1XU3E

Soluble methane monooxygenase hydroxylase-soaked with bromophenol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
total genus 63
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xu3E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xu3E02
1FZ7E 1XVFE 1XVEE 1XMGE 1XU5E 1FZIE 1FZ8E 1XVBE 1FZ5E 1MHYG 4GAMC 1FYZE 1XU3E 1FZ3E 1MHZG 1XVCE 1XMHE 1FZ2E 1XVGE 1FZ9E 1XVDE 1FZ0E 1FZ6E 1MMOG 1FZ4E 1MTYG 1XMFE 1FZ1E 1FZHE
chains in the Genus database with same CATH superfamily
4M3RA 1XL3C 1FZ7E 4KI4A 4KHUA 2E31A 3TJYA 2RCUA 3QEVA 3TAEA 3E4WA 1FXXA 3V7DB 4DTMA 2OVPB 3L1NA 1JW2A 4M3ZA 2B7MA 2MMBA 3J2PA 2OZMA 2OZSA 2K5SA 4KHNA 3C6OB 4FK0A 4JS5A 2QXFA 3NHGA 3KD1E 2PFTA 4FK2A 2VIXA 4FJKA 2P5OA 3NE6A 2OVRB 4J2DA 3K2OA 2FW3A 2JQTA 3NGIA 1LDKE 3L0MA 3QETA 5IBKB 3KD5E 4RNGA 4FJMA 1FZ0E 3SUOA 1Q9YA 1FPOA 4RG8A 1FZ4E 4DTXA 2JH9A 2H4TA 3TAFA 4J2BA 4I9LA 1XVCE 3QEIA 3SQ1A 3HL8A 2JHPA 2YB5A 1WAFA 4X5NA 1FZHE 3QESA 4FVMA 1XVFE 3NCIA 1FZ8E 1FZ5E 1N1CA 3QNNA 3SJJA 4RL5A 1MHYG 2P1OB 4GAMC 5IZ7A 1XU3E 4JS4A 3NDKA 1FZ3E 3N1BA 2JH8A 2FYOA 2MW2A 4QNDA 3QEWA 4HCCA 3MKSB 3CFPA 4I9QA 3SUQA 4DTRA 3SQ0A 4I6JB 4M3WA 2DY4A 1FS1A 4M3UA 4ADOA 4FJNA 4M42A 4EPHA 3LZIA 4AI6A 1FZ9E 3HP9A 1XVDE 3UIQA 3SPZA 4ICGC 3LDSA 1P22A 4AKGA 3HGKE 2VJ4A 3CQ8A 1IH7A 1MTYG 3OGMB 4M3TA 3L2OB 4DTUA 4DTOA 3LDBA 4JRQA 4QNCA 4J2AA 4M3XA 1XVEE 1XMGE 1XU5E 1FZIE 3RMBA 2DTUA 5IREA 4DTNA 3LZJA 4HCBA 2JHAA 1FYZE 1NEXB 3C94A 1CLQA 3SI6A 3QNOA 3QEXA 2P1PB 3WSOA 3BVOA 2OYQA 2JPNA 1FZ2E 4KI6A 1WAJA 3E4YA 4EYWA 2PFVA 4KHYA 4B08A 3SQ4A 4FJJA 2ATQA 3SUNA 4AKHA 2VJ5A 2E32A 3NAEA 2P1NB 4M45A 3UO2A 4EP9A 3C6NB 3CFRA 3LD8A 3RMAA 1MMOG 1IG9A 1Q9XA 2LF6A 3OGKB 4DTSA 4M3YA 3SVIA 3RMDA 4DTPA 2B1EA 4FJXA 4E3SA 4E4BA 3SCXA 4FJGA 4FK4A 4FJ5A 2B8IA 1XVBE 2OVQB 4KHQA 4AKIA 3CFOA 4X5MA 4J2EA 4KHSA 3QERA 2MZWB 4KHWA 3C95A 3SQ2A 4JRPA 2JHCA 2LF3A 4DTJA 3RWUA 3RMCA 1MHZG 5H37A 2P1MB 3UO3A 4FJLA 1XMHE 2P5GA 3TABA 2DEBA 4DU4A 4IT5A 1XVGE 4ADNA 3TL8B 4M41A 4FJ7A 4DU1A 4FJ9A 3QEPA 2P1QB 3C6PB 4FJHA 3SUPA 3J27A 3HGLA 3TAGA 3SPYA 1FZ6E 3N1EA 4DU3A 4FJIA 2HD0A 4FJ8A 3OGLB 2RKHA 3SNNA 3L8BA 1XMFE 3S9HA 1FZ1E
chains in the Genus database with same CATH topology
