1MHYG

Methane monooxygenase hydroxylase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
167
structure length
167
Chain Sequence
AKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hydroxylase component of methane monooxygenase from Methylosinus trichosporium OB3b
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE HYDROXYLASE
total genus 63
structure length 167
sequence length 167
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1996-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhyG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhyG02
1FZ7E 1XMGE 1MHZG 1FZ5E 1FZ6E 1XVFE 1XVGE 1MTYG 1FZ3E 1FZ1E 1FZIE 1MMOG 1FZ9E 1XMFE 1XVEE 1XVCE 4GAMC 1FZ8E 1FZ4E 1XVDE 1FYZE 1FZ2E 1XU5E 1MHYG 1FZHE 1FZ0E 1XMHE 1XVBE 1XU3E
chains in the Genus database with same CATH superfamily
3RWUA 3E4YA 2FYOA 2K5SA 4M3YA 1JW2A 2OYQA 2DY4A 1FZ5E 4X5MA 3QETA 1N1CA 3QEXA 2P1PB 2OVPB 2OZSA 4M42A 2E31A 4FJMA 4QNCA 1FXXA 4M3RA 1XVEE 4RG8A 3CFOA 4RL5A 3QESA 1IG9A 4KHQA 4B08A 3SCXA 4KHNA 1WAJA 4M41A 1XL3C 4JRQA 1WAFA 3C95A 3SUPA 2JHAA 3NHGA 3SI6A 2B8IA 3BVOA 3OGMB 3SNNA 4ADNA 4DTXA 2QXFA 4DTUA 3TAGA 4FVMA 1CLQA 3L2OB 4M3XA 4FJKA 3RMCA 4J2DA 3LDBA 4HCCA 2E32A 1XVBE 1FZ7E 4JS4A 4M3TA 2VJ4A 1XMGE 4DTJA 2VIXA 4FJ7A 4FJNA 3SUNA 2B7MA 4AKGA 1FZ6E 1XVFE 3TAEA 3UIQA 4FJGA 2VJ5A 3CFRA 1NEXB 1FZ1E 1IH7A 4EP9A 1XMFE 4I9LA 3CFPA 4E3SA 3RMBA 3C6PB 4KHWA 3QEVA 3LDSA 3QEIA 3E4WA 2OVQB 3L0MA 3RMDA 3QEPA 4DU1A 4KI6A 3UO3A 3SUOA 4J2AA 3TJYA 1FZ8E 4EYWA 3SUQA 1XVDE 1FYZE 5IBKB 3KD1E 3N1BA 1MHYG 3K2OA 4I6JB 3LZJA 2HD0A 3NCIA 2LF3A 1FS1A 2PFTA 4DTMA 2DEBA 3TAFA 4AI6A 2LF6A 3N1EA 3LZIA 1FPOA 3C6OB 3QERA 3SQ1A 4KHSA 3J2PA 3J27A 4FJ9A 3QEWA 1MHZG 4M45A 4M3ZA 2JH9A 2P1OB 1XVGE 1MTYG 5IZ7A 4IT5A 1FZIE 1MMOG 1FZ9E 3SQ0A 2P5OA 2JHCA 4FJJA 1LDKE 4QNDA 3SPYA 4DTRA 1XVCE 2MZWB 3NGIA 3MKSB 4GAMC 3C94A 4JS5A 2H4TA 3TABA 3WSOA 2P1NB 4EPHA 4KHUA 4AKHA 4DTNA 1FZ2E 2JH8A 4FJ8A 4DTSA 1Q9XA 3QNOA 2OVRB 4J2EA 2RCUA 1P22A 2MW2A 3C6NB 4E4BA 3NAEA 3SJJA 2OZMA 4FJLA 4M3UA 3SQ4A 1FZHE 2RKHA 3S9HA 4KI4A 4M3WA 4DU3A 4FJ5A 3HP9A 3QNNA 3RMAA 1XU3E 4ICGC 3NDKA 2B1EA 3KD5E 3OGLB 4FJXA 2DTUA 3HGKE 4ADOA 4FK4A 2P1MB 4DU4A 4AKIA 4RNGA 4FJIA 1FZ3E 3OGKB 3L1NA 5H37A 1Q9YA 4J2BA 4FK0A 3CQ8A 3SQ2A 2JQTA 3HL8A 2PFVA 4JRPA 2JPNA 3SPZA 2JHPA 3LD8A 2ATQA 2P1QB 4DTPA 3NE6A 4FK2A 1FZ4E 4FJHA 1XU5E 4KHYA 2P5GA 2FW3A 3L8BA 2YB5A 3SVIA 4HCBA 3TL8B 4I9QA 5IREA 1FZ0E 3UO2A 1XMHE 3HGLA 3V7DB 4DTOA 4X5NA 2MMBA
