ZRSA 1XREA 1Y66A 1S72V 5JH7A 4PDVA 1SRYA 1GK9A 2EJ7A 1XI1A 3CWBH 1OCOB 1NT2B 1L0LH 4FLXA 5H9CA 3GVMA 1KU9A 1XMHE 4LR3A 3BABA 3F5TA 2GTSA 1VF6C 1S76D 2Y4TA 2HD0A 1Q8IA 3SJCC 3GWKC 1RFYA 1BS3A 1Y76B 3QEPA 1FAFA 4DR2O 2N05A 3CCEV 1N1CA 4JAVA 1ZUQA 1JCHA 4I9QA 2YXHA 1P7GA 1RSOA 5EC1C 3CMEV 4H44B 4PJ0Z 1BQ0A 1QCEA 4DV6B 5JQGA 5KUMA 1BSMA 3SYQA 4L8JA 4TWKA 2VJ4A 1AJQA 1XNQB 4FFBB 1R6NA 4JI4B 3OGCC 4PA6A 4LWSB 1UPGA 3CRQA 3MDSA 2D2CB 3RYIA 3ZHVA 2ZIMA 3ZMZA 3JATB 1ROPA 2XASA 1HP8A 2JS3A 2M7WA 3SUPA 5CA0A 1FYZE 2QE7G 4W4KA 3ZBHA 1PM9A 2PF4E 1NTKH 4U3FH 3C6NB 2ITDC 4R6ZA 4JTCB 1AP5A 2EIKB 4ZOLA 2Q68A 1IBMO 5KAFZ 1V54C 4X20B 4DV3B 3NGIA 4JAUA 4LNUB 2BSKB 4YJ2B 2P4KA 3RYFA 2BOBC 1TGOA 1B06A 2JH8A 4GX2A 4Q20A 3AG3C 3TABA 1Q82W 1B6QA 3CRRA 3KD5E 1H2KA 1NVPD 4E3SA 1CP9A 5BZBA 3OTOO 2QWQB 4B7EA 1R3JC 4DK1A 4JI1O 2Q4PA 1YI2V 2MK3A 2OWOA 3BA9A 4GKKO 2HR3A 2B7MA 4B7KA 3SCXA 5CN0A 3NCIA 2FMLA 4B3RB 3JAWA 1N34O 4DV2O 3LZIA 3CRMA 1YEWA 3ZN1A 1QHTA 3CYOA 3H9VA 4UXNA 2B1EA 4R8CA 4DR6O 1N0JA 5B1BB 3LZJA 4HYOA 4FLWA 5GW7A 1XILA 2OVPB 4DR7O 3C3SA 3L73H 4AQYB 5J2TA 1EZJA 2F43G 1Q86W 3OGKB 2LO1A 2EIMB 4UVAA 4I7ZB 3TAFA 1AJPA 2X6CA 4KHPB 4IIJA 4I50A 5LBQA 3OGLB 4X1YA 1W2BU 2GV9A 5EZYB 2LW7A 4JI5O 4FIPC 3UT5A 1VIBA 4AKGA 3HKDB 5L3DA 1RPRA 1FXKC 4M3RA 1SQQH 1LUVA 3WFVA 3L2OB 4UCVA 3S3XA 1KB9F 3U0ZA 2DYRB 5JH7B 5LMNO 2M6YA 4ICGC 2UUBB 2K1EA 4WFEA 3ETDA 3K04A 1XOUA 1PNMA 4TUYB 4JI2O 4IL6Z 3AG1B 4CS2A 5LOVB 2WLIB 4EFBA 5ITZA 4OPAA 4OX9O 2PTMA 2LGQA 2DN9A 5B1OA 2Q9LA 1PD3A 3JARA 4TV8B 3QESA 4NTWA 4EFEA 2HJFC 2ZXWB 1EN5A 3G6BA 1D5NA 3LSQA 5CBFA 4FM1A 2QA4V 1AI6A 3CC2V 1G6UA 3JSNA 1VQ9V 4TQDA 5JQGB 3O65A 1IG9A 4ZIBA 4DV7O 4JYAO 4FM2A 3IGAC 4DTUA 3FB6C 3A0RA 1HNZO 3AG4B 2CDYA 2DYSB 4LFCO 5FPRA 1KC8W 2XAQA 1D5AA 4DTNA 4G28B 1VQOV 3HR0A 3JYCA 4GX5A 1TUBB 3JALA 3B77A 4RUEA 2DQ3A 5GTIZ 3ZMTA 3T4ZA 1RP3B 2RMKB 4J2EA 1M90W 4CS4A 3OEEG 1M9NA 1ZX3A 2AZ2A 1ZWIC 4B3TO 4NR1A 3LD8A 4X5NA 1FFXB 4I4TA 2AZ0A 5FNVB 4A5UB 3BHPA 4DTMA 2UUAB 3CSXA 4DUYO 4X88A 3FD9A 5CB4B 1Q6UA 3ZHTA 1FD9A 3E89A 3TL8B 1N33O 3CHXA 4JYYA 5BMVA 2PZSA 1IBMB 3LUTB 2WWWA 3CCMV 3OEHG 3E4YA 4BW5A 1K9MW 2XAGA 4U3JA 1FFTB 5A9GA 1D2DA 1KKDA 3SQ2A 3ZN0A 5IJ9B 2PI5A 2NLJC 3BY6A 2WSSG 2Q73A 3ZHRA 3OTOB 4HCCA 4JI1B 3ZIAG 1YXBA 2F95B 4DV1O 2NNUA 3EVKA 1EZVH 2ADQB 3M99B 4K8XA 4RQFA 4GKKB 3JCUZ 2CGNA 1HR0O 4H13B 1Q9XA 3T1HO 4OXSA 4WCEV 5KLVH 1JPXA 1Q43A 1FZ0E 1NBMG 3GB7C 1P84F 1YTFD 1N34B 1B3QA 1HWYA 2CAZC 3NDKA 1Z2GA 2DW4A 1L1FA 3ABTA 3R66A 3APOA 4I50B 2H8PC 2XOKG 4FJKA 4FJ7A 5CA3A 1RM1B 2ZM6O 1EM1A 1OCZB 1XQ8A 5IT9N 1M5IA 2IJKA 1VQLV 1Y67A 4PV1B 4NXNO 5KMGB 1QU7A 3K57A 1NTMH 4EEQA 3SVIA 3RYCB 1VQPV 1I94O 5B3SC 2BTQA 2ZE8A 4I9WA 1PL0A 4K8ZA 1JVMA 1YITV 4JI5B 1O9HA 2CK3G 5EBWC 3CFOA 4GX1A 3HKBA 2IJIA 1MG1A 1WP8A 3N2KB 4UCRA 4CZZA 3FB8C 5LMNB 2Y69B 4MVMA 1XMGE 1QLEB 4JI2B 4U7NA 4MVZA 4AI8A 4ZI7A 4JI0B 3L8BA 4DU1A 3VQXA 4O4LA 4YJ3B 1JA8A 5IYDO 4XDLA 4OX9B 1O9GA 3DTUB 3B8NA 2OCCB 2YEVA 2AHZA 1XHXA 3PN1A 2Y4UA 4PDRA 5H6RA 5JCOC 4ZBMA 4FLTA 1QVFU 4MVOA 2ETNA 2JQTA 4B3SB 4DXWA 5GONB 5F2VO 1WAJA 4GYCB 4WFFA 5L3EA 1PL4A 2VQFO 1IX9A 2JGDB 2QM7A 4DV7B 4JYAB 4EB6A 3LNNA 1HNZB 1M57B 4LFCB 2K5SA 4R50A 1VF6A 3AG7A 1W0JG 4I4TB 2PFTA 3ABMB 4M3WA 5H6QA 2E76B 3SPZA 4X66O 3SJQC 4I5SA 1FZ8E 1KP3A 3VBBA 1AROP 3VQVA 4ADOA 4FVMA 1AP6A 2ZR2A 3L75H 3LNMB 3SYPA 2GSMB 4KHQA 3IC7A 4B3TB 2JGUA 1GMGA 1ZL8B 2UU9O 