3UO2A

Jac1 co-chaperone from saccharomyces cerevisiae
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
169
structure length
160
Chain Sequence
FTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords J-type co-chaperone JAC1, mitochondrial
publication title Interaction of j-protein co-chaperone jac1 with fe-s scaffold isu is indispensable in vivo and conserved in evolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 62
structure length 160
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3uo2A01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3uo2A02
2LGWA 2QWRB 4J7ZA 1FAFA 2DN9A 2GUZA 3APQA 2EJ7A 2QWQB 3UO3A 1NZ6A 2N05A 2CUGA 2PF4E 2GUZB 2QWPB 1GH6A 2QWNB 1HDJA 3AG7A 2CTPA 1BQZA 2Y4UA 2L6LA 2M6YA 1WJZA 2QSAA 4J80A 2CTQA 2YS8A 3APOA 1IURA 1N4CA 2Y4TA 1BQ0A 2LO1A 2OCHA 2YUAA 3UCSC 2KQXA 4IT5A 1XBLA 2CTWA 3UO2A 2QWOB 3BVOA 1FPOA 2DMXA 2CTRA 2RKHA 4RWUA 2N04A 1N1CA
chains in the Genus database with same CATH superfamily
1R3JC 5KHKA 4CH4A 2N74A 3AG3C 4FLUA 3RYCB 1WAZA 2X0LA 4F4LA 1QQCA 1HNZB 2W6JG 4DV5O 3Q4HB 2FL4A 4KUMA 4E2LA 4MT8A 1H38A 4K0KO 3SPJA 2IU0A 2GDSA 1P49A 3CFOA 1N36O 1HW7A 2DYRC 2JRIA 1HR0O 4MS2A 3E8GA 1Q7YW 4X5NA 2EBOA 3SCXA 3ZHUA 1XDCA 3RW0A 3OMNB 1XHZA 2OCCC 2K1EA 5J2TA 4PA3A 3ZRXA 1VQLV 3VQVA 4JV5O 1XOUA 2RQ6A 3K5LA 4DV2B 4OX9O 5KHIA 2K5SA 4FJJA 4JTCB 5JVDB 3SDLA 1R1BA 1H2SB 1OJHA 1PV0A 4EEQA 3UQ8A 2HJFC 4IHJA 4DUZO 3TGUH 4DR6B 1SA0A 2K9PA 1XUQA 1US6A 2CH7B 4RAIA 3SVIA 2EX3A 1D5NA 1WPBA 2JGUA 1EN5A 4E4EA 4JZ2A 2MW2A 1AJPA 1Q3EA 4W4KA 1P7GA 1PD3A 2PUSA 3KD5E 4RWUA 2N04A 2UXDO 1GM7A 4PDMA 2LJ2A 1OCZC 3HKCA 3SQ1A 4EPHA 2ZIMA 4I6JB 1XL4A 5LYJB 2DYSB 1Y6XA 4PI0A 2YSUB 3AK1A 1J5EO 3K79A 2QM4A 4FLZA 1CLQA 2PGGA 3B40A 5A9GA 1ZX3A 3M8AA 3JYCA 3TXQA 3N2GA 1E1QG 1YCIA 2JGDA 1P22A 3D3QA 1AR4A 2F4VB 4BIUA 1NR1A 3NXSA 4IIJB 4OXSA 3LSUA 3E22B 3ETQA 4I5SA 3ABLC 3MD0A 2EZOA 1MNGA 2KQXA 1FZ8E 4O4JA 3RN4A 4DW1A 4LF6B 2HVJC 5IT9N 3B77A 3N2KA 3LDCA 1XMOB 2R72A 2ZCEA 2P7TC 2VJ5A 4DTJA 4I9QA 1H2LA 2CUGA 4ZOLB 1AP6A 2YIBD 4LWSA 2PTMA 3VQYA 3SUQA 2IJKA 2BSKA 1HNXO 3J27A 1BL8A 4M3UA 2LGQA 4LH6A 4PI2A 2Q7GA 5IY5B 2DWDC 1YHQV 1FJGO 3K3WA 3TK1A 1KQSU 4WFGA 3CFPA 5L3GA 4DU3A 1IBMB 2UUCO 1BGYH 4CC5A 2PF4E 4JI4O 2VQFB 2UUAB 3AG2C 4FPPA 2ZXWB 3LUTB 4H37A 5EZYB 2Q0OC 3IAYA 3UT5B 4DR5O 2XT9A 4YXWG 2CTWA 1JFFB 3CEIA 3CS5A 5LL6Y 4RQEA 1P7BA 1SRYA 1K5QA 4BW5A 3I56V 2GHYA 1ENVA 1SQBH 1Z5WA 2WLIB 1XMHE 4I50A 5EC2C 3ZS8C 2Z0AA 4JGSA 4UCVA 2E5LB 1G6UA 1NZ6A 3W7WA 5H37A 4U3JA 3L75H 4LF7O 1CPYA 3WFVA 3QERA 1Y74B 4OPAA 1QR8A 3W7UA 2Y4TA 4D7TA 4UUJC 3PN1A 4G2KA 4GZRB 3X2QB 2B1EA 3OGMB 1O9GA 2GUZA 5HFMA 4TOIA 2IBZH 1BCCH 5IBKB 5IYDO 3ABUA 5KMGB 4DV1O 1FZ2E 1RM1B 4I4TA 3OEEG 1Z5VA 2EIKB 4LR3A 1QBZA 1I94B 3SUNA 4DTMA 2QWOB 1QVFU 1URFA 4TQDA 1YDXA 4LFAO 1S5LZ 4CS3A 4YY3O 3SNNA 3B2EE 3ASNC 1GAXA 3RBZA 2UXCO 1WAFA 1PL4A 5DECA 2ATQA 3QETA 4FJKA 4JAUA 2ZE8A 4O4LA 5B1NA 3OMIB 4JI7B 3QVNA 2UUBB 4JI6O 3HKDA 5FPRA 5J9PC 3JD3A 4R8CA 4B7EA 2YUAA 1GTOA 5IWAB 3CCMV 4B3MB 1XQ8A 3ZHQA 1QNMA 2FB5A 3ZX6A 4AI8A 2DEBA 1WB7A 4P9PA 3L72H 3ABTA 3ABMB 1D5AA 3J2PA 2QWRB 5KHHA 4MVQA 2YI9A 2HKOA 2B5UA 1KKCA 1K3EA 4X20B 2WA4A 2YS8A 5LP6C 4YJ3A 1MHYG 3SUOA 2P90A 1VQ6V 4EFBA 3NE6A 2B8IA 4X88A 4TQFA 1KUQA 2MK3A 5IYZA 3C90A 3SYOA 2JEXA 3AG3B 1EN4A 4DR6O 3IC9A 1JX9A 1GH6A 2Q7EA 1QCEA 4MW8A 4BW9A 4LF5O 4FM2A 3L74H 1FZ9E 2HG5C 1AI7A 1BQ0A 3QEIA 4X66O 1W2BU 2DMXA 3K5NA 3CD6V 1MMOG 2Y69C 5JH7A 3NAEA 3SPGA 5L3DA 4FJ9A 5EYPA 2PY5A 4JYBA 2P67A 2DYRB 1EZJA 2YXLA 4XDLA 4DV5B 3T1HO 2ADQB 4LF8B 1U97A 2YB5A 3JARB 5EBWC 1K8AW 1MSDA 2Q5ZA 2OYQA 2OCCB 4K0KB 4O2AA 4I55B 2VQEB 1Y76B 2ITCC 4DR3B 3HKBA 4KXRA 2B1GA 4BIZA 1K97A 3IJ4A 1FAFA 1N36B 1EBOA 2ADPA 1HR0B 2JPNA 1ZLZA 1XL3C 1VEWA 2Q8VA 1F7YA 1I08A 3SUPA 4DXWA 2VJ4A 3H9VA 4KHPO 3MHSC 4FZ1A 4PA9A 1EN6A 2JS3A 4JV5B 3QF7A 3K08A 1KP3A 4OX9B 4X1YB 3ZN1A 3ZMUA 1YVWA 1G1XB 1OCZB 1VMGA 1FXHA 4MVUA 4DUZB 5CBHA 1TUEB 3ZCCA 4X64O 4MVMA 1PP9H 3LDSA 3CX5F 1BMFG 3H01A 3JALB 3CCRV 4GYCB 3ETDA 3KCXA 4GX1A 3VBBA 1FS1A 4NTWA 1L0LH 4JS4A 3D36A 3A0RA 5GTIZ 3RMAA 2UXDB 3DXRA 4YIOA 2RNBA 4GLXA 4DRXB 4IIJA 1HNWO 2NR5A 5IJ0B 4LF4O 1IG9A 1NQTA 1FKAO 1NH2D 3H1LH 4KI6A 3ABLB 1NT2B 3LNMB 3SGIA 5CB4A 4JTDB 3F7VC 2YXYA 5IJ9A 5EIBC 4RUFA 1TUBA 2KSDA 1M93A 3JAWA 4EP9A 1H2KA 1B3QA 2R9IA 1YJNV 2YEVB 3FX7A 5DN6G 4N23A 3CRCA 3A8TA 3K9AA 4FK4A 1NH2B 3HGKE 3SYCA 2P4VA 1HDJA 1PNKA 3U11A 2XAGA 1SERA 