2YB5A

Structure of the fusidic acid resistance protein fusc
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
204
Chain Sequence
MNKIEVYKFVKVKQLVYQLIKLYRTNDMNSHKTQKDFLLNEINDIFKEKDIDISDFITSIDDVKLTKKKAEHLLNELKVYIQDFEIPSSSQLEKIFRKVKKLKRPDINLIDTKEISYLGWNDNSSNRKYIVYKNLDDKFEGIYGEISPNKVKGFCKICNQESDTSLFLNKTYTKKGDYICYDSFKCNQNLDDINNLYEFIVKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE FUSIDIC ACID RESISTANCE PROTEIN
publication title Ribosome Clearance by Fusb-Type Proteins Mediates Resistance to the Antibiotic Fusidic Acid
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Translation
total genus 60
structure length 204
sequence length 212
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
A PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2yb5A01
4E4BA 2MZWB 4ADOA 2YB5A 4ADNA
chains in the Genus database with same CATH superfamily
2OVQB 3C6OB 1NEXB 1FXXA 1XVEE 3N1EA 3NAEA 2LF6A 4ADOA 3SCXA 2P5GA 4ADNA 4DTSA 1XMFE 4E4BA 3CQ8A 4M3XA 2JHAA 3HGKE 2H4TA 5IZ7A 3SQ0A 3L8BA 1WAFA 2JHPA 3QESA 4EPHA 3SVIA 1IH7A 4JRQA 4M41A 2JHCA 4FJMA 1FPOA 3HGLA 4QNDA 2E31A 1XVCE 3SUPA 2JH9A 4RL5A 3TAFA 2B1EA 4FJ7A 4M3WA 3NGIA 4KHYA 4IT5A 3SUNA 2VIXA 4FJLA 5IREA 1MHYG 4X5NA 3C6NB 3L0MA 3SQ2A 1JW2A 2VJ4A 2E32A 2JQTA 1FZ0E 4KI4A 3SQ1A 1XVDE 4JS4A 3RMAA 3QEVA 2RCUA 3NHGA 4KHQA 4M3YA 1FZ7E 4DTMA 3SQ4A 4KHWA 2OVRB 4DTOA 4DTNA 3QEWA 2QXFA 4EP9A 1XVGE 1Q9YA 4RNGA 4I9QA 3OGKB 3OGLB 2P1QB 3C94A 5H37A 4M3UA 1FZ1E 3L2OB 3SUOA 4DU3A 3L1NA 4J2AA 2B7MA 4KHSA 3SPYA 4M3ZA 2P1MB 3CFRA 3UIQA 3NDKA 4J2BA 1P22A 1XU3E 2P5OA 1FZ2E 4FJGA 4I6JB 4HCCA 3J2PA 3TJYA 4M42A 4M3TA 4JRPA 1FZ4E 1XU5E 2JPNA 4QNCA 5IBKB 1LDKE 2MW2A 3UO3A 2K5SA 3NE6A 3RMDA 4AKIA 1WAJA 4AKGA 2MMBA 3SUQA 4FK0A 2JH8A 3RMBA 2VJ5A 3C95A 1IG9A 3HP9A 3LDBA 3MKSB 1N1CA 3HL8A 2RKHA 3WSOA 2DEBA 3LZIA 3CFOA 4I9LA 3QNNA 3TAEA 4FVMA 1MTYG 2YB5A 3RMCA 2DTUA 3E4WA 4KHUA 4FK2A 2FYOA 4FJJA 3QERA 4HCBA 2FW3A 1FYZE 4FJ5A 3LD8A 4M45A 1Q9XA 4J2DA 4B08A 1FZ8E 2B8IA 3SPZA 3NCIA 4DU4A 4FJ8A 2OVPB 3C6PB 3LZJA 4FJKA 2OYQA 4KI6A 1FS1A 4AKHA 3OGMB 3SNNA 2P1NB 2P1OB 4GAMC 2PFVA 2PFTA 1FZ9E 1XVBE 4JS5A 4DTUA 3SI6A 2OZSA 3CFPA 1FZIE 4M3RA 3S9HA 1XMHE 2OZMA 3K2OA 4FJ9A 4DTPA 3QEXA 4X5MA 3J27A 4AI6A 3TL8B 3TAGA 3E4YA 3V7DB 3RWUA 1FZHE 2ATQA 3LDSA 1XVFE 1XL3C 4DTJA 3KD5E 3BVOA 2LF3A 4FK4A 4J2EA 3UO2A 1FZ3E 1XMGE 4DU1A 4ICGC 4E3SA 2DY4A 4FJHA 1MMOG 1FZ5E 1FZ6E 1MHZG 3QNOA 4FJIA 4EYWA 3N1BA 2HD0A 3TABA 3SJJA 2MZWB 4RG8A 3QEPA 4FJNA 4KHNA 1CLQA 4DTXA 4DTRA 4FJXA 3QEIA 3QETA 2P1PB 3KD1E
