4X5NA

Crystal structure of semisweet in the inward-open and outward-open conformations
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
91
structure length
91
Chain Sequence
b'DTILLTGLFAAFFTTFAFAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFAVLIANIVTLFLAAPVLVITLINRRKKHVLES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural basis for the facilitative diffusion mechanism by SemiSWEET transporter
pubmed doi rcsb
source organism Escherichia coli umea 3162-1
molecule tags Transport protein
total genus 37
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4x5nA00
4QNCA 4X5NA 4QNDA 4X5MA 4RNGA
chains in the Genus database with same CATH superfamily
4IT5A 2K5SA 3RMBA 3K2OA 3OGLB 2B1EA 4DTMA 4KHWA 3HL8A 4M41A 3UO2A 1MMOG 2P1QB 1XVFE 4FJ8A 1XVBE 4DTSA 4AKGA 3L0MA 4FVMA 1NEXB 1WAJA 5IREA 2YB5A 1FZ0E 3N1EA 2LF6A 1XVCE 4JRPA 4B08A 3TAGA 1FXXA 3J27A 4EYWA 4DTOA 1XU3E 2DEBA 2VIXA 3C6OB 2OZMA 1MHYG 1Q9YA 3CFOA 3E4YA 3KD5E 3SPYA 1FZ2E 1FPOA 4M3TA 3NDKA 2DTUA 2MZWB 3CFRA 3L8BA 2JPNA 2E31A 4EP9A 3SUQA 1FYZE 2ATQA 1XU5E 2VJ4A 3QNNA 2P1OB 3KD1E 4QNCA 2P1PB 4FJGA 3RMDA 1XMGE 3SI6A 4DU1A 3HGKE 3TJYA 3QEPA 3SUNA 1N1CA 2FYOA 1XMFE 2OZSA 2P1MB 4E4BA 4FJNA 4JS5A 3QEIA 4DTXA 3OGMB 4X5MA 2FW3A 1JW2A 3HP9A 3UIQA 2RCUA 1LDKE 3QEVA 3L2OB 4DTUA 3RMAA 4KHQA 1FZ4E 5IBKB 3CFPA 2JHAA 4RNGA 4GAMC 2B7MA 2OVPB 1CLQA 2OVRB 3BVOA 3SJJA 4X5NA 2DY4A 4I9QA 4FJXA 1FZ3E 3C94A 4KHYA 2PFTA 4DU4A 1XVDE 4J2EA 4M3WA 2E32A 3NAEA 3SQ1A 4FJJA 4FJHA 3WSOA 4AKIA 3NCIA 2VJ5A 4FJMA 1IH7A 4FK4A 1XVEE 3N1BA 2HD0A 4J2BA 4FJKA 2MMBA 1XVGE 3TABA 2LF3A 4M3UA 4JRQA 1FZ9E 4DU3A 2H4TA 2JQTA 3S9HA 3QERA 4M3YA 3QEWA 1FZIE 3LDBA 4M3ZA 2P5GA 2MW2A 4HCCA 3J2PA 4DTPA 1FZ1E 1FZHE 3V7DB 2JH8A 2QXFA 4FJ7A 4RG8A 3TAFA 4FJLA 1XMHE 4DTNA 4ADNA 3CQ8A 1WAFA 4ADOA 4FK2A 4M42A 4M45A 3NE6A 2JHCA 4I6JB 3QNOA 3RWUA 3E4WA 3C95A 3SUOA 3TAEA 3LD8A 4E3SA 1FS1A 3OGKB 4AKHA 2PFVA 3QESA 1MHZG 3HGLA 3LZIA 3QETA 4I9LA 4AI6A 1Q9XA 3SUPA 4FJIA 4RL5A 4ICGC 4DTJA 2OVQB 4M3RA 3UO3A 2JHPA 2JH9A 3C6NB 3NHGA 1MTYG 3SNNA 1IG9A 2OYQA 4FJ9A 3NGIA 4KHSA 2RKHA 3L1NA 3QEXA 4HCBA 3RMCA 1FZ7E 4EPHA 3C6PB 3LZJA 5H37A 2P5OA 1FZ6E 3SQ2A 4KI6A 4JS4A 4QNDA 3MKSB 1P22A 4FJ5A 3SPZA 2B8IA 3SCXA 4J2AA 3LDSA 4KI4A 4M3XA 4DTRA 3SQ4A 1XL3C 2P1NB 3SVIA 1FZ8E 4FK0A 1FZ5E 3SQ0A 5IZ7A 4KHNA 4KHUA 4J2DA 3TL8B