5KUKA 3RYIB 5ITZA 4QE7A 4CZZA 4UXNA 3CB2A 1R73A 4P9OA 2YIBA 2P5GA 3SYAA 4JS5A 4KHWA 3T1CA 3L70H 4B7KA 5KLVH 1VF6A 1K33A 4QGPA 2W0XA 4QNHB 4JI8O 3BA9A 2DN9A 3OR6C 1W59A 5KUMA 3R66A 4X65O 1FXKC 5JCOA 4DK1A 1XVCE 3TJTA 2L6LA 2RCUA 2ZNIA 1HNXB 3AG2B 5C8YB 2IH1C 3AK3A 1JFFA 4QJFB 1FZIE 2FKXA 1AI5A 1RPRA 4IGGA 2PYLA 1E1RG 1TGOA 2AZ0A 4M3WA 2JDIG 2UUCB 4D6TH 2IW5A 2BTQA 5JQGB 3SPYA 2FTKA 4JI4B 3WB2A 3AG4C 4YHHO 1EM1A 3ZHTA 1H8EG 4NTYA 4DR5B 4FLYA 3LNNA 1KC8W 4ICGC 3K06A 4PDVA 1FYJA 3EFFK 2Y0PA 4LFBB 3NHGA 1FXXA 1IXBA 3APQA 3JSNA 2LP7A 5L3FA 3I5DA 2VS0A 3SPIA 1LNQA 5KA6A 2A0LA 4LF7B 1XHXA 2M6YA 4X1KA 5L3EA 4FLTA 3QEPA 2WWWA 1TVKB 1COWG 4H33A 1PKXA 2JK5C 1U96A 1MG1A 3HR0A 3ASNB 3ZMZA 2R9RB 2EJ7A 2X6AA 2OWOA 2QJ1A 1YSCA 3T2MA 2QM7A 4K8XA 4WFFA 1DF4A 5BR8O 3TAGA 1BHBA 1FZ5E 3OFNG 4DV1B 4P2ZA 1FZ7E 2HFEC 1VIBA 3C95A 4QE9A 2QE7G 4O4HA 1AR1B 1PPJH 1XBLA 1Q9YA 1YEWA 2Y48A 5A2QN 3CC7V 5LA6A 5KA5A 1R3LC 2AGAA 1K7DA 1GN4A 1QVGU 1Q43A 4YY3B 1WN7A 1WNSA 3G71V 3JASA 2UXCB 2ETNA 5BZBA 3T1YB 4RL5A 4TUYA 2Q9LA 1AP5A 3P3PA 4JF3A 4LF8O 4JI6B 3OMAB 4JASA 5LP6B 1DK1A 1P84F 4EB6A 2E76B 5BMVA 1MHZG 4J41A 1M90W 3SPHA 2VQEO 4DR3O 2OVRB 3FYEB 4DV0O 2FMLA 2LF6A 1V54C 3CE2A 3CSXA 4DV4B 4FFBA 4PDLA 3DC6A 4JI0O 2ITDC 4UVBA 2KG7A 2CTQA 1ZWIC 4M45A 2NN4A 3UO2A 3L2OB 2XAHA 4M3XA 1KMIZ 4HNAA 2CK3G 3K03A 5EBMC 2P1NB 3CMEV 2HP8A 2Y69B 4L8JA 5LBQA 3CCLV 1MTYG 4FJ8A 2VWKA 3OGCC 4IL6Z 3JATB 2R9AA 5BXZA 1Q82W 2BOCC 4PHZA 2WLMA 1VQ8V 4LF5B 1CEZA 2OCHA 4X1IA 4X66B 1R3IC 3RVYA 1LUWA 3VOUA 1S72V 2EIJC 3PJSK 1QHTA 2P1PB 5HFLA 4LNUB 3E4WA 4MTGA 4YIPA 3CJHA 3ZJZA 1Q90D 1H8HG 3OTOO 5B1AC 5C93A 2ZDIA 3T1HB 1WJZA 1WAJA 1K92A 3FB5C 1YF2A 2CGNA 4UCSA 3ZRWB 2C2AA 4FJGA 1MA1A 2E75B 1NKDA 4R6ZA 5J2UB 1WA8A 1IBLB 1K4CC 2VIXA 1M5IA 3N1EA 2EJRA 2ZQMA 3OE7G 4BWAA 3RYHA 4F6RA 3SPCA 2MMBA 1JR9A 4DU1A 1HWYA 4JAVA 4UFZA 3H1IH 1DF5A 1JJOA 2Q67A 3OEHG 1S76D 4ZI7A 4KHPB 3E83A 1K9MW 2DY4A 1L0NH 4DR1O 1RPOA 4I0XA 3RWRD 2OT5A 3LZJA 4G28B 3JD4A 2JHPA 3ZHSA 4LP8A 4FK2A 5LGNA 4RNGA 3CPWU 4O4IB 5K1PA 2YC0A 4KHUA 1N0NA 4X64B 3RMCA 1QR9A 1XNRO 4H0LB 2F93B 4UCUA 2UU9O 3RWUA 3KCYA 1CXZB 4IT5A 1VQKV 3AEIA 2WPDG 4P30A 5CA1A 2XASA 5GONB 1FFXB 1S5HC 3E8FA 3SQ4A 2F95B 4R50A 1HNWB 4LF4B 3N27A 4JYYA 4DR2O 4JYCA 1PL0A 4JI5O 3ETEA 1S5JA 4YJ2B 2HD0A 1AJQA 4MVOA 4CBCA 5B1BC 3MKSB 3WU2Z 2PZSA 4LFBO 4NB5A 2OZSA 1M1KW 1YI2V 1Q9XA 4TV8A 3LZIA 4JRQA 1FXKB 4ADOA 2LW7A 1ZL8A 1FYZE 2F43G 1XU3E 3HKEA 4HCBA 3RYFB 2E74B 1FZ6E 3AK2A 3K59A 1E79G 3K0GA 2HEPA 3BCCH 2WLLB 4GUNA 4Z2WA 2XHBA 5LOVB 3DSQA 1KECA 4J2EA 2YIDA 4MTFA 3EXAA 4JI8B 5CA0B 5KAIZ 1FFTB 1WLEA 4LBEC 2HJDA 4X65B 3KKYA 1KB9F 3U0ZA 3OUSA 3VQXA 1OCOC 4M42A 4D7SA 4U3FH 2OTLV 3AG4B 4MW3A 4B3RO 1XVDE 2GTSA 5KX5A 2IJJA 4CH6A 3D3IA 2ZE6A 2Q6AA 3E35A 1SQFA 2B9ZA 2KKWA 4PA7A 3K04A 2YDEA 1MZFA 1N34B 3SJQC 2EZPA 3ASOC 1FZ4E 3RGBA 3T1YO 2FYUH 4WBNA 1PM9A 1B6QA 4ZHQA 4YHHB 4TV9A 5FNVA 3IFXA 2VRZA 1YTFD 5FL7G 4GKJO 3QTCA 4DTPA 2CDYA 4RUEA 3FAVA 2LGWA 4KHYA 1ZTEA 3BRCA 4PELA 1JMKC 5KHGA 3OUFA 3JAKB 3FFQA 4DV4O 1LUVA 5LXTB 3ZBHA 1RSOA 1YTFB 2Q7HA 4QPJA 4J80A 2OIGA 2D2CB 2R70A 2LO1A 4MTOA 4CS4A 1KU9A 1VF5B 2DWEC 4ZIBA 4UVCA 1W0JG 1IBKO 3H1JH 4MVSA 2OIEA 2H8PC 4DR4O 3RYCA 4B3SO 4QIWF 2ZINA 2EILC 3JD0A 1M56C 4GX0A 3L9DA 1BT8A 2JJ1G 3SQ0A 3SJAC 3CWBH 1Q6HA 3Q4HA 1XMGE 3ZRVA 5BR8B 2W0FC 2HHHB 1VQOV 1JJ2U 1GK9A 3SJJA 3BY6A 1A32A 3OGIB 2BCCH 3H1KH 2EINC 3K5OA 1QLNA 4XBFA 3L1NA 1AJNA 1IVSA 1V54B 4KI4A 1OCRC 4DUYB 2QWNB 1EZVH 2HR3A 3CRRA 1FZ1E 2LW1A 4UV9A 3SI6A 1V9PA 4WFEA 5J2TB 1SF9A 2CGOA 2Q68A 1IBLO 5D5PA 5JVDA 5LMUO 1ROPA 1S3JA 1ORQC 3BEHA 4DV6O 4JAAA 3NCIA 1P4RA 2JVDA 4X5MA 2X6CA 3CQ8A 4DV0B 3ZIAG 1B06A 4ZKIA 2UXBO 2AHZA 4IHJB 4PA4A 2JH9A 1WP7A 2CH7A 5EC1C 3QEVA 4JI0B 3GWKC 1SESA 3CFRA 2F66C 1SA0B 2BE3A 3LD8A 2MW2B 3BHPA 2DTUA 3MAQA 3O9OA 2LFRA 5H6QA 2XAFA 3CCQV 1XI1A 5EK0A 4ASUG 3OTFA 5L3CA 2EIJB 5LYJA 3HKCB 3JD1A 5B1AB 1VQ4V 2JQTA 2A3QA 1IH7A 5GTHZ 5IREA 1I7FA 4NYKA 2A9HA 3ICXA 3L73H 4FJMA 3EHBB 4Q20A 1GN6A 3N2GB 3STLC 1NTMH 4XDJA 3ZEDA 3MDSA 3IC7A 1WB8A 3TJYA 2QKSA 2JGDB 5E1AC 4FJ7A 3OTOB 1PNLA 3B4SA 3E22A 1TA8A 5E79Z 1H2NA 1K5SA 4IYHA 4J2AA 2GTAA 4L87A 1THZA 4O4JB 3QNEA 4I9LA 2QKAA 3FKSG 1VF7A 1N1CA 4DV7O 4KP4A 3N2KB 4HAMA 1FD9A 4KFMA 2ZM6O 4ZOLA 3CRQA 2ARHA 2CE4A 4IYIA 2JEUA 4JI2B 4LWSB 2P1QB 4J2BA 2BSKB 3O65A 1N4CA 3STZC 5JJNB 5BY1A 3C3TA 4DR1B 4UCRA 3BVOA 2ZR2A 3OGKB 4WF9V 5TISZ 4AI6A 1VF6C 4J7ZA 3L71H 2DW4A 