1MHYG

Methane monooxygenase hydroxylase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
167
structure length
167
Chain Sequence
AKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE HYDROXYLASE
publication title Crystal structure of the hydroxylase component of methane monooxygenase from Methylosinus trichosporium OB3b
pubmed rcsb
total genus 63
structure length 167
sequence length 167
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 1996-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhyG01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1mhyG02
1FZ3E 1MHYG 1FZ5E 1FZ6E 1FYZE 1XMFE 1FZ0E 1MMOG 1XU3E 1XVBE 1XVCE 1FZIE 1FZ2E 1FZ7E 1XMHE 1FZ4E 1FZ8E 1XVEE 4GAMC 1XMGE 1MHZG 1FZ1E 1XVDE 1XU5E 1XVFE 1MTYG 1XVGE 1FZ9E 1FZHE
chains in the Genus database with same CATH superfamily
2P1NB 4FVMA 4JS4A 2DEBA 3LD8A 3NGIA 1XMFE 5H37A 4DTJA 3SUPA 1MMOG 1XU3E 1XVBE 4KHNA 2VJ5A 4J2EA 4AKIA 3SQ1A 4DTNA 3K2OA 4EYWA 4FJGA 4X5MA 3QEPA 2E31A 4M42A 3C6NB 5IREA 3C6PB 3QESA 3QERA 3SUQA 1Q9XA 3SCXA 3N1EA 3RMBA 1CLQA 4DTOA 2QXFA 3SVIA 4FJNA 1WAJA 4ADOA 2DY4A 1JW2A 3LZIA 3LDBA 1FS1A 2RCUA 3CFRA 3L0MA 3TAFA 3LDSA 4I9LA 1XVGE 2JPNA 4FJLA 4AI6A 2RKHA 4B08A 3RMAA 3UIQA 1FZ3E 3L2OB 4I9QA 2JHPA 2JQTA 3NE6A 4M45A 2VIXA 1XVCE 4DTRA 4FK0A 1FZIE 4FJ8A 4QNCA 4X5NA 3TL8B 3TAGA 2OZMA 4KI4A 4M41A 4M3TA 2E32A 5IBKB 4DU1A 2OZSA 3LZJA 4FJIA 4I6JB 3V7DB 3TABA 4AKHA 1NEXB 2DTUA 2B1EA 4FJ7A 3C94A 3L1NA 3TAEA 3L8BA 3HL8A 3NAEA 1XMGE 1WAFA 4EPHA 3QEXA 3SUOA 2JH9A 5IZ7A 1FZ1E 1XL3C 2B7MA 4FJKA 3C6OB 1XVDE 2OVQB 4E4BA 3SPYA 1MTYG 3MKSB 4RNGA 4KHSA 4M3YA 1FZHE 3N1BA 1Q9YA 4AKGA 3SJJA 4DTXA 3RWUA 2VJ4A 1FZ5E 1FZ6E 1FYZE 3NHGA 2MMBA 4EP9A 2P1MB 4DTPA 3E4WA 3SQ4A 4DTMA 2YB5A 3QEVA 2K5SA 3QNOA 4RL5A 2OYQA 3NDKA 3TJYA 4FJ9A 2JHCA 3BVOA 4JS5A 4J2AA 1FZ4E 4E3SA 3QEWA 2P1PB 3SQ2A 1FZ8E 1XVEE 4GAMC 1MHZG 4FJHA 3C95A 3KD1E 3J27A 2LF3A 4ADNA 1N1CA 2PFVA 4DU3A 3KD5E 4QNDA 4JRQA 2JHAA 2JH8A 2MZWB 1XU5E 1XVFE 2LF6A 2OVRB 3UO3A 3SUNA 2OVPB 4KHWA 3CFPA 4HCBA 4J2DA 4M3WA 1MHYG 4DTSA 3OGLB 4FJ5A 4KHYA 1FZ0E 3QEIA 4KI6A 4M3RA 3CQ8A 3HP9A 3J2PA 3WSOA 1IG9A 1FZ2E 4ICGC 1LDKE 4DU4A 4M3ZA 3E4YA 2PFTA 3RMCA 4M3XA 3HGKE 1FZ7E 1XMHE 3HGLA 3QETA 2P1QB 3SQ0A 2ATQA 4FK2A 3RMDA 2FYOA 3QNNA 2MW2A 2P5GA 3OGMB 2HD0A 4FJJA 1FXXA 1P22A 2B8IA 4M3UA 1IH7A 3UO2A 2H4TA 2FW3A 3S9HA 4RG8A 3SI6A 3NCIA 4DTUA 4J2BA 4JRPA 2P5OA 4FJXA 4KHUA 4FJMA 3OGKB 3SPZA 2P1OB 4IT5A 3CFOA 1FZ9E 4KHQA 3SNNA 1FPOA 4FK4A 4HCCA