2QSAA 2IJJA 1HW7A 4F6RA 4LF5O 2ZQMA 2EINB 4DUYB 3TK1A 1AVMA 3DC5A 4P2ZA 1S5LZ 4O2BA 3K2OA 2EJRA 1S5JA 4ADNA 1IBKO 2K9PA 4CH4A 3CCUV 2BTOA 2Q5ZA 3HKEA 2P5OA 1AI5A 1KQSU 4X1IB 5CA1A 1L8DA 3FX7A 1SQVH 2F4VO 3DXRA 3OR6C 3CXHF 2Z0AA 1FZ5E 2XTAA 2QM8A 5D5PA 5TISZ 2L35A 1GH6A 1F51A 1TA8A 2CH7B 3CQ8A 1KKCA 1SQPH 4BIUA 2RDCA 4FLZA 1IVSA 3KCYA 4MW8A 2V1DA 2RCVA 3V7DB 2QGNA 1VQ6V 1X59A 5HFMA 4NTYA 3S9HA 1GTOA 2Q0AA 4QIWF 1MMOG 4DYLA 3M8AA 4DV1B 4ABMA 2RCUA 2UXNA 3EXAA 4JRPA 3SUOA 1Q7YW 2E75B 3SJAC 2HEPA 3T1HB 3UO2A 1R1BA 3ZJZA 2PYLA 4KHWA 5L3FA 1FYJA 3ZCCA 1PV0A 3D36C 4JF3A 3TXSA 5LP6A 1N36O 4DV0O 3FAVA 4PELA 1XVDE 4RG8A 3G4SV 4J2AA 2ZM6B 3TJYA 1EBOA 1MZEA 1AJNA 5LYJA 3VQYA 1OCOC 2JVDA 4X65O 1DF5A 1TVKA 2ZIOA 3G6EV 4PI2A 2IW5A 5IBKB 3CB2A 2Q7HA 3E22A 4BIOA 4NXNB 1U97A 3C90A 1Y6XA 4I55B 4XBFA 2QTSA 1GN6A 4RUFA 1MTYG 2MW2A 4M3XA 1DLBA 4FK5C 1I94B 2FL4A 3W7SA 3UKMA 1P49A 3K03A 2WLJA 4IYHA 3ETEA 1N8RW 1QNMA 3G80A 4ZI7B 2F23A 1K97A 2B1IA 2Q7GA 2AW9A 1ZAUA 2QM4A 3OD4A 2QWOB 3HKCB 1FZ7E 1P7BA 3B4SA 3SJBC 1H8HG 4FJ9A 3ML0A 1BGYH 2PI4A 4DR1O 4TQFA 4K0KO 4ICGA 3SUNA 1E1RG 2OCHA 5DN6G 4MW3A 2P1OB 1FZ6E 2LFSA 5EYPB 1NZ6A 3H1LH 3CCRV 3WU2Z 1Q90D 4FFKA 1SQBH 4U7OA 1K4CC 2ZDIC 3IFXA 4LFBO 3Q4HA 1M1KW 4JRQA 2EIKC 2X7RB 4O4HA 1QR8A 4J7ZA 2CTWA 2VQFB 2UUAO 1Q9YA 4KUMA 1JFFA 4W4LA 2E32A 3A0BZ 2ILMA 4DTXA 4JV5B 4D7TA 2DWEC 2Y0IA 2CE4A 4LF4O 2DWDC 4J10A 1NEXB 4HBNA 4DTJA 1SA0A 2KQXA 3STZC 4X66B 3H1IH 2YS8A 4R7CA 2VWJA 1QQCA 3M7MX 5B1AB 2Q67A 1YIJV 3SQ0A 5D5QA 3PJSK 1U96A 1SERA 4BAYA 1FXVA 3OAAG 5FL7G 3GWOA 1NTZH 3SGIA 3HKEB 4MTOA 1DK1A 2UU9B 1M93A 3L71H 5CA1B 4LF5B 2RNBA 2QWPB 3DXRB 1H2LA 3F7VC 1YJ9V 4YHHO 5LL6Y 4GCZA 3ZRWA 2X6AA 4PDMA 2R9IA 5B1BC 3QNOA 4JZ2A 5IYZB 2VJ5A 1N32B 3L1NA 2HP8A 3FFQA 2FYOA 1H8EG 4F4LA 4O4IA 1IBKB 5JJEB 4FLUA 2EIMC 3N2GB 1NH2B 4O4JA 1B04A 2GBOA 1KD1W 1VQ8V 4IHJA 2N74A 5C93A 2F4VB 4JZGA 1AILA 1GAXA 4ASUG 2HVKC 5LP6B 4DTSA 3HPLC 1DTOA 5DM6V 2UXBO 1MA1A 3JASA 3ABUA 1SQXH 1GO3F 4X8AA 1I5YA 3QVNA 1K34A 5BXZA 5LYJB 2DYRC 2W0FC 2WLLA 4X1KB 4FLVA 1WJZA 2ATQA 1LNQA 1VQKV 3K5MA 2IU3A 4QPKA 3AG1C 5K1PA 3OTFA 1N36B 2MW2B 3ABLB 4LH6A 1R6KA 4DV0B 2DTUA 2GDSA 4NVPA 3K59A 1M56B 3AG2B 4AKIA 4B3MB 3ZS8C 4BWAA 1R3LC 1WAFA 3C94A 2ZXWC 4JI0O 4X65B 1SQFA 1V55B 3ZHSA 2DEBA 3K0GA 1XU3E 3JD4A 3LDSA 3E8FA 3J2PA 3CC4V 2YIAA 4M3UA 2UXCO 4P30A 2QXFA 1RSOB 1Y74A 4RQEA 3APQA 3AG4C 4B3SO 4DTRA 2DYSC 4PA7A 4KI4A 1P4RA 3K0DA 3CCSV 2KG7A 1YSCA 3H1KH 4GAMC 4H37A 2XAHA 2AHYA 3ZEDA 2ZINA 5H5NA 4WFAV 4EP9A 2JIZG
chains in the Genus database with same CATH topology
2GUZA 1FAFA 2L6LA 2QWQB 2DMXA 1BQZA 2N05A 2QWOB 2CTQA 1N1CA 2LGWA 3APQA 1FPOA 2EJ7A 3UO3A 2YUAA 2QWNB 1HDJA 2QWPB 1WJZA 2KQXA 4J80A 3BVOA 2Y4UA 2N04A 4RWUA 2YS8A 1N4CA 2QWRB 3AG7A 4J7ZA 3APOA 2DN9A 2LO1A 1BQ0A 2CTWA 2CTPA 3UCSC 2QSAA 2PF4E 2GUZB 1XBLA 2Y4TA 1IURA 2CTRA 3UO2A 2OCHA 4IT5A 1GH6A 2M6YA 2CUGA 1NZ6A 2RKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUZ A;  1FAF A;  2L6L A;  2QWQ B;  2DMX A;  1BQZ A;  2N05 A;  2QWO B;  2CTQ A;  1N1C A;  2LGW A;  3APQ A;  1FPO A;  2EJ7 A;  3UO3 A;  2YUA A;  2QWN B;  1HDJ A;  2QWP B;  1WJZ A;  2KQX A;  4J80 A;  3BVO A;  2Y4U A;  2N04 A;  4RWU A;  2YS8 A;  1N4C A;  2QWR B;  3AG7 A;  4J7Z A;  3APO A;  2DN9 A;  2LO1 A;  1BQ0 A;  2CTW A;  2CTP A;  3UCS C;  2QSA A;  2PF4 E;  2GUZ B;  1XBL A;  2Y4T A;  1IUR A;  2CTR A;  3UO2 A;  2OCH A;  4IT5 A;  1GH6 A;  2M6Y A;  2CUG A;  1NZ6 A;  2RKH A; 