3RMBA 2RCVA 3K9SA 3C94A 1XEQA 5JCOC 1XMQO 2V1DA 5EZYA 1SS3A 3UT5A 1XNRB 4Q6GA 5B3SC 2QKCA 3QESA 3BAAA 2UU9B 2BOBC 4B3TO 4HBNA 3H1HH 3LSQA 3ZMTA 1BSMA 5B1BB 2WLIA 2GSMB 2FW3A 2Q4PA 1N34O 3CCJV 1N8RW 4FJIA 1UFIA 2A7WA 4MVZA 5B1OA 4JI3O 4I50B 2E31A 3K2OA 4BAYA 1Y74A 4U3JB 4DR2B 3S3WA 4JI5B 1K73W 2ZD9A 1K34A 3HB3B 1KKDA 4ZBMA 2QTOA 1N33O 4M3TA 3ZHVA 1H2GA 2ZIOA 3ZMVA 5KMGA 3F5WC 2XAQA 4LH7A 2Y0IA 1OCOB 3CYOA 5LHGA 5JWPA 1IURA 1K4DC 3WG7C 2ZKOA 4I4TB 1SQVH 2WLHA 4GKKO 5CMUA 3CXCU 1FPOA 3A0BZ 2Q0AA 5GW7A 3CHXA 1VQ7V 1JQ0A 2P6JA 4J7JA 5L3BA 1KBHA 3SJCC 2QDOA 4TWKA 4FM1A 4PJ0Z 3AG1C 5IYCO 2QGNA 4DK0A 3ASOB 3RMDA 4GT1A 3GWOA 1GN2A 1XNQO 3SQ2A 4B08A 4K8ZA 4X8AA 4FK5C 1XL6A 4O4LB 4UB6Z 1JOYA 1JA8A 4B3RB 3APOA 3HKDB 4LF9O 2HHHO 5H2FZ 4BR6A 2QA4V 1QLEC 4I7ZB 2MZWB 3F7YC 1KYOF 1R6KA 5JJJB 1N32O 3E8BA 3J81N 4HCCA 2RMKB 3L8BA 4DUYO 1DTOA 3JSLA 4X20A 5LHIA 1NI8A 2B1IA 4HYOA 4ABMA 3E8HA 4NXMO 1MABG 1XVFE 2P1OB 2P4KA 1H2MA 4YJ3B 1V55C 2UXXA 4AKGA 3FD9A 2WLNA 4GKJB 2H4TA 3ABKC 3C6OB 1LDKE 4J2DA 1X4TA 4G27B 1GN3A 1W0KG 2EILB 1M56B 5IYZB 5FLXN 2ATKC 4O2BB 5CBFA 4GAMC 3QO5A 4FLWA 4WFHA 2HVKC 2RN9A 4ADNA 4FIPC 1SQQH 2F23A 2F1MA 3OR7C 1SKVA 1NJIW 3SYPA 4AQYO 1IBKB 2WA3A 2EINB 3W7XA 4DR4B 1SZTA 2QXFA 4FK0A 4QPKA 5JH7B 4B3SB 3UO3A 3HPLC 5EYPB 4UB8Z 2P5OA 1OCRB 3LDDA 3JARA 5IDJA 1XVEE 1SC5B 2ILMA 1Q5OA 2XOKG 1DGSA 3P30A 1IXMA 4I55A 1Y76A 4DYLA 4LC1A 2RKHA 2CTRA 1FXVA 1XVBE 3RFRA 4O2AB 4TSFG 5B5EZ 5IE9A 5KHJA 2OTJV 2JJ2G 4M3RA 1BS3A 4FJ5A 3HKBB 3T4ZA 4MSWC 2QR4A 3VQWA 1KD1W 2ZDIC 4QNCA 3MHHC 5CA3A 5DEDA 3B8NA 3DGEA 2Z5UA 4FJHA 1I5XA 3ZN0A 3ETGA 3I55V 1KP2A 3BABA 4X1YA 5AG2A 3T4DA 2ZE5A 3S9HA 4X89A 5LMUB 4J42A 2OVPB 5CN0A 1JCHA 4DV6B 3A0HZ 1GKFA 1VQ9V 4DTXA 4X62O 4J11A 3U10A 2UXBB 2ZT9B 1HP8A 1AR5A 4JI2O 5LMNO 3JALA 3SYQA 3TXSA 4LCUC 4U7OA 3UIQA 2LF3A 4I9WA 3CCEV 2XAJA 1T5EA 3K5MA 4M3ZA 3G6EV 1VQ5V 2YI8A 2P1MB 2ODMA 4FLVA 2DQ3A 1EFRG 4DRXA 3SJBC 1Q6IA 3P32A 1AB3A 5IJ0A 3DXRB 4DV3B 2RDCA 4C7UA 1RFYA 5EIBD 3K57A 1SZXA 4MVRA 4DU4A 1R6TA 3HL8A 3G80A 4JPRA 1MMMA 2H3OA 5IYBO 1AI6A 3LDBA 3OT7A 4WCEV 5CB4B 3JCUZ 1OZ0A 1SQXH 4FM0A 2YEVA 5IJ9B 1TUBB 3JAWB 1XREA 4NXNO 2A79B 4R7CA 2DQ0A 2G38A 4DTOA 4M41A 3WB1A 1RP3B 4FJCC 3RYIA 5H5NA 3G6BA 3RVZA 2QM8A 3V7DB 5ITZB 1M57C 4DR7B 1OCCC 4LFCO 3CC2V 1GO3F 4JI1O 4DV7B 4JRPA 2IU3A 2ZM6B 3E4YA 1OV9A 3J7AU 5C8YA 3CCSV 1BQZA 3OD4A 1I0HA 1SQPH 3QO7A 3UM7A 1ZAUA 5B3SB 5H9CA 2V7QG 2RJZA 5CBGA 4PD4F 2NLJC 3J80N 4FFKA 3LSSA 3RT3C 2PYJA 5JQGA 5LGUA 1OHHG 1TAEA 1Z2GA 2PFVA 1XMQB 2BTQB 2XTAA 4AKIA 2EULA 1J95A 3OGLB 3UCSC 4JYAO 3OM3B 4EYWA 3BFRA 4B3TB 4UV8A 1NR7A 1BZKA 2L35A 4FLXA 2EIMC 3CC4V 3LDEA 1VQPV 2Q73A 1I5YA 4JI3B 3NR7A 5D5QA 2DE0X 3A2FA 4X1KB 1CP9A 1TVKA 3DTUB 3WG7B 4X9QA 3TETA 1GMGA 2XUMA 4U7NA 4DTSA 3QEXA 4J9YB 2AZ2A 3WSOA 1N33B 3AG1B 3OW2U 1HNZO 1LR1A 4MTXA 4PV1B 4EFEA 3CRMA 2IJHA 4Z1VA 3QEWA 1JVMA 3K58A 2ZR3A 3KG2A 1NTKH 3KZIZ 2FYOA 1R3KC 1Q81W 1Y4MA 3WB0A 4O4HB 4AHCA 4FJNA 4GKKB 5F2VO 4XDKA 3HGLA 4DTUA 4TT3G 1QLEB 5LA6B 1MOFA 4AILC 2E3CA 3FB6C 1IX9A 4PDRA 3JASB 2M7WA 1XNQB 4TUYB 3P3NA 5LP6A 3TAFA 3B8MA 1S0VA 4LF9B 4DV2O 3N1BA 1XU5E 4EB6B 1V55B 5BMVB 4DTNA 4UVAA 3S3XA 3ABKB 1N32B 2JHAA 1GM9A 1GM8A 4O2BA 1VQMV 4E4BA 4HZ3A 2QTSA 2QWPB 2AHYA 4FFBB 2Y4UA 2QSAA 3QNNA 2QEXV 1M9NA 5B66Z 1AVMA 2KG7B 4NXMB 3C6PB 3SR2C 4E3SA 5JJEB 3QNOA 4HNAB 1AILA 4CS2A 1VQNV 2CAZC 2WLJA 1NS1A 3JATA 1YITV 2D3OW 3BPZA 1M4UA 1ZSPA 4DW0A 2XNDG 1SETA 1Q6UA 4EKWA 1NTZH 2GBOA 2YICA 1AI4A 1Y67A 4OGQB 3E2EA 2YXHA 1XVGE 4RG8A 3ZRSA 1ZUQA 3B09A 4X1IB 1VP7A 2A06H 1YJWV 1MSWD 4LNUA 4NR1A 4AQYB 1G8MA 4J7KA 2HLDG 2DYSC 1YXBA 4DV3O 3NDKA 2F4VO 3CJHB 3ZRWA 3QO8A 4KHSA 1FZHE 5J2UA 4AKHA 1UJWB 3G67A 4LF6O 1XILA 2NNUA 3IGAC 1WA8B 3CRAA 1S77D 1XMFE 1N0JA 3FB8C 1F4MA 1XMOO 3D36C 2IM9A 1JPXA 2OVQB 3BA8A 4WFAV 1YZBA 1YJ9V 1F51A 4DO2A 3CCVV 1G4YB 3RYHB 2AXTZ 4F6RB 1SQGA 3C3SA 5IZ7A 4CC6A 3KD1E 2O57A 2ZNJA 4ZI7B 4FZ0A 3UKMA 4DR7O 3CMAV 4I0XB 1Y66A 3SPZA 3G4SV 3CCUV 2JH8A 1IBMO 1NEXB 5KAFZ 4O4IA 2X6BA 4X62B 1GRJA 1X59A 2VQFO 3ZMSA 2UUAO 3AG7A 4CH5A 1J5EB 5LMNB 4H13B 2VWJA 5IY5C 3W7SA 4UCOA 2W6IG 3OAAG 3GVMA 5K1XA 1R6NA 1YIJV 5GONA 1FFXA 2V4DA 1O9HA 3JCZA 4UCTA 2P06A 4GX2A 4PA6A 3E89A 5CA1B 2IJIA 4BIOA 2JIZG 2E5LO 2QWQB 3DC5A 3K0DA 3CXHF 3E86A 4N21A 3TCUA 3NGIA 2Q69A 4DTRA 2ZXWC 2P22C 4YJ2A 1VARA 1Q86W 2E32A 1JW2A 4JTAB 3M99B 3GB7C 1DLBA 1M57B 1NU1H 1FS0G 1OCCB 1B04A 3JAMN 3TAEA 3FB7C 4CH3A 3ZHRA 1FZ3E 