chains in the Genus database with same CATH topology
2P1NB 4FVMA 4JS4A 2DEBA 3LD8A 3NGIA 1XMFE 5H37A 4DTJA 3SUPA 1MMOG 1XU3E 1XVBE 4KHNA 2VJ5A 4J2EA 4AKIA 3SQ1A 4DTNA 3K2OA 4EYWA 4FJGA 4X5MA 3QEPA 2E31A 4M42A 3C6NB 5IREA 3C6PB 3QESA 3QERA 3SUQA 1Q9XA 3SCXA 3N1EA 3RMBA 1CLQA 4DTOA 2QXFA 3SVIA 4FJNA 1WAJA 4ADOA 2DY4A 3LZIA 3LDBA 1FS1A 2RCUA 3CFRA 3L0MA 3TAFA 3LDSA 4I9LA 1XVGE 2JPNA 4FJLA 4AI6A 4B08A 3RMAA 3UIQA 1FZ3E 3L2OB 4I9QA 2JHPA 3NE6A 4M45A 2VIXA 1XVCE 4DTRA 4FK0A 1FZIE 4FJ8A 4QNCA 4X5NA 3TL8B 3TAGA 2OZMA 4KI4A 4M41A 4M3TA 2E32A 5IBKB 4DU1A 2OZSA 3LZJA 4FJIA 4I6JB 3V7DB 3TABA 4AKHA 1NEXB 2DTUA 2B1EA 4FJ7A 3C94A 3L1NA 3TAEA 3L8BA 3HL8A 3NAEA 1XMGE 1WAFA 4EPHA 3QEXA 3SUOA 2JH9A 5IZ7A 1FZ1E 1XL3C 2B7MA 4FJKA 3C6OB 1XVDE 2OVQB 4E4BA 3SPYA 1MTYG 3MKSB 4RNGA 4KHSA 4M3YA 1FZHE 3N1BA 1Q9YA 4AKGA 3SJJA 4DTXA 3RWUA 2VJ4A 1FZ5E 1FZ6E 1FYZE 3NHGA 2MMBA 4EP9A 2P1MB 4DTPA 3E4WA 3SQ4A 4DTMA 2YB5A 3QEVA 3QNOA 4RL5A 2OYQA 3NDKA 3TJYA 4FJ9A 2JHCA 4JS5A 4J2AA 1FZ4E 4E3SA 3QEWA 2P1PB 3SQ2A 1FZ8E 1XVEE 4GAMC 1MHZG 4FJHA 3C95A 3KD1E 3J27A 2LF3A 4ADNA 2PFVA 4DU3A 3KD5E 4QNDA 4JRQA 2JHAA 2JH8A 2MZWB 1XU5E 1XVFE 2LF6A 2OVRB 3SUNA 2OVPB 4KHWA 3CFPA 4HCBA 4J2DA 4M3WA 1MHYG 4DTSA 3OGLB 4FJ5A 4KHYA 1FZ0E 3QEIA 4KI6A 4M3RA 3CQ8A 3HP9A 3J2PA 3WSOA 1IG9A 1FZ2E 4DU4A 1LDKE 4M3ZA 3E4YA 2PFTA 3RMCA 4M3XA 3HGKE 1FZ7E 1XMHE 3HGLA 3QETA 2P1QB 3SQ0A 2ATQA 4FK2A 3RMDA 2FYOA 3QNNA 2P5GA 3OGMB 2HD0A 4FJJA 1FXXA 1P22A 2B8IA 4M3UA 1IH7A 2H4TA 2FW3A 3S9HA 4RG8A 3SI6A 3NCIA 4DTUA 4J2BA 4JRPA 2P5OA 4FJXA 4KHUA 4FJMA 3OGKB 3SPZA 2P1OB 3CFOA 1FZ9E 4KHQA 3SNNA 4FK4A 4HCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ3 E;  1MHY G;  1FZ5 E;  1FZ6 E;  1FYZ E;  1XMF E;  1FZ0 E;  1MMO G;  1XU3 E;  1XVB E;  1XVC E;  1FZI E;  1FZ2 E;  1FZ7 E;  1XMH E;  1FZ4 E;  1FZ8 E;  1XVE E;  4GAM C;  1XMG E;  1MHZ G;  1FZ1 E;  1XVD E;  1XU5 E;  1XVF E;  1MTY G;  1XVG E;  1FZ9 E;  1FZH E; 
#chains in the Genus database with same CATH topology