#chains in the Genus database with same CATH topology
 2W6I G;  2AGA A;  3RYI B;  4DTO A;  4G27 B;  1P22 A;  3ASN B;  3ZMV A;  4O4H B;  5KHJ A;  1H38 A;  4DR1 B;  5CA0 B;  1QR9 A;  5B5E Z;  5KX5 A;  4K0K B;  4HNA A;  3SPJ A;  1IDS A;  4M42 A;  4JTD B;  4F6E A;  5LXT A;  4WF9 V;  5KA5 A;  4ZOL B;  3SYA A;  5LHI A;  4KHN A;  2ZT9 B;  3CP1 A;  3K06 A;  4HCB A;  3K3W A;  4LFB B;  1F7Y A;  2GUZ A;  5H2F Z;  1MHY G;  1SA0 B;  2OYQ A;  3W7T A;  3RYF B;  4UB8 Z;  1OZ0 A;  3HL8 A;  3SQ4 A;  2ZE7 A;  2ZNI A;  1FZ3 E;  1WB7 A;  2OZS A;  2JS5 A;  3BVO A;  2OIG A;  2N04 A;  5JCO A;  1OCR B;  4UCS A;  3HGL A;  1IZ3 A;  3RT3 C;  2JHP A;  2P7T C;  3SI6 A;  4KHU A;  4HZ3 A;  4LF4 B;  2P1N B;  2HJD A;  3QTC A;  3JAK A;  3WG7 B;  1CEZ A;  3L9D A;  1IXM A;  2X6B A;  4J7J A;  1K5Q A;  4NYK A;  3OGM B;  1LUW A;  2LF3 A;  4JI8 O;  4PD4 F;  3RW0 A;  3ZRW B;  3RYH A;  4NXM O;  1HDJ A;  1XU5 E;  1PP9 H;  3OGI B;  1YJW V;  2MMB A;  2YI9 A;  4DUZ O;  5LA6 A;  3N1E A;  3JAW B;  3VOU A;  1BHA A;  4DR3 O;  3QNN A;  2WLN A;  3RMA A;  1KBH A;  3D3I A;  2HFE C;  3CXC U;  4XDK A;  4J41 A;  2XND G;  4DRX A;  4YHH B;  2VWK A;  2DJV A;  5J2T B;  1K7D A;  1RM1 C;  1SQG A;  3U10 A;  5J2U A;  4JAS A;  2JPN A;  1CXZ B;  2YC0 A;  2EIL B;  4DW0 A;  1OCZ C;  4JI6 O;  1J5E B;  3BFR A;  4M45 A;  3EFF K;  1TAE A;  1FS0 G;  4NB5 A;  2Z5U A;  1R6T A;  4RWU A;  2EIJ B;  3T1C A;  2ZR3 A;  2UUC O;  3C3T A;  3STL C;  4IIJ B;  2E5L O;  3UCS C;  2QKA A;  4Z1V A;  5AG2 A;  2OVR B;  4X1Y B;  1WA8 A;  3QG5 A;  3SPI A;  5A2Q N;  1VF5 B;  3UT5 B;  1CPY A;  4J9Z B;  4JYC A;  3JD0 A;  1I5X A;  5KHH A;  1FZ1 E;  3E86 A;  2UXB B;  5HFL A;  2EZP A;  2WLH A;  3OE7 G;  4CC6 A;  5FLX N;  4DU3 A;  3OW2 U;  4ZHQ A;  4TOI A;  2Y69 C;  1K8A W;  4FJM A;  1PNL A;  4KXR A;  3KCX A;  1QLE C;  4EPH A;  4UCO A;  5IDJ A;  5B1N A;  1G4Y B;  1KEC A;  5ITZ B;  3LDD A;  2QWN B;  3E8B A;  4JS5 A;  3JAR B;  2WA3 A;  4TV9 A;  3D3Q A;  5L3C A;  2H4T A;  1CLQ A;  4OGQ B;  1SES A;  5IJ0 A;  3ABK B;  3E35 A;  3FB7 C;  1JW2 A;  1JJ2 U;  1MOF A;  5IZ7 A;  2OCC C;  4P9P A;  2OVQ B;  1NR1 A;  4GLX A;  4IT5 A;  1UFI A;  3D36 A;  3QET A;  4CH6 A;  3FYE B;  4LF6 O;  3LSU A;  2KG7 B;  1UJW B;  1YJN V;  4FJG A;  1VQN V;  3JD2 A;  2WAM A;  1OJH A;  2QTO A;  3FYI B;  3QF7 A;  3SYO A;  2UXC B;  4GX0 A;  2HG5 C;  1KP2 A;  2IH1 C;  1M57 C;  3K79 A;  3BEH A;  3UM7 A;  3X2Q B;  1XVF E;  3JAL B;  3ABM C;  1HNW O;  2IM9 A;  4AKH A;  3H01 A;  2HVJ C;  2Z3Y A;  3N27 A;  5BR8 O;  1Y76 A;  1FZ9 E;  1VQ7 V;  2DE0 X;  3W7W A;  4DR5 B;  2P90 A;  4JV5 O;  1AR5 A;  2UXX A;  1JOY A;  2FW3 A;  5H37 A;  1N0N A;  3KD1 E;  1WN7 A;  3OM3 B;  1XNR O;  2EBO A;  3K9S A;  3B40 A;  1V9P A;  2VQE O;  3CCQ V;  4PA9 A;  1YHQ V;  1G8M A;  3G67 A;  3JAM N;  1YVW A;  2EIN C;  4FFB A;  4DV4 O;  1NQT A;  5BMV B;  3A2F A;  2NR5 A;  1BMF G;  4LWS A;  2A7W A;  4LCU C;  4PI0 A;  2GTA A;  3JAT A;  1XBL A;  4U3J B;  3CJH A;  2E74 B;  1HNX O;  5LGU A;  4IYI A;  3QEV A;  2JJ2 G;  1F4N A;  3RYH B;  3I55 V;  2OTJ V;  3TAE A;  1BQZ A;  5DEC A;  1N32 O;  1GN3 A;  1BHB A;  1YDX A;  1H2G A;  3K58 A;  4KL1 A;  2JJ1 G;  3ZRX A;  2BSK A;  4WFB V;  4YJ2 A;  1S77 D;  2V4D A;  5JVD A;  3U11 A;  2IU0 A;  3RMC A;  4DRX B;  4O2A A;  2QR4 A;  4EYW A;  2ADP A;  4JI8 B;  1FJG O;  4NXM B;  4LF7 