4X5NA

Crystal structure of semisweet in the inward-open and outward-open conformations
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
91
structure length
91
Chain Sequence
DTILLTGLFAAFFTTFAFAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFAVLIANIVTLFLAAPVLVITLINRRKKHVLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural basis for the facilitative diffusion mechanism by SemiSWEET transporter
pubmed doi rcsb
source organism Escherichia coli umea 3162-1
molecule tags Transport protein
total genus 37
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4x5nA00
4QNDA 4X5MA 4RNGA 4QNCA 4X5NA
chains in the Genus database with same CATH superfamily
2OVQB 4B08A 3C94A 4I9QA 3NHGA 3SCXA 4M3UA 3SQ1A 1XVCE 2VJ4A 4DU1A 3UIQA 4ADNA 4M3XA 3OGMB 3BVOA 5H37A 4J2AA 4FJ7A 3TAGA 1FXXA 4RNGA 4RG8A 1Q9YA 4KHQA 1FZ9E 4FK0A 3C6OB 3KD1E 3L2OB 4E3SA 3HGKE 4IT5A 2P1OB 4JRQA 1IH7A 4HCBA 4FJKA 1XMFE 3QEXA 2B8IA 3TABA 2RKHA 3C95A 3UO2A 1FZ3E 3HP9A 3NAEA 1MMOG 4KHYA 1FYZE 4AI6A 1FZ2E 4M3ZA 3NGIA 3QNOA 3RMCA 4JRPA 3L1NA 3J2PA 3N1EA 3NDKA 1FZ0E 3E4WA 3QEPA 2HD0A 4X5MA 3OGKB 1FZ1E 2P1MB 2JH9A 3HGLA 4DU4A 1XU3E 2B1EA 1MTYG 4I9LA 4M41A 4M45A 3CFPA 3QEIA 3RMAA 1XVDE 2JQTA 3RMDA 4AKIA 3S9HA 2MW2A 3J27A 4EPHA 3QESA 2P5OA 4M3YA 1MHZG 4FJ9A 4DTUA 2OYQA 2FYOA 1IG9A 2ATQA 2QXFA 4DU3A 4FJ8A 3LD8A 3SQ4A 3SQ2A 3SUNA 2E31A 3SUQA 4FJXA 4DTSA 2E32A 1XU5E 4QNDA 3NCIA 3TJYA 3TL8B 4HCCA 4E4BA 4FJHA 2DTUA 3CQ8A 2DEBA 4DTNA 3MKSB 2JH8A 3CFOA 4DTMA 4KHNA 4JS4A 3SUOA 4KHWA 4KI4A 4J2EA 1XVEE 1FZHE 2OVRB 4FK4A 3LZJA 2RCUA 2P5GA 1N1CA 4M3WA 2JHAA 4X5NA 3QNNA 3LDBA 4ICGC 1FZ8E 1MHYG 2YB5A 2PFTA 4DTPA 4AKGA 2JPNA 3QEWA 4QNCA 5IREA 4FJIA 3SQ0A 3RMBA 2JHPA 4FJNA 3SPZA 4KHSA 4FJGA 3LZIA 1CLQA 2PFVA 1FZ6E 2OZMA 4J2DA 4AKHA 3E4YA 4FJLA 3L0MA 2P1NB 3V7DB 3UO3A 4FVMA 3SVIA 3KD5E 1FZ5E 3QERA 4DTXA 3N1BA 4DTOA 2OVPB 4DTRA 2OZSA 1LDKE 1WAJA 4RL5A 3SNNA 2DY4A 1XL3C 3SUPA 3L8BA 3K2OA 3SPYA 3SI6A 3HL8A 4DTJA 4KI6A 3LDSA 1P22A 1FZ4E 3C6NB 1FZIE 2VJ5A 4ADOA 3NE6A 3OGLB 3TAFA 3SJJA 3C6PB 1WAFA 1NEXB 2H4TA 2FW3A 2LF6A 2LF3A 3RWUA 4JS5A 5IZ7A 3CFRA 4FJJA 3QETA 2B7MA 1FPOA 1XMHE 1XVFE 4EP9A 4M42A 2MMBA 2P1PB 5IBKB 3TAEA 1XVBE 4J2BA 2JHCA 2VIXA 4GAMC 3WSOA 4FJ5A 4KHUA 4M3TA 1FZ7E 1XMGE 1Q9XA 2P1QB 4M3RA 1FS1A 4FJMA 2K5SA 2MZWB 3QEVA 4I6JB 4FK2A 4EYWA 1XVGE 1JW2A
