1XU3E

Soluble methane monooxygenase hydroxylase-soaked with bromophenol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xu3E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xu3E02
1FZ8E 1XVBE 1XMFE 1XVEE 1XVDE 1XMGE 1XU3E 1XVFE 1FZ3E 1FZ2E 1MMOG 1FZ6E 1MHZG 1MHYG 1FZ1E 4GAMC 1FZ4E 1XU5E 1XMHE 1XVCE 1MTYG 1FZIE 1FZ0E 1FZ7E 1FZ5E 1FYZE 1FZ9E 1XVGE 1FZHE
chains in the Genus database with same CATH superfamily
4FJNA 1N1CA 1FZ8E 2P1MB 2VIXA 4JS4A 1P22A 3C95A 3QEPA 2P1QB 4M3UA 2VJ4A 4DU4A 3NDKA 4JRPA 4FJ8A 2RCUA 1LDKE 4KI6A 3CFRA 4KHWA 4DTSA 3SUPA 4ADOA 4AKIA 4B08A 3LDBA 1NEXB 2QXFA 3TAEA 3SUQA 4HCBA 4J2AA 3UIQA 4AI6A 2E31A 1MMOG 1FZ4E 1XU5E 3RMAA 1XVCE 1FPOA 1FZ0E 1FZ7E 1Q9YA 3SQ1A 2JPNA 4ICGC 4DTNA 1WAFA 2DY4A 2H4TA 4KHQA 3CFPA 4FJMA 4M3ZA 3NAEA 4M3WA 4M3RA 3RMBA 4FK2A 2DTUA 4DTPA 2JQTA 3CFOA 3K2OA 2MMBA 4KI4A 2FW3A 4JS5A 4FJIA 2DEBA 3UO3A 1XMGE 3KD5E 1XU3E 4FK0A 4QNDA 4EPHA 3NCIA 4DU1A 3RWUA 2RKHA 4M45A 4FJKA 4M3YA 2LF6A 1FZ3E 2LF3A 3BVOA 4IT5A 2MW2A 3SQ2A 4DTOA 2K5SA 1MHYG 4GAMC 3NHGA 4HCCA 3E4WA 3N1EA 2B7MA 1XMHE 3C6NB 3HGKE 2JH8A 4RL5A 3L2OB 3TJYA 3QERA 1IG9A 4FJHA 4DU3A 3SPZA 4J2BA 3QESA 4I6JB 3CQ8A 4M42A 4JRQA 3MKSB 4E3SA 4FJGA 1FZ5E 2JHPA 3LZJA 1FZ9E 1IH7A 3SPYA 3S9HA 2MZWB 3OGKB 1WAJA 3SNNA 3SUOA 3SCXA 4X5NA 4DTXA 1XMFE 4KHSA 4AKHA 1XVDE 4KHNA 4EP9A 4DTRA 3QETA 3C6OB 3RMDA 5IBKB 4FJ5A 1FXXA 3HGLA 2OYQA 1CLQA 2OZSA 4E4BA 3QNNA 4I9LA 3SJJA 1FZ2E 4FJJA 1FZ6E 1MHZG 3L1NA 5IZ7A 4RG8A 3QEIA 1FZ1E 5H37A 3SUNA 3TL8B 2FYOA 3HL8A 3LD8A 2PFTA 3LDSA 2JHCA 3QEWA 3TAFA 2P5OA 3C6PB 3TAGA 4RNGA 4X5MA 3OGLB 3UO2A 4I9QA 3SI6A 2P1NB 1FYZE 2PFVA 2OZMA 1JW2A 2B1EA 3NE6A 2YB5A 4DTJA 1FZHE 3HP9A 5IREA 4DTMA 4FJXA 1XVBE 3LZIA 3KD1E 4M41A 1XVEE 3L0MA 3QNOA 2JHAA 4ADNA 3QEVA 4EYWA 3QEXA 3SQ4A 4M3XA 3NGIA 3L8BA 3TABA 2P5GA 2VJ5A 3N1BA 2OVRB 3SQ0A 4FJ7A 1Q9XA 1XVFE 2E32A 2JH9A 3C94A 2OVQB 4FJLA 4FK4A 4AKGA 3SVIA 2OVPB 3J2PA 1FS1A 2B8IA 4KHUA 3E4YA 1XL3C 2HD0A 1MTYG 4FVMA 2P1PB 3OGMB 1FZIE 4J2EA 4J2DA 3WSOA 4QNCA 4KHYA 2ATQA 3RMCA 4FJ9A 2P1OB 3V7DB 4DTUA 4M3TA 3J27A 1XVGE
chains in the Genus database with same CATH topology
