2YB5A

Structure of the fusidic acid resistance protein fusc
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
204
Chain Sequence
MNKIEVYKFVKVKQLVYQLIKLYRTNDMNSHKTQKDFLLNEINDIFKEKDIDISDFITSIDDVKLTKKKAEHLLNELKVYIQDFEIPSSSQLEKIFRKVKKLKRPDINLIDTKEISYLGWNDNSSNRKYIVYKNLDDKFEGIYGEISPNKVKGFCKICNQESDTSLFLNKTYTKKGDYICYDSFKCNQNLDDINNLYEFIVKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords PUTATIVE FUSIDIC ACID RESISTANCE PROTEIN
publication title Ribosome Clearance by Fusb-Type Proteins Mediates Resistance to the Antibiotic Fusidic Acid
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 60
structure length 204
sequence length 212
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
A PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2yb5A01
4E4BA 2MZWB 2YB5A 4ADNA 4ADOA
chains in the Genus database with same CATH superfamily
1FZ4E 2JHAA 4EPHA 1XL3C 3QEWA 1FPOA 3TJYA 4DU3A 1FYZE 1MTYG 2PFTA 4KHYA 3QNNA 4M3ZA 4M3WA 3MKSB 1XVGE 3RMDA 1FZ2E 3L2OB 1MHYG 1FZHE 3SUOA 2YB5A 3SCXA 3UO3A 3SPZA 4JS4A 3NDKA 3E4YA 3SPYA 1MMOG 3SQ2A 3BVOA 4FJ8A 4AKGA 3UIQA 2MZWB 3TAFA 2DY4A 5H37A 3S9HA 2VJ5A 4RL5A 3K2OA 1FZ6E 3QETA 3UO2A 4FJLA 3SNNA 3LZJA 4X5MA 4E4BA 4DTSA 4JRQA 4FJ5A 3SJJA 3NE6A 3L8BA 4DU1A 3SI6A 4M42A 4M45A 2P1NB 1FS1A 4ADOA 3TAGA 3RMCA 4KHWA 2HD0A 4KHUA 1JW2A 3TABA 2JQTA 4KHNA 1CLQA 3N1EA 4FVMA 4FJHA 2E32A 1WAJA 3QEPA 2B1EA 2JH9A 3C6OB 3OGKB 1MHZG 3RMBA 2LF6A 3RWUA 4HCCA 2B8IA 3QEVA 3KD1E 3CFOA 3SQ4A 2FW3A 2FYOA 4FJXA 1XMHE 1XVDE 4AKIA 2P5OA 4FK2A 1XMFE 4DU4A 4FJ7A 1IH7A 1P22A 4AI6A 1XMGE 1FZ0E 2RCUA 5IZ7A 1IG9A 3NGIA 2JH8A 4M41A 1Q9XA 3LDSA 4JS5A 1FXXA 4DTUA 4RG8A 2P1PB 3HP9A 4DTRA 4DTOA 2OZMA 1XU5E 4FJMA 3C94A 1WAFA 3QERA 3SQ1A 4KI6A 3SVIA 2P1QB 3HGKE 3NAEA 4DTJA 3QESA 2OYQA 3C6PB 2OZSA 3WSOA 3SUQA 4DTXA 2DTUA 3C6NB 1XVCE 3OGMB 3QEXA 1FZ3E 3OGLB 4GAMC 4FK0A 4HCBA 1N1CA 3TL8B 4EP9A 4E3SA 3NCIA 4KHSA 1XU3E 4J2BA 2P5GA 2OVQB 3QNOA 4FJ9A 3J2PA 3CFRA 4M3RA 4DTNA 1Q9YA 2JHPA 1FZ5E 2OVPB 3LZIA 4M3XA 2VJ4A 4IT5A 3LDBA 2MMBA 3CQ8A 4J2EA 2P1MB 3LD8A 3TAEA 3SUPA 2JPNA 3C95A 3HGLA 3J27A 4ICGC 3QEIA 4B08A 3HL8A 3SQ0A 4DTMA 1FZ7E 1LDKE 4FK4A 4KI4A 4X5NA 3CFPA 4EYWA 5IBKB 3NHGA 2LF3A 4M3YA 4J2AA 4I9QA 1XVFE 4M3UA 4FJKA 1XVEE 3RMAA 4FJNA 4J2DA 3L1NA 1FZIE 1XVBE 2QXFA 4FJJA 3L0MA 3E4WA 4RNGA 4JRPA 2PFVA 3KD5E 3V7DB 4AKHA 2MW2A 2RKHA 4DTPA 4FJIA 1FZ1E 4QNCA 3SUNA 2H4TA 4QNDA 4I9LA 3N1BA 1NEXB 2ATQA 4KHQA 2VIXA 1FZ8E 2B7MA 4FJGA 2DEBA 2P1OB 2OVRB 2K5SA 4ADNA 4I6JB 1FZ9E 4M3TA 2JHCA 5IREA 2E31A