chains in the Genus database with same CATH topology
2OVQB 3C6OB 1NEXB 1FXXA 1XVEE 3N1EA 3NAEA 2LF6A 4ADOA 3SCXA 2P5GA 4ADNA 4DTSA 1XMFE 4E4BA 3CQ8A 4M3XA 2JHAA 3HGKE 2H4TA 5IZ7A 3SQ0A 3L8BA 1WAFA 2JHPA 3QESA 4EPHA 3SVIA 1IH7A 4JRQA 4M41A 2JHCA 4FJMA 3HGLA 4QNDA 2E31A 1XVCE 3SUPA 2JH9A 4RL5A 3TAFA 2B1EA 4FJ7A 4M3WA 3NGIA 4KHYA 3SUNA 2VIXA 4FJLA 5IREA 1MHYG 4X5NA 3C6NB 3L0MA 3SQ2A 2VJ4A 2E32A 1FZ0E 4KI4A 3SQ1A 1XVDE 4JS4A 3RMAA 3QEVA 2RCUA 3NHGA 4KHQA 4M3YA 1FZ7E 4DTMA 3SQ4A 4KHWA 2OVRB 4DTOA 4DTNA 3QEWA 2QXFA 4EP9A 1XVGE 1Q9YA 4RNGA 4I9QA 3OGKB 3OGLB 2P1QB 3C94A 5H37A 4M3UA 1FZ1E 3L2OB 3SUOA 4DU3A 3L1NA 4J2AA 2B7MA 4KHSA 3SPYA 4M3ZA 2P1MB 3CFRA 3UIQA 3NDKA 4J2BA 1P22A 1XU3E 2P5OA 1FZ2E 4FJGA 4I6JB 4HCCA 3J2PA 3TJYA 4M42A 4M3TA 4JRPA 1FZ4E 1XU5E 2JPNA 4QNCA 5IBKB 1LDKE 3NE6A 3RMDA 4AKIA 1WAJA 4AKGA 2MMBA 3SUQA 4FK0A 2JH8A 3RMBA 2VJ5A 3C95A 1IG9A 3HP9A 3LDBA 3MKSB 3HL8A 3WSOA 2DEBA 3LZIA 3CFOA 4I9LA 3QNNA 3TAEA 4FVMA 1MTYG 2YB5A 3RMCA 2DTUA 3E4WA 4KHUA 4FK2A 2FYOA 4FJJA 3QERA 4HCBA 2FW3A 1FYZE 4FJ5A 3LD8A 4M45A 1Q9XA 4J2DA 4B08A 1FZ8E 2B8IA 3SPZA 3NCIA 4DU4A 4FJ8A 2OVPB 3C6PB 3LZJA 4FJKA 2OYQA 4KI6A 1FS1A 4AKHA 3OGMB 3SNNA 2P1NB 2P1OB 4GAMC 2PFVA 2PFTA 1FZ9E 1XVBE 4JS5A 4DTUA 3SI6A 2OZSA 3CFPA 1FZIE 4M3RA 3S9HA 1XMHE 2OZMA 3K2OA 4FJ9A 4DTPA 3QEXA 4X5MA 3J27A 4AI6A 3TL8B 3TAGA 3E4YA 3V7DB 3RWUA 1FZHE 2ATQA 3LDSA 1XVFE 1XL3C 4DTJA 3KD5E 2LF3A 4FK4A 4J2EA 1FZ3E 1XMGE 4DU1A 4E3SA 2DY4A 4FJHA 1MMOG 1FZ5E 1FZ6E 1MHZG 3QNOA 4FJIA 4EYWA 3N1BA 2HD0A 3TABA 3SJJA 2MZWB 4RG8A 3QEPA 4FJNA 4KHNA 1CLQA 4DTXA 4DTRA 4FJXA 3QEIA 3QETA 2P1PB 3KD1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E4B A;  2MZW B;  4ADO A;  2YB5 A;  4ADN A; 
#chains in the Genus database with same CATH topology
