2MW2A

Hha-h-ns46 charge zipper complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
LTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Hemolysin expression-modulating protein Hha
publication title A Three-protein Charge Zipper Stabilizes a Complex Modulating Bacterial Gene Silencing.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 2mw2A00
1JW2A 2JQTA 2MW2A 2K5SA 4ICGC
chains in the Genus database with same CATH superfamily
4FJLA 3SQ2A 4M3YA 4AKHA 4FJ9A 1IG9A 2PFVA 3HL8A 4I9LA 4I6JB 1FZ6E 1XVBE 3SJJA 4FJ7A 3MKSB 2JQTA 2P5OA 4FK2A 3CQ8A 3SUPA 1MTYG 3OGLB 4DTMA 1MMOG 5IREA 4JRPA 3LD8A 3RMDA 5IBKB 3RMAA 3QERA 4B08A 1FZ4E 2QXFA 3QEIA 4KI6A 4DTPA 1XVEE 4FJ8A 2JHAA 2VJ5A 4GAMC 4FJNA 4FJXA 4DTXA 2P1PB 3QETA 2JHCA 2B8IA 2FYOA 3QEXA 2P5GA 1FZ2E 3TL8B 1XU3E 1WAJA 2P1QB 4M45A 1MHYG 3NDKA 3C6PB 1FXXA 1XU5E 4EP9A 4KHWA 5IZ7A 2HD0A 3E4WA 1XMGE 1Q9YA 4EPHA 2P1NB 2OZSA 1WAFA 4HCCA 1XVGE 3E4YA 3KD1E 3SCXA 4QNDA 4KI4A 4JS4A 4M3WA 3HP9A 3K2OA 2RCUA 2LF6A 1FYZE 4FVMA 4ICGC 3LDSA 1JW2A 4RG8A 1FZIE 2OVRB 2OVPB 4JS5A 4FJMA 3SUOA 3CFPA 2JPNA 3TAFA 1XVDE 2PFTA 3KD5E 3SQ0A 4AKIA 2E32A 2JH9A 3RMBA 4HCBA 3TJYA 4X5MA 4ADOA 2VIXA 4J2AA 4FJJA 1FZ3E 3OGMB 2RKHA 4E3SA 3TAGA 2H4TA 3C6OB 2DY4A 3SPZA 2DEBA 2YB5A 3V7DB 3C94A 4DTNA 4FK4A 2OYQA 4DTUA 3UO3A 3RWUA 3L8BA 2P1MB 3HGKE 4IT5A 3UO2A 3J2PA 3WSOA 2JH8A 2ATQA 4QNCA 1FS1A 2E31A 2JHPA 3SVIA 3LZIA 3QNNA 1MHZG 3C95A 4ADNA 3BVOA 3QEWA 4KHQA 3LDBA 1Q9XA 2MW2A 1XMHE 3HGLA 1XVFE 3LZJA 3NE6A 2VJ4A 3RMCA 3UIQA 3L2OB 1FZ1E 4DU4A 3SNNA 4EYWA 4KHSA 4DTJA 4FJGA 4I9QA 1XL3C 4FJKA 4J2EA 3NHGA 4X5NA 4FJIA 1FPOA 3SUQA 3SUNA 1LDKE 2DTUA 3QNOA 3OGKB 3QEPA 2B1EA 4M41A 3L1NA 3N1BA 4DU1A 3NCIA 3C6NB 2LF3A 2B7MA 3TABA 4DTRA 2MMBA 3SI6A 3QESA 1XVCE 4RNGA 3TAEA 2FW3A 4AI6A 2OZMA 4KHNA 4M42A 1XMFE 4KHUA 4M3RA 1FZ8E 4KHYA 4JRQA 3SQ1A 3N1EA 1NEXB 4FJHA 4FJ5A 3SQ4A 4DTOA 2MZWB 4DU3A 4J2BA 4FK0A 4RL5A 4DTSA 2OVQB 5H37A 1FZ5E 3NAEA 1N1CA 4M3ZA 4M3UA 4E4BA 1FZ9E 3CFOA 3L0MA 4M3XA 3QEVA 3NGIA 4M3TA 3S9HA 3SPYA 4AKGA 2P1OB 1FZHE 1P22A 1CLQA 2K5SA 1FZ0E 1FZ7E 3J27A 4J2DA 3CFRA 1IH7A
chains in the Genus database with same CATH topology
1JW2A 2JQTA 2MW2A 2K5SA 4ICGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JW2 A;  2JQT A;  2MW2 A;  2K5S A;  4ICG C; 
#chains in the Genus database with same CATH topology