4FJNA 2P1MB 1FZ8E 2VIXA 4JS4A 4M3UA 1P22A 3C95A 3QEPA 2P1QB 2VJ4A 4DU4A 3NDKA 4JRPA 4FJ8A 2RCUA 1LDKE 4KI6A 3CFRA 4KHWA 4DTSA 3SUPA 4ADOA 4AKIA 4B08A 3LDBA 1NEXB 2QXFA 3TAEA 3SUQA 4HCBA 4J2AA 3UIQA 4AI6A 2E31A 1MMOG 1FZ4E 1XU5E 3RMAA 1XVCE 1FZ0E 1FZ7E 1Q9YA 3SQ1A 2JPNA 4DTNA 1WAFA 2DY4A 2H4TA 4KHQA 3CFPA 4FJMA 4M3ZA 3NAEA 4M3WA 4M3RA 3RMBA 4FK2A 2DTUA 4DTPA 3CFOA 3K2OA 2MMBA 4KI4A 2FW3A 4JS5A 4FJIA 2DEBA 1XMGE 3KD5E 1XU3E 4FK0A 4QNDA 4EPHA 3NCIA 4DU1A 3RWUA 4FJKA 4M45A 4M3YA 2LF6A 1FZ3E 2LF3A 3SQ2A 4DTOA 1MHYG 4GAMC 3NHGA 4HCCA 3E4WA 3N1EA 2B7MA 1XMHE 3C6NB 3HGKE 2JH8A 4RL5A 3L2OB 3TJYA 3QERA 1IG9A 4FJHA 4DU3A 3SPZA 4J2BA 3QESA 4I6JB 3CQ8A 4M42A 4JRQA 3MKSB 4E3SA 4FJGA 1FZ5E 2JHPA 3LZJA 1FZ9E 1IH7A 3SPYA 3S9HA 2MZWB 3OGKB 1WAJA 3SNNA 3SUOA 3SCXA 4X5NA 4DTXA 1XMFE 4KHSA 4AKHA 1XVDE 4KHNA 4EP9A 4DTRA 3QETA 3C6OB 3RMDA 5IBKB 4FJ5A 1FXXA 3HGLA 2OYQA 1CLQA 2OZSA 4E4BA 3QNNA 4I9LA 3SJJA 1FZ2E 4FJJA 1FZ6E 1MHZG 3L1NA 5IZ7A 4RG8A 3QEIA 1FZ1E 5H37A 3SUNA 3TL8B 2FYOA 3HL8A 3LD8A 2PFTA 3LDSA 2JHCA 3QEWA 3TAFA 2P5OA 3C6PB 3TAGA 4RNGA 4X5MA 3OGLB 4I9QA 3SI6A 2P1NB 1FYZE 2PFVA 2OZMA 2B1EA 3NE6A 2YB5A 4DTJA 1FZHE 3HP9A 5IREA 4DTMA 4FJXA 1XVBE 3LZIA 3KD1E 4M41A 1XVEE 3L0MA 3QNOA 2JHAA 4ADNA 3QEVA 4EYWA 3QEXA 3SQ4A 4M3XA 3NGIA 3L8BA 3TABA 2P5GA 2VJ5A 3N1BA 2OVRB 3SQ0A 4FJ7A 1Q9XA 1XVFE 2E32A 2JH9A 3C94A 2OVQB 4FJLA 4FK4A 4AKGA 3SVIA 2OVPB 3J2PA 1FS1A 2B8IA 4KHUA 3E4YA 1XL3C 2HD0A 1MTYG 4FVMA 2P1PB 3OGMB 1FZIE 4J2EA 4J2DA 3WSOA 4QNCA 4KHYA 2ATQA 3RMCA 4FJ9A 2P1OB 3V7DB 4DTUA 4M3TA 3J27A 1XVGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ8 E;  1XVB E;  1XMF E;  1XVE E;  1XVD E;  1XMG E;  1XU3 E;  1XVF E;  1FZ3 E;  1FZ2 E;  1MMO G;  1FZ6 E;  1MHZ G;  1MHY G;  1FZ1 E;  4GAM C;  1FZ4 E;  1XU5 E;  1XMH E;  1XVC E;  1MTY G;  1FZI E;  1FZ0 E;  1FZ7 E;  1FZ5 E;  1FYZ E;  1FZ9 E;  1XVG E;  1FZH E; 
#chains in the Genus database with same CATH topology
 4FJN A;  1N1C A;  1FZ8 E;  2P1M B;  2VIX A;  4JS4 A;  1P22 A;  3C95 A;  3QEP A;  2P1Q B;  4M3U A;  2VJ4 A;  4DU4 A;  3NDK A;  4JRP A;  4FJ8 A;  2RCU A;  1LDK E;  4KI6 A;  3CFR A;  4KHW A;  4DTS A;  3SUP A;  4ADO A;  4AKI A;  4B08 A;  3LDB A;  1NEX B;  2QXF A;  3TAE A;  3SUQ A;  4HCB A;  4J2A A;  3UIQ A;  4AI6 A;  2E31 A;  1MMO G;  1FZ4 E;  1XU5 E;  3RMA A;  1XVC E;  1FPO A;  1FZ0 E;  1FZ7 E;  1Q9Y