chains in the Genus database with same CATH topology
2OVQB 4B08A 3C94A 4I9QA 3NHGA 3SCXA 4M3UA 3SQ1A 1XVCE 2VJ4A 4DU1A 3UIQA 4ADNA 4M3XA 3OGMB 5H37A 4J2AA 4FJ7A 3TAGA 1FXXA 4RNGA 4RG8A 1Q9YA 4KHQA 1FZ9E 4FK0A 3C6OB 3KD1E 3L2OB 4E3SA 3HGKE 2P1OB 4JRQA 1IH7A 4HCBA 4FJKA 1XMFE 3QEXA 2B8IA 3TABA 3C95A 1FZ3E 3HP9A 3NAEA 1MMOG 4KHYA 1FYZE 4AI6A 1FZ2E 4M3ZA 3NGIA 3QNOA 3RMCA 4JRPA 3L1NA 3J2PA 3N1EA 3NDKA 1FZ0E 3E4WA 3QEPA 2HD0A 4X5MA 3OGKB 1FZ1E 2P1MB 2JH9A 3HGLA 4DU4A 1XU3E 2B1EA 1MTYG 4I9LA 4M41A 4M45A 3CFPA 3QEIA 3RMAA 1XVDE 3RMDA 4AKIA 3S9HA 3J27A 4EPHA 3QESA 2P5OA 4M3YA 1MHZG 4FJ9A 4DTUA 2OYQA 2FYOA 1IG9A 2ATQA 2QXFA 4DU3A 4FJ8A 3LD8A 3SQ4A 3SQ2A 3SUNA 2E31A 3SUQA 4FJXA 4DTSA 2E32A 1XU5E 4QNDA 3NCIA 3TJYA 3TL8B 4HCCA 4E4BA 4FJHA 2DTUA 3CQ8A 2DEBA 4DTNA 3MKSB 2JH8A 3CFOA 4DTMA 4KHNA 4JS4A 3SUOA 4KHWA 4KI4A 4J2EA 1XVEE 1FZHE 2OVRB 4FK4A 3LZJA 2RCUA 2P5GA 4M3WA 2JHAA 4X5NA 3QNNA 3LDBA 4AKGA 1FZ8E 1MHYG 2YB5A 2PFTA 4DTPA 2JPNA 3QEWA 4QNCA 5IREA 4FJIA 3SQ0A 3RMBA 2JHPA 4FJNA 3SPZA 4KHSA 4FJGA 3LZIA 1CLQA 2PFVA 1FZ6E 2OZMA 4J2DA 4AKHA 3E4YA 4FJLA 3L0MA 2P1NB 3V7DB 3SVIA 4FVMA 3KD5E 1FZ5E 3QERA 4DTXA 3N1BA 4DTOA 2OVPB 4DTRA 2OZSA 1LDKE 1WAJA 4RL5A 3SNNA 2DY4A 1XL3C 3SUPA 3L8BA 3K2OA 3SPYA 3SI6A 3HL8A 4DTJA 4KI6A 3LDSA 1P22A 1FZ4E 3C6NB 1FZIE 2VJ5A 4ADOA 3NE6A 3OGLB 3TAFA 3SJJA 3C6PB 1WAFA 1NEXB 2H4TA 2FW3A 2LF6A 2LF3A 3RWUA 4JS5A 5IZ7A 3CFRA 4FJJA 3QETA 2B7MA 1XMHE 1XVFE 4EP9A 4M42A 2MMBA 2P1PB 5IBKB 3TAEA 1XVBE 4J2BA 2JHCA 2VIXA 4GAMC 3WSOA 4FJ5A 4KHUA 4M3TA 1FZ7E 1XMGE 1Q9XA 2P1QB 4M3RA 1FS1A 4FJMA 2MZWB 3QEVA 4I6JB 4FK2A 4EYWA 1XVGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QND A;  4X5M A;  4RNG A;  4QNC A;  4X5N A; 
#chains in the Genus database with same CATH topology
 2OVQ B;  4B08 A;  3C94 A;  4I9Q A;  3NHG A;  3SCX A;  4M3U A;  3SQ1 A;  1XVC E;  2VJ4 A;  4DU1 A;  3UIQ A;  4ADN A;  4M3X A;  3OGM B;  3BVO A;  5H37 A;  4J2A A;  4FJ7 A;  3TAG A;  1FXX A;  4RNG A;  4RG8 A;  1Q9Y A;  4KHQ A;  1FZ9 E;  4FK0 A;  3C6O B;  3KD1 E;  3L2O B;  4E3S A;  3HGK E;  4IT5 A;  2P1O B;  4JRQ A;  1IH7 A;  4HCB A;  4FJK A;  1XMF E;  3QEX A;  2B8I A;  3TAB A;  2RKH A;  