4X5NA

Crystal structure of semisweet in the inward-open and outward-open conformations
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
91
structure length
91
Chain Sequence
DTILLTGLFAAFFTTFAFAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFAVLIANIVTLFLAAPVLVITLINRRKKHVLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Uncharacterized protein
publication title Structural basis for the facilitative diffusion mechanism by SemiSWEET transporter
pubmed doi rcsb
source organism Escherichia coli umea 3162-1
total genus 37
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4x5nA00
4X5NA 4X5MA 4QNCA 4RNGA 4QNDA
chains in the Genus database with same CATH superfamily
4FJJA 1FPOA 2LF6A 3QEXA 4EYWA 4DTJA 3KD5E 4AKHA 3SQ0A 3QEPA 3QESA 3L2OB 4I6JB 3J27A 4KI6A 3E4YA 3HP9A 1FXXA 1XL3C 4JRPA 2E31A 4RG8A 1XMHE 4HCBA 3HGKE 3SJJA 2JPNA 2YB5A 1FZ8E 4FJIA 1FZ7E 3CFOA 4ADOA 4FJGA 4AI6A 1XVGE 2B8IA 3LDBA 4DTPA 2H4TA 4FJMA 3SQ1A 2JHPA 3RMAA 2FYOA 3QERA 1XMGE 2JHCA 3OGMB 4DTNA 4M42A 3RMDA 1FZ2E 2JQTA 5IREA 4IT5A 1MTYG 2P5GA 1FZ4E 3E4WA 4FVMA 4FJ9A 2JHAA 2HD0A 4X5NA 2OVQB 3NE6A 1P22A 1XVCE 2PFVA 3MKSB 4M3WA 4DU3A 2OYQA 4QNDA 4JS5A 3V7DB 1FZ0E 1XVBE 2FW3A 2MZWB 3UO2A 4DTXA 2P1NB 4I9LA 3SQ2A 4ADNA 3QETA 2VIXA 2RKHA 3SUPA 1CLQA 3N1BA 3S9HA 1FZ6E 2DY4A 4FJXA 3TL8B 2OVPB 3TAEA 2B7MA 1FYZE 3LZIA 3CFPA 2DTUA 2B1EA 4FK2A 5IZ7A 4JS4A 2VJ5A 3TAGA 3SQ4A 4DTSA 2P1QB 1WAFA 3SUQA 4ICGC 5H37A 3SPZA 1XU5E 2OVRB 4I9QA 2ATQA 4M41A 3NGIA 3OGLB 4QNCA 3RWUA 3NDKA 1MHZG 3TABA 2K5SA 3OGKB 3L8BA 3CFRA 3LDSA 4M3ZA 4M3RA 4J2BA 4M3UA 1XVEE 2P1MB 2QXFA 4M45A 3UO3A 3C6PB 3NAEA 3QNNA 3SPYA 2OZSA 2DEBA 2E32A 3C6OB 4EPHA 1FZ3E 3SVIA 2JH9A 3TAFA 1FZ1E 1XMFE 3QNOA 1FS1A 4FJ7A 1XVDE 1N1CA 1LDKE 2RCUA 4RNGA 2P1OB 1FZ9E 2VJ4A 3NHGA 4M3YA 4M3XA 4EP9A 1FZIE 4KHYA 1JW2A 4DTOA 4KHUA 3QEWA 3J2PA 1Q9XA 4DU4A 3SNNA 3C95A 3CQ8A 3WSOA 2OZMA 1Q9YA 3N1EA 1WAJA 4J2DA 4FJ8A 4E3SA 2P1PB 4J2AA 3NCIA 3QEIA 3L0MA 4FJNA 3UIQA 3SI6A 3QEVA 3C94A 4FJHA 3SCXA 3RMBA 3BVOA 1NEXB 4KHWA 4GAMC 1MHYG 4AKGA 1MMOG 4B08A 3HL8A 3K2OA 4KHQA 2MW2A 4X5MA 1XVFE 4KHNA 4J2EA 4M3TA 4KI4A 4FJLA 4FJ5A 2LF3A 4RL5A 4DTRA 4KHSA 3SUNA 3C6NB 4DTUA 1IH7A 3LD8A 3SUOA 3RMCA 3TJYA 3HGLA 3KD1E 2JH8A 1IG9A 2MMBA 4HCCA 4E4BA 2P5OA 4FK0A 1FZ5E 4FJKA 1XU3E 2PFTA 5IBKB 3LZJA 4FK4A 4JRQA 4DTMA 4DU1A 4AKIA 1FZHE 3L1NA
