2MW2A

Hha-h-ns46 charge zipper complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
LTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin expression-modulating protein Hha
publication title A Three-protein Charge Zipper Stabilizes a Complex Modulating Bacterial Gene Silencing.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 2mw2A00
4ICGC 2JQTA 2MW2A 2K5SA 1JW2A
chains in the Genus database with same CATH superfamily
2E31A 4RG8A 1MHZG 4M3XA 3LZIA 4FJGA 4DTJA 2PFTA 3HL8A 3QEVA 4JRQA 4FJHA 2P1QB 3QESA 3V7DB 4X5NA 3HP9A 5IZ7A 4DTPA 3RMCA 4FJXA 3RMDA 3TL8B 3NCIA 3QNNA 3WSOA 1FPOA 2MMBA 4M45A 3TAEA 3SUQA 4ADNA 1FZ2E 2OVPB 4DU3A 2H4TA 3BVOA 4FJ9A 4JS4A 3E4WA 3UO2A 2OVRB 4FK4A 1FZHE 3CQ8A 4KHYA 2RKHA 4M3UA 2FYOA 1FZ3E 2HD0A 2JH9A 4GAMC 2P1OB 2ATQA 3QEWA 4JS5A 4JRPA 1XU5E 1Q9XA 1XMFE 3HGKE 1XMGE 3TJYA 4KHUA 1Q9YA 2JPNA 4M3RA 1XU3E 2P1NB 4AKGA 2PFVA 2RCUA 3QETA 3C6PB 3CFPA 3KD5E 4IT5A 1FZ0E 1FZ5E 4FJNA 3N1EA 3L0MA 2FW3A 3SJJA 4KHWA 2JHCA 3NHGA 4FVMA 4DTSA 4FK0A 1FYZE 2JHPA 4RL5A 3SQ2A 3RMBA 3SQ1A 4FJMA 1XVEE 1WAFA 3SUPA 3KD1E 1CLQA 2K5SA 4EPHA 1FS1A 3LDBA 4HCCA 4HCBA 4AKIA 4M41A 4M3TA 4X5MA 1XVDE 3K2OA 2VIXA 4M42A 2VJ4A 2OYQA 1JW2A 4J2BA 2P1MB 4ICGC 4B08A 4EYWA 3SUNA 4RNGA 5H37A 4I6JB 2P5OA 1NEXB 4FJ7A 2OZMA 4FJKA 4DTUA 3SPZA 4KHQA 4M3ZA 1FXXA 3C94A 3LZJA 3RWUA 3UO3A 4FJIA 1LDKE 1XL3C 2LF6A 1IG9A 4FK2A 3LDSA 3SQ4A 4FJ8A 3NAEA 1FZ1E 1MMOG 3J2PA 4J2EA 3J27A 4FJLA 1FZ9E 4QNCA 2E32A 3TAGA 1IH7A 4I9QA 2LF3A 4DU4A 1P22A 4E4BA 3L1NA 4M3YA 4DTXA 2QXFA 1N1CA 2B1EA 2OVQB 1MTYG 4DTNA 4AKHA 3L8BA 4KHSA 1MHYG 4I9LA 3C6OB 2B8IA 2YB5A 2DTUA 3OGLB 3QEPA 2JH8A 3C6NB 3CFRA 3HGLA 5IREA 3NDKA 3QEXA 2MZWB 4E3SA 1FZ7E 3OGMB 3SPYA 3QERA 3SNNA 4M3WA 1XVFE 4FJJA 3C95A 4KI4A 3NGIA 2B7MA 2MW2A 3LD8A 4DTMA 1WAJA 3RMAA 3TABA 4AI6A 4EP9A 4J2AA 4KHNA 3SVIA 4ADOA 3SCXA 1FZ8E 4KI6A 3TAFA 3SUOA 3UIQA 2VJ5A 4FJ5A 4DTRA 3S9HA 3NE6A 1FZ6E 1XVCE 1XMHE 3N1BA 3QEIA 4DTOA 3E4YA 2P5GA 2JHAA 2JQTA 3CFOA 3SQ0A 2P1PB 1XVGE 4QNDA 4DU1A 1XVBE 2DEBA 2OZSA 1FZ4E 3L2OB 3MKSB 4J2DA 2DY4A 5IBKB 3QNOA 3OGKB 1FZIE 3SI6A
chains in the Genus database with same CATH topology
4ICGC 2JQTA 2MW2A 2K5SA 1JW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICG C;  2JQT A;  2MW2 A;  2K5S A;  1JW2 A; 
#chains in the Genus database with same CATH topology