A;  3SQ1 A;  2JPN A;  4ICG C;  4DTN A;  1WAF A;  2DY4 A;  2H4T A;  4KHQ A;  3CFP A;  4FJM A;  4M3Z A;  3NAE A;  4M3W A;  4M3R A;  3RMB A;  4FK2 A;  2DTU A;  4DTP A;  2JQT A;  3CFO A;  3K2O A;  2MMB A;  4KI4 A;  2FW3 A;  4JS5 A;  4FJI A;  2DEB A;  3UO3 A;  1XMG E;  3KD5 E;  1XU3 E;  4FK0 A;  4QND A;  4EPH A;  3NCI A;  4DU1 A;  3RWU A;  2RKH A;  4M45 A;  4FJK A;  4M3Y A;  2LF6 A;  1FZ3 E;  2LF3 A;  3BVO A;  4IT5 A;  2MW2 A;  3SQ2 A;  4DTO A;  2K5S A;  1MHY G;  4GAM C;  3NHG A;  4HCC A;  3E4W A;  3N1E A;  2B7M A;  1XMH E;  3C6N B;  3HGK E;  2JH8 A;  4RL5 A;  3L2O B;  3TJY A;  3QER A;  1IG9 A;  4FJH A;  4DU3 A;  3SPZ A;  4J2B A;  3QES A;  4I6J B;  3CQ8 A;  4M42 A;  4JRQ A;  3MKS B;  4E3S A;  4FJG A;  1FZ5 E;  2JHP A;  3LZJ A;  1FZ9 E;  1IH7 A;  3SPY A;  3S9H A;  2MZW B;  3OGK B;  1WAJ A;  3SNN A;  3SUO A;  3SCX A;  4X5N A;  4DTX A;  1XMF E;  4KHS A;  4AKH A;  1XVD E;  4KHN A;  4EP9 A;  4DTR A;  3QET A;  3C6O B;  3RMD A;  5IBK B;  4FJ5 A;  1FXX A;  3HGL A;  2OYQ A;  1CLQ A;  2OZS A;  4E4B A;  3QNN A;  4I9L A;  3SJJ A;  1FZ2 E;  4FJJ A;  1FZ6 E;  1MHZ G;  3L1N A;  5IZ7 A;  4RG8 A;  3QEI A;  1FZ1 E;  5H37 A;  3SUN A;  3TL8 B;  2FYO A;  3HL8 A;  3LD8 A;  2PFT A;  3LDS A;  2JHC A;  3QEW A;  3TAF A;  2P5O A;  3C6P B;  3TAG A;  4RNG A;  4X5M A;  3OGL B;  3UO2 A;  4I9Q A;  3SI6 A;  2P1N B;  1FYZ E;  2PFV A;  2OZM A;  1JW2 A;  2B1E A;  3NE6 A;  2YB5 A;  4DTJ A;  1FZH E;  3HP9 A;  5IRE A;  4DTM A;  4FJX A;  1XVB E;  3LZI A;  3KD1 E;  4M41 A;  1XVE E;  3L0M A;  3QNO A;  2JHA A;  4ADN A;  3QEV A;  4EYW A;  3QEX A;  3SQ4 A;  4M3X A;  3NGI A;  3L8B A;  3TAB A;  2P5G A;  2VJ5 A;  3N1B A;  2OVR B;  3SQ0 A;  4FJ7 A;  1Q9X A;  1XVF E;  2E32 A;  2JH9 A;  3C94 A;  2OVQ B;  4FJL A;  4FK4 A;  4AKG A;  3SVI A;  2OVP B;  3J2P A;  1FS1 A;  2B8I A;  4KHU A;  3E4Y A;  1XL3 C;  2HD0 A;  1MTY G;  4FVM A;  2P1P B;  3OGM B;  1FZI E;  4J2E A;  4J2D A;  3WSO A;  4QNC A;  4KHY A;  2ATQ A;  3RMC A;  4FJ9 A;  2P1O B;  3V7D B;  4DTU A;  4M3T A;  3J27 A;  1XVG E; 
#chains in the Genus database with same CATH homology
