2YB5A

Structure of the fusidic acid resistance protein fusc
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
204
Chain Sequence
MNKIEVYKFVKVKQLVYQLIKLYRTNDMNSHKTQKDFLLNEINDIFKEKDIDISDFITSIDDVKLTKKKAEHLLNELKVYIQDFEIPSSSQLEKIFRKVKKLKRPDINLIDTKEISYLGWNDNSSNRKYIVYKNLDDKFEGIYGEISPNKVKGFCKICNQESDTSLFLNKTYTKKGDYICYDSFKCNQNLDDINNLYEFIVKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE FUSIDIC ACID RESISTANCE PROTEIN
publication title Ribosome Clearance by Fusb-Type Proteins Mediates Resistance to the Antibiotic Fusidic Acid
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Translation
total genus 60
structure length 204
sequence length 212
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
A PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2yb5A01
4ADNA 2YB5A 4ADOA 4E4BA 2MZWB
chains in the Genus database with same CATH superfamily
3LZJA 3QESA 4J2BA 3K2OA 3RMBA 4B08A 4FJMA 4E4BA 2P1PB 4ICGC 4FJIA 1XVFE 2FW3A 3LDBA 2MMBA 2B1EA 1FXXA 3HGLA 4M42A 3SPZA 1FZIE 1XMGE 2OVRB 3SVIA 3NHGA 4DTNA 1N1CA 2RCUA 3MKSB 4FJ5A 4J2AA 4FVMA 2HD0A 3SUPA 3CFPA 3RMDA 3SUOA 1IG9A 4FJXA 1XVBE 2MW2A 4I6JB 3QEXA 2FYOA 3C94A 2H4TA 3N1EA 4M45A 4JRQA 2DY4A 4FK2A 3C6PB 3L8BA 1MHZG 4X5NA 2JH9A 1FYZE 3SI6A 3KD1E 1XL3C 4GAMC 3RWUA 4KHSA 1FZ3E 3TL8B 2OZMA 3SUQA 4ADNA 3E4YA 3NGIA 3CFRA 3SJJA 1FZ1E 3L2OB 1JW2A 4I9LA 1Q9XA 4KHNA 2VJ4A 4QNDA 4X5MA 3UO3A 3HGKE 3LDSA 3CQ8A 4DTSA 1XVEE 4M3TA 3J27A 3QNOA 4EYWA 1FZ5E 4J2EA 3C6NB 4E3SA 1XVCE 4EPHA 2ATQA 4AKHA 5IBKB 1FZ9E 1FZ2E 3HL8A 2OVQB 4FJHA 4M3UA 2JHCA 2YB5A 4QNCA 1MMOG 1FZ0E 4JS5A 4JS4A 3SQ0A 2JQTA 3HP9A 3SQ4A 4FJ9A 1MHYG 4HCCA 2PFVA 1FZ4E 3TAEA 4IT5A 3UO2A 2RKHA 2JHAA 3J2PA 4DTXA 3SQ2A 2VIXA 4DTOA 4FJGA 1FS1A 3TAFA 2P1QB 4DU3A 4DTMA 3QNNA 4DU1A 4RNGA 3CFOA 1Q9YA 2P5OA 2PFTA 4DU4A 3QETA 4KHWA 1FZ7E 3BVOA 4M3ZA 1LDKE 4DTPA 3TAGA 4FJNA 1XVDE 3N1BA 3KD5E 3SQ1A 1XVGE 3LD8A 5IREA 4JRPA 4KI4A 1FPOA 3QERA 3LZIA 2MZWB 2K5SA 2E32A 4FK4A 4DTUA 4RL5A 4M3YA 1XU5E 4M3RA 1P22A 4FJ8A 1FZ6E 2DEBA 4AKIA 3UIQA 4KHUA 2DTUA 4RG8A 2LF3A 3C6OB 3OGMB 5IZ7A 4AI6A 3C95A 4FJLA 3SCXA 2OVPB 1XMHE 3OGKB 3WSOA 1WAFA 3V7DB 1FZHE 2P1OB 4I9QA 3S9HA 1MTYG 1XU3E 2E31A 4ADOA 3QEIA 3QEVA 3SUNA 2OZSA 4KHQA 3OGLB 3TJYA 4EP9A 4HCBA 3E4WA 4M41A 2B8IA 2P1MB 2VJ5A 5H37A 2JHPA 2P5GA 4M3WA 4KI6A 2OYQA 4FK0A 1FZ8E 2JPNA 2LF6A 3QEWA 4J2DA 4KHYA 4FJJA 2P1NB 1IH7A 4FJ7A 1NEXB 3RMCA 3NDKA 3TABA 1CLQA 3NCIA 3RMAA 3L1NA 3SNNA 3QEPA 4FJKA 1XMFE 3NE6A 1WAJA 4M3XA 2B7MA 2QXFA 4DTRA 3SPYA 2JH8A 3NAEA 4DTJA 4AKGA 3L0MA
