1XU3E

Soluble methane monooxygenase hydroxylase-soaked with bromophenol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
total genus 63
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xu3E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xu3E02
1FZIE 1FZHE 1MMOG 1FZ1E 1XMFE 1XVDE 1FYZE 1FZ4E 1MHZG 1FZ7E 4GAMC 1FZ9E 1XVEE 1FZ8E 1XVBE 1MTYG 1XMHE 1XMGE 1XVCE 1FZ5E 1FZ2E 1XU5E 1XVFE 1MHYG 1FZ6E 1XVGE 1FZ3E 1XU3E 1FZ0E
chains in the Genus database with same CATH superfamily
3C94A 2P5OA 2P1NB 4B08A 2ATQA 1NEXB 4FK4A 3NAEA 1FYZE 5IZ7A 3NE6A 4M3XA 1FZ4E 4FJ9A 4RL5A 4DU4A 4FJKA 3QEWA 2P5GA 2B1EA 3J27A 3UO3A 3LZJA 2P1QB 3UO2A 3QNOA 2OVQB 2OZMA 1MTYG 4M3RA 2OZSA 2P1PB 3SNNA 3RMDA 4FJIA 3SUPA 1FZ5E 1FZ2E 1XU5E 4J2EA 3SUQA 2VJ4A 2PFVA 3L1NA 4DTJA 1XVFE 2FW3A 4FK0A 1FZ6E 3C6OB 4DU1A 4FJNA 1IG9A 4AKHA 4FJXA 4FJ8A 2MW2A 3SQ2A 3K2OA 4KHSA 1FZIE 4DTMA 1MMOG 3CFPA 3SJJA 3E4YA 3TL8B 3CFRA 4M3UA 2B8IA 2DEBA 4M41A 3LD8A 4RNGA 3KD5E 4HCBA 2HD0A 2JHAA 4I9LA 4AKGA 5IREA 1IH7A 4QNDA 4HCCA 2JPNA 3QNNA 2JH9A 5H37A 3HL8A 2B7MA 1FZ9E 3SI6A 4J2AA 3J2PA 4DTUA 2OYQA 3QEIA 1XVCE 4FJHA 3QEPA 3N1EA 4QNCA 4JS4A 3MKSB 1XL3C 3V7DB 4J2DA 2YB5A 4M3ZA 2MMBA 2QXFA 3TAGA 3SCXA 2DTUA 4DTOA 1FZ3E 3E4WA 3QEVA 4FJJA 2K5SA 2PFTA 2FYOA 4E3SA 1FZHE 2VIXA 3HGKE 3RWUA 3TAFA 2VJ5A 3QEXA 1Q9YA 3C95A 4ADNA 3LDSA 3SQ1A 4FVMA 4IT5A 3NHGA 4KHYA 3KD1E 3CQ8A 1P22A 1CLQA 2E32A 3SQ4A 1FXXA 3S9HA 4DTNA 4GAMC 4ADOA 4AI6A 1XVEE 3NDKA 1JW2A 1FZ8E 1XVBE 3RMAA 4M3TA 2OVRB 4EP9A 3NCIA 2H4TA 2LF6A 2MZWB 4X5MA 3TJYA 4FK2A 3HP9A 4KHWA 2JHCA 3HGLA 3N1BA 4M42A 4FJMA 1MHYG 2LF3A 3L0MA 4E4BA 3OGKB 4X5NA 3WSOA 1XVGE 4KHUA 1XU3E 2P1OB 1WAJA 1FZ0E 3TABA 4M45A 4KHNA 3TAEA 4JRQA 1FZ1E 1XMFE 4JRPA 3NGIA 4J2BA 1XVDE 2OVPB 3OGLB 4ICGC 2RKHA 4RG8A 3BVOA 3SPYA 2E31A 3L2OB 3RMBA 4KHQA 4FJGA 2DY4A 2RCUA 3SUOA 3LDBA 3QESA 1MHZG 3C6NB 1FZ7E 4DTRA 3C6PB 4DTPA 4DU3A 3SQ0A 3QERA 1N1CA 4FJ5A 3QETA 1FS1A 4EPHA 3CFOA 4DTSA 1WAFA 1FPOA 4FJ7A 1LDKE 3L8BA 1XMHE 4I6JB 3SVIA 4KI4A 4EYWA 3SUNA 1XMGE 3UIQA 3RMCA 3OGMB 3SPZA 1Q9XA 4M3YA 2JQTA 2JH8A 4DTXA 4M3WA 4JS5A 4AKIA 3LZIA 4KI6A 4I9QA 5IBKB 2P1MB 2JHPA 4FJLA
chains in the Genus database with same CATH topology