 2P1N B;  4FVM A;  4JS4 A;  2DEB A;  3LD8 A;  3NGI A;  1XMF E;  5H37 A;  4DTJ A;  3SUP A;  1MMO G;  1XU3 E;  1XVB E;  4KHN A;  2VJ5 A;  4J2E A;  4AKI A;  3SQ1 A;  4DTN A;  3K2O A;  4EYW A;  4FJG A;  4X5M A;  3QEP A;  2E31 A;  4M42 A;  3C6N B;  5IRE A;  3C6P B;  3QES A;  3QER A;  3SUQ A;  1Q9X A;  3SCX A;  3N1E A;  3RMB A;  1CLQ A;  4DTO A;  2QXF A;  3SVI A;  4FJN A;  1WAJ A;  4ADO A;  2DY4 A;  1JW2 A;  3LZI A;  3LDB A;  1FS1 A;  2RCU A;  3CFR A;  3L0M A;  3TAF A;  3LDS A;  4I9L A;  1XVG E;  2JPN A;  4FJL A;  4AI6 A;  2RKH A;  4B08 A;  3RMA A;  3UIQ A;  1FZ3 E;  3L2O B;  4I9Q A;  2JHP A;  2JQT A;  3NE6 A;  4M45 A;  2VIX A;  1XVC E;  4DTR A;  4FK0 A;  1FZI E;  4FJ8 A;  4QNC A;  4X5N A;  3TL8 B;  3TAG A;  2OZM A;  4KI4 A;  4M41 A;  4M3T A;  2E32 A;  5IBK B;  4DU1 A;  2OZS A;  3LZJ A;  4FJI A;  4I6J B;  3V7D B;  3TAB A;  4AKH A;  1NEX B;  2DTU A;  2B1E A;  4FJ7 A;  3C94 A;  3L1N A;  3TAE A;  3L8B A;  3HL8 A;  3NAE A;  1XMG E;  1WAF A;  4EPH A;  3QEX A;  3SUO A;  2JH9 A;  5IZ7 A;  1FZ1 E;  1XL3 C;  2B7M A;  4FJK A;  3C6O B;  1XVD E;  2OVQ B;  4E4B A;  3SPY A;  1MTY G;  3MKS B;  4RNG A;  4KHS A;  4M3Y A;  1FZH E;  3N1B A;  1Q9Y A;  4AKG A;  3SJJ A;  4DTX A;  3RWU A;  2VJ4 A;  1FZ5 E;  1FZ6 E;  1FYZ E;  3NHG A;  2MMB A;  4EP9 A;  2P1M B;  4DTP A;  3E4W A;  3SQ4 A;  4DTM A;  2YB5 A;  3QEV A;  2K5S A;  3QNO A;  4RL5 A;  2OYQ A;  3NDK A;  3TJY A;  4FJ9 A;  2JHC A;  3BVO A;  4JS5 A;  4J2A A;  1FZ4 E;  4E3S A;  3QEW A;  2P1P B;  3SQ2 A;  1FZ8 E;  1XVE E;  4GAM C;  1MHZ G;  4FJH A;  3C95 A;  3KD1 E;  3J27 A;  2LF3 A;  4ADN A;  1N1C A;  2PFV A;  4DU3 A;  3KD5 E;  4QND A;  4JRQ A;  2JHA A;  2JH8 A;  2MZW B;  1XU5 E;  1XVF E;  2LF6 A;  2OVR B;  3UO3 A;  3SUN A;  2OVP B;  4KHW A;  3CFP A;  4HCB A;  4J2D A;  4M3W A;  1MHY G;  4DTS A;  3OGL B;  4FJ5 A;  4KHY A;  1FZ0 E;  3QEI A;  4KI6 A;  4M3R A;  3CQ8 A;  3HP9 A;  3J2P A;  3WSO A;  1IG9 A;  1FZ2 E;  4ICG C;  1LDK E;  4DU4 A;  4M3Z A;  3E4Y A;  2PFT A;  3RMC A;  4M3X A;  3HGK E;  1FZ7 E;  1XMH E;  3HGL A;  3QET A;  2P1Q B;  3SQ0 A;  2ATQ A;  4FK2 A;  3RMD A;  2FYO A;  3QNN A;  2MW2 A;  2P5G A;  3OGM B;  2HD0 A;  4FJJ A;  1FXX A;  1P22 A;  2B8I A;  4M3U A;  1IH7 A;  3UO2 A;  2H4T A;  2FW3 A;  3S9H A;  4RG8 A;  3SI6 A;  3NCI A;  4DTU A;  4J2B A;  4JRP A;  2P5O A;  4FJX A;  4KHU A;  4FJM A;  3OGK B;  3SPZ A;  2P1O B;  4IT5 A;  3CFO A;  1FZ9 E;  4KHQ A;  3SNN A;  1FPO A;  4FK4 A;  4HCC A; 
#chains in the Genus database with same CATH homology