 2E31 A;  4RG8 A;  1MHZ G;  4M3X A;  3LZI A;  4FJG A;  4DTJ A;  2PFT A;  3HL8 A;  3QEV A;  4JRQ A;  4FJH A;  2P1Q B;  3QES A;  3V7D B;  4X5N A;  3HP9 A;  5IZ7 A;  4DTP A;  3RMC A;  4FJX A;  3RMD A;  3TL8 B;  3NCI A;  3QNN A;  3WSO A;  1FPO A;  2MMB A;  4M45 A;  3TAE A;  3SUQ A;  4ADN A;  1FZ2 E;  2OVP B;  4DU3 A;  2H4T A;  3BVO A;  4FJ9 A;  4JS4 A;  3E4W A;  3UO2 A;  2OVR B;  4FK4 A;  1FZH E;  3CQ8 A;  4KHY A;  2RKH A;  4M3U A;  2FYO A;  1FZ3 E;  2HD0 A;  2JH9 A;  4GAM C;  2P1O B;  2ATQ A;  3QEW A;  4JS5 A;  4JRP A;  1XU5 E;  1Q9X A;  1XMF E;  3HGK E;  1XMG E;  3TJY A;  4KHU A;  1Q9Y A;  2JPN A;  4M3R A;  1XU3 E;  2P1N B;  4AKG A;  2PFV A;  2RCU A;  3QET A;  3C6P B;  3CFP A;  3KD5 E;  4IT5 A;  1FZ0 E;  1FZ5 E;  4FJN A;  3N1E A;  3L0M A;  2FW3 A;  3SJJ A;  4KHW A;  2JHC A;  3NHG A;  4FVM A;  4DTS A;  4FK0 A;  1FYZ E;  2JHP A;  4RL5 A;  3SQ2 A;  3RMB A;  3SQ1 A;  4FJM A;  1XVE E;  1WAF A;  3SUP A;  3KD1 E;  1CLQ A;  2K5S A;  4EPH A;  1FS1 A;  3LDB A;  4HCC A;  4HCB A;  4AKI A;  4M41 A;  4M3T A;  4X5M A;  1XVD E;  3K2O A;  2VIX A;  4M42 A;  2VJ4 A;  2OYQ A;  1JW2 A;  4J2B A;  2P1M B;  4ICG C;  4B08 A;  4EYW A;  3SUN A;  4RNG A;  5H37 A;  4I6J B;  2P5O A;  1NEX B;  4FJ7 A;  2OZM A;  4FJK A;  4DTU A;  3SPZ A;  4KHQ A;  4M3Z A;  1FXX A;  3C94 A;  3LZJ A;  3RWU A;  3UO3 A;  4FJI A;  1LDK E;  1XL3 C;  2LF6 A;  1IG9 A;  4FK2 A;  3LDS A;  3SQ4 A;  4FJ8 A;  3NAE A;  1FZ1 E;  1MMO G;  3J2P A;  4J2E A;  3J27 A;  4FJL A;  1FZ9 E;  4QNC A;  2E32 A;  3TAG A;  1IH7 A;  4I9Q A;  2LF3 A;  4DU4 A;  1P22 A;  4E4B A;  3L1N A;  4M3Y A;  4DTX A;  2QXF A;  1N1C A;  2B1E A;  2OVQ B;  1MTY G;  4DTN A;  4AKH A;  3L8B A;  4KHS A;  1MHY G;  4I9L A;  3C6O B;  2B8I A;  2YB5 A;  2DTU A;  3OGL B;  3QEP A;  2JH8 A;  3C6N B;  3CFR A;  3HGL A;  5IRE A;  3NDK A;  3QEX A;  2MZW B;  4E3S A;  1FZ7 E;  3OGM B;  3SPY A;  3QER A;  3SNN A;  4M3W A;  1XVF E;  4FJJ A;  3C95 A;  4KI4 A;  3NGI A;  2B7M A;  2MW2 A;  3LD8 A;  4DTM A;  1WAJ A;  3RMA A;  3TAB A;  4AI6 A;  4EP9 A;  4J2A A;  4KHN A;  3SVI A;  4ADO A;  3SCX A;  1FZ8 E;  4KI6 A;  3TAF A;  3SUO A;  3UIQ A;  2VJ5 A;  4FJ5 A;  4DTR A;  3S9H A;  3NE6 A;  1FZ6 E;  1XVC E;  1XMH E;  3N1B A;  3QEI A;  4DTO A;  3E4Y A;  2P5G A;  2JHA A;  2JQT A;  3CFO A;  3SQ0 A;  2P1P B;  1XVG E;  4QND A;  4DU1 A;  1XVB E;  2DEB A;  2OZS A;  1FZ4 E;  3L2O B;  3MKS B;  4J2D A;  2DY4 A;  5IBK B;  3QNO A;  3OGK B;  1FZI E;  3SI6 A; 
#chains in the Genus database with same CATH homology
 4ICG C;  2JQT A;  2MW2 A;  2K5S A;  1JW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...