 4FJL A;  3SQ2 A;  4M3Y A;  4AKH A;  4FJ9 A;  1IG9 A;  2PFV A;  3HL8 A;  4I9L A;  4I6J B;  1FZ6 E;  1XVB E;  3SJJ A;  4FJ7 A;  3MKS B;  2JQT A;  2P5O A;  4FK2 A;  3CQ8 A;  3SUP A;  1MTY G;  3OGL B;  4DTM A;  1MMO G;  5IRE A;  4JRP A;  3LD8 A;  3RMD A;  5IBK B;  3RMA A;  3QER A;  4B08 A;  1FZ4 E;  2QXF A;  3QEI A;  4KI6 A;  4DTP A;  1XVE E;  4FJ8 A;  2JHA A;  2VJ5 A;  4GAM C;  4FJN A;  4FJX A;  4DTX A;  2P1P B;  3QET A;  2JHC A;  2B8I A;  2FYO A;  3QEX A;  2P5G A;  1FZ2 E;  3TL8 B;  1XU3 E;  1WAJ A;  2P1Q B;  4M45 A;  1MHY G;  3NDK A;  3C6P B;  1FXX A;  1XU5 E;  4EP9 A;  4KHW A;  5IZ7 A;  2HD0 A;  3E4W A;  1XMG E;  1Q9Y A;  4EPH A;  2P1N B;  2OZS A;  1WAF A;  4HCC A;  1XVG E;  3E4Y A;  3KD1 E;  3SCX A;  4QND A;  4KI4 A;  4JS4 A;  4M3W A;  3HP9 A;  3K2O A;  2RCU A;  2LF6 A;  1FYZ E;  4FVM A;  4ICG C;  3LDS A;  1JW2 A;  4RG8 A;  1FZI E;  2OVR B;  2OVP B;  4JS5 A;  4FJM A;  3SUO A;  3CFP A;  2JPN A;  3TAF A;  1XVD E;  2PFT A;  3KD5 E;  3SQ0 A;  4AKI A;  2E32 A;  2JH9 A;  3RMB A;  4HCB A;  3TJY A;  4X5M A;  4ADO A;  2VIX A;  4J2A A;  4FJJ A;  1FZ3 E;  3OGM B;  2RKH A;  4E3S A;  3TAG A;  2H4T A;  3C6O B;  2DY4 A;  3SPZ A;  2DEB A;  2YB5 A;  3V7D B;  3C94 A;  4DTN A;  4FK4 A;  2OYQ A;  4DTU A;  3UO3 A;  3RWU A;  3L8B A;  2P1M B;  3HGK E;  4IT5 A;  3UO2 A;  3J2P A;  3WSO A;  2JH8 A;  2ATQ A;  4QNC A;  1FS1 A;  2E31 A;  2JHP A;  3SVI A;  3LZI A;  3QNN A;  1MHZ G;  3C95 A;  4ADN A;  3BVO A;  3QEW A;  4KHQ A;  3LDB A;  1Q9X A;  2MW2 A;  1XMH E;  3HGL A;  1XVF E;  3LZJ A;  3NE6 A;  2VJ4 A;  3RMC A;  3UIQ A;  3L2O B;  1FZ1 E;  4DU4 A;  3SNN A;  4EYW A;  4KHS A;  4DTJ A;  4FJG A;  4I9Q A;  1XL3 C;  4FJK A;  4J2E A;  3NHG A;  4X5N A;  4FJI A;  1FPO A;  3SUQ A;  3SUN A;  1LDK E;  2DTU A;  3QNO A;  3OGK B;  3QEP A;  2B1E A;  4M41 A;  3L1N A;  3N1B A;  4DU1 A;  3NCI A;  3C6N B;  2LF3 A;  2B7M A;  3TAB A;  4DTR A;  2MMB A;  3SI6 A;  3QES A;  1XVC E;  4RNG A;  3TAE A;  2FW3 A;  4AI6 A;  2OZM A;  4KHN A;  4M42 A;  1XMF E;  4KHU A;  4M3R A;  1FZ8 E;  4KHY A;  4JRQ A;  3SQ1 A;  3N1E A;  1NEX B;  4FJH A;  4FJ5 A;  3SQ4 A;  4DTO A;  2MZW B;  4DU3 A;  4J2B A;  4FK0 A;  4RL5 A;  4DTS A;  2OVQ B;  5H37 A;  1FZ5 E;  3NAE A;  1N1C A;  4M3Z A;  4M3U A;  4E4B A;  1FZ9 E;  3CFO A;  3L0M A;  4M3X A;  3QEV A;  3NGI A;  4M3T A;  3S9H A;  3SPY A;  4AKG A;  2P1O B;  1FZH E;  1P22 A;  1CLQ A;  2K5S A;  1FZ0 E;  1FZ7 E;  3J27 A;  4J2D A;  3CFR A;  1IH7 A; 
#chains in the Genus database with same CATH homology
 1JW2 A;  2JQT A;  2MW2 A;  2K5S A;  4ICG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...