3C94A 2P5OA 2P1NB 4B08A 2ATQA 1NEXB 4FK4A 3NAEA 1FYZE 5IZ7A 3NE6A 4M3XA 1FZ4E 4FJ9A 4RL5A 4DU4A 4FJKA 3QEWA 2P5GA 2B1EA 3J27A 3LZJA 2P1QB 3QNOA 2OVQB 2OZMA 1MTYG 4M3RA 2OZSA 2P1PB 3SNNA 3RMDA 4FJIA 3SUPA 1FZ5E 1FZ2E 1XU5E 4J2EA 3SUQA 2VJ4A 2PFVA 3L1NA 4DTJA 1XVFE 2FW3A 4FK0A 1FZ6E 3C6OB 4DU1A 4FJNA 1IG9A 4AKHA 4FJXA 4FJ8A 3SQ2A 3K2OA 4KHSA 1FZIE 4DTMA 1MMOG 3CFPA 3SJJA 3E4YA 3TL8B 3CFRA 4M3UA 2B8IA 2DEBA 4M41A 3LD8A 4RNGA 3KD5E 4HCBA 2HD0A 2JHAA 4I9LA 4AKGA 5IREA 1IH7A 4QNDA 4HCCA 2JPNA 3QNNA 2JH9A 5H37A 3HL8A 2B7MA 1FZ9E 3SI6A 4J2AA 3J2PA 4DTUA 2OYQA 3QEIA 1XVCE 4FJHA 3QEPA 3N1EA 4QNCA 4JS4A 3MKSB 1XL3C 3V7DB 4J2DA 2YB5A 4M3ZA 2MMBA 2QXFA 3TAGA 3SCXA 2DTUA 4DTOA 1FZ3E 3E4WA 3QEVA 4FJJA 2PFTA 2FYOA 4E3SA 1FZHE 2VIXA 3HGKE 3RWUA 3TAFA 2VJ5A 3QEXA 1Q9YA 3C95A 4ADNA 3LDSA 3SQ1A 4FVMA 3NHGA 4KHYA 1CLQA 3KD1E 3CQ8A 1P22A 2E32A 3SQ4A 1FXXA 3S9HA 4DTNA 4GAMC 4ADOA 4AI6A 1XVEE 3NDKA 1FZ8E 1XVBE 3RMAA 4M3TA 2OVRB 4EP9A 3NCIA 2H4TA 2LF6A 2MZWB 4X5MA 3TJYA 4FK2A 3HP9A 4KHWA 2JHCA 3HGLA 3N1BA 4M42A 4FJMA 1MHYG 2LF3A 3L0MA 4E4BA 3OGKB 4X5NA 3WSOA 1XVGE 4KHUA 1XU3E 2P1OB 1WAJA 1FZ0E 3TABA 4M45A 4KHNA 3TAEA 4JRQA 1FZ1E 1XMFE 4JRPA 3NGIA 4J2BA 1XVDE 2OVPB 3OGLB 4KHQA 4RG8A 3SPYA 2DY4A 2E31A 3L2OB 3RMBA 4FJGA 2RCUA 3SUOA 3LDBA 3QESA 1MHZG 3C6NB 1FZ7E 4DTRA 3C6PB 4DTPA 4DU3A 3SQ0A 3QERA 4FJ5A 3QETA 1FS1A 4EPHA 3CFOA 4DTSA 1WAFA 4FJ7A 1LDKE 3L8BA 1XMHE 4I6JB 3SVIA 4KI4A 4EYWA 3SUNA 1XMGE 3UIQA 3RMCA 3OGMB 3SPZA 1Q9XA 4M3YA 2JH8A 4DTXA 4M3WA 4JS5A 4AKIA 3LZIA 4KI6A 4I9QA 5IBKB 2P1MB 2JHPA 4FJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZI E;  1FZH E;  1MMO G;  1FZ1 E;  1XMF E;  1XVD E;  1FYZ E;  1FZ4 E;  1MHZ G;  1FZ7 E;  4GAM C;  1FZ9 E;  1XVE E;  1FZ8 E;  1XVB E;  1MTY G;  1XMH E;  1XMG E;  1XVC E;  1FZ5 E;  1FZ2 E;  1XU5 E;  1XVF E;  1MHY G;  1FZ6 E;  1XVG E;  1FZ3 E;  1XU3 E;  1FZ0 E; 
#chains in the Genus database with same CATH topology
 3C94 A;  2P5O A;  2P1N B;  4B08 A;  2ATQ A;  1NEX B;  4FK4 A;  3NAE A;  1FYZ E;  5IZ7 A;  3NE6 A;  4M3X A;  1FZ4 E;  4FJ9 A;  4RL5 A;  4DU4 A;  4FJK A;  3QEW A;  2P5G A;  2B1E A;  3J27 A;  3UO3 A;  3LZJ A;  2P1Q B;  3UO2 A;  3QNO A;  2OVQ B;  2OZM A;  1MTY G;  4M3R A;  2OZS A;  2P1P B;  3SNN A;  3RMD A;  4FJI A;  3SUP A;  1FZ5 E;  1FZ2 E;  1XU5 E;  4J2E A;  3SUQ A;  