3C95 A;  3UO2 A;  1FZ3 E;  3HP9 A;  3NAE A;  1MMO G;  4KHY A;  1FYZ E;  4AI6 A;  1FZ2 E;  4M3Z A;  3NGI A;  3QNO A;  3RMC A;  4JRP A;  3L1N A;  3J2P A;  3N1E A;  3NDK A;  1FZ0 E;  3E4W A;  3QEP A;  2HD0 A;  4X5M A;  3OGK B;  1FZ1 E;  2P1M B;  2JH9 A;  3HGL A;  4DU4 A;  1XU3 E;  2B1E A;  1MTY G;  4I9L A;  4M41 A;  4M45 A;  3CFP A;  3QEI A;  3RMA A;  1XVD E;  2JQT A;  3RMD A;  4AKI A;  3S9H A;  2MW2 A;  3J27 A;  4EPH A;  3QES A;  2P5O A;  4M3Y A;  1MHZ G;  4FJ9 A;  4DTU A;  2OYQ A;  2FYO A;  1IG9 A;  2ATQ A;  2QXF A;  4DU3 A;  4FJ8 A;  3LD8 A;  3SQ4 A;  3SQ2 A;  3SUN A;  2E31 A;  3SUQ A;  4FJX A;  4DTS A;  2E32 A;  1XU5 E;  4QND A;  3NCI A;  3TJY A;  3TL8 B;  4HCC A;  4E4B A;  4FJH A;  2DTU A;  3CQ8 A;  2DEB A;  4DTN A;  3MKS B;  2JH8 A;  3CFO A;  4DTM A;  4KHN A;  4JS4 A;  3SUO A;  4KHW A;  4KI4 A;  4J2E A;  1XVE E;  1FZH E;  2OVR B;  4FK4 A;  3LZJ A;  2RCU A;  2P5G A;  1N1C A;  4M3W A;  2JHA A;  4X5N A;  3QNN A;  3LDB A;  4ICG C;  1FZ8 E;  1MHY G;  2YB5 A;  2PFT A;  4DTP A;  4AKG A;  2JPN A;  3QEW A;  4QNC A;  5IRE A;  4FJI A;  3SQ0 A;  3RMB A;  2JHP A;  4FJN A;  3SPZ A;  4KHS A;  4FJG A;  3LZI A;  1CLQ A;  2PFV A;  1FZ6 E;  2OZM A;  4J2D A;  4AKH A;  3E4Y A;  4FJL A;  3L0M A;  2P1N B;  3V7D B;  3UO3 A;  4FVM A;  3SVI A;  3KD5 E;  1FZ5 E;  3QER A;  4DTX A;  3N1B A;  4DTO A;  2OVP B;  4DTR A;  2OZS A;  1LDK E;  1WAJ A;  4RL5 A;  3SNN A;  2DY4 A;  1XL3 C;  3SUP A;  3L8B A;  3K2O A;  3SPY A;  3SI6 A;  3HL8 A;  4DTJ A;  4KI6 A;  3LDS A;  1P22 A;  1FZ4 E;  3C6N B;  1FZI E;  2VJ5 A;  4ADO A;  3NE6 A;  3OGL B;  3TAF A;  3SJJ A;  3C6P B;  1WAF A;  1NEX B;  2H4T A;  2FW3 A;  2LF6 A;  2LF3 A;  3RWU A;  4JS5 A;  5IZ7 A;  3CFR A;  4FJJ A;  3QET A;  2B7M A;  1FPO A;  1XMH E;  1XVF E;  4EP9 A;  4M42 A;  2MMB A;  2P1P B;  5IBK B;  3TAE A;  1XVB E;  4J2B A;  2JHC A;  2VIX A;  4GAM C;  3WSO A;  4FJ5 A;  4KHU A;  4M3T A;  1FZ7 E;  1XMG E;  1Q9X A;  2P1Q B;  4M3R A;  1FS1 A;  4FJM A;  2K5S A;  2MZW B;  3QEV A;  4I6J B;  4FK2 A;  4EYW A;  1XVG E;  1JW2 A; 
#chains in the Genus database with same CATH homology