chains in the Genus database with same CATH topology
3RWUA 3E4YA 2FYOA 4M3YA 2OYQA 2DY4A 1FZ5E 4X5MA 3QETA 3QEXA 2P1PB 2OVPB 2OZSA 4M42A 2E31A 4FJMA 4QNCA 1FXXA 4M3RA 1XVEE 4RG8A 3CFOA 4RL5A 3QESA 1IG9A 4KHQA 4B08A 3SCXA 4KHNA 1WAJA 4M41A 1XL3C 4JRQA 1WAFA 3C95A 3SUPA 2JHAA 3NHGA 3SI6A 2B8IA 3OGMB 3SNNA 4ADNA 4DTXA 2QXFA 4DTUA 3TAGA 4FVMA 1CLQA 3L2OB 4M3XA 4FJKA 3RMCA 4J2DA 3LDBA 4HCCA 2E32A 1XVBE 1FZ7E 4JS4A 4M3TA 2VJ4A 1XMGE 4DTJA 2VIXA 4FJ7A 4FJNA 3SUNA 2B7MA 4AKGA 1FZ6E 1XVFE 3TAEA 3UIQA 4FJGA 2VJ5A 3CFRA 1NEXB 1FZ1E 1IH7A 4EP9A 1XMFE 4I9LA 3CFPA 4E3SA 3RMBA 3C6PB 4KHWA 3QEVA 3LDSA 3QEIA 3E4WA 2OVQB 3L0MA 3RMDA 3QEPA 4DU1A 4KI6A 3SUOA 4J2AA 3TJYA 1FZ8E 4EYWA 3SUQA 1XVDE 1FYZE 5IBKB 3KD1E 3N1BA 1MHYG 3K2OA 4I6JB 3LZJA 2HD0A 3NCIA 2LF3A 1FS1A 2PFTA 4DTMA 2DEBA 3TAFA 4AI6A 2LF6A 3N1EA 3LZIA 3C6OB 3QERA 3SQ1A 4KHSA 3J2PA 3J27A 4FJ9A 3QEWA 1MHZG 4M45A 4M3ZA 2JH9A 2P1OB 1XVGE 1MTYG 5IZ7A 1FZIE 1MMOG 1FZ9E 3SQ0A 2P5OA 2JHCA 4FJJA 1LDKE 4QNDA 3SPYA 4DTRA 1XVCE 2MZWB 3NGIA 3MKSB 4GAMC 3C94A 4JS5A 2H4TA 3TABA 3WSOA 2P1NB 4EPHA 4KHUA 4AKHA 4DTNA 1FZ2E 2JH8A 4FJ8A 4DTSA 1Q9XA 3QNOA 2OVRB 4J2EA 2RCUA 1P22A 3C6NB 4E4BA 3NAEA 2OZMA 3SJJA 4FJLA 4M3UA 3SQ4A 1FZHE 3S9HA 4KI4A 4M3WA 4DU3A 4FJ5A 3HP9A 3QNNA 3RMAA 1XU3E 3KD5E 3NDKA 2B1EA 3OGLB 4FJXA 2DTUA 3HGKE 4ADOA 4FK4A 2P1MB 4DU4A 4AKIA 4RNGA 4FJIA 1FZ3E 3OGKB 3L1NA 5H37A 1Q9YA 4J2BA 4FK0A 3CQ8A 3SQ2A 3HL8A 2PFVA 4JRPA 2JPNA 3SPZA 2JHPA 3LD8A 2ATQA 2P1QB 4DTPA 3NE6A 4FK2A 1FZ4E 4FJHA 1XU5E 4KHYA 2P5GA 2FW3A 3L8BA 2YB5A 3SVIA 4HCBA 3TL8B 4I9QA 5IREA 1FZ0E 1XMHE 3HGLA 3V7DB 4DTOA 4X5NA 2MMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ7 E;  1XMG E;  1MHZ G;  1FZ5 E;  1FZ6 E;  1XVF E;  1XVG E;  1MTY G;  1FZ3 E;  1FZ1 E;  1FZI E;  1MMO G;  1FZ9 E;  1XMF E;  1XVE E;  1XVC E;  4GAM C;  1FZ8 E;  1FZ4 E;  1XVD E;  1FYZ E;  1FZ2 E;  1XU5 E;  1MHY G;  1FZH E;  1FZ0 E;  1XMH E;  1XVB E;  1XU3 E; 
#chains in the Genus database with same CATH topology