chains in the Genus database with same CATH topology
1FZ4E 2JHAA 4EPHA 1XL3C 3QEWA 3TJYA 4DU3A 1FYZE 1MTYG 2PFTA 4KHYA 3QNNA 4M3ZA 4M3WA 3MKSB 1XVGE 3RMDA 1FZ2E 3L2OB 1MHYG 1FZHE 3SUOA 2YB5A 3SCXA 3SPZA 4JS4A 3NDKA 3E4YA 3SPYA 1MMOG 3SQ2A 4FJ8A 4AKGA 3UIQA 2MZWB 3TAFA 2DY4A 5H37A 3S9HA 2VJ5A 4RL5A 3K2OA 1FZ6E 3QETA 4FJLA 3SNNA 3LZJA 4X5MA 4E4BA 4DTSA 4JRQA 4FJ5A 3SJJA 3NE6A 3L8BA 4DU1A 3SI6A 4M42A 4M45A 2P1NB 1FS1A 4ADOA 3TAGA 3RMCA 4KHWA 2HD0A 4KHUA 3TABA 1CLQA 4KHNA 3N1EA 4FVMA 4FJHA 2E32A 1WAJA 3QEPA 2B1EA 2JH9A 3C6OB 3OGKB 1MHZG 3RMBA 2LF6A 3RWUA 4HCCA 2B8IA 3QEVA 3KD1E 3CFOA 3SQ4A 2FW3A 2FYOA 4FJXA 1XMHE 1XVDE 4AKIA 2P5OA 4FK2A 1XMFE 4DU4A 4FJ7A 1IH7A 1P22A 4AI6A 1XMGE 1FZ0E 2RCUA 5IZ7A 1IG9A 3NGIA 2JH8A 4M41A 1Q9XA 3LDSA 4JS5A 1FXXA 4DTUA 4RG8A 2P1PB 3HP9A 4DTRA 4DTOA 2OZMA 1XU5E 4FJMA 3C94A 1WAFA 3QERA 3SQ1A 4KI6A 3SVIA 2P1QB 3HGKE 3NAEA 4DTJA 3QESA 2OYQA 3C6PB 2OZSA 3WSOA 3SUQA 4DTXA 2DTUA 3C6NB 1XVCE 3OGMB 3QEXA 1FZ3E 3OGLB 4GAMC 4FK0A 4HCBA 3TL8B 4EP9A 4E3SA 3NCIA 4KHSA 1XU3E 4J2BA 2P5GA 2OVQB 3QNOA 4FJ9A 3J2PA 3CFRA 4M3RA 4DTNA 1Q9YA 2JHPA 1FZ5E 2OVPB 3LZIA 4M3XA 2VJ4A 3LDBA 2MMBA 3CQ8A 4J2EA 2P1MB 3LD8A 3TAEA 3SUPA 2JPNA 3C95A 3HGLA 3J27A 3QEIA 4B08A 3HL8A 3SQ0A 4DTMA 1FZ7E 1LDKE 4FK4A 4KI4A 4X5NA 3CFPA 4EYWA 5IBKB 3NHGA 2LF3A 4M3YA 4J2AA 4I9QA 1XVFE 4M3UA 4FJKA 1XVEE 3RMAA 4FJNA 4J2DA 3L1NA 1FZIE 1XVBE 2QXFA 4FJJA 3L0MA 3E4WA 4RNGA 4JRPA 2PFVA 3KD5E 3V7DB 4AKHA 4DTPA 4FJIA 1FZ1E 4QNCA 3SUNA 2H4TA 4QNDA 4I9LA 3N1BA 1NEXB 2ATQA 4KHQA 2VIXA 1FZ8E 2B7MA 4FJGA 2DEBA 2P1OB 2OVRB 4ADNA 4I6JB 1FZ9E 4M3TA 2JHCA 5IREA 2E31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E4B A;  2MZW B;  2YB5 A;  4ADN A;  4ADO A; 
#chains in the Genus database with same CATH topology