4F6EA 4NXNB 2AW9A 3R65A 4KL1A 1FXKA 1Q8IA 4TV8B 3QG5A 2PI5A 4H44B 1MZEA 3RYFA 2Z3YA 1ZL8B 2LFSA 2YIAA 3EVKA 1I94O 3HKEB 4OPHA 1FJGB 1QU7A 2WLLA 4WFBV 3X2QC 4KHQA 5LOVA 4LFCB 3FYIB 1BE3H 4JI1B 4M3YA 5CA0A 3C6NB 3L0MA 4K3AA 3M7MX 3D8CA 1NVPD 4FVMA 2B7MA 5DM6V 2UXNA 5LHHA 1WP8A 2GUZB 4JI7O 2UUBO 2CTPA 1RM1C 1NBMG 4KHNA 2EIKC 1F23A 3HP9A 5IWAO 4B3MO 1BHAA 4ICGA 5EBLC 2WLKA 5KX5B 4W4LA 3W7TA 4QNDA 1PNMA 1UPGA 2WSSG 4JZGA 1NVPB 2EIMB 4NVPA 4GX5A 2PFTA 2H94A 2N05A 4NKGB 2JS5A 3TABA 2WAMA 4FJLA 2KB1A 2LQTA 4FJXA 3TL8B 1IDSA 1D2DA 4NTXA 2IH3C 4WBNB 4RO2A 4ZHQB 1IZ3A 3CP1A 4TV9B 5H6RA 4Z1MG 5FNVB 5FPOA 4JYAB 3F5TA 3ABMC 2DOSA 1WPXA 2X7RB 4FMTA 1FZ0E 3THOA 3JAKA 3FAVB 3JD2A 5LXTA 1F4NA 2BTOA 4GCZA 4A5UB 2ZE7A 2PI4A 2OZMA 1AROP 4K35A 1RSOB 2GV9A 1L1FA 4J9ZB 1L8DA 2DJVA 5LGTA 4RQFA 4LFAB 2JHCA 3ML0A 4J10A
chains in the Genus database with same CATH topology
2LGWA 2QWRB 4J7ZA 1FAFA 2DN9A 2GUZA 3APQA 2EJ7A 2QWQB 3UO3A 1NZ6A 2N05A 2CUGA 2PF4E 2GUZB 2QWPB 1GH6A 2QWNB 1HDJA 3AG7A 2CTPA 1BQZA 2Y4UA 2L6LA 2M6YA 1WJZA 2QSAA 4J80A 2CTQA 2YS8A 3APOA 1IURA 1N4CA 2Y4TA 1BQ0A 2LO1A 2OCHA 2YUAA 3UCSC 2KQXA 4IT5A 1XBLA 2CTWA 3UO2A 2QWOB 3BVOA 1FPOA 2DMXA 2CTRA 2RKHA 4RWUA 2N04A 1N1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGW A;  2QWR B;  4J7Z A;  1FAF A;  2DN9 A;  2GUZ A;  3APQ A;  2EJ7 A;  2QWQ B;  3UO3 A;  1NZ6 A;  2N05 A;  2CUG A;  2PF4 E;  2GUZ B;  2QWP B;  1GH6 A;  2QWN B;  1HDJ A;  3AG7 A;  2CTP A;  1BQZ A;  2Y4U A;  2L6L A;  2M6Y A;  1WJZ A;  2QSA A;  4J80 A;  2CTQ A;  2YS8 A;  3APO A;  1IUR A;  1N4C A;  2Y4T A;  1BQ0 A;  2LO1 A;  2OCH A;  2YUA A;  3UCS C;  2KQX A;  4IT5 A;  1XBL A;  2CTW A;  3UO2 A;  2QWO B;  3BVO A;  1FPO A;  2DMX A;  2CTR A;  2RKH A;  4RWU A;  2N04 A;  1N1C A; 
#chains in the Genus database with same CATH topology
 1R3J C;  5KHK A;  4CH4 A;  2N74 A;  3AG3 C;  4FLU A;  3RYC B;  1WAZ A;  2X0L A;  4F4L A;  1QQC A;  1HNZ B;  2W6J G;  4DV5 O;  3Q4H B;  2FL4 A;  4KUM A;  4E2L A;  4MT8 A;  1H38 A;  4K0K O;  3SPJ A;  2IU0 A;  2GDS A;  1P49 A;  3CFO A;  1N36 O;  1HW7 A;  2DYR C;  2JRI A;  1HR0 O;  4MS2 A;  3E8G A;  1Q7Y W;  4X5N A;  2EBO A;  3SCX A;  3ZHU A;  1XDC A;  3RW0 A;  3OMN B;  1XHZ A;  2OCC C;  2K1E A;  5J2T A;  4PA3 A;  3ZRX A;  1VQL V;  3VQV A;  4JV5 O;  1XOU A;  2RQ6 A;  3K5L A;  4DV2 B;  4OX9 O;  5KHI A;  2K5S A;  4FJJ A;  4JTC B;  5JVD B;  3SDL A;  1R1B A;  1H2S B;  1OJH A;  1PV0 A;  4EEQ A;  3UQ8 A;  2HJF C;  4IHJ A;  4DUZ O;  3TGU H;  4DR6 B;  1SA0 A;  2K9P A;  1XUQ A;  1US6 A;  2CH7 B;  4RAI A;  3SVI A;  2EX3 A;  1D5N A;  1WPB A;  2JGU A;  1EN5 A;  4E4E A;  4JZ2 A;  2MW2 A;  1AJP A;  1Q3E A;  4W4K A;  1P7G A;  1PD3 A;  2PUS A;  3KD5 E;  4RWU A;  2N04 A;  2UXD O;  1GM7 A;  4PDM A;  2LJ2 A;  1OCZ C;  3HKC A;  3SQ1 A;  4EPH A;  2ZIM A;  4I6J B;  1XL4 A;  5LYJ B;  2DYS B;  1Y6X A;  4PI0 A;  2YSU B;  3AK1 A;  1J5E O;  3K79 A;  2QM4 A;  4FLZ A;  1CLQ A;  2PGG A;  3B40 A;  5A9G A;  1ZX3 A;  3M8A A;  3JYC A;  3TXQ A;  3N2G A;  1E1Q G;  1YCI A;  2JGD A;  1P22 A;  3D3Q A;  1AR4 A;  2F4V B;  4BIU A;  1NR1 A;  3NXS A;  4IIJ B;  4OXS A;  3LSU A;  3E22 B;  3ETQ A;  4I5S A;  3ABL C;  3MD0 A;  2EZO A;  1MNG A;  2KQX A;  1FZ8 E;  4O4J A;  3RN4 A;  4DW1 A;  4LF6 B;  2HVJ C;  5IT9 N;  3B77 A;  3N2K A;  3LDC A;  1XMO B;  2R72 A;  2ZCE A;  2P7T C;  2VJ5 A;  4DTJ A;  4I9Q A;  1H2L A;  2CUG A;  4ZOL B;  1AP6 A;  2YIB D;  4LWS A;  2PTM A;  3VQY A;  3SUQ A;  2IJK A;  2BSK A;  1HNX O;  3J27 A;  1BL8 A;  4M3U A;  2LGQ A;  4LH6 A;  4PI2 A;  2Q7G A;  5IY5 B;  2DWD C;  1YHQ V;  1FJG O;  3K3W A;  3TK1 A;  1KQS U;  4WFG A;  3CFP A;  5L3G A;  4DU3 A;  1IBM B;  2UUC O;  1BGY H;  4CC5 A;  2PF4 E;  4JI4 O;  2VQF B;  2UUA B;  3AG2 C;  4FPP A;  2ZXW B;  3LUT B;  4H37 A;  5EZY B;  2Q0O C;  3IAY A;  3UT5 B;  4DR5 O;  2XT9 A;  4YXW G;  2CTW A;  1JFF B;  3CEI A;  3CS5 A;  5LL6 Y;  4RQE A;  1P7B A;  1SRY A;  1K5Q A;  4BW5 A;  3I56 V;  2GHY A;  1ENV A;  1SQB H;  1Z5W A;  2WLI B;  1XMH E;  4I50 A;  5EC2 C;  3ZS8 C;  2Z0A A;  4JGS A;  4UCV A;  2E5L B;  1G6U A;  1NZ6 A;  3W7W A;  5H37 A;  4U3J A;  3L75 H;  4LF7 O;  1CPY A;  3WFV A;  3QER A;  1Y74 B;  4OPA A;  1QR8 A;  3W7U A;  2Y4T A;  4D7T A;  4UUJ C;  3PN1 A;  4G2K A;  4GZR B;  3X2Q B;  2B1E A;  3OGM B;  1O9G A;  2GUZ A;  5HFM A;  4TOI A;  2IBZ H;  1BCC H;  5IBK B;  5IYD O;  3ABU A;  5KMG B;  4DV1 O;  1FZ2 E;  1RM1 B;  4I4T A;  