 3RWU A;  3E4Y A;  2FYO A;  2K5S A;  4M3Y A;  1JW2 A;  2OYQ A;  2DY4 A;  1FZ5 E;  4X5M A;  3QET A;  1N1C A;  3QEX A;  2P1P B;  2OVP B;  2OZS A;  4M42 A;  2E31 A;  4FJM A;  4QNC A;  1FXX A;  4M3R A;  1XVE E;  4RG8 A;  3CFO A;  4RL5 A;  3QES A;  1IG9 A;  4KHQ A;  4B08 A;  3SCX A;  4KHN A;  1WAJ A;  4M41 A;  1XL3 C;  4JRQ A;  1WAF A;  3C95 A;  3SUP A;  2JHA A;  3NHG A;  3SI6 A;  2B8I A;  3BVO A;  3OGM B;  3SNN A;  4ADN A;  4DTX A;  2QXF A;  4DTU A;  3TAG A;  4FVM A;  1CLQ A;  3L2O B;  4M3X A;  4FJK A;  3RMC A;  4J2D A;  3LDB A;  4HCC A;  2E32 A;  1XVB E;  1FZ7 E;  4JS4 A;  4M3T A;  2VJ4 A;  1XMG E;  4DTJ A;  2VIX A;  4FJ7 A;  4FJN A;  3SUN A;  2B7M A;  4AKG A;  1FZ6 E;  1XVF E;  3TAE A;  3UIQ A;  4FJG A;  2VJ5 A;  3CFR A;  1NEX B;  1FZ1 E;  1IH7 A;  4EP9 A;  1XMF E;  4I9L A;  3CFP A;  4E3S A;  3RMB A;  3C6P B;  4KHW A;  3QEV A;  3LDS A;  3QEI A;  3E4W A;  2OVQ B;  3L0M A;  3RMD A;  3QEP A;  4DU1 A;  4KI6 A;  3UO3 A;  3SUO A;  4J2A A;  3TJY A;  1FZ8 E;  4EYW A;  3SUQ A;  1XVD E;  1FYZ E;  5IBK B;  3KD1 E;  3N1B A;  1MHY G;  3K2O A;  4I6J B;  3LZJ A;  2HD0 A;  3NCI A;  2LF3 A;  1FS1 A;  2PFT A;  4DTM A;  2DEB A;  3TAF A;  4AI6 A;  2LF6 A;  3N1E A;  3LZI A;  1FPO A;  3C6O B;  3QER A;  3SQ1 A;  4KHS A;  3J2P A;  3J27 A;  4FJ9 A;  3QEW A;  1MHZ G;  4M45 A;  4M3Z A;  2JH9 A;  2P1O B;  1XVG E;  1MTY G;  5IZ7 A;  4IT5 A;  1FZI E;  1MMO G;  1FZ9 E;  3SQ0 A;  2P5O A;  2JHC A;  4FJJ A;  1LDK E;  4QND A;  3SPY A;  4DTR A;  1XVC E;  2MZW B;  3NGI A;  3MKS B;  4GAM C;  3C94 A;  4JS5 A;  2H4T A;  3TAB A;  3WSO A;  2P1N B;  4EPH A;  4KHU A;  4AKH A;  4DTN A;  1FZ2 E;  2JH8 A;  4FJ8 A;  4DTS A;  1Q9X A;  3QNO A;  2OVR B;  4J2E A;  2RCU A;  1P22 A;  2MW2 A;  3C6N B;  4E4B A;  3NAE A;  3SJJ A;  2OZM A;  4FJL A;  4M3U A;  3SQ4 A;  1FZH E;  2RKH A;  3S9H A;  4KI4 A;  4M3W A;  4DU3 A;  4FJ5 A;  3HP9 A;  3QNN A;  3RMA A;  1XU3 E;  4ICG C;  3NDK A;  2B1E A;  3KD5 E;  3OGL B;  4FJX A;  2DTU A;  3HGK E;  4ADO A;  4FK4 A;  2P1M B;  4DU4 A;  4AKI A;  4RNG A;  4FJI A;  1FZ3 E;  3OGK B;  3L1N A;  5H37 A;  1Q9Y A;  4J2B A;  4FK0 A;  3CQ8 A;  3SQ2 A;  2JQT A;  3HL8 A;  2PFV A;  4JRP A;  2JPN A;  3SPZ A;  2JHP A;  3LD8 A;  2ATQ A;  2P1Q B;  4DTP A;  3NE6 A;  4FK2 A;  1FZ4 E;  4FJH A;  1XU5 E;  4KHY A;  2P5G A;  2FW3 A;  3L8B A;  2YB5 A;  3SVI A;  4HCB A;  3TL8 B;  4I9Q A;  5IRE A;  1FZ0 E;  3UO2 A;  1XMH E;  3HGL A;  3V7D B;  4DTO A;  4X5N A;  2MMB A; 
#chains in the Genus database with same CATH homology