B;  4DUZ B;  4AHC A;  1XUQ A;  1WAZ A;  4E4E A;  1FPO A;  4I6J B;  4DR3 B;  5CMU A;  2FB5 A;  1FS1 A;  4L87 A;  2JEU A;  3LDB A;  1MMM A;  1KYO F;  4LC1 A;  4OPH A;  1RPO A;  1IXB A;  1JR9 A;  1NKD A;  4KHY A;  2DY4 A;  2BOC C;  4MTX A;  2P1Q B;  4JI6 B;  3S3W A;  3AK1 A;  2Y48 A;  2UUC B;  1NU1 H;  2PGG A;  2E5L B;  3QO5 A;  1XHZ A;  2BTQ B;  4RNG A;  4FJL A;  3OUF A;  3CMA V;  1VQ5 V;  3WSO A;  4CC5 A;  4B3M O;  3D8C A;  1VQM V;  4MSW C;  1SF9 A;  2YI8 A;  1DGS A;  1FXX A;  3HKB B;  3LSS A;  2VIX A;  3ASO B;  3EHB B;  5LHH A;  4KI6 A;  1OHH G;  3THO A;  4TT3 G;  5EZY A;  5KUK A;  1NVP B;  1XL3 C;  3ZX6 A;  3HKD A;  3E2E A;  2QJ1 A;  3CRC A;  4O4L B;  2OIE A;  5GTH Z;  1YZB A;  2KSD A;  5IY5 B;  5LHG A;  2YEV B;  2PFV A;  1XVG E;  1FZ2 E;  2B1G A;  4RL5 A;  3CX5 F;  3JSL A;  3WB2 A;  4FJI A;  2JRI A;  3H1H H;  4TUY A;  2V7Q G;  4CH5 A;  2HHH B;  3RFR A;  1FXK A;  2Y0P A;  4I0X A;  3MD0 A;  5B66 Z;  5LOV A;  4X5M A;  3RWR D;  2WLI A;  4CS3 A;  4FK2 A;  3ETG A;  4AI6 A;  4LF6 B;  2JDI G;  1S0V A;  3NE6 A;  3QER A;  4MVR A;  3RGB A;  4TV8 A;  1XVE E;  1NI8 A;  3L74 H;  3L72 H;  2W6J G;  4EB6 B;  1M4U A;  3QEI A;  2P22 C;  3F5W C;  3CEI A;  3HB3 B;  2FYU H;  3L0M A;  5K1X A;  3OFN G;  3G71 V;  2ARH A;  2WPD G;  4M3Y A;  3W7X A;  1US6 A;  3RMB A;  1N4C A;  4FK4 A;  2X0L A;  1X4T A;  1L0N H;  4WFG A;  1MZF A;  2YDE A;  1HNW B;  4LF8 O;  5BR8 B;  2JHA A;  3K5L A;  3NAE A;  2IBZ H;  4P9O A;  2XAJ A;  3CFP A;  2QKC A;  5B1A C;  3ZMS A;  2L6L A;  1F4M A;  2BE3 A;  4GKJ B;  1BZK A;  2YXY A;  3DGE A;  4YIO A;  3UO3 A;  4YIP A;  4JYB A;  4DR4 B;  3CJH B;  4F6R B;  1XL4 A;  2FTK A;  3E4W A;  1XNR B;  3OMA B;  1KMI Z;  1TUB A;  4UV8 A;  1WPB A;  2VQE B;  3BPZ A;  1SET A;  5BY1 A;  1AB3 A;  3MHH C;  4O2B B;  3MAQ A;  1Q3E A;  1EFR G;  1S5H C;  3KKY A;  4DV4 B;  4FZ0 A;  4K3A A;  2JH9 A;  4J7K A;  1FFX A;  1W0K G;  4UCT A;  2RQ6 A;  5FNV A;  4QND A;  4H0L B;  5JVD B;  3P30 A;  1VMG A;  1HNX B;  1GN2 A;  1G1X B;  3OR7 C;  2G38 A;  4O2A B;  5IE9 A;  4G2K A;  3T2M A;  2YB5 A;  1MAB G;  3OMI B;  2R9R B;  2PY5 A;  5CB4 A;  3N1B A;  5CBG A;  1GRJ A;  1V54 B;  1FXH A;  4UV9 A;  1J5E O;  4MS2 A;  2PYJ A;  2E31 A;  4JPR A;  1WP7 A;  3AK2 A;  3MHS C;  1GM9 A;  3TXQ A;  5LP6 C;  2LGW A;  3AG3 B;  1Y4M A;  1GM8 A;  4J80 A;  3UIQ A;  2KB1 A;  4E4B A;  1T5E A;  1FKA O;  1JQ0 A;  3C95 A;  2ODM A;  5E79 Z;  1EN6 A;  1FJG B;  5KA6 A;  3T1Y O;  5IJ9 A;  5FPO A;  2R70 A;  4DV5 B;  1IUR A;  3WB1 A;  4JI7 O;  2H94 A;  1JJO A;  2HLD G;  4J11 A;  4WFH A;  2YIB D;  5IYC O;  4JGS A;  3FAV B;  3MKS B;  3B2E E;  2A06 H;  2B9Z A;  2CTQ A;  4J42 A;  2WLM A;  3ABL C;  4FJJ A;  4MVS A;  4QPJ A;  3SDL A;  2Q0O C;  3SPC A;  4TSF G;  3JCZ A;  1H2M A;  1M56 C;  2RN9 A;  2IH3 C;  3AG2 C;  1TVK B;  2MZW B;  1EN4 A;  4X89 A;  4XDJ A;  3E22 B;  1V55 C;  4FMT A;  3LDE A;  4WBN A;  1NR7 A;  4FJH A;  3CC7 V;  4H33 A;  1ZTE A;  1SC5 B;  4Q6G A;  3C6P B;  4MT8 A;  1E1Q G;  4J2D A;  4NTX A;  2XT9 A;  1LR1 A;  3KG2 A;  3H1J H;  4DK0 A;  2GHY A;  4QNC A;  1S3J A;  2LW1 A;  1JX9 A;  1YF2 A;  2QWR B;  3SQ1 A;  5KMG A;  2Q7E A;  4BIZ A;  3AEI A;  1XVB E;  4I9L A;  4Z2W A;  4M3Z A;  3CE2 A;  1XMQ O;  2BCC H;  3RYC A;  4QE7 A;  4IGG A;  4JTA B;  3P3N A;  1VQ4 V;  3SR2 C;  2ATK C;  2DOS A;  4ZKI A;  3CFR A;  3R65 A;  4X64 O;  4HAM A;  1VP7 A;  4LH7 A;  1FXK B;  