2MW2A

Hha-h-ns46 charge zipper complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
b'LTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin expression-modulating protein Hha
publication title A Three-protein Charge Zipper Stabilizes a Complex Modulating Bacterial Gene Silencing.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 2mw2A00
2JQTA 2K5SA 2MW2A 1JW2A 4ICGC
chains in the Genus database with same CATH superfamily
1WAFA 4HCCA 3QESA 2JHAA 4M3YA 4FJ8A 3QEXA 2B8IA 4KHSA 3QEVA 4M3UA 2HD0A 3J2PA 2E32A 4FJKA 3QEPA 2B1EA 4ADOA 3TAEA 4GAMC 3LDSA 3QNOA 2ATQA 4AKHA 1Q9YA 1XVEE 1MHZG 3SCXA 3HL8A 1FS1A 2P1OB 3LZIA 1FZIE 3LD8A 1XMFE 3RMAA 4FJ9A 3L1NA 2RKHA 1FZ6E 1XVCE 4DTXA 4DTUA 1XVFE 1IG9A 4KHUA 3HP9A 4DTOA 1MTYG 1FZ5E 4DTRA 3SPZA 2YB5A 4FK4A 2JQTA 2FYOA 4FK0A 3L2OB 3RWUA 1FZ4E 3J27A 3SVIA 4DU1A 1FZ7E 1XMHE 3OGLB 3SUOA 3UO2A 3SQ0A 1MMOG 3QERA 3LDBA 3C6NB 3SUNA 4FK2A 2DTUA 3SPYA 3E4YA 4IT5A 1WAJA 3UO3A 2OVPB 3NE6A 4DU4A 4M41A 3NAEA 2H4TA 4RNGA 2VJ4A 2LF3A 4DTNA 1FZ1E 4J2BA 4FJ5A 3NCIA 2PFTA 4X5MA 4FJGA 4FJHA 1XL3C 2JHCA 1XMGE 5IZ7A 3K2OA 3S9HA 1XVGE 3SQ1A 4B08A 4JRPA 1N1CA 4DTSA 4M42A 2K5SA 4I9QA 3L0MA 1XVBE 4E4BA 3OGKB 3LZJA 4JS5A 3HGLA 2FW3A 3TAFA 1FYZE 2MMBA 4M3WA 4FJLA 1JW2A 2DEBA 4FJIA 1XU3E 3UIQA 2P1QB 4RG8A 2E31A 2P1MB 4EYWA 2OYQA 2OZSA 5H37A 3SUPA 2JPNA 2P1NB 4J2EA 2OZMA 3TJYA 2DY4A 1P22A 4KHNA 2RCUA 3TAGA 1CLQA 3E4WA 5IREA 3WSOA 3QEWA 4KI4A 3C94A 2B7MA 2P5OA 3TL8B 3RMDA 4FJJA 4FJMA 3N1EA 3OGMB 1FPOA 2PFVA 3BVOA 3MKSB 3NGIA 4JRQA 4DU3A 4J2DA 1FZ9E 1IH7A 3KD5E 2OVRB 4DTMA 2VIXA 3QNNA 5IBKB 2VJ5A 2P5GA 4M3TA 4I6JB 4KHWA 4QNDA 3CFOA 2JHPA 3HGKE 3SQ4A 4E3SA 2JH8A 3SUQA 4KHQA 3C6PB 4DTJA 3V7DB 4KHYA 4RL5A 1FZ3E 1NEXB 4M3RA 2LF6A 1FZ8E 1FXXA 3QEIA 3KD1E 3L8BA 4KI6A 4QNCA 4EPHA 3RMBA 3QETA 3RMCA 3SNNA 3CFRA 3SJJA 4FVMA 4JS4A 3C6OB 4EP9A 1FZHE 3NDKA 4I9LA 4AI6A 4X5NA 3CQ8A 3SQ2A 4DTPA 4HCBA 3N1BA 1FZ2E 4J2AA 3SI6A 4AKGA 4AKIA 1LDKE 4ICGC 4ADNA 2QXFA 2MZWB 2OVQB 1Q9XA 4M3ZA 1MHYG 2MW2A 4FJ7A 1XVDE 3CFPA 3C95A 1XU5E 4M45A 3NHGA 2P1PB 2JH9A 4FJNA 4FJXA 4M3XA 1FZ0E 3TABA
chains in the Genus database with same CATH topology
2JQTA 2K5SA 2MW2A 1JW2A 4ICGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQT A;  2K5S A;  2MW2 A;  1JW2 A;  4ICG C; 
#chains in the Genus database with same CATH topology