 2OVQ B;  4B08 A;  3C94 A;  4I9Q A;  3NHG A;  3SCX A;  4M3U A;  3SQ1 A;  1XVC E;  2VJ4 A;  4DU1 A;  3UIQ A;  4ADN A;  4M3X A;  3OGM B;  5H37 A;  4J2A A;  4FJ7 A;  3TAG A;  1FXX A;  4RNG A;  4RG8 A;  1Q9Y A;  4KHQ A;  1FZ9 E;  4FK0 A;  3C6O B;  3KD1 E;  3L2O B;  4E3S A;  3HGK E;  2P1O B;  4JRQ A;  1IH7 A;  4HCB A;  4FJK A;  1XMF E;  3QEX A;  2B8I A;  3TAB A;  3C95 A;  1FZ3 E;  3HP9 A;  3NAE A;  1MMO G;  4KHY A;  1FYZ E;  4AI6 A;  1FZ2 E;  4M3Z A;  3NGI A;  3QNO A;  3RMC A;  4JRP A;  3L1N A;  3J2P A;  3N1E A;  3NDK A;  1FZ0 E;  3E4W A;  3QEP A;  2HD0 A;  4X5M A;  3OGK B;  1FZ1 E;  2P1M B;  2JH9 A;  3HGL A;  4DU4 A;  1XU3 E;  2B1E A;  1MTY G;  4I9L A;  4M41 A;  4M45 A;  3CFP A;  3QEI A;  3RMA A;  1XVD E;  3RMD A;  4AKI A;  3S9H A;  3J27 A;  4EPH A;  3QES A;  2P5O A;  4M3Y A;  1MHZ G;  4FJ9 A;  4DTU A;  2OYQ A;  2FYO A;  1IG9 A;  2ATQ A;  2QXF A;  4DU3 A;  4FJ8 A;  3LD8 A;  3SQ4 A;  3SQ2 A;  3SUN A;  2E31 A;  3SUQ A;  4FJX A;  4DTS A;  2E32 A;  1XU5 E;  4QND A;  3NCI A;  3TJY A;  3TL8 B;  4HCC A;  4E4B A;  4FJH A;  2DTU A;  3CQ8 A;  2DEB A;  4DTN A;  3MKS B;  2JH8 A;  3CFO A;  4DTM A;  4KHN A;  4JS4 A;  3SUO A;  4KHW A;  4KI4 A;  4J2E A;  1XVE E;  1FZH E;  2OVR B;  4FK4 A;  3LZJ A;  2RCU A;  2P5G A;  4M3W A;  2JHA A;  4X5N A;  3QNN A;  3LDB A;  4AKG A;  1FZ8 E;  1MHY G;  2YB5 A;  2PFT A;  4DTP A;  2JPN A;  3QEW A;  4QNC A;  5IRE A;  4FJI A;  3SQ0 A;  3RMB A;  2JHP A;  4FJN A;  3SPZ A;  4KHS A;  4FJG A;  3LZI A;  1CLQ A;  2PFV A;  1FZ6 E;  2OZM A;  4J2D A;  4AKH A;  3E4Y A;  4FJL A;  3L0M A;  2P1N B;  3V7D B;  3SVI A;  4FVM A;  3KD5 E;  1FZ5 E;  3QER A;  4DTX A;  3N1B A;  4DTO A;  2OVP B;  4DTR A;  2OZS A;  1LDK E;  1WAJ A;  4RL5 A;  3SNN A;  2DY4 A;  1XL3 C;  3SUP A;  3L8B A;  3K2O A;  3SPY A;  3SI6 A;  3HL8 A;  4DTJ A;  4KI6 A;  3LDS A;  1P22 A;  1FZ4 E;  3C6N B;  1FZI E;  2VJ5 A;  4ADO A;  3NE6 A;  3OGL B;  3TAF A;  3SJJ A;  3C6P B;  1WAF A;  1NEX B;  2H4T A;  2FW3 A;  2LF6 A;  2LF3 A;  3RWU A;  4JS5 A;  5IZ7 A;  3CFR A;  4FJJ A;  3QET A;  2B7M A;  1XMH E;  1XVF E;  4EP9 A;  4M42 A;  2MMB A;  2P1P B;  5IBK B;  3TAE A;  1XVB E;  4J2B A;  2JHC A;  2VIX A;  4GAM C;  3WSO A;  4FJ5 A;  4KHU A;  4M3T A;  1FZ7 E;  1XMG E;  1Q9X A;  2P1Q B;  4M3R A;  1FS1 A;  4FJM A;  2MZW B;  3QEV A;  4I6J B;  4FK2 A;  4EYW A;  1XVG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...