 3RWU A;  3E4Y A;  2FYO A;  4M3Y A;  2OYQ A;  2DY4 A;  1FZ5 E;  4X5M A;  3QET A;  3QEX A;  2P1P B;  2OVP B;  2OZS A;  4M42 A;  2E31 A;  4FJM A;  4QNC A;  1FXX A;  4M3R A;  1XVE E;  4RG8 A;  3CFO A;  4RL5 A;  3QES A;  1IG9 A;  4KHQ A;  4B08 A;  3SCX A;  4KHN A;  1WAJ A;  4M41 A;  1XL3 C;  4JRQ A;  1WAF A;  3C95 A;  3SUP A;  2JHA A;  3NHG A;  3SI6 A;  2B8I A;  3OGM B;  3SNN A;  4ADN A;  4DTX A;  2QXF A;  4DTU A;  3TAG A;  4FVM A;  1CLQ A;  3L2O B;  4M3X A;  4FJK A;  3RMC A;  4J2D A;  3LDB A;  4HCC A;  2E32 A;  1XVB E;  1FZ7 E;  4JS4 A;  4M3T A;  2VJ4 A;  1XMG E;  4DTJ A;  2VIX A;  4FJ7 A;  4FJN A;  3SUN A;  2B7M A;  4AKG A;  1FZ6 E;  1XVF E;  3TAE A;  3UIQ A;  4FJG A;  2VJ5 A;  3CFR A;  1NEX B;  1FZ1 E;  1IH7 A;  4EP9 A;  1XMF E;  4I9L A;  3CFP A;  4E3S A;  3RMB A;  3C6P B;  4KHW A;  3QEV A;  3LDS A;  3QEI A;  3E4W A;  2OVQ B;  3L0M A;  3RMD A;  3QEP A;  4DU1 A;  4KI6 A;  3SUO A;  4J2A A;  3TJY A;  1FZ8 E;  4EYW A;  3SUQ A;  1XVD E;  1FYZ E;  5IBK B;  3KD1 E;  3N1B A;  1MHY G;  3K2O A;  4I6J B;  3LZJ A;  2HD0 A;  3NCI A;  2LF3 A;  1FS1 A;  2PFT A;  4DTM A;  2DEB A;  3TAF A;  4AI6 A;  2LF6 A;  3N1E A;  3LZI A;  3C6O B;  3QER A;  3SQ1 A;  4KHS A;  3J2P A;  3J27 A;  4FJ9 A;  3QEW A;  1MHZ G;  4M45 A;  4M3Z A;  2JH9 A;  2P1O B;  1XVG E;  1MTY G;  5IZ7 A;  1FZI E;  1MMO G;  1FZ9 E;  3SQ0 A;  2P5O A;  2JHC A;  4FJJ A;  1LDK E;  4QND A;  3SPY A;  4DTR A;  1XVC E;  2MZW B;  3NGI A;  3MKS B;  4GAM C;  3C94 A;  4JS5 A;  2H4T A;  3TAB A;  3WSO A;  2P1N B;  4EPH A;  4KHU A;  4AKH A;  4DTN A;  1FZ2 E;  2JH8 A;  4FJ8 A;  4DTS A;  1Q9X A;  3QNO A;  2OVR B;  4J2E A;  2RCU A;  1P22 A;  3C6N B;  4E4B A;  3NAE A;  2OZM A;  3SJJ A;  4FJL A;  4M3U A;  3SQ4 A;  1FZH E;  3S9H A;  4KI4 A;  4M3W A;  4DU3 A;  4FJ5 A;  3HP9 A;  3QNN A;  3RMA A;  1XU3 E;  3KD5 E;  3NDK A;  2B1E A;  3OGL B;  4FJX A;  2DTU A;  3HGK E;  4ADO A;  4FK4 A;  2P1M B;  4DU4 A;  4AKI A;  4RNG A;  4FJI A;  1FZ3 E;  3OGK B;  3L1N A;  5H37 A;  1Q9Y A;  4J2B A;  4FK0 A;  3CQ8 A;  3SQ2 A;  3HL8 A;  2PFV A;  4JRP A;  2JPN A;  3SPZ A;  2JHP A;  3LD8 A;  2ATQ A;  2P1Q B;  4DTP A;  3NE6 A;  4FK2 A;  1FZ4 E;  4FJH A;  1XU5 E;  4KHY A;  2P5G A;  2FW3 A;  3L8B A;  2YB5 A;  3SVI A;  4HCB A;  3TL8 B;  4I9Q A;  5IRE A;  1FZ0 E;  1XMH E;  3HGL A;  3V7D B;  4DTO A;  4X5N A;  2MMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...