 1FZ4 E;  2JHA A;  4EPH A;  1XL3 C;  3QEW A;  1FPO A;  3TJY A;  4DU3 A;  1FYZ E;  1MTY G;  2PFT A;  4KHY A;  3QNN A;  4M3Z A;  4M3W A;  3MKS B;  1XVG E;  3RMD A;  1FZ2 E;  3L2O B;  1MHY G;  1FZH E;  3SUO A;  2YB5 A;  3SCX A;  3UO3 A;  3SPZ A;  4JS4 A;  3NDK A;  3E4Y A;  3SPY A;  1MMO G;  3SQ2 A;  3BVO A;  4FJ8 A;  4AKG A;  3UIQ A;  2MZW B;  3TAF A;  2DY4 A;  5H37 A;  3S9H A;  2VJ5 A;  4RL5 A;  3K2O A;  1FZ6 E;  3QET A;  3UO2 A;  4FJL A;  3SNN A;  3LZJ A;  4X5M A;  4E4B A;  4DTS A;  4JRQ A;  4FJ5 A;  3SJJ A;  3NE6 A;  3L8B A;  4DU1 A;  3SI6 A;  4M42 A;  4M45 A;  2P1N B;  1FS1 A;  4ADO A;  3TAG A;  3RMC A;  4KHW A;  2HD0 A;  4KHU A;  1JW2 A;  3TAB A;  2JQT A;  4KHN A;  1CLQ A;  3N1E A;  4FVM A;  4FJH A;  2E32 A;  1WAJ A;  3QEP A;  2B1E A;  2JH9 A;  3C6O B;  3OGK B;  1MHZ G;  3RMB A;  2LF6 A;  3RWU A;  4HCC A;  2B8I A;  3QEV A;  3KD1 E;  3CFO A;  3SQ4 A;  2FW3 A;  2FYO A;  4FJX A;  1XMH E;  1XVD E;  4AKI A;  2P5O A;  4FK2 A;  1XMF E;  4DU4 A;  4FJ7 A;  1IH7 A;  1P22 A;  4AI6 A;  1XMG E;  1FZ0 E;  2RCU A;  5IZ7 A;  1IG9 A;  3NGI A;  2JH8 A;  4M41 A;  1Q9X A;  3LDS A;  4JS5 A;  1FXX A;  4DTU A;  4RG8 A;  2P1P B;  3HP9 A;  4DTR A;  4DTO A;  2OZM A;  1XU5 E;  4FJM A;  3C94 A;  1WAF A;  3QER A;  3SQ1 A;  4KI6 A;  3SVI A;  2P1Q B;  3HGK E;  3NAE A;  4DTJ A;  3QES A;  2OYQ A;  3C6P B;  2OZS A;  3WSO A;  3SUQ A;  4DTX A;  2DTU A;  3C6N B;  1XVC E;  3OGM B;  3QEX A;  1FZ3 E;  3OGL B;  4GAM C;  4FK0 A;  4HCB A;  1N1C A;  3TL8 B;  4EP9 A;  4E3S A;  3NCI A;  4KHS A;  1XU3 E;  4J2B A;  2P5G A;  2OVQ B;  3QNO A;  4FJ9 A;  3J2P A;  3CFR A;  4M3R A;  4DTN A;  1Q9Y A;  2JHP A;  1FZ5 E;  2OVP B;  3LZI A;  4M3X A;  2VJ4 A;  4IT5 A;  3LDB A;  2MMB A;  3CQ8 A;  4J2E A;  2P1M B;  3LD8 A;  3TAE A;  3SUP A;  2JPN A;  3C95 A;  3HGL A;  3J27 A;  4ICG C;  3QEI A;  4B08 A;  3HL8 A;  3SQ0 A;  4DTM A;  1FZ7 E;  1LDK E;  4FK4 A;  4KI4 A;  4X5N A;  3CFP A;  4EYW A;  5IBK B;  3NHG A;  2LF3 A;  4M3Y A;  4J2A A;  4I9Q A;  1XVF E;  4M3U A;  4FJK A;  1XVE E;  3RMA A;  4FJN A;  4J2D A;  3L1N A;  1FZI E;  1XVB E;  2QXF A;  4FJJ A;  3L0M A;  3E4W A;  4RNG A;  4JRP A;  2PFV A;  3KD5 E;  3V7D B;  4AKH A;  2MW2 A;  2RKH A;  4DTP A;  4FJI A;  1FZ1 E;  4QNC A;  3SUN A;  2H4T A;  4QND A;  4I9L A;  3N1B A;  1NEX B;  2ATQ A;  4KHQ A;  2VIX A;  1FZ8 E;  2B7M A;  4FJG A;  2DEB A;  2P1O B;  2OVR B;  2K5S A;  4ADN A;  4I6J B;  1FZ9 E;  4M3T A;  2JHC A;  5IRE A;  2E31 A; 
#chains in the Genus database with same CATH homology
