1XU5E

Soluble methane monooxygenase hydroxylase-phenol soaked
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
total genus 62
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xu5E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xu5E02
1XU5E 1XVCE 1MTYG 1XVGE 1XVDE 1MHYG 1FZ4E 1FZ5E 1FZHE 1XMHE 1XVEE 1FZIE 1XVFE 1FZ7E 1FZ1E 1FZ2E 1FZ6E 1MMOG 1FYZE 1FZ9E 1FZ3E 1XMGE 1FZ0E 1XU3E 1FZ8E 4GAMC 1XVBE 1XMFE 1MHZG
chains in the Genus database with same CATH superfamily
2B8IA 3V7DB 5IZ7A 2P5GA 4FJLA 2DEBA 1XVGE 2P5OA 2B7MA 5H37A 2RKHA 1FZ4E 2MMBA 4RL5A 4KI6A 1FZIE 4M3TA 3HGKE 4QNCA 4EYWA 3NCIA 3L8BA 3CFOA 4I9LA 3SI6A 1FZ1E 4QNDA 4DTPA 4HCCA 4FJIA 4AKGA 3RWUA 1FS1A 1MMOG 2E31A 4RG8A 3LZJA 3OGKB 3SPYA 1NEXB 4M3UA 3NHGA 3RMDA 1LDKE 3TABA 2JHCA 2FW3A 4M3RA 3QEWA 3QETA 2P1NB 1Q9XA 2JQTA 1XL3C 3C6OB 4FJMA 2JH8A 4M41A 2LF6A 3N1EA 4FVMA 3SQ4A 4B08A 4KHUA 1FZ5E 1XU5E 3NGIA 4I9QA 3TAEA 2DY4A 4E4BA 4DU1A 3TJYA 4EP9A 4KHQA 2OVRB 2VJ5A 3SVIA 3QEXA 3CQ8A 4ADOA 4FJ9A 3SQ2A 3TAFA 4J2AA 4DU4A 1XVFE 1FZ7E 4JRPA 3LD8A 3CFPA 3QERA 3SUQA 4J2EA 4M3ZA 4AKIA 2DTUA 1FZ2E 1IH7A 2VJ4A 3E4YA 3UO2A 4DTOA 4DU3A 1FYZE 3NE6A 3SQ1A 4AI6A 1XMGE 4DTSA 3OGLB 2JHAA 3C6PB 2OYQA 1XU3E 3CFRA 2P1PB 4DTRA 3RMAA 4JRQA 5IBKB 4FJGA 1XVBE 4FJNA 3HGLA 3RMBA 3SQ0A 4IT5A 4FK0A 3KD5E 4I6JB 3HP9A 1MTYG 3J27A 3LDSA 3RMCA 3OGMB 1FPOA 1Q9YA 1MHYG 2LF3A 3SUOA 3LZIA 1FXXA 3BVOA 1FZHE 3L2OB 3QEIA 3QEPA 1XMHE 2PFTA 4J2BA 3L1NA 3J2PA 4KHYA 2OVQB 4X5NA 4AKHA 1CLQA 4DTUA 4M3YA 4FJ5A 3K2OA 3TL8B 3SJJA 4FJJA 3SUPA 1FZ6E 4FJXA 4FK2A 1FZ9E 5IREA 1IG9A 4KI4A 4ICGC 2P1OB 4FJKA 4JS4A 3QNNA 3WSOA 4FJHA 2OVPB 2ATQA 3NDKA 1N1CA 4JS5A 4KHNA 2PFVA 3E4WA 1XMFE 2HD0A 3LDBA 1MHZG 4ADNA 3S9HA 3C94A 1XVCE 3C95A 2JH9A 3N1BA 2MW2A 1XVDE 2QXFA 4HCBA 3UO3A 2MZWB 3C6NB 2P1QB 4X5MA 3KD1E 2JHPA 1XVEE 4DTXA 4FK4A 2JPNA 3QESA 1P22A 2B1EA 4M42A 4DTNA 2E32A 2VIXA 2H4TA 1WAFA 4DTJA 3QNOA 3SPZA 3SCXA 4J2DA 1FZ3E 4DTMA 3HL8A 3L0MA 4FJ8A 4M3XA 3SNNA 1FZ0E 2RCUA 4E3SA 2FYOA 2K5SA 4RNGA 2P1MB 3TAGA 1FZ8E 3NAEA 3SUNA 2OZSA 1WAJA 3UIQA 4KHWA 4FJ7A 4GAMC 4M45A 3MKSB 4KHSA 4M3WA 3QEVA 2YB5A 4EPHA 2OZMA 1JW2A