chains in the Genus database with same CATH topology
3LZJA 3QESA 4J2BA 3K2OA 3RMBA 4B08A 4FJMA 4E4BA 2P1PB 4FJIA 1XVFE 2FW3A 3LDBA 2MMBA 2B1EA 1FXXA 3HGLA 4M42A 3SPZA 1FZIE 1XMGE 2OVRB 3SVIA 3NHGA 4DTNA 2RCUA 4FJ5A 3MKSB 4J2AA 4FVMA 2HD0A 3SUPA 3CFPA 3RMDA 3SUOA 1IG9A 4FJXA 1XVBE 4I6JB 3QEXA 3SI6A 2FYOA 3C94A 2H4TA 3N1EA 4M45A 4JRQA 2DY4A 4FK2A 3C6PB 3L8BA 1MHZG 4X5NA 2JH9A 1FYZE 3KD1E 1XL3C 4GAMC 3RWUA 4KHSA 1FZ3E 3TL8B 2OZMA 3SUQA 4ADNA 3E4YA 3NGIA 3CFRA 3SJJA 1FZ1E 3L2OB 4I9LA 1Q9XA 4KHNA 2VJ4A 4QNDA 4X5MA 3LDSA 3HGKE 3CQ8A 4DTSA 1XVEE 4M3TA 3J27A 3QNOA 4EYWA 1FZ5E 4J2EA 3C6NB 4E3SA 1XVCE 4EPHA 2ATQA 4AKHA 5IBKB 1FZ9E 1FZ2E 3HL8A 2OVQB 4FJHA 4M3UA 2JHCA 2YB5A 4QNCA 1MMOG 1FZ0E 4JS5A 4JS4A 3SQ0A 3HP9A 3SQ4A 4FJ9A 1MHYG 4HCCA 2PFVA 1FZ4E 3TAEA 3J2PA 2JHAA 4DTXA 3SQ2A 2VIXA 4DTOA 4FJGA 1FS1A 3TAFA 2P1QB 4DU3A 4DTMA 3QNNA 4DU1A 4RNGA 3CFOA 1Q9YA 2P5OA 2PFTA 4DU4A 3QETA 4KHWA 1FZ7E 4M3ZA 1LDKE 4DTPA 3TAGA 4FJNA 1XVDE 3N1BA 3KD5E 3SQ1A 1XVGE 3LD8A 5IREA 4JRPA 4KI4A 3QERA 3LZIA 2MZWB 2E32A 4FK4A 4DTUA 4RL5A 4M3YA 1XU5E 4M3RA 1P22A 4FJ8A 1FZ6E 2DEBA 4AKIA 3UIQA 4KHUA 2DTUA 4RG8A 2LF3A 3C6OB 3OGMB 5IZ7A 4AI6A 3C95A 4FJLA 3SCXA 2OVPB 1XMHE 3OGKB 3WSOA 1WAFA 3V7DB 1FZHE 2P1OB 4I9QA 3S9HA 1MTYG 1XU3E 2E31A 4ADOA 3QEIA 3QEVA 3SUNA 2OZSA 4KHQA 3OGLB 3TJYA 4EP9A 4HCBA 3E4WA 4M41A 2B8IA 2P1MB 2VJ5A 5H37A 2JHPA 2P5GA 4M3WA 4KI6A 2OYQA 4FK0A 1FZ8E 2JPNA 2LF6A 3QEWA 4J2DA 4KHYA 4FJJA 2P1NB 1IH7A 4FJ7A 1NEXB 3RMCA 3NDKA 3TABA 1CLQA 3NCIA 3RMAA 3L1NA 3SNNA 3QEPA 4FJKA 1XMFE 3NE6A 1WAJA 4M3XA 2B7MA 2QXFA 4DTRA 3SPYA 2JH8A 3NAEA 4DTJA 4AKGA 3L0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ADN A;  2YB5 A;  4ADO A;  4E4B A;  2MZW B; 
#chains in the Genus database with same CATH topology