chains in the Genus database with same CATH topology
3RMBA 3K2OA 3OGLB 2B1EA 4DTMA 4KHWA 3HL8A 4M41A 1MMOG 2P1QB 1XVFE 4FJ8A 1XVBE 4DTSA 4AKGA 3L0MA 4FVMA 1NEXB 1WAJA 5IREA 2YB5A 1FZ0E 3N1EA 2LF6A 1XVCE 4JRPA 4B08A 3TAGA 1FXXA 3J27A 4EYWA 4DTOA 1XU3E 2DEBA 2VIXA 3C6OB 2OZMA 1MHYG 1Q9YA 3CFOA 3E4YA 3KD5E 3SPYA 1FZ2E 4M3TA 3NDKA 2DTUA 2MZWB 3CFRA 3L8BA 2JPNA 2E31A 4EP9A 3SUQA 1FYZE 2ATQA 1XU5E 2VJ4A 3QNNA 2P1OB 3KD1E 4QNCA 2P1PB 4FJGA 3RMDA 1XMGE 3SI6A 4DU1A 3HGKE 3TJYA 3QEPA 3SUNA 2FYOA 1XMFE 2OZSA 2P1MB 4E4BA 4FJNA 4JS5A 3QEIA 4DTXA 3OGMB 4X5MA 2FW3A 3HP9A 3UIQA 2RCUA 1LDKE 3QEVA 3L2OB 4DTUA 3RMAA 4KHQA 1FZ4E 5IBKB 3CFPA 2JHAA 4RNGA 4GAMC 2B7MA 2OVPB 1CLQA 2OVRB 3SJJA 4X5NA 2DY4A 4I9QA 4FJXA 1FZ3E 3C94A 4KHYA 2PFTA 4DU4A 1XVDE 4J2EA 4M3WA 2E32A 3NAEA 3SQ1A 4FJJA 4FJHA 3WSOA 4AKIA 3NCIA 2VJ5A 4FJMA 1IH7A 4FK4A 1XVEE 3N1BA 2HD0A 4J2BA 4FJKA 2MMBA 1XVGE 3TABA 2LF3A 4M3UA 4JRQA 1FZ9E 4DU3A 2H4TA 3S9HA 3QERA 4M3YA 3QEWA 1FZIE 3LDBA 4M3ZA 2P5GA 4HCCA 3J2PA 4DTPA 1FZ1E 1FZHE 3V7DB 2JH8A 2QXFA 4FJ7A 4RG8A 3TAFA 4FJLA 1XMHE 4DTNA 4ADNA 3CQ8A 1WAFA 4ADOA 4FK2A 4M42A 4M45A 3NE6A 2JHCA 4I6JB 3QNOA 3RWUA 3E4WA 3C95A 3SUOA 3TAEA 3LD8A 4E3SA 1FS1A 3OGKB 4AKHA 2PFVA 3QESA 1MHZG 3HGLA 3LZIA 3QETA 4I9LA 4AI6A 1Q9XA 3SUPA 4FJIA 4RL5A 4DTJA 2OVQB 4M3RA 3SNNA 2JHPA 2JH9A 3C6NB 3NHGA 1MTYG 1IG9A 2OYQA 4FJ9A 3NGIA 4KHSA 3L1NA 3QEXA 4HCBA 3RMCA 1FZ7E 4EPHA 3C6PB 3LZJA 5H37A 2P5OA 1FZ6E 3SQ2A 4KI6A 4JS4A 4QNDA 3MKSB 1P22A 4FJ5A 3SPZA 2B8IA 3SCXA 4J2AA 3LDSA 4KI4A 4M3XA 4DTRA 3SQ4A 1XL3C 2P1NB 3SVIA 1FZ8E 4FK0A 1FZ5E 3SQ0A 5IZ7A 4KHNA 4KHUA 4J2DA 3TL8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNC A;  4X5N A;  4QND A;  4X5M A;  4RNG A; 
#chains in the Genus database with same CATH topology
 4IT5 A;  2K5S A;  3RMB A;  3K2O A;  3OGL B;  2B1E A;  4DTM A;  4KHW A;  3HL8 A;  4M41 A;  3UO2 A;  1MMO G;  2P1Q B;  1XVF E;  4FJ8 A;  1XVB E;  4DTS A;  4AKG A;  3L0M A;  4FVM A;  1NEX B;  1WAJ A;  5IRE A;  2YB5 A;  1FZ0 E;  3N1E A;  2LF6 A;  1XVC E;  4JRP A;  4B08 A;  3TAG A;  1FXX A;  3J27 A;  4EYW A;  4DTO A;  1XU3 E;  2DEB A;  2VIX A;  3C6O B;  2OZM A;  1MHY G;  1Q9Y A;  3CFO