 2P1N B;  4FVM A;  4JS4 A;  2DEB A;  3LD8 A;  3NGI A;  1XMF E;  5H37 A;  4DTJ A;  3SUP A;  1MMO G;  1XU3 E;  1XVB E;  4KHN A;  2VJ5 A;  4J2E A;  4AKI A;  3SQ1 A;  4DTN A;  3K2O A;  4EYW A;  4FJG A;  4X5M A;  3QEP A;  2E31 A;  4M42 A;  3C6N B;  5IRE A;  3C6P B;  3QES A;  3QER A;  3SUQ A;  1Q9X A;  3SCX A;  3N1E A;  3RMB A;  1CLQ A;  4DTO A;  2QXF A;  3SVI A;  4FJN A;  1WAJ A;  4ADO A;  2DY4 A;  3LZI A;  3LDB A;  1FS1 A;  2RCU A;  3CFR A;  3L0M A;  3TAF A;  3LDS A;  4I9L A;  1XVG E;  2JPN A;  4FJL A;  4AI6 A;  4B08 A;  3RMA A;  3UIQ A;  1FZ3 E;  3L2O B;  4I9Q A;  2JHP A;  3NE6 A;  4M45 A;  2VIX A;  1XVC E;  4DTR A;  4FK0 A;  1FZI E;  4FJ8 A;  4QNC A;  4X5N A;  3TL8 B;  3TAG A;  2OZM A;  4KI4 A;  4M41 A;  4M3T A;  2E32 A;  5IBK B;  4DU1 A;  2OZS A;  3LZJ A;  4FJI A;  4I6J B;  3V7D B;  3TAB A;  4AKH A;  1NEX B;  2DTU A;  2B1E A;  4FJ7 A;  3C94 A;  3L1N A;  3TAE A;  3L8B A;  3HL8 A;  3NAE A;  1XMG E;  1WAF A;  4EPH A;  3QEX A;  3SUO A;  2JH9 A;  5IZ7 A;  1FZ1 E;  1XL3 C;  2B7M A;  4FJK A;  3C6O B;  1XVD E;  2OVQ B;  4E4B A;  3SPY A;  1MTY G;  3MKS B;  4RNG A;  4KHS A;  4M3Y A;  1FZH E;  3N1B A;  1Q9Y A;  4AKG A;  3SJJ A;  4DTX A;  3RWU A;  2VJ4 A;  1FZ5 E;  1FZ6 E;  1FYZ E;  3NHG A;  2MMB A;  4EP9 A;  2P1M B;  4DTP A;  3E4W A;  3SQ4 A;  4DTM A;  2YB5 A;  3QEV A;  3QNO A;  4RL5 A;  2OYQ A;  3NDK A;  3TJY A;  4FJ9 A;  2JHC A;  4JS5 A;  4J2A A;  1FZ4 E;  4E3S A;  3QEW A;  2P1P B;  3SQ2 A;  1FZ8 E;  1XVE E;  4GAM C;  1MHZ G;  4FJH A;  3C95 A;  3KD1 E;  3J27 A;  2LF3 A;  4ADN A;  2PFV A;  4DU3 A;  3KD5 E;  4QND A;  4JRQ A;  2JHA A;  2JH8 A;  2MZW B;  1XU5 E;  1XVF E;  2LF6 A;  2OVR B;  3SUN A;  2OVP B;  4KHW A;  3CFP A;  4HCB A;  4J2D A;  4M3W A;  1MHY G;  4DTS A;  3OGL B;  4FJ5 A;  4KHY A;  1FZ0 E;  3QEI A;  4KI6 A;  4M3R A;  3CQ8 A;  3HP9 A;  3J2P A;  3WSO A;  1IG9 A;  1FZ2 E;  4DU4 A;  1LDK E;  4M3Z A;  3E4Y A;  2PFT A;  3RMC A;  4M3X A;  3HGK E;  1FZ7 E;  1XMH E;  3HGL A;  3QET A;  2P1Q B;  3SQ0 A;  2ATQ A;  4FK2 A;  3RMD A;  2FYO A;  3QNN A;  2P5G A;  3OGM B;  2HD0 A;  4FJJ A;  1FXX A;  1P22 A;  2B8I A;  4M3U A;  1IH7 A;  2H4T A;  2FW3 A;  3S9H A;  4RG8 A;  3SI6 A;  3NCI A;  4DTU A;  4J2B A;  4JRP A;  2P5O A;  4FJX A;  4KHU A;  4FJM A;  3OGK B;  3SPZ A;  2P1O B;  3CFO A;  1FZ9 E;  4KHQ A;  3SNN A;  4FK4 A;  4HCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...