chains in the Genus database with same CATH topology
4FJJA 2LF6A 3QEXA 4EYWA 4DTJA 3KD5E 4AKHA 3SQ0A 3QEPA 3QESA 3L2OB 4I6JB 3J27A 4KI6A 3E4YA 3HP9A 1FXXA 1XL3C 4JRPA 2E31A 4RG8A 1XMHE 4HCBA 3HGKE 3SJJA 2JPNA 2YB5A 1FZ8E 4FJIA 1FZ7E 3CFOA 4ADOA 4FJGA 4AI6A 1XVGE 2B8IA 3LDBA 4DTPA 2H4TA 4FJMA 3SQ1A 2JHPA 3RMAA 2FYOA 3QERA 1XMGE 2JHCA 3OGMB 4DTNA 4M42A 3RMDA 1FZ2E 5IREA 1MTYG 2P5GA 1FZ4E 3E4WA 4FVMA 4FJ9A 2JHAA 2HD0A 4X5NA 2OVQB 3NE6A 1P22A 1XVCE 2PFVA 3MKSB 4M3WA 4DU3A 2OYQA 4QNDA 4JS5A 3V7DB 1FZ0E 1XVBE 2FW3A 2MZWB 4DTXA 2P1NB 4I9LA 3SQ2A 4ADNA 3QETA 2VIXA 3SUPA 1CLQA 3N1BA 3S9HA 1FZ6E 2DY4A 4FJXA 3TL8B 2OVPB 3TAEA 2B7MA 1FYZE 3LZIA 3CFPA 2DTUA 2B1EA 4FK2A 5IZ7A 4JS4A 2VJ5A 3TAGA 3SQ4A 4DTSA 2P1QB 1WAFA 3SUQA 4J2BA 5H37A 3SPZA 1XU5E 2OVRB 4I9QA 2ATQA 4M41A 3NGIA 3OGLB 4QNCA 3RWUA 3NDKA 1MHZG 3TABA 4M3ZA 3OGKB 3L8BA 3CFRA 3LDSA 4M3RA 4M3UA 1XVEE 2P1MB 2QXFA 4M45A 3C6PB 3NAEA 3QNNA 3SPYA 2OZSA 2DEBA 2E32A 3C6OB 4EPHA 1FZ3E 3SVIA 2JH9A 3TAFA 1FZ1E 1XMFE 3QNOA 1FS1A 4FJ7A 1XVDE 1LDKE 2RCUA 4RNGA 2P1OB 1FZ9E 2VJ4A 3NHGA 4M3YA 4M3XA 4EP9A 1FZIE 4KHYA 4DTOA 4KHUA 3QEWA 3J2PA 1Q9XA 4DU4A 3SNNA 3C95A 3CQ8A 3WSOA 2OZMA 1Q9YA 3N1EA 1WAJA 4J2DA 4FJ8A 4E3SA 2P1PB 4J2AA 3NCIA 3QEIA 3L0MA 4FJNA 3UIQA 3SI6A 3QEVA 3C94A 4FJHA 3SCXA 3RMBA 1NEXB 4KHWA 4GAMC 1MHYG 4AKGA 1MMOG 4B08A 3HL8A 3K2OA 4KHQA 4X5MA 4KHNA 1XVFE 4J2EA 4M3TA 4KI4A 4FJLA 4FJ5A 2LF3A 4RL5A 4DTRA 4KHSA 3SUNA 3C6NB 4DTUA 1IH7A 3LD8A 3SUOA 3RMCA 3TJYA 3HGLA 3KD1E 2JH8A 1IG9A 2MMBA 4HCCA 4E4BA 2P5OA 4FK0A 1FZ5E 4FJKA 1XU3E 2PFTA 5IBKB 3LZJA 4FK4A 4JRQA 4DTMA 4DU1A 4AKIA 1FZHE 3L1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5N A;  4X5M A;  4QNC A;  4RNG A;  4QND A; 
#chains in the Genus database with same CATH topology
 4FJJ A;  1FPO A;  2LF6 A;  3QEX A;  4EYW A;  4DTJ A;  3KD5 E;  4AKH A;  3SQ0 A;  3QEP A;  3QES A;  3L2O B;  4I6J B;  3J27 A;  4KI6 A;  3E4Y A;  3HP9 A;  1FXX A;  1XL3 C;  4JRP A;  2E31 A;  4RG8 A;  1XMH E;  4HCB A;  3HGK E;  3SJJ A;  2JPN A;  2YB5 A;  1FZ8 E;  4FJI A;  1FZ7 E;  3CFO A;  4ADO A;  4FJG A;  4AI6 A;  1XVG E;  2B8I A;  3LDB A;  4DTP A;  2H4T A;  4FJM A;  3SQ1 A;  