A;  3E4Y A;  3KD5 E;  3SPY A;  1FZ2 E;  1FPO A;  4M3T A;  3NDK A;  2DTU A;  2MZW B;  3CFR A;  3L8B A;  2JPN A;  2E31 A;  4EP9 A;  3SUQ A;  1FYZ E;  2ATQ A;  1XU5 E;  2VJ4 A;  3QNN A;  2P1O B;  3KD1 E;  4QNC A;  2P1P B;  4FJG A;  3RMD A;  1XMG E;  3SI6 A;  4DU1 A;  3HGK E;  3TJY A;  3QEP A;  3SUN A;  1N1C A;  2FYO A;  1XMF E;  2OZS A;  2P1M B;  4E4B A;  4FJN A;  4JS5 A;  3QEI A;  4DTX A;  3OGM B;  4X5M A;  2FW3 A;  1JW2 A;  3HP9 A;  3UIQ A;  2RCU A;  1LDK E;  3QEV A;  3L2O B;  4DTU A;  3RMA A;  4KHQ A;  1FZ4 E;  5IBK B;  3CFP A;  2JHA A;  4RNG A;  4GAM C;  2B7M A;  2OVP B;  1CLQ A;  2OVR B;  3BVO A;  3SJJ A;  4X5N A;  2DY4 A;  4I9Q A;  4FJX A;  1FZ3 E;  3C94 A;  4KHY A;  2PFT A;  4DU4 A;  1XVD E;  4J2E A;  4M3W A;  2E32 A;  3NAE A;  3SQ1 A;  4FJJ A;  4FJH A;  3WSO A;  4AKI A;  3NCI A;  2VJ5 A;  4FJM A;  1IH7 A;  4FK4 A;  1XVE E;  3N1B A;  2HD0 A;  4J2B A;  4FJK A;  2MMB A;  1XVG E;  3TAB A;  2LF3 A;  4M3U A;  4JRQ A;  1FZ9 E;  4DU3 A;  2H4T A;  2JQT A;  3S9H A;  3QER A;  4M3Y A;  3QEW A;  1FZI E;  3LDB A;  4M3Z A;  2P5G A;  2MW2 A;  4HCC A;  3J2P A;  4DTP A;  1FZ1 E;  1FZH E;  3V7D B;  2JH8 A;  2QXF A;  4FJ7 A;  4RG8 A;  3TAF A;  4FJL A;  1XMH E;  4DTN A;  4ADN A;  3CQ8 A;  1WAF A;  4ADO A;  4FK2 A;  4M42 A;  4M45 A;  3NE6 A;  2JHC A;  4I6J B;  3QNO A;  3RWU A;  3E4W A;  3C95 A;  3SUO A;  3TAE A;  3LD8 A;  4E3S A;  1FS1 A;  3OGK B;  4AKH A;  2PFV A;  3QES A;  1MHZ G;  3HGL A;  3LZI A;  3QET A;  4I9L A;  4AI6 A;  1Q9X A;  3SUP A;  4FJI A;  4RL5 A;  4ICG C;  4DTJ A;  2OVQ B;  4M3R A;  3UO3 A;  2JHP A;  2JH9 A;  3C6N B;  3NHG A;  1MTY G;  3SNN A;  1IG9 A;  2OYQ A;  4FJ9 A;  3NGI A;  4KHS A;  2RKH A;  3L1N A;  3QEX A;  4HCB A;  3RMC A;  1FZ7 E;  4EPH A;  3C6P B;  3LZJ A;  5H37 A;  2P5O A;  1FZ6 E;  3SQ2 A;  4KI6 A;  4JS4 A;  4QND A;  3MKS B;  1P22 A;  4FJ5 A;  3SPZ A;  2B8I A;  3SCX A;  4J2A A;  3LDS A;  4KI4 A;  4M3X A;  4DTR A;  3SQ4 A;  1XL3 C;  2P1N B;  3SVI A;  1FZ8 E;  4FK0 A;  1FZ5 E;  3SQ0 A;  5IZ7 A;  4KHN A;  4KHU A;  4J2D A;  3TL8 B; 
#chains in the Genus database with same CATH homology