4M3RA 1XL3C 1FZ7E 4KI4A 4KHUA 2E31A 3TJYA 2RCUA 3QEVA 3TAEA 3E4WA 1FXXA 3V7DB 4DTMA 2OVPB 3L1NA 4M3ZA 2B7MA 2MMBA 3J2PA 2OZMA 2OZSA 4KHNA 3C6OB 4FK0A 4JS5A 2QXFA 3NHGA 3KD1E 2PFTA 4FK2A 2VIXA 4FJKA 2P5OA 3NE6A 2OVRB 4J2DA 3K2OA 2FW3A 3NGIA 1LDKE 3L0MA 3QETA 5IBKB 3KD5E 4RNGA 4FJMA 1FZ0E 3SUOA 1Q9YA 4RG8A 1FZ4E 4DTXA 2JH9A 2H4TA 3TAFA 4J2BA 4I9LA 1XVCE 3QEIA 3SQ1A 3HL8A 2JHPA 2YB5A 1WAFA 4X5NA 1FZHE 3QESA 4FVMA 1XVFE 3NCIA 1FZ8E 1FZ5E 3QNNA 3SJJA 4RL5A 1MHYG 2P1OB 4GAMC 5IZ7A 1XU3E 4JS4A 3NDKA 1FZ3E 3N1BA 2JH8A 2FYOA 4QNDA 4HCCA 3QEWA 3MKSB 3CFPA 4I9QA 3SUQA 4DTRA 3SQ0A 4I6JB 4M3WA 2DY4A 1FS1A 4M3UA 4ADOA 4FJNA 4M42A 4EPHA 3LZIA 4AI6A 1FZ9E 3HP9A 1XVDE 3UIQA 3SPZA 3LDSA 4AKGA 1P22A 3HGKE 2VJ4A 3CQ8A 1IH7A 1MTYG 3OGMB 4M3TA 3L2OB 4DTUA 4DTOA 3LDBA 4JRQA 4QNCA 4J2AA 4M3XA 1XVEE 1XMGE 1XU5E 1FZIE 3RMBA 2DTUA 5IREA 4DTNA 3LZJA 4HCBA 2JHAA 1FYZE 1NEXB 3C94A 1CLQA 3SI6A 3QNOA 3QEXA 2P1PB 3WSOA 2OYQA 2JPNA 1FZ2E 4KI6A 1WAJA 3E4YA 4EYWA 2PFVA 4KHYA 4B08A 3SQ4A 4FJJA 2ATQA 3SUNA 4AKHA 2VJ5A 2E32A 3NAEA 2P1NB 4M45A 4EP9A 3C6NB 3CFRA 3LD8A 3RMAA 1MMOG 1IG9A 1Q9XA 2LF6A 3OGKB 4DTSA 4M3YA 3SVIA 3RMDA 4DTPA 2B1EA 4FJXA 4E3SA 4E4BA 3SCXA 4FJGA 4FK4A 4FJ5A 2B8IA 1XVBE 2OVQB 4KHQA 4AKIA 3CFOA 4X5MA 4J2EA 4KHSA 3QERA 2MZWB 4KHWA 3C95A 3SQ2A 4JRPA 2JHCA 2LF3A 4DTJA 3RWUA 3RMCA 1MHZG 5H37A 2P1MB 4FJLA 1XMHE 2P5GA 3TABA 2DEBA 4DU4A 1XVGE 4ADNA 3TL8B 4M41A 4FJ7A 4DU1A 4FJ9A 3QEPA 2P1QB 3C6PB 4FJHA 3SUPA 3J27A 3HGLA 3TAGA 3SPYA 1FZ6E 3N1EA 4DU3A 4FJIA 2HD0A 4FJ8A 3OGLB 3SNNA 3L8BA 1XMFE 3S9HA 1FZ1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ7 E;  1XVF E;  1XVE E;  1XMG E;  1XU5 E;  1FZI E;  1FZ8 E;  1XVB E;  1FZ5 E;  1MHY G;  4GAM C;  1FYZ E;  1XU3 E;  1FZ3 E;  1MHZ G;  1XVC E;  1XMH E;  1FZ2 E;  1XVG E;  1FZ9 E;  1XVD E;  1FZ0 E;  1FZ6 E;  1MMO G;  1FZ4 E;  1MTY G;  1XMF E;  1FZ1 E;  1FZH E; 
#chains in the Genus database with same CATH topology
 4M3R A;  1XL3 C;  1FZ7 E;  4KI4 A;  4KHU A;  2E31 A;  3TJY A;  2RCU A;  3QEV A;  3TAE A;  3E4W A;  1FXX A;  3V7D B;  4DTM A;  2OVP B;  3L1N A;  1JW2 A;  4M3Z A;  2B7M A;  2MMB A;  3J2P A;  2OZM A;  2OZS A;  2K5S A;  4KHN A;  3C6O B;  4FK0 A;  4JS5 A;  2QXF A;  3NHG A;  3KD1 E;  2PFT A;  4FK2 A;  2VIX A;  4FJK A;  2P5O A;  3NE6 A;  2OVR B;  4J2D A;  3K2O A;  2FW3 A;  