 2OVQ B;  3C6O B;  1NEX B;  1FXX A;  1XVE E;  3N1E A;  3NAE A;  2LF6 A;  4ADO A;  3SCX A;  2P5G A;  4ADN A;  4DTS A;  1XMF E;  4E4B A;  3CQ8 A;  4M3X A;  2JHA A;  3HGK E;  2H4T A;  5IZ7 A;  3SQ0 A;  3L8B A;  1WAF A;  2JHP A;  3QES A;  4EPH A;  3SVI A;  1IH7 A;  4JRQ A;  4M41 A;  2JHC A;  4FJM A;  1FPO A;  3HGL A;  4QND A;  2E31 A;  1XVC E;  3SUP A;  2JH9 A;  4RL5 A;  3TAF A;  2B1E A;  4FJ7 A;  4M3W A;  3NGI A;  4KHY A;  4IT5 A;  3SUN A;  2VIX A;  4FJL A;  5IRE A;  1MHY G;  4X5N A;  3C6N B;  3L0M A;  3SQ2 A;  1JW2 A;  2VJ4 A;  2E32 A;  2JQT A;  1FZ0 E;  4KI4 A;  3SQ1 A;  1XVD E;  4JS4 A;  3RMA A;  3QEV A;  2RCU A;  3NHG A;  4KHQ A;  4M3Y A;  1FZ7 E;  4DTM A;  3SQ4 A;  4KHW A;  2OVR B;  4DTO A;  4DTN A;  3QEW A;  2QXF A;  4EP9 A;  1XVG E;  1Q9Y A;  4RNG A;  4I9Q A;  3OGK B;  3OGL B;  2P1Q B;  3C94 A;  5H37 A;  4M3U A;  1FZ1 E;  3L2O B;  3SUO A;  4DU3 A;  3L1N A;  4J2A A;  2B7M A;  4KHS A;  3SPY A;  4M3Z A;  2P1M B;  3CFR A;  3UIQ A;  3NDK A;  4J2B A;  1P22 A;  1XU3 E;  2P5O A;  1FZ2 E;  4FJG A;  4I6J B;  4HCC A;  3J2P A;  3TJY A;  4M42 A;  4M3T A;  4JRP A;  1FZ4 E;  1XU5 E;  2JPN A;  4QNC A;  5IBK B;  1LDK E;  2MW2 A;  3UO3 A;  2K5S A;  3NE6 A;  3RMD A;  4AKI A;  1WAJ A;  4AKG A;  2MMB A;  3SUQ A;  4FK0 A;  2JH8 A;  3RMB A;  2VJ5 A;  3C95 A;  1IG9 A;  3HP9 A;  3LDB A;  3MKS B;  1N1C A;  3HL8 A;  2RKH A;  3WSO A;  2DEB A;  3LZI A;  3CFO A;  4I9L A;  3QNN A;  3TAE A;  4FVM A;  1MTY G;  2YB5 A;  3RMC A;  2DTU A;  3E4W A;  4KHU A;  4FK2 A;  2FYO A;  4FJJ A;  3QER A;  4HCB A;  2FW3 A;  1FYZ E;  4FJ5 A;  3LD8 A;  4M45 A;  1Q9X A;  4J2D A;  4B08 A;  1FZ8 E;  2B8I A;  3SPZ A;  3NCI A;  4DU4 A;  4FJ8 A;  2OVP B;  3C6P B;  3LZJ A;  4FJK A;  2OYQ A;  4KI6 A;  1FS1 A;  4AKH A;  3OGM B;  3SNN A;  2P1N B;  2P1O B;  4GAM C;  2PFV A;  2PFT A;  1FZ9 E;  1XVB E;  4JS5 A;  4DTU A;  3SI6 A;  2OZS A;  3CFP A;  1FZI E;  4M3R A;  3S9H A;  1XMH E;  2OZM A;  3K2O A;  4FJ9 A;  4DTP A;  3QEX A;  4X5M A;  3J27 A;  4AI6 A;  3TL8 B;  3TAG A;  3E4Y A;  3V7D B;  3RWU A;  1FZH E;  2ATQ A;  3LDS A;  1XVF E;  1XL3 C;  4DTJ A;  3KD5 E;  3BVO A;  2LF3 A;  4FK4 A;  4J2E A;  3UO2 A;  1FZ3 E;  1XMG E;  4DU1 A;  4ICG C;  4E3S A;  2DY4 A;  4FJH A;  1MMO G;  1FZ5 E;  1FZ6 E;  1MHZ G;  3QNO A;  4FJI A;  4EYW A;  3N1B A;  2HD0 A;  3TAB A;  3SJJ A;  2MZW B;  4RG8 A;  3QEP A;  4FJN A;  4KHN A;  1CLQ A;  4DTX A;  4DTR A;  4FJX A;  3QEI A;  3QET A;  2P1P B;  3KD1 E; 
#chains in the Genus database with same CATH homology