3ETQ A;  3CD6 V;  4I0X B;  1URF A;  5KAI Z;  1AR4 A;  3J80 N;  2OZM A;  3N2K A;  2KKW A;  3ASN C;  4QJF B;  2RJZ A;  2C2A A;  3KZI Z;  4YY3 B;  3HP9 A;  3DC6 A;  4B08 A;  1W59 A;  2P67 A;  3J27 A;  2LFR A;  2HKO A;  3JD3 A;  1I7F A;  4DR5 O;  1IBL O;  2CUG A;  5IWA O;  1Z5W A;  1R3K C;  3Q4H B;  1NJI W;  1YTF B;  5J9P C;  3E83 A;  4YJ3 A;  4D7S A;  2EZO A;  1NH2 D;  3K08 A;  3ZHQ A;  3BAA A;  4FJX A;  3ZRV A;  5LMU O;  3CCJ V;  3I5D A;  1JFF B;  3NXS A;  2JEX A;  4PA4 A;  1OV9 A;  4DR2 B;  4UFZ A;  2Q6A A;  2QKS A;  1JMK C;  3QO8 A;  4FJN A;  4FLY A;  4KHS A;  1OCR C;  2QEX V;  5GON A;  1BT8 A;  3WG7 C;  4LF8 B;  3QO7 A;  2H3O A;  2JGD A;  3CPW U;  1FZI E;  3ZHU A;  2OTL V;  4AIL C;  1WPX A;  1A32 A;  4KFM A;  4MTF A;  4CBC A;  1QVG U;  1Z5V A;  4LFA O;  2F1M A;  5EIB C;  4K35 A;  3CRA A;  5E1A C;  4DW1 A;  2B5U A;  2P5G A;  2VS0 A;  4JI3 O;  3I56 V;  2CGO A;  5CBH A;  3TAG A;  2YUA A;  3AK3 A;  5IRE A;  2ZD9 A;  4LF7 O;  3K5N A;  3T4D A;  3O9O A;  1PNK A;  1XMO O;  1K5S A;  4O4I B;  2EUL A;  2EIL C;  3K9A A;  1ZL8 A;  3J7A U;  4O4J B;  2B8I A;  2EIJ C;  1GN4 A;  4IHJ B;  5L3B A;  1BE3 H;  1YCI A;  1K4D C;  4UVC A;  4X62 O;  4GUN A;  3ICX A;  3K5O A;  3B09 A;  1SZX A;  4FPP A;  5KHI A;  4C7U A;  3BCC H;  1ZLZ A;  2R72 A;  3B8M A;  2P4V A;  2Q8V A;  3OUS A;  3JAS B;  3F7Y C;  4UCU A;  4DO2 A;  1WB8 A;  4X1I A;  1K33 A;  3BA8 A;  3LDC A;  3RMD A;  1DF4 A;  2WLL B;  2ITC C;  4PA3 A;  1K92 A;  3E8G A;  1I08 A;  4FZ1 A;  3OT7 A;  2CH7 A;  3T1Y B;  2E3C A;  4LF9 O;  4GZR B;  2R9A A;  4DV2 B;  4N23 A;  4WBN B;  4JI7 B;  5C8Y A;  2D3O W;  4QE9 A;  2UXD O;  4M3T A;  1SZT A;  1NS1 A;  4CH3 A;  4DR6 B;  1XDC A;  1K73 W;  2P6J A;  1R3I C;  4DTP A;  1FZH E;  3ABK C;  2F93 B;  4DR7 B;  2ZNJ A;  1SKV A;  4PHZ A;  3SPG A;  2JHC A;  1MSD A;  4FJC C;  2FKX A;  2LP7 A;  1TUE B;  3TJT A;  5KHK A;  3NR7 A;  2EX3 A;  4GT1 A;  3A0H Z;  1J95 A;  4QNH B;  3VQW A;  2CTP A;  1VF7 A;  4UVB A;  1PPJ H;  1Y74 B;  2HHH O;  1IH7 A;  2YSU B;  3RN4 A;  2F66 C;  2YIC A;  4QGP A;  2XHB A;  3TGU H;  2VRZ A;  1GKF A;  1MSW D;  5IYB O;  3TET A;  2O57 A;  5B3S B;  4LP8 A;  4I55 A;  1ENV A;  1PKX A;  4DU4 A;  4RO2 A;  3X2Q C;  4JAA A;  1XMQ B;  2DQ0 A;  5DED A;  4KP4 A;  5L3G A;  1XMF E;  4NKG B;  2IJH A;  1THZ A;  3CS5 A;  3NHG A;  2YID A;  4MTG A;  4X64 B;  5EIB D;  4M41 A;  2NN4 A;  1H2N A;  3BRC A;  3IAY A;  3QEX A;  4DV6 O;  5KX5 B;  1VEW A;  1WLE A;  2A3Q A;  3SYC A;  3J81 N;  4HNA B;  1BL8 A;  1XEQ A;  1FZ4 E;  5LXT B;  1XVC E;  3HKC A;  5LGN A;  1XNQ O;  2XUM A;  1QBZ A;  4JI4 O;  4MVU A;  1IBL B;  1ZSP A;  1QLN A;  3HGK E;  3RVZ A;  4GKJ O;  5IWA B;  4E2L A;  1R73 A;  1MNG A;  2GUZ B;  4D6T H;  4FJ5 A;  4DR4 O;  5JJN B;  3FB5 C;  2ZKO A;  2P1M B;  2YIB A;  2LF6 A;  5LMU B;  4MVQ A;  5EYP A;  2WA4 A;  4Z1M G;  5KHG A;  2A0L A;  2Q69 A;  1ORQ C;  5LGT A;  4DV3 O;  1SS3 A;  1XL6 A;  3JAK B;  1F23 A;  3SPY A;  2CTR A;  1GM7 A;  1E79 G;  4FJ8 A;  1OCC C;  3SUQ A;  2ZDI A;  1K3E A;  3C6O B;  5LA6 B;  3RBZ A;  2PUS A;  1AR1 B;  4YXW G;  3QNE A;  4LFA B;  5EBL C;  1Q81 W;  3IC9 A;  5JJJ B;  4X20 A;  4LNU A;  3SPH A;  4UB6 Z;  4RAI A;  1OCC B;  3RWU A;  1Q6H A;  4JI3 B;  1I0H A;  4J9Y B;  5JWP A;  2RKH A;  3E8H A;  5J2U B;  4BW9 A;  2DMX A;  3P32 A;  1MHZ G;  4B3R O;  2W0X A;  1N33 B;  4DV5 O;  1XMO B;  2P06 A;  3RVY A;  1KUQ A;  