2JQT A;  3NGI A;  1LDK E;  3L0M A;  3QET A;  5IBK B;  3KD5 E;  4RNG A;  4FJM A;  1FZ0 E;  3SUO A;  1Q9Y A;  1FPO A;  4RG8 A;  1FZ4 E;  4DTX A;  2JH9 A;  2H4T A;  3TAF A;  4J2B A;  4I9L A;  1XVC E;  3QEI A;  3SQ1 A;  3HL8 A;  2JHP A;  2YB5 A;  1WAF A;  4X5N A;  1FZH E;  3QES A;  4FVM A;  1XVF E;  3NCI A;  1FZ8 E;  1FZ5 E;  1N1C A;  3QNN A;  3SJJ A;  4RL5 A;  1MHY G;  2P1O B;  4GAM C;  5IZ7 A;  1XU3 E;  4JS4 A;  3NDK A;  1FZ3 E;  3N1B A;  2JH8 A;  2FYO A;  2MW2 A;  4QND A;  3QEW A;  4HCC A;  3MKS B;  3CFP A;  4I9Q A;  3SUQ A;  4DTR A;  3SQ0 A;  4I6J B;  4M3W A;  2DY4 A;  1FS1 A;  4M3U A;  4ADO A;  4FJN A;  4M42 A;  4EPH A;  3LZI A;  4AI6 A;  1FZ9 E;  3HP9 A;  1XVD E;  3UIQ A;  3SPZ A;  4ICG C;  3LDS A;  1P22 A;  4AKG A;  3HGK E;  2VJ4 A;  3CQ8 A;  1IH7 A;  1MTY G;  3OGM B;  4M3T A;  3L2O B;  4DTU A;  4DTO A;  3LDB A;  4JRQ A;  4QNC A;  4J2A A;  4M3X A;  1XVE E;  1XMG E;  1XU5 E;  1FZI E;  3RMB A;  2DTU A;  5IRE A;  4DTN A;  3LZJ A;  4HCB A;  2JHA A;  1FYZ E;  1NEX B;  3C94 A;  1CLQ A;  3SI6 A;  3QNO A;  3QEX A;  2P1P B;  3WSO A;  3BVO A;  2OYQ A;  2JPN A;  1FZ2 E;  4KI6 A;  1WAJ A;  3E4Y A;  4EYW A;  2PFV A;  4KHY A;  4B08 A;  3SQ4 A;  4FJJ A;  2ATQ A;  3SUN A;  4AKH A;  2VJ5 A;  2E32 A;  3NAE A;  2P1N B;  4M45 A;  3UO2 A;  4EP9 A;  3C6N B;  3CFR A;  3LD8 A;  3RMA A;  1MMO G;  1IG9 A;  1Q9X A;  2LF6 A;  3OGK B;  4DTS A;  4M3Y A;  3SVI A;  3RMD A;  4DTP A;  2B1E A;  4FJX A;  4E3S A;  4E4B A;  3SCX A;  4FJG A;  4FK4 A;  4FJ5 A;  2B8I A;  1XVB E;  2OVQ B;  4KHQ A;  4AKI A;  3CFO A;  4X5M A;  4J2E A;  4KHS A;  3QER A;  2MZW B;  4KHW A;  3C95 A;  3SQ2 A;  4JRP A;  2JHC A;  2LF3 A;  4DTJ A;  3RWU A;  3RMC A;  1MHZ G;  5H37 A;  2P1M B;  3UO3 A;  4FJL A;  1XMH E;  2P5G A;  3TAB A;  2DEB A;  4DU4 A;  4IT5 A;  1XVG E;  4ADN A;  3TL8 B;  4M41 A;  4FJ7 A;  4DU1 A;  4FJ9 A;  3QEP A;  2P1Q B;  3C6P B;  4FJH A;  3SUP A;  3J27 A;  3HGL A;  3TAG A;  3SPY A;  1FZ6 E;  3N1E A;  4DU3 A;  4FJI A;  2HD0 A;  4FJ8 A;  3OGL B;  2RKH A;  3SNN A;  3L8B A;  1XMF E;  3S9H A;  1FZ1 E; 
#chains in the Genus database with same CATH homology