 3RMB A;  3K2O A;  3OGL B;  2B1E A;  4DTM A;  4KHW A;  3HL8 A;  4M41 A;  1MMO G;  2P1Q B;  1XVF E;  4FJ8 A;  1XVB E;  4DTS A;  4AKG A;  3L0M A;  4FVM A;  1NEX B;  1WAJ A;  5IRE A;  2YB5 A;  1FZ0 E;  3N1E A;  2LF6 A;  1XVC E;  4JRP A;  4B08 A;  3TAG A;  1FXX A;  3J27 A;  4EYW A;  4DTO A;  1XU3 E;  2DEB A;  2VIX A;  3C6O B;  2OZM A;  1MHY G;  1Q9Y A;  3CFO A;  3E4Y A;  3KD5 E;  3SPY A;  1FZ2 E;  4M3T A;  3NDK A;  2DTU A;  2MZW B;  3CFR A;  3L8B A;  2JPN A;  2E31 A;  4EP9 A;  3SUQ A;  1FYZ E;  2ATQ A;  1XU5 E;  2VJ4 A;  3QNN A;  2P1O B;  3KD1 E;  4QNC A;  2P1P B;  4FJG A;  3RMD A;  1XMG E;  3SI6 A;  4DU1 A;  3HGK E;  3TJY A;  3QEP A;  3SUN A;  2FYO A;  1XMF E;  2OZS A;  2P1M B;  4E4B A;  4FJN A;  4JS5 A;  3QEI A;  4DTX A;  3OGM B;  4X5M A;  2FW3 A;  3HP9 A;  3UIQ A;  2RCU A;  1LDK E;  3QEV A;  3L2O B;  4DTU A;  3RMA A;  4KHQ A;  1FZ4 E;  5IBK B;  3CFP A;  2JHA A;  4RNG A;  4GAM C;  2B7M A;  2OVP B;  1CLQ A;  2OVR B;  3SJJ A;  4X5N A;  2DY4 A;  4I9Q A;  4FJX A;  1FZ3 E;  3C94 A;  4KHY A;  2PFT A;  4DU4 A;  1XVD E;  4J2E A;  4M3W A;  2E32 A;  3NAE A;  3SQ1 A;  4FJJ A;  4FJH A;  3WSO A;  4AKI A;  3NCI A;  2VJ5 A;  4FJM A;  1IH7 A;  4FK4 A;  1XVE E;  3N1B A;  2HD0 A;  4J2B A;  4FJK A;  2MMB A;  1XVG E;  3TAB A;  2LF3 A;  4M3U A;  4JRQ A;  1FZ9 E;  4DU3 A;  2H4T A;  3S9H A;  3QER A;  4M3Y A;  3QEW A;  1FZI E;  3LDB A;  4M3Z A;  2P5G A;  4HCC A;  3J2P A;  4DTP A;  1FZ1 E;  1FZH E;  3V7D B;  2JH8 A;  2QXF A;  4FJ7 A;  4RG8 A;  3TAF A;  4FJL A;  1XMH E;  4DTN A;  4ADN A;  3CQ8 A;  1WAF A;  4ADO A;  4FK2 A;  4M42 A;  4M45 A;  3NE6 A;  2JHC A;  4I6J B;  3QNO A;  3RWU A;  3E4W A;  3C95 A;  3SUO A;  3TAE A;  3LD8 A;  4E3S A;  1FS1 A;  3OGK B;  4AKH A;  2PFV A;  3QES A;  1MHZ G;  3HGL A;  3LZI A;  3QET A;  4I9L A;  4AI6 A;  1Q9X A;  3SUP A;  4FJI A;  4RL5 A;  4DTJ A;  2OVQ B;  4M3R A;  3SNN A;  2JHP A;  2JH9 A;  3C6N B;  3NHG A;  1MTY G;  1IG9 A;  2OYQ A;  4FJ9 A;  3NGI A;  4KHS A;  3L1N A;  3QEX A;  4HCB A;  3RMC A;  1FZ7 E;  4EPH A;  3C6P B;  3LZJ A;  5H37 A;  2P5O A;  1FZ6 E;  3SQ2 A;  4KI6 A;  4JS4 A;  4QND A;  3MKS B;  1P22 A;  4FJ5 A;  3SPZ A;  2B8I A;  3SCX A;  4J2A A;  3LDS A;  4KI4 A;  4M3X A;  4DTR A;  3SQ4 A;  1XL3 C;  2P1N B;  3SVI A;  1FZ8 E;  4FK0 A;  1FZ5 E;  3SQ0 A;  5IZ7 A;  4KHN A;  4KHU A;  4J2D A;  3TL8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...