2JHP A;  3RMA A;  2FYO A;  3QER A;  1XMG E;  2JHC A;  3OGM B;  4DTN A;  4M42 A;  3RMD A;  1FZ2 E;  2JQT A;  5IRE A;  4IT5 A;  1MTY G;  2P5G A;  1FZ4 E;  3E4W A;  4FVM A;  4FJ9 A;  2JHA A;  2HD0 A;  4X5N A;  2OVQ B;  3NE6 A;  1P22 A;  1XVC E;  2PFV A;  3MKS B;  4M3W A;  4DU3 A;  2OYQ A;  4QND A;  4JS5 A;  3V7D B;  1FZ0 E;  1XVB E;  2FW3 A;  2MZW B;  3UO2 A;  4DTX A;  2P1N B;  4I9L A;  3SQ2 A;  4ADN A;  3QET A;  2VIX A;  2RKH A;  3SUP A;  1CLQ A;  3N1B A;  3S9H A;  1FZ6 E;  2DY4 A;  4FJX A;  3TL8 B;  2OVP B;  3TAE A;  2B7M A;  1FYZ E;  3LZI A;  3CFP A;  2DTU A;  2B1E A;  4FK2 A;  5IZ7 A;  4JS4 A;  2VJ5 A;  3TAG A;  3SQ4 A;  4DTS A;  2P1Q B;  1WAF A;  3SUQ A;  4ICG C;  5H37 A;  3SPZ A;  1XU5 E;  2OVR B;  4I9Q A;  2ATQ A;  4M41 A;  3NGI A;  3OGL B;  4QNC A;  3RWU A;  3NDK A;  1MHZ G;  3TAB A;  2K5S A;  3OGK B;  3L8B A;  3CFR A;  3LDS A;  4M3Z A;  4M3R A;  4J2B A;  4M3U A;  1XVE E;  2P1M B;  2QXF A;  4M45 A;  3UO3 A;  3C6P B;  3NAE A;  3QNN A;  3SPY A;  2OZS A;  2DEB A;  2E32 A;  3C6O B;  4EPH A;  1FZ3 E;  3SVI A;  2JH9 A;  3TAF A;  1FZ1 E;  1XMF E;  3QNO A;  1FS1 A;  4FJ7 A;  1XVD E;  1N1C A;  1LDK E;  2RCU A;  4RNG A;  2P1O B;  1FZ9 E;  2VJ4 A;  3NHG A;  4M3Y A;  4M3X A;  4EP9 A;  1FZI E;  4KHY A;  1JW2 A;  4DTO A;  4KHU A;  3QEW A;  3J2P A;  1Q9X A;  4DU4 A;  3SNN A;  3C95 A;  3CQ8 A;  3WSO A;  2OZM A;  1Q9Y A;  3N1E A;  1WAJ A;  4J2D A;  4FJ8 A;  4E3S A;  2P1P B;  4J2A A;  3NCI A;  3QEI A;  3L0M A;  4FJN A;  3UIQ A;  3SI6 A;  3QEV A;  3C94 A;  4FJH A;  3SCX A;  3RMB A;  3BVO A;  1NEX B;  4KHW A;  4GAM C;  1MHY G;  4AKG A;  1MMO G;  4B08 A;  3HL8 A;  3K2O A;  4KHQ A;  2MW2 A;  4X5M A;  1XVF E;  4KHN A;  4J2E A;  4M3T A;  4KI4 A;  4FJL A;  4FJ5 A;  2LF3 A;  4RL5 A;  4DTR A;  4KHS A;  3SUN A;  3C6N B;  4DTU A;  1IH7 A;  3LD8 A;  3SUO A;  3RMC A;  3TJY A;  3HGL A;  3KD1 E;  2JH8 A;  1IG9 A;  2MMB A;  4HCC A;  4E4B A;  2P5O A;  4FK0 A;  1FZ5 E;  4FJK A;  1XU3 E;  2PFT A;  5IBK B;  3LZJ A;  4FK4 A;  4JRQ A;  4DTM A;  4DU1 A;  4AKI A;  1FZH E;  3L1N A; 
#chains in the Genus database with same CATH homology