 3LZJ A;  3QES A;  4J2B A;  3K2O A;  3RMB A;  4B08 A;  4FJM A;  4E4B A;  2P1P B;  4ICG C;  4FJI A;  1XVF E;  2FW3 A;  3LDB A;  2MMB A;  2B1E A;  1FXX A;  3HGL A;  4M42 A;  3SPZ A;  1FZI E;  1XMG E;  2OVR B;  3SVI A;  3NHG A;  4DTN A;  1N1C A;  2RCU A;  3MKS B;  4FJ5 A;  4J2A A;  4FVM A;  2HD0 A;  3SUP A;  3CFP A;  3RMD A;  3SUO A;  1IG9 A;  4FJX A;  1XVB E;  2MW2 A;  4I6J B;  3QEX A;  2FYO A;  3C94 A;  2H4T A;  3N1E A;  4M45 A;  4JRQ A;  2DY4 A;  4FK2 A;  3C6P B;  3L8B A;  1MHZ G;  4X5N A;  2JH9 A;  1FYZ E;  3SI6 A;  3KD1 E;  1XL3 C;  4GAM C;  3RWU A;  4KHS A;  1FZ3 E;  3TL8 B;  2OZM A;  3SUQ A;  4ADN A;  3E4Y A;  3NGI A;  3CFR A;  3SJJ A;  1FZ1 E;  3L2O B;  1JW2 A;  4I9L A;  1Q9X A;  4KHN A;  2VJ4 A;  4QND A;  4X5M A;  3UO3 A;  3HGK E;  3LDS A;  3CQ8 A;  4DTS A;  1XVE E;  4M3T A;  3J27 A;  3QNO A;  4EYW A;  1FZ5 E;  4J2E A;  3C6N B;  4E3S A;  1XVC E;  4EPH A;  2ATQ A;  4AKH A;  5IBK B;  1FZ9 E;  1FZ2 E;  3HL8 A;  2OVQ B;  4FJH A;  4M3U A;  2JHC A;  2YB5 A;  4QNC A;  1MMO G;  1FZ0 E;  4JS5 A;  4JS4 A;  3SQ0 A;  2JQT A;  3HP9 A;  3SQ4 A;  4FJ9 A;  1MHY G;  4HCC A;  2PFV A;  1FZ4 E;  3TAE A;  4IT5 A;  3UO2 A;  2RKH A;  2JHA A;  3J2P A;  4DTX A;  3SQ2 A;  2VIX A;  4DTO A;  4FJG A;  1FS1 A;  3TAF A;  2P1Q B;  4DU3 A;  4DTM A;  3QNN A;  4DU1 A;  4RNG A;  3CFO A;  1Q9Y A;  2P5O A;  2PFT A;  4DU4 A;  3QET A;  4KHW A;  1FZ7 E;  3BVO A;  4M3Z A;  1LDK E;  4DTP A;  3TAG A;  4FJN A;  1XVD E;  3N1B A;  3KD5 E;  3SQ1 A;  1XVG E;  3LD8 A;  5IRE A;  4JRP A;  4KI4 A;  1FPO A;  3QER A;  3LZI A;  2MZW B;  2K5S A;  2E32 A;  4FK4 A;  4DTU A;  4RL5 A;  4M3Y A;  1XU5 E;  4M3R A;  1P22 A;  4FJ8 A;  1FZ6 E;  2DEB A;  4AKI A;  3UIQ A;  4KHU A;  2DTU A;  4RG8 A;  2LF3 A;  3C6O B;  3OGM B;  5IZ7 A;  4AI6 A;  3C95 A;  4FJL A;  3SCX A;  2OVP B;  1XMH E;  3OGK B;  3WSO A;  1WAF A;  3V7D B;  1FZH E;  2P1O B;  4I9Q A;  3S9H A;  1MTY G;  1XU3 E;  2E31 A;  4ADO A;  3QEI A;  3QEV A;  3SUN A;  2OZS A;  4KHQ A;  3OGL B;  3TJY A;  4EP9 A;  4HCB A;  3E4W A;  4M41 A;  2B8I A;  2P1M B;  2VJ5 A;  5H37 A;  2JHP A;  2P5G A;  4M3W A;  4KI6 A;  2OYQ A;  4FK0 A;  1FZ8 E;  2JPN A;  2LF6 A;  3QEW A;  4J2D A;  4KHY A;  4FJJ A;  2P1N B;  1IH7 A;  4FJ7 A;  1NEX B;  3RMC A;  3NDK A;  3TAB A;  1CLQ A;  3NCI A;  3RMA A;  3L1N A;  3SNN A;  3QEP A;  4FJK A;  1XMF E;  3NE6 A;  1WAJ A;  4M3X A;  2B7M A;  2QXF A;  4DTR A;  3SPY A;  2JH8 A;  3NAE A;  4DTJ A;  4AKG A;  3L0M A; 
#chains in the Genus database with same CATH homology