3OEE G;  1Z5V A;  2EIK B;  4LR3 A;  1QBZ A;  1I94 B;  3SUN A;  4DTM A;  2QWO B;  1QVF U;  1URF A;  4TQD A;  1YDX A;  4LFA O;  1S5L Z;  4CS3 A;  4YY3 O;  3SNN A;  3B2E E;  3ASN C;  1GAX A;  3RBZ A;  2UXC O;  1WAF A;  1PL4 A;  5DEC A;  2ATQ A;  3QET A;  4FJK A;  4JAU A;  2ZE8 A;  4O4L A;  5B1N A;  3OMI B;  4JI7 B;  3QVN A;  2UUB B;  4JI6 O;  3HKD A;  5FPR A;  5J9P C;  3JD3 A;  4R8C A;  4B7E A;  2YUA A;  1GTO A;  5IWA B;  3CCM V;  4B3M B;  1XQ8 A;  3ZHQ A;  1QNM A;  2FB5 A;  3ZX6 A;  4AI8 A;  2DEB A;  1WB7 A;  4P9P A;  3L72 H;  3ABT A;  3ABM B;  1D5A A;  3J2P A;  2QWR B;  5KHH A;  4MVQ A;  2YI9 A;  2HKO A;  2B5U A;  1KKC A;  1K3E A;  4X20 B;  2WA4 A;  2YS8 A;  5LP6 C;  4YJ3 A;  1MHY G;  3SUO A;  2P90 A;  1VQ6 V;  4EFB A;  3NE6 A;  2B8I A;  4X88 A;  4TQF A;  1KUQ A;  2MK3 A;  5IYZ A;  3C90 A;  3SYO A;  2JEX A;  3AG3 B;  1EN4 A;  4DR6 O;  3IC9 A;  1JX9 A;  1GH6 A;  2Q7E A;  1QCE A;  4MW8 A;  4BW9 A;  4LF5 O;  4FM2 A;  3L74 H;  1FZ9 E;  2HG5 C;  1AI7 A;  1BQ0 A;  3QEI A;  4X66 O;  1W2B U;  2DMX A;  3K5N A;  3CD6 V;  1MMO G;  2Y69 C;  5JH7 A;  3NAE A;  3SPG A;  5L3D A;  4FJ9 A;  5EYP A;  2PY5 A;  4JYB A;  2P67 A;  2DYR B;  1EZJ A;  2YXL A;  4XDL A;  4DV5 B;  3T1H O;  2ADQ B;  4LF8 B;  1U97 A;  2YB5 A;  3JAR B;  5EBW C;  1K8A W;  1MSD A;  2Q5Z A;  2OYQ A;  2OCC B;  4K0K B;  4O2A A;  4I55 B;  2VQE B;  1Y76 B;  2ITC C;  4DR3 B;  3HKB A;  4KXR A;  2B1G A;  4BIZ A;  1K97 A;  3IJ4 A;  1FAF A;  1N36 B;  1EBO A;  2ADP A;  1HR0 B;  2JPN A;  1ZLZ A;  1XL3 C;  1VEW A;  2Q8V A;  1F7Y A;  1I08 A;  3SUP A;  4DXW A;  2VJ4 A;  3H9V A;  4KHP O;  3MHS C;  4FZ1 A;  4PA9 A;  1EN6 A;  2JS3 A;  4JV5 B;  3QF7 A;  3K08 A;  1KP3 A;  4OX9 B;  4X1Y B;  3ZN1 A;  3ZMU A;  1YVW A;  1G1X B;  1OCZ B;  1VMG A;  1FXH A;  4MVU A;  4DUZ B;  5CBH A;  1TUE B;  3ZCC A;  4X64 O;  4MVM A;  1PP9 H;  3LDS A;  3CX5 F;  1BMF G;  3H01 A;  3JAL B;  3CCR V;  4GYC B;  3ETD A;  3KCX A;  4GX1 A;  3VBB A;  1FS1 A;  4NTW A;  1L0L H;  4JS4 A;  3D36 A;  3A0R A;  5GTI Z;  3RMA A;  2UXD B;  3DXR A;  4YIO A;  2RNB A;  4GLX A;  4DRX B;  4IIJ A;  1HNW O;  2NR5 A;  5IJ0 B;  4LF4 O;  1IG9 A;  1NQT A;  1FKA O;  1NH2 D;  3H1L H;  4KI6 A;  3ABL B;  1NT2 B;  3LNM B;  3SGI A;  5CB4 A;  4JTD B;  3F7V C;  2YXY A;  5IJ9 A;  5EIB C;  4RUF A;  1TUB A;  2KSD A;  1M93 A;  3JAW A;  4EP9 A;  1H2K A;  1B3Q A;  2R9I A;  1YJN V;  2YEV B;  3FX7 A;  5DN6 G;  4N23 A;  3CRC A;  3A8T A;  3K9A A;  4FK4 A;  1NH2 B;  3HGK E;  3SYC A;  2P4V A;  1HDJ A;  1PNK A;  3U11 A;  2XAG A;  1SER A;  5KUK A;  3RYI B;  5ITZ A;  4QE7 A;  4CZZ A;  4UXN A;  3CB2 A;  1R73 A;  4P9O A;  2YIB A;  2P5G A;  3SYA A;  4JS5 A;  4KHW A;  3T1C A;  3L70 H;  4B7K A;  5KLV H;  1VF6 A;  1K33 A;  4QGP A;  2W0X A;  4QNH B;  4JI8 O;  3BA9 A;  2DN9 A;  3OR6 C;  1W59 A;  5KUM A;  3R66 A;  4X65 O;  1FXK C;  5JCO A;  4DK1 A;  1XVC E;  3TJT A;  2L6L A;  2RCU A;  2ZNI A;  1HNX B;  3AG2 B;  5C8Y B;  2IH1 C;  3AK3 A;  1JFF A;  4QJF B;  1FZI E;  2FKX A;  1AI5 A;  1RPR A;  4IGG A;  2PYL A;  1E1R G;  1TGO A;  2AZ0 A;  4M3W A;  2JDI G;  2UUC B;  4D6T H;  2IW5 A;  2BTQ A;  5JQG B;  3SPY A;  2FTK A;  4JI4 B;  3WB2 A;  3AG4 C;  4YHH O;  1EM1 A;  3ZHT A;  1H8E G;  4NTY A;  4DR5 B;  4FLY A;  3LNN A;  1KC8 W;  4ICG C;  3K06 A;  4PDV A;  1FYJ A;  3EFF K;  2Y0P A;  4LFB B;  3NHG A;  1FXX A;  1IXB A;  3APQ A;  3JSN A;  2LP7 A;  5L3F A;  3I5D A;  2VS0 A;  3SPI A;  1LNQ A;  5KA6 A;  2A0L A;  4LF7 B;  1XHX A;  2M6Y A;  4X1K A;  5L3E A;  4FLT A;  3QEP A;  2WWW A;  1TVK B;  1COW G;  4H33 A;  1PKX A;  2JK5 C;  1U96 A;  1MG1 A;  3HR0 A;  3ASN B;  3ZMZ A;  2R9R B;  2EJ7 A;  2X6A A;  2OWO A;  2QJ1 A;  1YSC A;  3T2M A;  2QM7 A;  4K8X A;  4WFF A;  1DF4 A;  5BR8 O;  3TAG A;  1BHB A;  1FZ5 E;  3OFN G;  4DV1 B;  4P2Z A;  1FZ7 E;  2HFE C;  1VIB A;  3C95 A;  4QE9 A;  2QE7 G;  4O4H A;  1AR1 B;  1PPJ H;  1XBL A;  1Q9Y A;  1YEW A;  2Y48 A;  5A2Q N;  3CC7 V;  5LA6 A;  5KA5 A;  1R3L C;  2AGA A;  1K7D A;  1GN4 A;  1QVG U;  1Q43 A;  4YY3 B;  1WN7 A;  1WNS A;  3G71 V;  3JAS A;  2UXC B;  2ETN A;  5BZB A;  3T1Y B;  4RL5 A;  4TUY A;  2Q9L A;  1AP5 A;  3P3P A;  4JF3 A;  4LF8 O;  4JI6 B;  3OMA B;  4JAS A;  5LP6 B;  1DK1 A;  1P84 F;  4EB6 A;  2E76 B;  5BMV A;  1MHZ G;  4J41 A;  1M90 W;  3SPH A;  2VQE O;  4DR3 O;  2OVR B;  3FYE B;  4DV0 O;  2FML A;  2LF6 A;  1V54 C;  3CE2 A;  3CSX A;  4DV4 B;  4FFB A;  4PDL A;  3DC6 A;  4JI0 O;  