 4FJN A;  2P1M B;  1FZ8 E;  2VIX A;  4JS4 A;  4M3U A;  1P22 A;  3C95 A;  3QEP A;  2P1Q B;  2VJ4 A;  4DU4 A;  3NDK A;  4JRP A;  4FJ8 A;  2RCU A;  1LDK E;  4KI6 A;  3CFR A;  4KHW A;  4DTS A;  3SUP A;  4ADO A;  4AKI A;  4B08 A;  3LDB A;  1NEX B;  2QXF A;  3TAE A;  3SUQ A;  4HCB A;  4J2A A;  3UIQ A;  4AI6 A;  2E31 A;  1MMO G;  1FZ4 E;  1XU5 E;  3RMA A;  1XVC E;  1FZ0 E;  1FZ7 E;  1Q9Y A;  3SQ1 A;  2JPN A;  4DTN A;  1WAF A;  2DY4 A;  2H4T A;  4KHQ A;  3CFP A;  4FJM A;  4M3Z A;  3NAE A;  4M3W A;  4M3R A;  3RMB A;  4FK2 A;  2DTU A;  4DTP A;  3CFO A;  3K2O A;  2MMB A;  4KI4 A;  2FW3 A;  4JS5 A;  4FJI A;  2DEB A;  1XMG E;  3KD5 E;  1XU3 E;  4FK0 A;  4QND A;  4EPH A;  3NCI A;  4DU1 A;  3RWU A;  4FJK A;  4M45 A;  4M3Y A;  2LF6 A;  1FZ3 E;  2LF3 A;  3SQ2 A;  4DTO A;  1MHY G;  4GAM C;  3NHG A;  4HCC A;  3E4W A;  3N1E A;  2B7M A;  1XMH E;  3C6N B;  3HGK E;  2JH8 A;  4RL5 A;  3L2O B;  3TJY A;  3QER A;  1IG9 A;  4FJH A;  4DU3 A;  3SPZ A;  4J2B A;  3QES A;  4I6J B;  3CQ8 A;  4M42 A;  4JRQ A;  3MKS B;  4E3S A;  4FJG A;  1FZ5 E;  2JHP A;  3LZJ A;  1FZ9 E;  1IH7 A;  3SPY A;  3S9H A;  2MZW B;  3OGK B;  1WAJ A;  3SNN A;  3SUO A;  3SCX A;  4X5N A;  4DTX A;  1XMF E;  4KHS A;  4AKH A;  1XVD E;  4KHN A;  4EP9 A;  4DTR A;  3QET A;  3C6O B;  3RMD A;  5IBK B;  4FJ5 A;  1FXX A;  3HGL A;  2OYQ A;  1CLQ A;  2OZS A;  4E4B A;  3QNN A;  4I9L A;  3SJJ A;  1FZ2 E;  4FJJ A;  1FZ6 E;  1MHZ G;  3L1N A;  5IZ7 A;  4RG8 A;  3QEI A;  1FZ1 E;  5H37 A;  3SUN A;  3TL8 B;  2FYO A;  3HL8 A;  3LD8 A;  2PFT A;  3LDS A;  2JHC A;  3QEW A;  3TAF A;  2P5O A;  3C6P B;  3TAG A;  4RNG A;  4X5M A;  3OGL B;  4I9Q A;  3SI6 A;  2P1N B;  1FYZ E;  2PFV A;  2OZM A;  2B1E A;  3NE6 A;  2YB5 A;  4DTJ A;  1FZH E;  3HP9 A;  5IRE A;  4DTM A;  4FJX A;  1XVB E;  3LZI A;  3KD1 E;  4M41 A;  1XVE E;  3L0M A;  3QNO A;  2JHA A;  4ADN A;  3QEV A;  4EYW A;  3QEX A;  3SQ4 A;  4M3X A;  3NGI A;  3L8B A;  3TAB A;  2P5G A;  2VJ5 A;  3N1B A;  2OVR B;  3SQ0 A;  4FJ7 A;  1Q9X A;  1XVF E;  2E32 A;  2JH9 A;  3C94 A;  2OVQ B;  4FJL A;  4FK4 A;  4AKG A;  3SVI A;  2OVP B;  3J2P A;  1FS1 A;  2B8I A;  4KHU A;  3E4Y A;  1XL3 C;  2HD0 A;  1MTY G;  4FVM A;  2P1P B;  3OGM B;  1FZI E;  4J2E A;  4J2D A;  3WSO A;  4QNC A;  4KHY A;  2ATQ A;  3RMC A;  4FJ9 A;  2P1O B;  3V7D B;  4DTU A;  4M3T A;  3J27 A;  1XVG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...