 3LZJ A;  3QES A;  4J2B A;  3K2O A;  3RMB A;  4B08 A;  4FJM A;  4E4B A;  2P1P B;  4FJI A;  1XVF E;  2FW3 A;  3LDB A;  2MMB A;  2B1E A;  1FXX A;  3HGL A;  4M42 A;  3SPZ A;  1FZI E;  1XMG E;  2OVR B;  3SVI A;  3NHG A;  4DTN A;  2RCU A;  4FJ5 A;  3MKS B;  4J2A A;  4FVM A;  2HD0 A;  3SUP A;  3CFP A;  3RMD A;  3SUO A;  1IG9 A;  4FJX A;  1XVB E;  4I6J B;  3QEX A;  3SI6 A;  2FYO A;  3C94 A;  2H4T A;  3N1E A;  4M45 A;  4JRQ A;  2DY4 A;  4FK2 A;  3C6P B;  3L8B A;  1MHZ G;  4X5N A;  2JH9 A;  1FYZ E;  3KD1 E;  1XL3 C;  4GAM C;  3RWU A;  4KHS A;  1FZ3 E;  3TL8 B;  2OZM A;  3SUQ A;  4ADN A;  3E4Y A;  3NGI A;  3CFR A;  3SJJ A;  1FZ1 E;  3L2O B;  4I9L A;  1Q9X A;  4KHN A;  2VJ4 A;  4QND A;  4X5M A;  3LDS A;  3HGK E;  3CQ8 A;  4DTS A;  1XVE E;  4M3T A;  3J27 A;  3QNO A;  4EYW A;  1FZ5 E;  4J2E A;  3C6N B;  4E3S A;  1XVC E;  4EPH A;  2ATQ A;  4AKH A;  5IBK B;  1FZ9 E;  1FZ2 E;  3HL8 A;  2OVQ B;  4FJH A;  4M3U A;  2JHC A;  2YB5 A;  4QNC A;  1MMO G;  1FZ0 E;  4JS5 A;  4JS4 A;  3SQ0 A;  3HP9 A;  3SQ4 A;  4FJ9 A;  1MHY G;  4HCC A;  2PFV A;  1FZ4 E;  3TAE A;  3J2P A;  2JHA A;  4DTX A;  3SQ2 A;  2VIX A;  4DTO A;  4FJG A;  1FS1 A;  3TAF A;  2P1Q B;  4DU3 A;  4DTM A;  3QNN A;  4DU1 A;  4RNG A;  3CFO A;  1Q9Y A;  2P5O A;  2PFT A;  4DU4 A;  3QET A;  4KHW A;  1FZ7 E;  4M3Z A;  1LDK E;  4DTP A;  3TAG A;  4FJN A;  1XVD E;  3N1B A;  3KD5 E;  3SQ1 A;  1XVG E;  3LD8 A;  5IRE A;  4JRP A;  4KI4 A;  3QER A;  3LZI A;  2MZW B;  2E32 A;  4FK4 A;  4DTU A;  4RL5 A;  4M3Y A;  1XU5 E;  4M3R A;  1P22 A;  4FJ8 A;  1FZ6 E;  2DEB A;  4AKI A;  3UIQ A;  4KHU A;  2DTU A;  4RG8 A;  2LF3 A;  3C6O B;  3OGM B;  5IZ7 A;  4AI6 A;  3C95 A;  4FJL A;  3SCX A;  2OVP B;  1XMH E;  3OGK B;  3WSO A;  1WAF A;  3V7D B;  1FZH E;  2P1O B;  4I9Q A;  3S9H A;  1MTY G;  1XU3 E;  2E31 A;  4ADO A;  3QEI A;  3QEV A;  3SUN A;  2OZS A;  4KHQ A;  3OGL B;  3TJY A;  4EP9 A;  4HCB A;  3E4W A;  4M41 A;  2B8I A;  2P1M B;  2VJ5 A;  5H37 A;  2JHP A;  2P5G A;  4M3W A;  4KI6 A;  2OYQ A;  4FK0 A;  1FZ8 E;  2JPN A;  2LF6 A;  3QEW A;  4J2D A;  4KHY A;  4FJJ A;  2P1N B;  1IH7 A;  4FJ7 A;  1NEX B;  3RMC A;  3NDK A;  3TAB A;  1CLQ A;  3NCI A;  3RMA A;  3L1N A;  3SNN A;  3QEP A;  4FJK A;  1XMF E;  3NE6 A;  1WAJ A;  4M3X A;  2B7M A;  2QXF A;  4DTR A;  3SPY A;  2JH8 A;  3NAE A;  4DTJ A;  4AKG A;  3L0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...