1WA8 B;  5EBM C;  1LDK E;  1BCC H;  4X62 B;  4AQY O;  1AI7 A;  3CCV V;  4FM0 A;  5IYZ A;  3L70 H;  4N21 A;  2LJ2 A;  3UQ8 A;  5C8Y B;  3P3P A;  1AI4 A;  3ZMU A;  3A8T A;  5EK0 A;  4KHP O;  3N2G A;  4FK0 A;  3CCL V;  3DSQ A;  4ZHQ B;  3ASO C;  1Q5O A;  1HR0 B;  3W7U A;  2JK5 C;  1VAR A;  2OT5 A;  3OMN B;  2ZCE A;  2WLK A;  3FKS G;  4LF9 B;  1COW G;  2ZE6 A;  1H2S B;  1Q6I A;  3TCU A;  1WNS A;  4TV9 B;  2UXD B;  2A79 B;  5IJ0 B;  2ZE5 A;  3SJJ A;  3QEW A;  3SNN A;  5EC2 C;  2UUB O;  4J2B A;  5IY5 C;  2P1P B;  2XAF A;  4UUJ C;  4JS4 A;  4X1K A;  2LQT A;  4BR6 A;  2YXL A;  2AXT Z;  4X9Q A;  4EKW A;  4LBE C;  4PDL A;  3JD1 A;  2A9H A;  2QDO A;  3IJ4 A;  3WB0 A;  4YY3 O;  3ZRS A;  1XRE A;  1Y66 A;  1S72 V;  5JH7 A;  4PDV A;  1SRY A;  1GK9 A;  2EJ7 A;  1XI1 A;  3CWB H;  1OCO B;  1NT2 B;  1L0L H;  4FLX A;  5H9C A;  3GVM A;  1KU9 A;  1XMH E;  4LR3 A;  3BAB A;  3F5T A;  2GTS A;  1VF6 C;  1S76 D;  2Y4T A;  2HD0 A;  1Q8I A;  3SJC C;  3GWK C;  1RFY A;  1BS3 A;  1Y76 B;  3QEP A;  1FAF A;  4DR2 O;  2N05 A;  3CCE V;  1N1C A;  4JAV A;  1ZUQ A;  1JCH A;  4I9Q A;  2YXH A;  1P7G A;  1RSO A;  5EC1 C;  3CME V;  4H44 B;  4PJ0 Z;  1BQ0 A;  1QCE A;  4DV6 B;  5JQG A;  5KUM A;  1BSM A;  3SYQ A;  4L8J A;  4TWK A;  2VJ4 A;  1AJQ A;  1XNQ B;  4FFB B;  1R6N A;  4JI4 B;  3OGC C;  4PA6 A;  4LWS B;  1UPG A;  3CRQ A;  3MDS A;  2D2C B;  3RYI A;  3ZHV A;  2ZIM A;  3ZMZ A;  3JAT B;  1ROP A;  2XAS A;  1HP8 A;  2JS3 A;  2M7W A;  3SUP A;  5CA0 A;  1FYZ E;  2QE7 G;  4W4K A;  3ZBH A;  1PM9 A;  2PF4 E;  1NTK H;  4U3F H;  3C6N B;  2ITD C;  4R6Z A;  4JTC B;  1AP5 A;  2EIK B;  4ZOL A;  2Q68 A;  1IBM O;  5KAF Z;  1V54 C;  4X20 B;  4DV3 B;  3NGI A;  4JAU A;  4LNU B;  2BSK B;  4YJ2 B;  2P4K A;  3RYF A;  2BOB C;  1TGO A;  1B06 A;  2JH8 A;  4GX2 A;  4Q20 A;  3AG3 C;  3TAB A;  1Q82 W;  1B6Q A;  3CRR A;  3KD5 E;  1H2K A;  1NVP D;  4E3S A;  1CP9 A;  5BZB A;  3OTO O;  2QWQ B;  4B7E A;  1R3J C;  4DK1 A;  4JI1 O;  2Q4P A;  1YI2 V;  2MK3 A;  2OWO A;  3BA9 A;  4GKK O;  2HR3 A;  2B7M A;  4B7K A;  3SCX A;  5CN0 A;  3NCI A;  2FML A;  4B3R B;  3JAW A;  1N34 O;  4DV2 O;  3LZI A;  3CRM A;  1YEW A;  3ZN1 A;  1QHT A;  3CYO A;  3H9V A;  4UXN A;  2B1E A;  4R8C A;  4DR6 O;  1N0J A;  5B1B B;  3LZJ A;  4HYO A;  4FLW A;  5GW7 A;  1XIL A;  2OVP B;  4DR7 O;  3C3S A;  3L73 H;  4AQY B;  5J2T A;  1EZJ A;  2F43 G;  1Q86 W;  3OGK B;  2LO1 A;  2EIM B;  4UVA A;  4I7Z B;  3TAF A;  1AJP A;  2X6C A;  4KHP B;  4IIJ A;  4I50 A;  5LBQ A;  3OGL B;  4X1Y A;  1W2B U;  2GV9 A;  5EZY B;  2LW7 A;  4JI5 O;  4FIP C;  3UT5 A;  1VIB A;  4AKG A;  3HKD B;  5L3D A;  1RPR A;  1FXK C;  4M3R A;  1SQQ H;  1LUV A;  3WFV A;  3L2O B;  4UCV A;  3S3X A;  1KB9 F;  3U0Z A;  2DYR B;  5JH7 B;  5LMN O;  2M6Y A;  4ICG C;  2UUB B;  2K1E A;  4WFE A;  3ETD A;  3K04 A;  1XOU A;  1PNM A;  4TUY B;  4JI2 O;  4IL6 Z;  3AG1 B;  4CS2 A;  5LOV B;  2WLI B;  4EFB A;  5ITZ A;  4OPA A;  4OX9 O;  2PTM A;  2LGQ A;  2DN9 A;  5B1O A;  2Q9L A;  1PD3 A;  3JAR A;  4TV8 B;  3QES A;  4NTW A;  4EFE A;  2HJF C;  2ZXW B;  1EN5 A;  3G6B A;  1D5N A;  3LSQ A;  5CBF A;  4FM1 A;  2QA4 V;  1AI6 A;  3CC2 V;  1G6U A;  3JSN A;  1VQ9 V;  4TQD A;  5JQG B;  3O65 A;  1IG9 A;  4ZIB A;  4DV7 O;  4JYA O;  4FM2 A;  3IGA C;  4DTU A;  3FB6 C;  3A0R A;  1HNZ O;  3AG4 B;  2CDY A;  2DYS B;  4LFC O;  5FPR A;  1KC8 W;  2XAQ A;  1D5A A;  4DTN A;  4G28 B;  