2VJ4 A;  2PFV A;  3L1N A;  4DTJ A;  1XVF E;  2FW3 A;  4FK0 A;  1FZ6 E;  3C6O B;  4DU1 A;  4FJN A;  1IG9 A;  4AKH A;  4FJX A;  4FJ8 A;  2MW2 A;  3SQ2 A;  3K2O A;  4KHS A;  1FZI E;  4DTM A;  1MMO G;  3CFP A;  3SJJ A;  3E4Y A;  3TL8 B;  3CFR A;  4M3U A;  2B8I A;  2DEB A;  4M41 A;  3LD8 A;  4RNG A;  3KD5 E;  4HCB A;  2HD0 A;  2JHA A;  4I9L A;  4AKG A;  5IRE A;  1IH7 A;  4QND A;  4HCC A;  2JPN A;  3QNN A;  2JH9 A;  5H37 A;  3HL8 A;  2B7M A;  1FZ9 E;  3SI6 A;  4J2A A;  3J2P A;  4DTU A;  2OYQ A;  3QEI A;  1XVC E;  4FJH A;  3QEP A;  3N1E A;  4QNC A;  4JS4 A;  3MKS B;  1XL3 C;  3V7D B;  4J2D A;  2YB5 A;  4M3Z A;  2MMB A;  2QXF A;  3TAG A;  3SCX A;  2DTU A;  4DTO A;  1FZ3 E;  3E4W A;  3QEV A;  4FJJ A;  2K5S A;  2PFT A;  2FYO A;  4E3S A;  1FZH E;  2VIX A;  3HGK E;  3RWU A;  3TAF A;  2VJ5 A;  3QEX A;  1Q9Y A;  3C95 A;  4ADN A;  3LDS A;  3SQ1 A;  4FVM A;  4IT5 A;  3NHG A;  4KHY A;  3KD1 E;  3CQ8 A;  1P22 A;  1CLQ A;  2E32 A;  3SQ4 A;  1FXX A;  3S9H A;  4DTN A;  4GAM C;  4ADO A;  4AI6 A;  1XVE E;  3NDK A;  1JW2 A;  1FZ8 E;  1XVB E;  3RMA A;  4M3T A;  2OVR B;  4EP9 A;  3NCI A;  2H4T A;  2LF6 A;  2MZW B;  4X5M A;  3TJY A;  4FK2 A;  3HP9 A;  4KHW A;  2JHC A;  3HGL A;  3N1B A;  4M42 A;  4FJM A;  1MHY G;  2LF3 A;  3L0M A;  4E4B A;  3OGK B;  4X5N A;  3WSO A;  1XVG E;  4KHU A;  1XU3 E;  2P1O B;  1WAJ A;  1FZ0 E;  3TAB A;  4M45 A;  4KHN A;  3TAE A;  4JRQ A;  1FZ1 E;  1XMF E;  4JRP A;  3NGI A;  4J2B A;  1XVD E;  2OVP B;  3OGL B;  4ICG C;  2RKH A;  4RG8 A;  3BVO A;  3SPY A;  2E31 A;  3L2O B;  3RMB A;  4KHQ A;  4FJG A;  2DY4 A;  2RCU A;  3SUO A;  3LDB A;  3QES A;  1MHZ G;  3C6N B;  1FZ7 E;  4DTR A;  3C6P B;  4DTP A;  4DU3 A;  3SQ0 A;  3QER A;  1N1C A;  4FJ5 A;  3QET A;  1FS1 A;  4EPH A;  3CFO A;  4DTS A;  1WAF A;  1FPO A;  4FJ7 A;  1LDK E;  3L8B A;  1XMH E;  4I6J B;  3SVI A;  4KI4 A;  4EYW A;  3SUN A;  1XMG E;  3UIQ A;  3RMC A;  3OGM B;  3SPZ A;  1Q9X A;  4M3Y A;  2JQT A;  2JH8 A;  4DTX A;  4M3W A;  4JS5 A;  4AKI A;  3LZI A;  4KI6 A;  4I9Q A;  5IBK B;  2P1M B;  2JHP A;  4FJL A; 
#chains in the Genus database with same CATH homology