2ITD C;  4UVB A;  2KG7 A;  2CTQ A;  1ZWI C;  4M45 A;  2NN4 A;  3UO2 A;  3L2O B;  2XAH A;  4M3X A;  1KMI Z;  4HNA A;  2CK3 G;  3K03 A;  5EBM C;  2P1N B;  3CME V;  2HP8 A;  2Y69 B;  4L8J A;  5LBQ A;  3CCL V;  1MTY G;  4FJ8 A;  2VWK A;  3OGC C;  4IL6 Z;  3JAT B;  2R9A A;  5BXZ A;  1Q82 W;  2BOC C;  4PHZ A;  2WLM A;  1VQ8 V;  4LF5 B;  1CEZ A;  2OCH A;  4X1I A;  4X66 B;  1R3I C;  3RVY A;  1LUW A;  3VOU A;  1S72 V;  2EIJ C;  3PJS K;  1QHT A;  2P1P B;  5HFL A;  4LNU B;  3E4W A;  4MTG A;  4YIP A;  3CJH A;  3ZJZ A;  1Q90 D;  1H8H G;  3OTO O;  5B1A C;  5C93 A;  2ZDI A;  3T1H B;  1WJZ A;  1WAJ A;  1K92 A;  3FB5 C;  1YF2 A;  2CGN A;  4UCS A;  3ZRW B;  2C2A A;  4FJG A;  1MA1 A;  2E75 B;  1NKD A;  4R6Z A;  5J2U B;  1WA8 A;  1IBL B;  1K4C C;  2VIX A;  1M5I A;  3N1E A;  2EJR A;  2ZQM A;  3OE7 G;  4BWA A;  3RYH A;  4F6R A;  3SPC A;  2MMB A;  1JR9 A;  4DU1 A;  1HWY A;  4JAV A;  4UFZ A;  3H1I H;  1DF5 A;  1JJO A;  2Q67 A;  3OEH G;  1S76 D;  4ZI7 A;  4KHP B;  3E83 A;  1K9M W;  2DY4 A;  1L0N H;  4DR1 O;  1RPO A;  4I0X A;  3RWR D;  2OT5 A;  3LZJ A;  4G28 B;  3JD4 A;  2JHP A;  3ZHS A;  4LP8 A;  4FK2 A;  5LGN A;  4RNG A;  3CPW U;  4O4I B;  5K1P A;  2YC0 A;  4KHU A;  1N0N A;  4X64 B;  3RMC A;  1QR9 A;  1XNR O;  4H0L B;  2F93 B;  4UCU A;  2UU9 O;  3RWU A;  3KCY A;  1CXZ B;  4IT5 A;  1VQK V;  3AEI A;  2WPD G;  4P30 A;  5CA1 A;  2XAS A;  5GON B;  1FFX B;  1S5H C;  3E8F A;  3SQ4 A;  2F95 B;  4R50 A;  1HNW B;  4LF4 B;  3N27 A;  4JYY A;  4DR2 O;  4JYC A;  1PL0 A;  4JI5 O;  3ETE A;  1S5J A;  4YJ2 B;  2HD0 A;  1AJQ A;  4MVO A;  4CBC A;  5B1B C;  3MKS B;  3WU2 Z;  2PZS A;  4LFB O;  4NB5 A;  2OZS A;  1M1K W;  1YI2 V;  1Q9X A;  4TV8 A;  3LZI A;  4JRQ A;  1FXK B;  4ADO A;  2LW7 A;  1ZL8 A;  1FYZ E;  2F43 G;  1XU3 E;  3HKE A;  4HCB A;  3RYF B;  2E74 B;  1FZ6 E;  3AK2 A;  3K59 A;  1E79 G;  3K0G A;  2HEP A;  3BCC H;  2WLL B;  4GUN A;  4Z2W A;  2XHB A;  5LOV B;  3DSQ A;  1KEC A;  4J2E A;  2YID A;  4MTF A;  3EXA A;  4JI8 B;  5CA0 B;  5KAI Z;  1FFT B;  1WLE A;  4LBE C;  2HJD A;  4X65 B;  3KKY A;  1KB9 F;  3U0Z A;  3OUS A;  3VQX A;  1OCO C;  4M42 A;  4D7S A;  4U3F H;  2OTL V;  3AG4 B;  4MW3 A;  4B3R O;  1XVD E;  2GTS A;  5KX5 A;  2IJJ A;  4CH6 A;  3D3I A;  2ZE6 A;  2Q6A A;  3E35 A;  1SQF A;  2B9Z A;  2KKW A;  4PA7 A;  3K04 A;  2YDE A;  1MZF A;  1N34 B;  3SJQ C;  2EZP A;  3ASO C;  1FZ4 E;  3RGB A;  3T1Y O;  2FYU H;  4WBN A;  1PM9 A;  1B6Q A;  4ZHQ A;  4YHH B;  4TV9 A;  5FNV A;  3IFX A;  2VRZ A;  1YTF D;  5FL7 G;  4GKJ O;  3QTC A;  4DTP A;  2CDY A;  4RUE A;  3FAV A;  2LGW A;  4KHY A;  1ZTE A;  3BRC A;  4PEL A;  1JMK C;  5KHG A;  3OUF A;  3JAK B;  3FFQ A;  4DV4 O;  1LUV A;  5LXT B;  3ZBH A;  1RSO A;  1YTF B;  2Q7H A;  4QPJ A;  4J80 A;  2OIG A;  2D2C B;  2R70 A;  2LO1 A;  4MTO A;  4CS4 A;  1KU9 A;  1VF5 B;  2DWE C;  4ZIB A;  4UVC A;  1W0J G;  1IBK O;  3H1J H;  4MVS A;  2OIE A;  2H8P C;  4DR4 O;  3RYC A;  4B3S O;  4QIW F;  2ZIN A;  2EIL C;  3JD0 A;  1M56 C;  4GX0 A;  3L9D A;  1BT8 A;  2JJ1 G;  3SQ0 A;  3SJA C;  3CWB H;  1Q6H A;  3Q4H A;  1XMG E;  3ZRV A;  5BR8 B;  2W0F C;  2HHH B;  1VQO V;  1JJ2 U;  1GK9 A;  3SJJ A;  3BY6 A;  1A32 A;  3OGI B;  2BCC H;  3H1K H;  2EIN C;  3K5O A;  1QLN A;  4XBF A;  3L1N A;  1AJN A;  1IVS A;  1V54 B;  4KI4 A;  1OCR C;  4DUY B;  2QWN B;  1EZV H;  2HR3 A;  3CRR A;  1FZ1 E;  2LW1 A;  4UV9 A;  3SI6 A;  1V9P A;  4WFE A;  5J2T B;  1SF9 A;  2CGO A;  2Q68 A;  1IBL O;  5D5P A;  5JVD A;  5LMU O;  1ROP A;  1S3J A;  1ORQ C;  3BEH A;  4DV6 O;  4JAA A;  3NCI A;  1P4R A;  2JVD A;  4X5M A;  2X6C A;  3CQ8 A;  4DV0 B;  3ZIA G;  1B06 A;  4ZKI A;  2UXB O;  2AHZ A;  4IHJ B;  4PA4 A;  2JH9 A;  1WP7 A;  2CH7 A;  5EC1 C;  3QEV A;  4JI0 B;  3GWK C;  1SES A;  3CFR A;  2F66 C;  1SA0 B;  2BE3 A;  3LD8 A;  2MW2 B;  3BHP A;  2DTU A;  3MAQ A;  3O9O A;  2LFR A;  5H6Q A;  2XAF A;  3CCQ V;  1XI1 A;  5EK0 A;  4ASU G;  3OTF A;  5L3C A;  2EIJ B;  5LYJ A;  3HKC B;  3JD1 A;  5B1A B;  1VQ4 V;  2JQT A;  2A3Q A;  1IH7 A;  5GTH Z;  5IRE A;  1I7F A;  4NYK A;  2A9H A;  3ICX A;  3L73 H;  4FJM A;  3EHB B;  4Q20 A;  1GN6 A;  3N2G B;  3STL C;  1NTM H;  4XDJ A;  3ZED A;  3MDS A;  3IC7 A;  1WB8 A;  3TJY A;  2QKS A;  2JGD B;  5E1A C;  4FJ7 A;  3OTO B;  1PNL A;  3B4S A;  3E22 A;  1TA8 A;  5E79 Z;  1H2N A;  1K5S A;  4IYH A;  4J2A A;  2GTA A;  4L87 A;  1THZ A;  4O4J B;  3QNE A;  4I9L A;  2QKA A;  3FKS G;  1VF7 A;  1N1C A;  