1VQO V;  3HR0 A;  3JYC A;  4GX5 A;  1TUB B;  3JAL A;  3B77 A;  4RUE A;  2DQ3 A;  5GTI Z;  3ZMT A;  3T4Z A;  1RP3 B;  2RMK B;  4J2E A;  1M90 W;  4CS4 A;  3OEE G;  1M9N A;  1ZX3 A;  2AZ2 A;  1ZWI C;  4B3T O;  4NR1 A;  3LD8 A;  4X5N A;  1FFX B;  4I4T A;  2AZ0 A;  5FNV B;  4A5U B;  3BHP A;  4DTM A;  2UUA B;  3CSX A;  4DUY O;  4X88 A;  3FD9 A;  5CB4 B;  1Q6U A;  3ZHT A;  1FD9 A;  3E89 A;  3TL8 B;  1N33 O;  3CHX A;  4JYY A;  5BMV A;  2PZS A;  1IBM B;  3LUT B;  2WWW A;  3CCM V;  3OEH G;  3E4Y A;  4BW5 A;  1K9M W;  2XAG A;  4U3J A;  1FFT B;  5A9G A;  1D2D A;  1KKD A;  3SQ2 A;  3ZN0 A;  5IJ9 B;  2PI5 A;  2NLJ C;  3BY6 A;  2WSS G;  2Q73 A;  3ZHR A;  3OTO B;  4HCC A;  4JI1 B;  3ZIA G;  1YXB A;  2F95 B;  4DV1 O;  2NNU A;  3EVK A;  1EZV H;  2ADQ B;  3M99 B;  4K8X A;  4RQF A;  4GKK B;  3JCU Z;  2CGN A;  1HR0 O;  4H13 B;  1Q9X A;  3T1H O;  4OXS A;  4WCE V;  5KLV H;  1JPX A;  1Q43 A;  1FZ0 E;  1NBM G;  3GB7 C;  1P84 F;  1YTF D;  1N34 B;  1B3Q A;  1HWY A;  2CAZ C;  3NDK A;  1Z2G A;  2DW4 A;  1L1F A;  3ABT A;  3R66 A;  3APO A;  4I50 B;  2H8P C;  2XOK G;  4FJK A;  4FJ7 A;  5CA3 A;  1RM1 B;  2ZM6 O;  1EM1 A;  1OCZ B;  1XQ8 A;  5IT9 N;  1M5I A;  2IJK A;  1VQL V;  1Y67 A;  4PV1 B;  4NXN O;  5KMG B;  1QU7 A;  3K57 A;  1NTM H;  4EEQ A;  3SVI A;  3RYC B;  1VQP V;  1I94 O;  5B3S C;  2BTQ A;  2ZE8 A;  4I9W A;  1PL0 A;  4K8Z A;  1JVM A;  1YIT V;  4JI5 B;  1O9H A;  2CK3 G;  5EBW C;  3CFO A;  4GX1 A;  3HKB A;  2IJI A;  1MG1 A;  1WP8 A;  3N2K B;  4UCR A;  4CZZ A;  3FB8 C;  5LMN B;  2Y69 B;  4MVM A;  1XMG E;  1QLE B;  4JI2 B;  4U7N A;  4MVZ A;  4AI8 A;  4ZI7 A;  4JI0 B;  3L8B A;  4DU1 A;  3VQX A;  4O4L A;  4YJ3 B;  1JA8 A;  5IYD O;  4XDL A;  4OX9 B;  1O9G A;  3DTU B;  3B8N A;  2OCC B;  2YEV A;  2AHZ A;  1XHX A;  3PN1 A;  2Y4U A;  4PDR A;  5H6R A;  5JCO C;  4ZBM A;  4FLT A;  1QVF U;  4MVO A;  2ETN A;  2JQT A;  4B3S B;  4DXW A;  5GON B;  5F2V O;  1WAJ A;  4GYC B;  4WFF A;  5L3E A;  1PL4 A;  2VQF O;  1IX9 A;  2JGD B;  2QM7 A;  4DV7 B;  4JYA B;  4EB6 A;  3LNN A;  1HNZ B;  1M57 B;  4LFC B;  2K5S A;  4R50 A;  1VF6 A;  3AG7 A;  1W0J G;  4I4T B;  2PFT A;  3ABM B;  4M3W A;  5H6Q A;  2E76 B;  3SPZ A;  4X66 O;  3SJQ C;  4I5S A;  1FZ8 E;  1KP3 A;  3VBB A;  1ARO P;  3VQV A;  4ADO A;  4FVM A;  1AP6 A;  2ZR2 A;  3L75 H;  3LNM B;  3SYP A;  2GSM B;  4KHQ A;  3IC7 A;  4B3T B;  2JGU A;  1GMG A;  1ZL8 B;  2UU9 O;  2QSA A;  2IJJ A;  1HW7 A;  4F6R A;  4LF5 O;  2ZQM A;  2EIN B;  4DUY B;  3TK1 A;  1AVM A;  3DC5 A;  4P2Z A;  1S5L Z;  4O2B A;  3K2O A;  2EJR A;  1S5J A;  4ADN A;  1IBK O;  2K9P A;  4CH4 A;  3CCU V;  2BTO A;  2Q5Z A;  3HKE A;  2P5O A;  1AI5 A;  1KQS U;  4X1I B;  5CA1 A;  1L8D A;  3FX7 A;  1SQV H;  2F4V O;  3DXR A;  3OR6 C;  3CXH F;  2Z0A A;  1FZ5 E;  2XTA A;  2QM8 A;  5D5P A;  5TIS Z;  2L35 A;  1GH6 A;  1F51 A;  1TA8 A;  2CH7 B;  3CQ8 A;  1KKC A;  1SQP H;  4BIU A;  2RDC A;  4FLZ A;  1IVS A;  3KCY A;  4MW8 A;  2V1D A;  2RCV A;  3V7D B;  2QGN A;  1VQ6 V;  1X59 A;  5HFM A;  4NTY A;  3S9H A;  1GTO A;  2Q0A A;  4QIW F;  1MMO G;  4DYL A;  3M8A A;  4DV1 B;  4ABM A;  2RCU A;  2UXN A;  3EXA A;  4JRP A;  3SUO A;  1Q7Y W;  2E75 B;  3SJA C;  2HEP A;  3T1H B;  3UO2 A;  1R1B A;  3ZJZ A;  2PYL A;  4KHW A;  5L3F A;  1FYJ A;  3ZCC A;  1PV0 A;  3D36 C;  4JF3 A;  3TXS A;  5LP6 A;  1N36 O;  4DV0 O;  3FAV A;  4PEL A;  1XVD E;  4RG8 A;  3G4S V;  4J2A A;  2ZM6 