 4FJJ A;  2LF6 A;  3QEX A;  4EYW A;  4DTJ A;  3KD5 E;  4AKH A;  3SQ0 A;  3QEP A;  3QES A;  3L2O B;  4I6J B;  3J27 A;  4KI6 A;  3E4Y A;  3HP9 A;  1FXX A;  1XL3 C;  4JRP A;  2E31 A;  4RG8 A;  1XMH E;  4HCB A;  3HGK E;  3SJJ A;  2JPN A;  2YB5 A;  1FZ8 E;  4FJI A;  1FZ7 E;  3CFO A;  4ADO A;  4FJG A;  4AI6 A;  1XVG E;  2B8I A;  3LDB A;  4DTP A;  2H4T A;  4FJM A;  3SQ1 A;  2JHP A;  3RMA A;  2FYO A;  3QER A;  1XMG E;  2JHC A;  3OGM B;  4DTN A;  4M42 A;  3RMD A;  1FZ2 E;  5IRE A;  1MTY G;  2P5G A;  1FZ4 E;  3E4W A;  4FVM A;  4FJ9 A;  2JHA A;  2HD0 A;  4X5N A;  2OVQ B;  3NE6 A;  1P22 A;  1XVC E;  2PFV A;  3MKS B;  4M3W A;  4DU3 A;  2OYQ A;  4QND A;  4JS5 A;  3V7D B;  1FZ0 E;  1XVB E;  2FW3 A;  2MZW B;  4DTX A;  2P1N B;  4I9L A;  3SQ2 A;  4ADN A;  3QET A;  2VIX A;  3SUP A;  1CLQ A;  3N1B A;  3S9H A;  1FZ6 E;  2DY4 A;  4FJX A;  3TL8 B;  2OVP B;  3TAE A;  2B7M A;  1FYZ E;  3LZI A;  3CFP A;  2DTU A;  2B1E A;  4FK2 A;  5IZ7 A;  4JS4 A;  2VJ5 A;  3TAG A;  3SQ4 A;  4DTS A;  2P1Q B;  1WAF A;  3SUQ A;  4J2B A;  5H37 A;  3SPZ A;  1XU5 E;  2OVR B;  4I9Q A;  2ATQ A;  4M41 A;  3NGI A;  3OGL B;  4QNC A;  3RWU A;  3NDK A;  1MHZ G;  3TAB A;  4M3Z A;  3OGK B;  3L8B A;  3CFR A;  3LDS A;  4M3R A;  4M3U A;  1XVE E;  2P1M B;  2QXF A;  4M45 A;  3C6P B;  3NAE A;  3QNN A;  3SPY A;  2OZS A;  2DEB A;  2E32 A;  3C6O B;  4EPH A;  1FZ3 E;  3SVI A;  2JH9 A;  3TAF A;  1FZ1 E;  1XMF E;  3QNO A;  1FS1 A;  4FJ7 A;  1XVD E;  1LDK E;  2RCU A;  4RNG A;  2P1O B;  1FZ9 E;  2VJ4 A;  3NHG A;  4M3Y A;  4M3X A;  4EP9 A;  1FZI E;  4KHY A;  4DTO A;  4KHU A;  3QEW A;  3J2P A;  1Q9X A;  4DU4 A;  3SNN A;  3C95 A;  3CQ8 A;  3WSO A;  2OZM A;  1Q9Y A;  3N1E A;  1WAJ A;  4J2D A;  4FJ8 A;  4E3S A;  2P1P B;  4J2A A;  3NCI A;  3QEI A;  3L0M A;  4FJN A;  3UIQ A;  3SI6 A;  3QEV A;  3C94 A;  4FJH A;  3SCX A;  3RMB A;  1NEX B;  4KHW A;  4GAM C;  1MHY G;  4AKG A;  1MMO G;  4B08 A;  3HL8 A;  3K2O A;  4KHQ A;  4X5M A;  4KHN A;  1XVF E;  4J2E A;  4M3T A;  4KI4 A;  4FJL A;  4FJ5 A;  2LF3 A;  4RL5 A;  4DTR A;  4KHS A;  3SUN A;  3C6N B;  4DTU A;  1IH7 A;  3LD8 A;  3SUO A;  3RMC A;  3TJY A;  3HGL A;  3KD1 E;  2JH8 A;  1IG9 A;  2MMB A;  4HCC A;  4E4B A;  2P5O A;  4FK0 A;  1FZ5 E;  4FJK A;  1XU3 E;  2PFT A;  5IBK B;  3LZJ A;  4FK4 A;  4JRQ A;  4DTM A;  4DU1 A;  4AKI A;  1FZH E;  3L1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...