 2OVQ B;  3C6O B;  1NEX B;  1FXX A;  1XVE E;  3N1E A;  3NAE A;  2LF6 A;  4ADO A;  3SCX A;  2P5G A;  4ADN A;  4DTS A;  1XMF E;  4E4B A;  3CQ8 A;  4M3X A;  2JHA A;  3HGK E;  2H4T A;  5IZ7 A;  3SQ0 A;  3L8B A;  1WAF A;  2JHP A;  3QES A;  4EPH A;  3SVI A;  1IH7 A;  4JRQ A;  4M41 A;  2JHC A;  4FJM A;  3HGL A;  4QND A;  2E31 A;  1XVC E;  3SUP A;  2JH9 A;  4RL5 A;  3TAF A;  2B1E A;  4FJ7 A;  4M3W A;  3NGI A;  4KHY A;  3SUN A;  2VIX A;  4FJL A;  5IRE A;  1MHY G;  4X5N A;  3C6N B;  3L0M A;  3SQ2 A;  2VJ4 A;  2E32 A;  1FZ0 E;  4KI4 A;  3SQ1 A;  1XVD E;  4JS4 A;  3RMA A;  3QEV A;  2RCU A;  3NHG A;  4KHQ A;  4M3Y A;  1FZ7 E;  4DTM A;  3SQ4 A;  4KHW A;  2OVR B;  4DTO A;  4DTN A;  3QEW A;  2QXF A;  4EP9 A;  1XVG E;  1Q9Y A;  4RNG A;  4I9Q A;  3OGK B;  3OGL B;  2P1Q B;  3C94 A;  5H37 A;  4M3U A;  1FZ1 E;  3L2O B;  3SUO A;  4DU3 A;  3L1N A;  4J2A A;  2B7M A;  4KHS A;  3SPY A;  4M3Z A;  2P1M B;  3CFR A;  3UIQ A;  3NDK A;  4J2B A;  1P22 A;  1XU3 E;  2P5O A;  1FZ2 E;  4FJG A;  4I6J B;  4HCC A;  3J2P A;  3TJY A;  4M42 A;  4M3T A;  4JRP A;  1FZ4 E;  1XU5 E;  2JPN A;  4QNC A;  5IBK B;  1LDK E;  3NE6 A;  3RMD A;  4AKI A;  1WAJ A;  4AKG A;  2MMB A;  3SUQ A;  4FK0 A;  2JH8 A;  3RMB A;  2VJ5 A;  3C95 A;  1IG9 A;  3HP9 A;  3LDB A;  3MKS B;  3HL8 A;  3WSO A;  2DEB A;  3LZI A;  3CFO A;  4I9L A;  3QNN A;  3TAE A;  4FVM A;  1MTY G;  2YB5 A;  3RMC A;  2DTU A;  3E4W A;  4KHU A;  4FK2 A;  2FYO A;  4FJJ A;  3QER A;  4HCB A;  2FW3 A;  1FYZ E;  4FJ5 A;  3LD8 A;  4M45 A;  1Q9X A;  4J2D A;  4B08 A;  1FZ8 E;  2B8I A;  3SPZ A;  3NCI A;  4DU4 A;  4FJ8 A;  2OVP B;  3C6P B;  3LZJ A;  4FJK A;  2OYQ A;  4KI6 A;  1FS1 A;  4AKH A;  3OGM B;  3SNN A;  2P1N B;  2P1O B;  4GAM C;  2PFV A;  2PFT A;  1FZ9 E;  1XVB E;  4JS5 A;  4DTU A;  3SI6 A;  2OZS A;  3CFP A;  1FZI E;  4M3R A;  3S9H A;  1XMH E;  2OZM A;  3K2O A;  4FJ9 A;  4DTP A;  3QEX A;  4X5M A;  3J27 A;  4AI6 A;  3TL8 B;  3TAG A;  3E4Y A;  3V7D B;  3RWU A;  1FZH E;  2ATQ A;  3LDS A;  1XVF E;  1XL3 C;  4DTJ A;  3KD5 E;  2LF3 A;  4FK4 A;  4J2E A;  1FZ3 E;  1XMG E;  4DU1 A;  4E3S A;  2DY4 A;  4FJH A;  1MMO G;  1FZ5 E;  1FZ6 E;  1MHZ G;  3QNO A;  4FJI A;  4EYW A;  3N1B A;  2HD0 A;  3TAB A;  3SJJ A;  2MZW B;  4RG8 A;  3QEP A;  4FJN A;  4KHN A;  1CLQ A;  4DTX A;  4DTR A;  4FJX A;  3QEI A;  3QET A;  2P1P B;  3KD1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...