2MW2A

Hha-h-ns46 charge zipper complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
LTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin expression-modulating protein Hha
publication title A Three-protein Charge Zipper Stabilizes a Complex Modulating Bacterial Gene Silencing.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 2mw2A00
2K5SA 4ICGC 1JW2A 2JQTA 2MW2A
chains in the Genus database with same CATH superfamily
3SNNA 4FJ5A 3TL8B 3RMAA 4I9QA 1FZ8E 4FJKA 4M42A 4QNCA 1JW2A 1MHYG 5H37A 3SJJA 1LDKE 1MMOG 4X5MA 3RMCA 3HP9A 1Q9YA 2JH8A 2MZWB 2B1EA 2VIXA 3J2PA 5IBKB 3HGKE 1XVFE 3TAFA 3NE6A 2PFVA 4M3XA 5IZ7A 4FK0A 4E4BA 3QEXA 2OVRB 3L2OB 2P5GA 4HCBA 3QEIA 2QXFA 4KI4A 4M3TA 1Q9XA 4JS4A 2MMBA 3NGIA 2E31A 3OGLB 1FZ3E 3UO3A 2LF3A 3RMDA 3QETA 2H4TA 3CFOA 1FXXA 4FJXA 3CFPA 2JQTA 3SPZA 4JRPA 2PFTA 4JRQA 3C6NB 4X5NA 1FZ0E 2B8IA 1XL3C 1XMHE 3QNOA 1FZIE 3SUPA 4FJ7A 4KHYA 2OVQB 4J2BA 1XU5E 4RNGA 3LDSA 2YB5A 4IT5A 2VJ4A 3BVOA 2B7MA 3J27A 1IG9A 4DU4A 2RCUA 5IREA 3RMBA 4FJHA 3C95A 4EPHA 3QERA 1FZ1E 2RKHA 3E4WA 4ICGC 4RG8A 4M45A 3SI6A 4RL5A 3QEWA 2DY4A 4KHUA 3LZIA 1MHZG 2HD0A 4DTMA 1XVDE 4KHNA 3UO2A 4ADOA 1WAJA 2K5SA 4DTJA 4DU3A 3SQ2A 3RWUA 4FJ8A 2JHPA 1WAFA 2P1MB 3L8BA 2ATQA 4JS5A 3SCXA 3CQ8A 3S9HA 4M3WA 2JHCA 3OGKB 2P5OA 3C94A 3SUOA 4HCCA 1XVGE 3V7DB 3SQ0A 4AKIA 2MW2A 3CFRA 1XVCE 1XVBE 4FJNA 3L0MA 4KHSA 4KI6A 2DTUA 1FPOA 3SQ4A 4B08A 3KD5E 4FJLA 2P1QB 4KHWA 2JHAA 4DTUA 4E3SA 4DTXA 2OYQA 1N1CA 3C6OB 3LD8A 1XMFE 3SQ1A 4DTRA 2P1PB 4FJGA 3K2OA 2LF6A 1XMGE 1FZ5E 3QEVA 3NAEA 1FZHE 4FK4A 2P1OB 4FJ9A 3TJYA 2OZMA 4AKHA 3TAGA 1XVEE 4GAMC 2OZSA 3WSOA 4FK2A 1FZ4E 3N1BA 3HL8A 3NHGA 1MTYG 2FYOA 4EP9A 4EYWA 2OVPB 3LDBA 4M3UA 3SUQA 4QNDA 4I9LA 4FJMA 1CLQA 4AI6A 2JPNA 1FZ2E 4M3RA 1FZ7E 2P1NB 3LZJA 3SVIA 3QEPA 1IH7A 3OGMB 4FJJA 4KHQA 4FVMA 3TAEA 4DU1A 4J2AA 4J2EA 1FS1A 1FYZE 3E4YA 4J2DA 3MKSB 1NEXB 2E32A 4DTNA 2DEBA 1FZ9E 4I6JB 3SPYA 4AKGA 3C6PB 3QNNA 1XU3E 4DTSA 3QESA 3NDKA 1P22A 4DTPA 3NCIA 4DTOA 3SUNA 2JH9A 4M3YA 3TABA 2VJ5A 4FJIA 4ADNA 3UIQA 3HGLA 4M3ZA 1FZ6E 2FW3A 3N1EA 3KD1E 3L1NA 4M41A
chains in the Genus database with same CATH topology
2K5SA 4ICGC 1JW2A 2JQTA 2MW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5S A;  4ICG C;  1JW2 A;  2JQT A;  2MW2 A; 
#chains in the Genus database with same CATH topology