 1FZ4 E;  2JHA A;  4EPH A;  1XL3 C;  3QEW A;  3TJY A;  4DU3 A;  1FYZ E;  1MTY G;  2PFT A;  4KHY A;  3QNN A;  4M3Z A;  4M3W A;  3MKS B;  1XVG E;  3RMD A;  1FZ2 E;  3L2O B;  1MHY G;  1FZH E;  3SUO A;  2YB5 A;  3SCX A;  3SPZ A;  4JS4 A;  3NDK A;  3E4Y A;  3SPY A;  1MMO G;  3SQ2 A;  4FJ8 A;  4AKG A;  3UIQ A;  2MZW B;  3TAF A;  2DY4 A;  5H37 A;  3S9H A;  2VJ5 A;  4RL5 A;  3K2O A;  1FZ6 E;  3QET A;  4FJL A;  3SNN A;  3LZJ A;  4X5M A;  4E4B A;  4DTS A;  4JRQ A;  4FJ5 A;  3SJJ A;  3NE6 A;  3L8B A;  4DU1 A;  3SI6 A;  4M42 A;  4M45 A;  2P1N B;  1FS1 A;  4ADO A;  3TAG A;  3RMC A;  4KHW A;  2HD0 A;  4KHU A;  3TAB A;  1CLQ A;  4KHN A;  3N1E A;  4FVM A;  4FJH A;  2E32 A;  1WAJ A;  3QEP A;  2B1E A;  2JH9 A;  3C6O B;  3OGK B;  1MHZ G;  3RMB A;  2LF6 A;  3RWU A;  4HCC A;  2B8I A;  3QEV A;  3KD1 E;  3CFO A;  3SQ4 A;  2FW3 A;  2FYO A;  4FJX A;  1XMH E;  1XVD E;  4AKI A;  2P5O A;  4FK2 A;  1XMF E;  4DU4 A;  4FJ7 A;  1IH7 A;  1P22 A;  4AI6 A;  1XMG E;  1FZ0 E;  2RCU A;  5IZ7 A;  1IG9 A;  3NGI A;  2JH8 A;  4M41 A;  1Q9X A;  3LDS A;  4JS5 A;  1FXX A;  4DTU A;  4RG8 A;  2P1P B;  3HP9 A;  4DTR A;  4DTO A;  2OZM A;  1XU5 E;  4FJM A;  3C94 A;  1WAF A;  3QER A;  3SQ1 A;  4KI6 A;  3SVI A;  2P1Q B;  3HGK E;  3NAE A;  4DTJ A;  3QES A;  2OYQ A;  3C6P B;  2OZS A;  3WSO A;  3SUQ A;  4DTX A;  2DTU A;  3C6N B;  1XVC E;  3OGM B;  3QEX A;  1FZ3 E;  3OGL B;  4GAM C;  4FK0 A;  4HCB A;  3TL8 B;  4EP9 A;  4E3S A;  3NCI A;  4KHS A;  1XU3 E;  4J2B A;  2P5G A;  2OVQ B;  3QNO A;  4FJ9 A;  3J2P A;  3CFR A;  4M3R A;  4DTN A;  1Q9Y A;  2JHP A;  1FZ5 E;  2OVP B;  3LZI A;  4M3X A;  2VJ4 A;  3LDB A;  2MMB A;  3CQ8 A;  4J2E A;  2P1M B;  3LD8 A;  3TAE A;  3SUP A;  2JPN A;  3C95 A;  3HGL A;  3J27 A;  3QEI A;  4B08 A;  3HL8 A;  3SQ0 A;  4DTM A;  1FZ7 E;  1LDK E;  4FK4 A;  4KI4 A;  4X5N A;  3CFP A;  4EYW A;  5IBK B;  3NHG A;  2LF3 A;  4M3Y A;  4J2A A;  4I9Q A;  1XVF E;  4M3U A;  4FJK A;  1XVE E;  3RMA A;  4FJN A;  4J2D A;  3L1N A;  1FZI E;  1XVB E;  2QXF A;  4FJJ A;  3L0M A;  3E4W A;  4RNG A;  4JRP A;  2PFV A;  3KD5 E;  3V7D B;  4AKH A;  4DTP A;  4FJI A;  1FZ1 E;  4QNC A;  3SUN A;  2H4T A;  4QND A;  4I9L A;  3N1B A;  1NEX B;  2ATQ A;  4KHQ A;  2VIX A;  1FZ8 E;  2B7M A;  4FJG A;  2DEB A;  2P1O B;  2OVR B;  4ADN A;  4I6J B;  1FZ9 E;  4M3T A;  2JHC A;  5IRE A;  2E31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...