4DV7 O;  4KP4 A;  3N2K B;  4HAM A;  1FD9 A;  4KFM A;  2ZM6 O;  4ZOL A;  3CRQ A;  2ARH A;  2CE4 A;  4IYI A;  2JEU A;  4JI2 B;  4LWS B;  2P1Q B;  4J2B A;  2BSK B;  3O65 A;  1N4C A;  3STZ C;  5JJN B;  5BY1 A;  3C3T A;  4DR1 B;  4UCR A;  3BVO A;  2ZR2 A;  3OGK B;  4WF9 V;  5TIS Z;  4AI6 A;  1VF6 C;  4J7Z A;  3L71 H;  2DW4 A;  3RMB A;  2RCV A;  3K9S A;  3C94 A;  1XEQ A;  5JCO C;  1XMQ O;  2V1D A;  5EZY A;  1SS3 A;  3UT5 A;  1XNR B;  4Q6G A;  5B3S C;  2QKC A;  3QES A;  3BAA A;  2UU9 B;  2BOB C;  4B3T O;  4HBN A;  3H1H H;  3LSQ A;  3ZMT A;  1BSM A;  5B1B B;  2WLI A;  2GSM B;  2FW3 A;  2Q4P A;  1N34 O;  3CCJ V;  1N8R W;  4FJI A;  1UFI A;  2A7W A;  4MVZ A;  5B1O A;  4JI3 O;  4I50 B;  2E31 A;  3K2O A;  4BAY A;  1Y74 A;  4U3J B;  4DR2 B;  3S3W A;  4JI5 B;  1K73 W;  2ZD9 A;  1K34 A;  3HB3 B;  1KKD A;  4ZBM A;  2QTO A;  1N33 O;  4M3T A;  3ZHV A;  1H2G A;  2ZIO A;  3ZMV A;  5KMG A;  3F5W C;  2XAQ A;  4LH7 A;  2Y0I A;  1OCO B;  3CYO A;  5LHG A;  5JWP A;  1IUR A;  1K4D C;  3WG7 C;  2ZKO A;  4I4T B;  1SQV H;  2WLH A;  4GKK O;  5CMU A;  3CXC U;  1FPO A;  3A0B Z;  2Q0A A;  5GW7 A;  3CHX A;  1VQ7 V;  1JQ0 A;  2P6J A;  4J7J A;  5L3B A;  1KBH A;  3SJC C;  2QDO A;  4TWK A;  4FM1 A;  4PJ0 Z;  3AG1 C;  5IYC O;  2QGN A;  4DK0 A;  3ASO B;  3RMD A;  4GT1 A;  3GWO A;  1GN2 A;  1XNQ O;  3SQ2 A;  4B08 A;  4K8Z A;  4X8A A;  4FK5 C;  1XL6 A;  4O4L B;  4UB6 Z;  1JOY A;  1JA8 A;  4B3R B;  3APO A;  3HKD B;  4LF9 O;  2HHH O;  5H2F Z;  4BR6 A;  2QA4 V;  1QLE C;  4I7Z B;  2MZW B;  3F7Y C;  1KYO F;  1R6K A;  5JJJ B;  1N32 O;  3E8B A;  3J81 N;  4HCC A;  2RMK B;  3L8B A;  4DUY O;  1DTO A;  3JSL A;  4X20 A;  5LHI A;  1NI8 A;  2B1I A;  4HYO A;  4ABM A;  3E8H A;  4NXM O;  1MAB G;  1XVF E;  2P1O B;  2P4K A;  1H2M A;  4YJ3 B;  1V55 C;  2UXX A;  4AKG A;  3FD9 A;  2WLN A;  4GKJ B;  2H4T A;  3ABK C;  3C6O B;  1LDK E;  4J2D A;  1X4T A;  4G27 B;  1GN3 A;  1W0K G;  2EIL B;  1M56 B;  5IYZ B;  5FLX N;  2ATK C;  4O2B B;  5CBF A;  4GAM C;  3QO5 A;  4FLW A;  4WFH A;  2HVK C;  2RN9 A;  4ADN A;  4FIP C;  1SQQ H;  2F23 A;  2F1M A;  3OR7 C;  1SKV A;  1NJI W;  3SYP A;  4AQY O;  1IBK B;  2WA3 A;  2EIN B;  3W7X A;  4DR4 B;  1SZT A;  2QXF A;  4FK0 A;  4QPK A;  5JH7 B;  4B3S B;  3UO3 A;  3HPL C;  5EYP B;  4UB8 Z;  2P5O A;  1OCR B;  3LDD A;  3JAR A;  5IDJ A;  1XVE E;  1SC5 B;  2ILM A;  1Q5O A;  2XOK G;  1DGS A;  3P30 A;  1IXM A;  4I55 A;  1Y76 A;  4DYL A;  4LC1 A;  2RKH A;  2CTR A;  1FXV A;  1XVB E;  3RFR A;  4O2A B;  4TSF G;  5B5E Z;  5IE9 A;  5KHJ A;  2OTJ V;  2JJ2 G;  4M3R A;  1BS3 A;  4FJ5 A;  3HKB B;  3T4Z A;  4MSW C;  2QR4 A;  3VQW A;  1KD1 W;  2ZDI C;  4QNC A;  3MHH C;  5CA3 A;  5DED A;  3B8N A;  3DGE A;  2Z5U A;  4FJH A;  1I5X A;  3ZN0 A;  3ETG A;  3I55 V;  1KP2 A;  3BAB A;  4X1Y A;  5AG2 A;  3T4D A;  2ZE5 A;  3S9H A;  4X89 A;  5LMU B;  4J42 A;  2OVP B;  5CN0 A;  1JCH A;  4DV6 B;  3A0H Z;  1GKF A;  1VQ9 V;  4DTX A;  4X62 O;  4J11 A;  3U10 A;  2UXB B;  2ZT9 B;  1HP8 A;  1AR5 A;  4JI2 O;  5LMN O;  3JAL A;  3SYQ A;  3TXS A;  4LCU C;  4U7O A;  3UIQ A;  2LF3 A;  4I9W A;  3CCE V;  2XAJ A;  1T5E A;  3K5M A;  4M3Z A;  3G6E V;  1VQ5 V;  2YI8 A;  2P1M B;  2ODM A;  4FLV A;  2DQ3 A;  1EFR G;  4DRX A;  3SJB C;  1Q6I A;  3P32 A;  1AB3 A;  5IJ0 A;  3DXR B;  4DV3 B;  2RDC A;  4C7U A;  1RFY A;  5EIB D;  3K57 A;  1SZX A;  4MVR A;  4DU4 A;  1R6T A;  3HL8 A;  3G80 A;  4JPR A;  1MMM A;  2H3O A;  5IYB O;  1AI6 A;  3LDB A;  3OT7 A;  4WCE V;  5CB4 B;  3JCU Z;  1OZ0 A;  1SQX H;  4FM0 A;  2YEV A;  5IJ9 B;  1TUB B;  3JAW B;  1XRE A;  4NXN O;  2A79 B;  4R7C A;  2DQ0 A;  2G38 A;  4DTO A;  4M41 A;  3WB1 A;  1RP3 B;  4FJC C;  3RYI A;  5H5N A;  3G6B A;  3RVZ A;  2QM8 A;  3V7D B;  5ITZ B;  1M57 C;  4DR7 B;  1OCC C;  4LFC O;  3CC2 V;  1GO3 F;  4JI1 O;  4DV7 B;  4JRP A;  2IU3 A;  2ZM6 B;  3E4Y A;  1OV9 A;  3J7A U;  5C8Y A;  3CCS V;  1BQZ A;  3OD4 A;  1I0H A;  1SQP H;  3QO7 A;  3UM7 A;  1ZAU A;  5B3S B;  5H9C A;  2V7Q G;  2RJZ A;  5CBG A;  4PD4 F;  2NLJ C;  3J80 N;  4FFK A;  3LSS A;  3RT3 C;  2PYJ A;  5JQG A;  5LGU A;  1OHH G;  1TAE A;  1Z2G A;  2PFV A;  1XMQ B;  2BTQ B;  2XTA A;  4AKI A;  2EUL A;  1J95 A;  3OGL B;  3UCS C;  4JYA O;  3OM3 B;  4EYW A;  3BFR A;  4B3T B;  4UV8 A;  1NR7 A;  1BZK A;  2L35 A;  4FLX A;  2EIM C;  3CC4 V;  3LDE A;  1VQP V;  2Q73 A;  1I5Y A;  4JI3 B;  3NR7 A;  5D5Q A;  2DE0 X;  3A2F A;  4X1K B;  1CP9 A;  1TVK A;  3DTU