B;  3TJY A;  1EBO A;  1MZE A;  1AJN A;  5LYJ A;  3VQY A;  1OCO C;  2JVD A;  4X65 O;  1DF5 A;  1TVK A;  2ZIO A;  3G6E V;  4PI2 A;  2IW5 A;  5IBK B;  3CB2 A;  2Q7H A;  3E22 A;  4BIO A;  4NXN B;  1U97 A;  3C90 A;  1Y6X A;  4I55 B;  4XBF A;  2QTS A;  1GN6 A;  4RUF A;  1MTY G;  2MW2 A;  4M3X A;  1DLB A;  4FK5 C;  1I94 B;  2FL4 A;  3W7S A;  3UKM A;  1P49 A;  3K03 A;  2WLJ A;  4IYH A;  3ETE A;  1N8R W;  1QNM A;  3G80 A;  4ZI7 B;  2F23 A;  1K97 A;  2B1I A;  2Q7G A;  2AW9 A;  1ZAU A;  2QM4 A;  3OD4 A;  2QWO B;  3HKC B;  1FZ7 E;  1P7B A;  3B4S A;  3SJB C;  1H8H G;  4FJ9 A;  3ML0 A;  1BGY H;  2PI4 A;  4DR1 O;  4TQF A;  4K0K O;  4ICG A;  3SUN A;  1E1R G;  2OCH A;  5DN6 G;  4MW3 A;  2P1O B;  1FZ6 E;  2LFS A;  5EYP B;  1NZ6 A;  3H1L H;  3CCR V;  3WU2 Z;  1Q90 D;  4FFK A;  1SQB H;  4U7O A;  1K4C C;  2ZDI C;  3IFX A;  4LFB O;  3Q4H A;  1M1K W;  4JRQ A;  2EIK C;  2X7R B;  4O4H A;  1QR8 A;  4J7Z A;  2CTW A;  2VQF B;  2UUA O;  1Q9Y A;  4KUM A;  1JFF A;  4W4L A;  2E32 A;  3A0B Z;  2ILM A;  4DTX A;  4JV5 B;  4D7T A;  2DWE C;  2Y0I A;  2CE4 A;  4LF4 O;  2DWD C;  4J10 A;  1NEX B;  4HBN A;  4DTJ A;  1SA0 A;  2KQX A;  3STZ C;  4X66 B;  3H1I H;  2YS8 A;  4R7C A;  2VWJ A;  1QQC A;  3M7M X;  5B1A B;  2Q67 A;  1YIJ V;  3SQ0 A;  5D5Q A;  3PJS K;  1U96 A;  1SER A;  4BAY A;  1FXV A;  3OAA G;  5FL7 G;  3GWO A;  1NTZ H;  3SGI A;  3HKE B;  4MTO A;  1DK1 A;  2UU9 B;  1M93 A;  3L71 H;  5CA1 B;  4LF5 B;  2RNB A;  2QWP B;  3DXR B;  1H2L A;  3F7V C;  1YJ9 V;  4YHH O;  5LL6 Y;  4GCZ A;  3ZRW A;  2X6A A;  4PDM A;  2R9I A;  5B1B C;  3QNO A;  4JZ2 A;  5IYZ B;  2VJ5 A;  1N32 B;  3L1N A;  2HP8 A;  3FFQ A;  2FYO A;  1H8E G;  4F4L A;  4O4I A;  1IBK B;  5JJE B;  4FLU A;  2EIM C;  3N2G B;  1NH2 B;  4O4J A;  1B04 A;  2GBO A;  1KD1 W;  1VQ8 V;  4IHJ A;  2N74 A;  5C93 A;  2F4V B;  4JZG A;  1AIL A;  1GAX A;  4ASU G;  2HVK C;  5LP6 B;  4DTS A;  3HPL C;  1DTO A;  5DM6 V;  2UXB O;  1MA1 A;  3JAS A;  3ABU A;  1SQX H;  1GO3 F;  4X8A A;  1I5Y A;  3QVN A;  1K34 A;  5BXZ A;  5LYJ B;  2DYR C;  2W0F C;  2WLL A;  4X1K B;  4FLV A;  1WJZ A;  2ATQ A;  1LNQ A;  1VQK V;  3K5M A;  2IU3 A;  4QPK A;  3AG1 C;  5K1P A;  3OTF A;  1N36 B;  2MW2 B;  3ABL B;  4LH6 A;  1R6K A;  4DV0 B;  2DTU A;  2GDS A;  4NVP A;  3K59 A;  1M56 B;  3AG2 B;  4AKI A;  4B3M B;  3ZS8 C;  4BWA A;  1R3L C;  1WAF A;  3C94 A;  2ZXW C;  4JI0 O;  4X65 B;  1SQF A;  1V55 B;  3ZHS A;  2DEB A;  3K0G A;  1XU3 E;  3JD4 A;  3LDS A;  3E8F A;  3J2P A;  3CC4 V;  2YIA A;  4M3U A;  2UXC O;  4P30 A;  2QXF A;  1RSO B;  1Y74 A;  4RQE A;  3APQ A;  3AG4 C;  4B3S O;  4DTR A;  2DYS C;  4PA7 A;  4KI4 A;  1P4R A;  3K0D A;  3CCS V;  2KG7 A;  1YSC A;  3H1K H;  4GAM C;  4H37 A;  2XAH A;  2AHY A;  3ZED A;  2ZIN A;  5H5N A;  4WFA V;  4EP9 A;  2JIZ G; 
#chains in the Genus database with same CATH homology
 2GUZ A;  1FAF A;  2L6L A;  2QWQ B;  2DMX A;  1BQZ A;  2N05 A;  2QWO B;  2CTQ A;  1N1C A;  2LGW A;  3APQ A;  1FPO A;  2EJ7 A;  3UO3 A;  2YUA A;  2QWN B;  1HDJ A;  2QWP B;  1WJZ A;  2KQX A;  4J80 A;  3BVO A;  2Y4U A;  2N04 A;  4RWU A;  2YS8 A;  1N4C A;  2QWR B;  3AG7 A;  4J7Z A;  3APO A;  2DN9 A;  2LO1 A;  1BQ0 A;  2CTW A;  2CTP A;  3UCS C;  2QSA A;  2PF4 E;  2GUZ B;  1XBL A;  2Y4T A;  1IUR A;  2CTR A;  3UO2 A;  2OCH A;  4IT5 A;  1GH6 A;  2M6Y A;  2CUG A;  1NZ6 A;  2RKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...