 1WAF A;  4HCC A;  3QES A;  2JHA A;  4M3Y A;  4FJ8 A;  3QEX A;  2B8I A;  4KHS A;  3QEV A;  4M3U A;  2HD0 A;  3J2P A;  2E32 A;  4FJK A;  3QEP A;  2B1E A;  4ADO A;  3TAE A;  4GAM C;  3LDS A;  3QNO A;  2ATQ A;  4AKH A;  1Q9Y A;  1XVE E;  1MHZ G;  3SCX A;  3HL8 A;  1FS1 A;  2P1O B;  3LZI A;  1FZI E;  3LD8 A;  1XMF E;  3RMA A;  4FJ9 A;  3L1N A;  2RKH A;  1FZ6 E;  1XVC E;  4DTX A;  4DTU A;  1XVF E;  1IG9 A;  4KHU A;  3HP9 A;  4DTO A;  1MTY G;  1FZ5 E;  4DTR A;  3SPZ A;  2YB5 A;  4FK4 A;  2JQT A;  2FYO A;  4FK0 A;  3L2O B;  3RWU A;  1FZ4 E;  3J27 A;  3SVI A;  4DU1 A;  1FZ7 E;  1XMH E;  3OGL B;  3SUO A;  3UO2 A;  3SQ0 A;  1MMO G;  3QER A;  3LDB A;  3C6N B;  3SUN A;  4FK2 A;  2DTU A;  3SPY A;  3E4Y A;  4IT5 A;  1WAJ A;  3UO3 A;  2OVP B;  3NE6 A;  4DU4 A;  4M41 A;  3NAE A;  2H4T A;  4RNG A;  2VJ4 A;  2LF3 A;  4DTN A;  1FZ1 E;  4J2B A;  4FJ5 A;  3NCI A;  2PFT A;  4X5M A;  4FJG A;  4FJH A;  1XL3 C;  2JHC A;  1XMG E;  5IZ7 A;  3K2O A;  3S9H A;  1XVG E;  3SQ1 A;  4B08 A;  4JRP A;  1N1C A;  4DTS A;  4M42 A;  2K5S A;  4I9Q A;  3L0M A;  1XVB E;  4E4B A;  3OGK B;  3LZJ A;  4JS5 A;  3HGL A;  2FW3 A;  3TAF A;  1FYZ E;  2MMB A;  4M3W A;  4FJL A;  1JW2 A;  2DEB A;  4FJI A;  1XU3 E;  3UIQ A;  2P1Q B;  4RG8 A;  2E31 A;  2P1M B;  4EYW A;  2OYQ A;  2OZS A;  5H37 A;  3SUP A;  2JPN A;  2P1N B;  4J2E A;  2OZM A;  3TJY A;  2DY4 A;  1P22 A;  4KHN A;  2RCU A;  3TAG A;  1CLQ A;  3E4W A;  5IRE A;  3WSO A;  3QEW A;  4KI4 A;  3C94 A;  2B7M A;  2P5O A;  3TL8 B;  3RMD A;  4FJJ A;  4FJM A;  3N1E A;  3OGM B;  1FPO A;  2PFV A;  3BVO A;  3MKS B;  3NGI A;  4JRQ A;  4DU3 A;  4J2D A;  1FZ9 E;  1IH7 A;  3KD5 E;  2OVR B;  4DTM A;  2VIX A;  3QNN A;  5IBK B;  2VJ5 A;  2P5G A;  4M3T A;  4I6J B;  4KHW A;  4QND A;  3CFO A;  2JHP A;  3HGK E;  3SQ4 A;  4E3S A;  2JH8 A;  3SUQ A;  4KHQ A;  3C6P B;  4DTJ A;  3V7D B;  4KHY A;  4RL5 A;  1FZ3 E;  1NEX B;  4M3R A;  2LF6 A;  1FZ8 E;  1FXX A;  3QEI A;  3KD1 E;  3L8B A;  4KI6 A;  4QNC A;  4EPH A;  3RMB A;  3QET A;  3RMC A;  3SNN A;  3CFR A;  3SJJ A;  4FVM A;  4JS4 A;  3C6O B;  4EP9 A;  1FZH E;  3NDK A;  4I9L A;  4AI6 A;  4X5N A;  3CQ8 A;  3SQ2 A;  4DTP A;  4HCB A;  3N1B A;  1FZ2 E;  4J2A A;  3SI6 A;  4AKG A;  4AKI A;  1LDK E;  4ICG C;  4ADN A;  2QXF A;  2MZW B;  2OVQ B;  1Q9X A;  4M3Z A;  1MHY G;  2MW2 A;  4FJ7 A;  1XVD E;  3CFP A;  3C95 A;  1XU5 E;  4M45 A;  3NHG A;  2P1P B;  2JH9 A;  4FJN A;  4FJX A;  4M3X A;  1FZ0 E;  3TAB A; 
#chains in the Genus database with same CATH homology
 2JQT A;  2K5S A;  2MW2 A;  1JW2 A;  4ICG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...