B;  3WG7 B;  4X9Q A;  3TET A;  1GMG A;  2XUM A;  4U7N A;  4DTS A;  3QEX A;  4J9Y B;  2AZ2 A;  3WSO A;  1N33 B;  3AG1 B;  3OW2 U;  1HNZ O;  1LR1 A;  4MTX A;  4PV1 B;  4EFE A;  3CRM A;  2IJH A;  4Z1V A;  3QEW A;  1JVM A;  3K58 A;  2ZR3 A;  3KG2 A;  1NTK H;  3KZI Z;  2FYO A;  1R3K C;  1Q81 W;  1Y4M A;  3WB0 A;  4O4H B;  4AHC A;  4FJN A;  4GKK B;  5F2V O;  4XDK A;  3HGL A;  4DTU A;  4TT3 G;  1QLE B;  5LA6 B;  1MOF A;  4AIL C;  2E3C A;  3FB6 C;  1IX9 A;  4PDR A;  3JAS B;  2M7W A;  1XNQ B;  4TUY B;  3P3N A;  5LP6 A;  3TAF A;  3B8M A;  1S0V A;  4LF9 B;  4DV2 O;  3N1B A;  1XU5 E;  4EB6 B;  1V55 B;  5BMV B;  4DTN A;  4UVA A;  3S3X A;  3ABK B;  1N32 B;  2JHA A;  1GM9 A;  1GM8 A;  4O2B A;  1VQM V;  4E4B A;  4HZ3 A;  2QTS A;  2QWP B;  2AHY A;  4FFB B;  2Y4U A;  2QSA A;  3QNN A;  2QEX V;  1M9N A;  5B66 Z;  1AVM A;  2KG7 B;  4NXM B;  3C6P B;  3SR2 C;  4E3S A;  5JJE B;  3QNO A;  4HNA B;  1AIL A;  4CS2 A;  1VQN V;  2CAZ C;  2WLJ A;  1NS1 A;  3JAT A;  1YIT V;  2D3O W;  3BPZ A;  1M4U A;  1ZSP A;  4DW0 A;  2XND G;  1SET A;  1Q6U A;  4EKW A;  1NTZ H;  2GBO A;  2YIC A;  1AI4 A;  1Y67 A;  4OGQ B;  3E2E A;  2YXH A;  1XVG E;  4RG8 A;  3ZRS A;  1ZUQ A;  3B09 A;  4X1I B;  1VP7 A;  2A06 H;  1YJW V;  1MSW D;  4LNU A;  4NR1 A;  4AQY B;  1G8M A;  4J7K A;  2HLD G;  2DYS C;  1YXB A;  4DV3 O;  3NDK A;  2F4V O;  3CJH B;  3ZRW A;  3QO8 A;  4KHS A;  1FZH E;  5J2U A;  4AKH A;  1UJW B;  3G67 A;  4LF6 O;  1XIL A;  2NNU A;  3IGA C;  1WA8 B;  3CRA A;  1S77 D;  1XMF E;  1N0J A;  3FB8 C;  1F4M A;  1XMO O;  3D36 C;  2IM9 A;  1JPX A;  2OVQ B;  3BA8 A;  4WFA V;  1YZB A;  1YJ9 V;  1F51 A;  4DO2 A;  3CCV V;  1G4Y B;  3RYH B;  2AXT Z;  4F6R B;  1SQG A;  3C3S A;  5IZ7 A;  4CC6 A;  3KD1 E;  2O57 A;  2ZNJ A;  4ZI7 B;  4FZ0 A;  3UKM A;  4DR7 O;  3CMA V;  4I0X B;  1Y66 A;  3SPZ A;  3G4S V;  3CCU V;  2JH8 A;  1IBM O;  1NEX B;  5KAF Z;  4O4I A;  2X6B A;  4X62 B;  1GRJ A;  1X59 A;  2VQF O;  3ZMS A;  2UUA O;  3AG7 A;  4CH5 A;  1J5E B;  5LMN B;  4H13 B;  2VWJ A;  5IY5 C;  3W7S A;  4UCO A;  2W6I G;  3OAA G;  3GVM A;  5K1X A;  1R6N A;  1YIJ V;  5GON A;  1FFX A;  2V4D A;  1O9H A;  3JCZ A;  4UCT A;  2P06 A;  4GX2 A;  4PA6 A;  3E89 A;  5CA1 B;  2IJI A;  4BIO A;  2JIZ G;  2E5L O;  2QWQ B;  3DC5 A;  3K0D A;  3CXH F;  3E86 A;  4N21 A;  3TCU A;  3NGI A;  2Q69 A;  4DTR A;  2ZXW C;  2P22 C;  4YJ2 A;  1VAR A;  1Q86 W;  2E32 A;  1JW2 A;  4JTA B;  3M99 B;  3GB7 C;  1DLB A;  1M57 B;  1NU1 H;  1FS0 G;  1OCC B;  1B04 A;  3JAM N;  3TAE A;  3FB7 C;  4CH3 A;  3ZHR A;  1FZ3 E;  4F6E A;  4NXN B;  2AW9 A;  3R65 A;  4KL1 A;  1FXK A;  1Q8I A;  4TV8 B;  3QG5 A;  2PI5 A;  4H44 B;  1MZE A;  3RYF A;  2Z3Y A;  1ZL8 B;  2LFS A;  2YIA A;  3EVK A;  1I94 O;  3HKE B;  4OPH A;  1FJG B;  1QU7 A;  2WLL A;  4WFB V;  3X2Q C;  4KHQ A;  5LOV A;  4LFC B;  3FYI B;  1BE3 H;  4JI1 B;  4M3Y A;  5CA0 A;  3C6N B;  3L0M A;  4K3A A;  3M7M X;  3D8C A;  1NVP D;  4FVM A;  2B7M A;  5DM6 V;  2UXN A;  5LHH A;  1WP8 A;  2GUZ B;  4JI7 O;  2UUB O;  2CTP A;  1RM1 C;  1NBM G;  4KHN A;  2EIK C;  1F23 A;  3HP9 A;  5IWA O;  4B3M O;  1BHA A;  4ICG A;  5EBL C;  2WLK A;  5KX5 B;  4W4L A;  3W7T A;  4QND A;  1PNM A;  1UPG A;  2WSS G;  4JZG A;  1NVP B;  2EIM B;  4NVP A;  4GX5 A;  2PFT A;  2H94 A;  2N05 A;  4NKG B;  2JS5 A;  3TAB A;  2WAM A;  4FJL A;  2KB1 A;  2LQT A;  4FJX A;  3TL8 B;  1IDS A;  1D2D A;  4NTX A;  2IH3 C;  4WBN B;  4RO2 A;  4ZHQ B;  1IZ3 A;  3CP1 A;  4TV9 B;  5H6R A;  4Z1M G;  5FNV B;  5FPO A;  4JYA B;  3F5T A;  3ABM C;  2DOS A;  1WPX A;  2X7R B;  4FMT A;  1FZ0 E;  3THO A;  3JAK A;  3FAV B;  3JD2 A;  5LXT A;  1F4N A;  2BTO A;  4GCZ A;  4A5U B;  2ZE7 A;  2PI4 A;  2OZM A;  1ARO P;  4K35 A;  1RSO B;  2GV9 A;  1L1F A;  4J9Z B;  1L8D A;  2DJV A;  5LGT A;  4RQF A;  4LFA B;  2JHC A;  3ML0 A;  4J10 A; 
#chains in the Genus database with same CATH homology
 2LGW A;  2QWR B;  4J7Z A;  1FAF A;  2DN9 A;  2GUZ A;  3APQ A;  2EJ7 A;  2QWQ B;  3UO3 A;  1NZ6 A;  2N05 A;  2CUG A;  2PF4 E;  2GUZ B;  2QWP B;  1GH6 A;  2QWN B;  1HDJ A;  3AG7 A;  2CTP A;  1BQZ A;  2Y4U A;  2L6L A;  2M6Y A;  1WJZ A;  2QSA A;  4J80 A;  2CTQ A;  2YS8 A;  3APO A;  1IUR A;  1N4C A;  2Y4T A;  1BQ0 A;  2LO1 A;  2OCH A;  2YUA A;  3UCS C;  2KQX A;  4IT5 A;  1XBL A;  2CTW A;  3UO2 A;  2QWO B;  3BVO A;  1FPO A;  2DMX A;  2CTR A;  2RKH A;  4RWU A;  2N04 A;  1N1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...