 3C94 A;  2P5O A;  2P1N B;  4B08 A;  2ATQ A;  1NEX B;  4FK4 A;  3NAE A;  1FYZ E;  5IZ7 A;  3NE6 A;  4M3X A;  1FZ4 E;  4FJ9 A;  4RL5 A;  4DU4 A;  4FJK A;  3QEW A;  2P5G A;  2B1E A;  3J27 A;  3LZJ A;  2P1Q B;  3QNO A;  2OVQ B;  2OZM A;  1MTY G;  4M3R A;  2OZS A;  2P1P B;  3SNN A;  3RMD A;  4FJI A;  3SUP A;  1FZ5 E;  1FZ2 E;  1XU5 E;  4J2E A;  3SUQ A;  2VJ4 A;  2PFV A;  3L1N A;  4DTJ A;  1XVF E;  2FW3 A;  4FK0 A;  1FZ6 E;  3C6O B;  4DU1 A;  4FJN A;  1IG9 A;  4AKH A;  4FJX A;  4FJ8 A;  3SQ2 A;  3K2O A;  4KHS A;  1FZI E;  4DTM A;  1MMO G;  3CFP A;  3SJJ A;  3E4Y A;  3TL8 B;  3CFR A;  4M3U A;  2B8I A;  2DEB A;  4M41 A;  3LD8 A;  4RNG A;  3KD5 E;  4HCB A;  2HD0 A;  2JHA A;  4I9L A;  4AKG A;  5IRE A;  1IH7 A;  4QND A;  4HCC A;  2JPN A;  3QNN A;  2JH9 A;  5H37 A;  3HL8 A;  2B7M A;  1FZ9 E;  3SI6 A;  4J2A A;  3J2P A;  4DTU A;  2OYQ A;  3QEI A;  1XVC E;  4FJH A;  3QEP A;  3N1E A;  4QNC A;  4JS4 A;  3MKS B;  1XL3 C;  3V7D B;  4J2D A;  2YB5 A;  4M3Z A;  2MMB A;  2QXF A;  3TAG A;  3SCX A;  2DTU A;  4DTO A;  1FZ3 E;  3E4W A;  3QEV A;  4FJJ A;  2PFT A;  2FYO A;  4E3S A;  1FZH E;  2VIX A;  3HGK E;  3RWU A;  3TAF A;  2VJ5 A;  3QEX A;  1Q9Y A;  3C95 A;  4ADN A;  3LDS A;  3SQ1 A;  4FVM A;  3NHG A;  4KHY A;  1CLQ A;  3KD1 E;  3CQ8 A;  1P22 A;  2E32 A;  3SQ4 A;  1FXX A;  3S9H A;  4DTN A;  4GAM C;  4ADO A;  4AI6 A;  1XVE E;  3NDK A;  1FZ8 E;  1XVB E;  3RMA A;  4M3T A;  2OVR B;  4EP9 A;  3NCI A;  2H4T A;  2LF6 A;  2MZW B;  4X5M A;  3TJY A;  4FK2 A;  3HP9 A;  4KHW A;  2JHC A;  3HGL A;  3N1B A;  4M42 A;  4FJM A;  1MHY G;  2LF3 A;  3L0M A;  4E4B A;  3OGK B;  4X5N A;  3WSO A;  1XVG E;  4KHU A;  1XU3 E;  2P1O B;  1WAJ A;  1FZ0 E;  3TAB A;  4M45 A;  4KHN A;  3TAE A;  4JRQ A;  1FZ1 E;  1XMF E;  4JRP A;  3NGI A;  4J2B A;  1XVD E;  2OVP B;  3OGL B;  4KHQ A;  4RG8 A;  3SPY A;  2DY4 A;  2E31 A;  3L2O B;  3RMB A;  4FJG A;  2RCU A;  3SUO A;  3LDB A;  3QES A;  1MHZ G;  3C6N B;  1FZ7 E;  4DTR A;  3C6P B;  4DTP A;  4DU3 A;  3SQ0 A;  3QER A;  4FJ5 A;  3QET A;  1FS1 A;  4EPH A;  3CFO A;  4DTS A;  1WAF A;  4FJ7 A;  1LDK E;  3L8B A;  1XMH E;  4I6J B;  3SVI A;  4KI4 A;  4EYW A;  3SUN A;  1XMG E;  3UIQ A;  3RMC A;  3OGM B;  3SPZ A;  1Q9X A;  4M3Y A;  2JH8 A;  4DTX A;  4M3W A;  4JS5 A;  4AKI A;  3LZI A;  4KI6 A;  4I9Q A;  5IBK B;  2P1M B;  2JHP A;  4FJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...