 4M3R A;  1XL3 C;  1FZ7 E;  4KI4 A;  4KHU A;  2E31 A;  3TJY A;  2RCU A;  3QEV A;  3TAE A;  3E4W A;  1FXX A;  3V7D B;  4DTM A;  2OVP B;  3L1N A;  4M3Z A;  2B7M A;  2MMB A;  3J2P A;  2OZM A;  2OZS A;  4KHN A;  3C6O B;  4FK0 A;  4JS5 A;  2QXF A;  3NHG A;  3KD1 E;  2PFT A;  4FK2 A;  2VIX A;  4FJK A;  2P5O A;  3NE6 A;  2OVR B;  4J2D A;  3K2O A;  2FW3 A;  3NGI A;  1LDK E;  3L0M A;  3QET A;  5IBK B;  3KD5 E;  4RNG A;  4FJM A;  1FZ0 E;  3SUO A;  1Q9Y A;  4RG8 A;  1FZ4 E;  4DTX A;  2JH9 A;  2H4T A;  3TAF A;  4J2B A;  4I9L A;  1XVC E;  3QEI A;  3SQ1 A;  3HL8 A;  2JHP A;  2YB5 A;  1WAF A;  4X5N A;  1FZH E;  3QES A;  4FVM A;  1XVF E;  3NCI A;  1FZ8 E;  1FZ5 E;  3QNN A;  3SJJ A;  4RL5 A;  1MHY G;  2P1O B;  4GAM C;  5IZ7 A;  1XU3 E;  4JS4 A;  3NDK A;  1FZ3 E;  3N1B A;  2JH8 A;  2FYO A;  4QND A;  4HCC A;  3QEW A;  3MKS B;  3CFP A;  4I9Q A;  3SUQ A;  4DTR A;  3SQ0 A;  4I6J B;  4M3W A;  2DY4 A;  1FS1 A;  4M3U A;  4ADO A;  4FJN A;  4M42 A;  4EPH A;  3LZI A;  4AI6 A;  1FZ9 E;  3HP9 A;  1XVD E;  3UIQ A;  3SPZ A;  3LDS A;  4AKG A;  1P22 A;  3HGK E;  2VJ4 A;  3CQ8 A;  1IH7 A;  1MTY G;  3OGM B;  4M3T A;  3L2O B;  4DTU A;  4DTO A;  3LDB A;  4JRQ A;  4QNC A;  4J2A A;  4M3X A;  1XVE E;  1XMG E;  1XU5 E;  1FZI E;  3RMB A;  2DTU A;  5IRE A;  4DTN A;  3LZJ A;  4HCB A;  2JHA A;  1FYZ E;  1NEX B;  3C94 A;  1CLQ A;  3SI6 A;  3QNO A;  3QEX A;  2P1P B;  3WSO A;  2OYQ A;  2JPN A;  1FZ2 E;  4KI6 A;  1WAJ A;  3E4Y A;  4EYW A;  2PFV A;  4KHY A;  4B08 A;  3SQ4 A;  4FJJ A;  2ATQ A;  3SUN A;  4AKH A;  2VJ5 A;  2E32 A;  3NAE A;  2P1N B;  4M45 A;  4EP9 A;  3C6N B;  3CFR A;  3LD8 A;  3RMA A;  1MMO G;  1IG9 A;  1Q9X A;  2LF6 A;  3OGK B;  4DTS A;  4M3Y A;  3SVI A;  3RMD A;  4DTP A;  2B1E A;  4FJX A;  4E3S A;  4E4B A;  3SCX A;  4FJG A;  4FK4 A;  4FJ5 A;  2B8I A;  1XVB E;  2OVQ B;  4KHQ A;  4AKI A;  3CFO A;  4X5M A;  4J2E A;  4KHS A;  3QER A;  2MZW B;  4KHW A;  3C95 A;  3SQ2 A;  4JRP A;  2JHC A;  2LF3 A;  4DTJ A;  3RWU A;  3RMC A;  1MHZ G;  5H37 A;  2P1M B;  4FJL A;  1XMH E;  2P5G A;  3TAB A;  2DEB A;  4DU4 A;  1XVG E;  4ADN A;  3TL8 B;  4M41 A;  4FJ7 A;  4DU1 A;  4FJ9 A;  3QEP A;  2P1Q B;  3C6P B;  4FJH A;  3SUP A;  3J27 A;  3HGL A;  3TAG A;  3SPY A;  1FZ6 E;  3N1E A;  4DU3 A;  4FJI A;  2HD0 A;  4FJ8 A;  3OGL B;  3SNN A;  3L8B A;  1XMF E;  3S9H A;  1FZ1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...