 3SNN A;  4FJ5 A;  3TL8 B;  3RMA A;  4I9Q A;  1FZ8 E;  4FJK A;  4M42 A;  4QNC A;  1JW2 A;  1MHY G;  5H37 A;  3SJJ A;  1LDK E;  1MMO G;  4X5M A;  3RMC A;  3HP9 A;  1Q9Y A;  2JH8 A;  2MZW B;  2B1E A;  2VIX A;  3J2P A;  5IBK B;  3HGK E;  1XVF E;  3TAF A;  3NE6 A;  2PFV A;  4M3X A;  5IZ7 A;  4FK0 A;  4E4B A;  3QEX A;  2OVR B;  3L2O B;  2P5G A;  4HCB A;  3QEI A;  2QXF A;  4KI4 A;  4M3T A;  1Q9X A;  4JS4 A;  2MMB A;  3NGI A;  2E31 A;  3OGL B;  1FZ3 E;  3UO3 A;  2LF3 A;  3RMD A;  3QET A;  2H4T A;  3CFO A;  1FXX A;  4FJX A;  3CFP A;  2JQT A;  3SPZ A;  4JRP A;  2PFT A;  4JRQ A;  3C6N B;  4X5N A;  1FZ0 E;  2B8I A;  1XL3 C;  1XMH E;  3QNO A;  1FZI E;  3SUP A;  4FJ7 A;  4KHY A;  2OVQ B;  4J2B A;  1XU5 E;  4RNG A;  3LDS A;  2YB5 A;  4IT5 A;  2VJ4 A;  3BVO A;  2B7M A;  3J27 A;  1IG9 A;  4DU4 A;  2RCU A;  5IRE A;  3RMB A;  4FJH A;  3C95 A;  4EPH A;  3QER A;  1FZ1 E;  2RKH A;  3E4W A;  4ICG C;  4RG8 A;  4M45 A;  3SI6 A;  4RL5 A;  3QEW A;  2DY4 A;  4KHU A;  3LZI A;  1MHZ G;  2HD0 A;  4DTM A;  1XVD E;  4KHN A;  3UO2 A;  4ADO A;  1WAJ A;  2K5S A;  4DTJ A;  4DU3 A;  3SQ2 A;  3RWU A;  4FJ8 A;  2JHP A;  1WAF A;  2P1M B;  3L8B A;  2ATQ A;  4JS5 A;  3SCX A;  3CQ8 A;  3S9H A;  4M3W A;  2JHC A;  3OGK B;  2P5O A;  3C94 A;  3SUO A;  4HCC A;  1XVG E;  3V7D B;  3SQ0 A;  4AKI A;  2MW2 A;  3CFR A;  1XVC E;  1XVB E;  4FJN A;  3L0M A;  4KHS A;  4KI6 A;  2DTU A;  1FPO A;  3SQ4 A;  4B08 A;  3KD5 E;  4FJL A;  2P1Q B;  4KHW A;  2JHA A;  4DTU A;  4E3S A;  4DTX A;  2OYQ A;  1N1C A;  3C6O B;  3LD8 A;  1XMF E;  3SQ1 A;  4DTR A;  2P1P B;  4FJG A;  3K2O A;  2LF6 A;  1XMG E;  1FZ5 E;  3QEV A;  3NAE A;  1FZH E;  4FK4 A;  2P1O B;  4FJ9 A;  3TJY A;  2OZM A;  4AKH A;  3TAG A;  1XVE E;  4GAM C;  2OZS A;  3WSO A;  4FK2 A;  1FZ4 E;  3N1B A;  3HL8 A;  3NHG A;  1MTY G;  2FYO A;  4EP9 A;  4EYW A;  2OVP B;  3LDB A;  4M3U A;  3SUQ A;  4QND A;  4I9L A;  4FJM A;  1CLQ A;  4AI6 A;  2JPN A;  1FZ2 E;  4M3R A;  1FZ7 E;  2P1N B;  3LZJ A;  3SVI A;  3QEP A;  1IH7 A;  3OGM B;  4FJJ A;  4KHQ A;  4FVM A;  3TAE A;  4DU1 A;  4J2A A;  4J2E A;  1FS1 A;  1FYZ E;  3E4Y A;  4J2D A;  3MKS B;  1NEX B;  2E32 A;  4DTN A;  2DEB A;  1FZ9 E;  4I6J B;  3SPY A;  4AKG A;  3C6P B;  3QNN A;  1XU3 E;  4DTS A;  3QES A;  3NDK A;  1P22 A;  4DTP A;  3NCI A;  4DTO A;  3SUN A;  2JH9 A;  4M3Y A;  3TAB A;  2VJ5 A;  4FJI A;  4ADN A;  3UIQ A;  3HGL A;  4M3Z A;  1FZ6 E;  2FW3 A;  3N1E A;  3KD1 E;  3L1N A;  4M41 A; 
#chains in the Genus database with same CATH homology
 2K5S A;  4ICG C;  1JW2 A;  2JQT A;  2MW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...