chains in the Genus database with same CATH topology
2B8IA 3V7DB 5IZ7A 2P5GA 4FJLA 2DEBA 1XVGE 2P5OA 2B7MA 5H37A 1FZ4E 2MMBA 4RL5A 4KI6A 1FZIE 3HGKE 4QNCA 4EYWA 3NCIA 3L8BA 3CFOA 4I9LA 3SI6A 1FZ1E 4QNDA 4DTPA 4HCCA 4FJIA 4AKGA 3RWUA 1FS1A 1MMOG 2E31A 4RG8A 3LZJA 3OGKB 3SPYA 1NEXB 4M3UA 3NHGA 3RMDA 1LDKE 3TABA 2JHCA 2FW3A 4M3RA 3QEWA 3QETA 2P1NB 1Q9XA 1XL3C 3C6OB 4FJMA 2JH8A 4M41A 2LF6A 3N1EA 4FVMA 3SQ4A 4B08A 4KHUA 1FZ5E 1XU5E 3NGIA 4I9QA 3TAEA 2DY4A 4E4BA 4DU1A 3TJYA 4EP9A 4KHQA 2OVRB 2VJ5A 3SVIA 3QEXA 3CQ8A 4ADOA 4FJ9A 3SQ2A 3TAFA 4J2AA 4DU4A 1XVFE 1FZ7E 4JRPA 3LD8A 3CFPA 3QERA 3SUQA 4J2EA 4M3ZA 4AKIA 2DTUA 1FZ2E 1IH7A 2VJ4A 3E4YA 4DTOA 4DU3A 1FYZE 3NE6A 3SQ1A 4AI6A 1XMGE 4DTSA 3OGLB 2JHAA 3C6PB 2OYQA 1XU3E 3CFRA 2P1PB 4DTRA 3RMAA 4JRQA 5IBKB 4FJGA 1XVBE 4FJNA 3HGLA 3RMBA 3SQ0A 4FK0A 3KD5E 4I6JB 3HP9A 1MTYG 3J27A 3LDSA 3RMCA 3OGMB 1Q9YA 1MHYG 2LF3A 3SUOA 3LZIA 1FXXA 1FZHE 3L2OB 3QEIA 3QEPA 1XMHE 2PFTA 4J2BA 3L1NA 3J2PA 4KHYA 2OVQB 4X5NA 4AKHA 1CLQA 4DTUA 4M3YA 4FJ5A 3K2OA 3TL8B 3SJJA 4FJJA 3SUPA 1FZ6E 4FJXA 4FK2A 1FZ9E 5IREA 1IG9A 4KI4A 2P1OB 4FJKA 4JS4A 3QNNA 3WSOA 4FJHA 2OVPB 2ATQA 3NDKA 4KHNA 4JS5A 2PFVA 3E4WA 1XMFE 2HD0A 3LDBA 1MHZG 4ADNA 3S9HA 3C94A 1XVCE 3C95A 2JH9A 3N1BA 1XVDE 2QXFA 4HCBA 2MZWB 3C6NB 2P1QB 4X5MA 3KD1E 2JHPA 1XVEE 4DTXA 4FK4A 2JPNA 3QESA 1P22A 2B1EA 4M42A 4DTNA 2E32A 2VIXA 2H4TA 1WAFA 4DTJA 3QNOA 3SPZA 3SCXA 4J2DA 1FZ3E 4DTMA 3HL8A 3L0MA 4FJ8A 4M3XA 3SNNA 1FZ0E 2RCUA 4E3SA 2FYOA 4RNGA 3TAGA 2P1MB 3SUNA 1FZ8E 3NAEA 2OZSA 4KHWA 1WAJA 3UIQA 4M3TA 4FJ7A 4GAMC 4M45A 3MKSB 4KHSA 4M3WA 3QEVA 2YB5A 4EPHA 2OZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XU5 E;  1XVC E;  1MTY G;  1XVG E;  1XVD E;  1MHY G;  1FZ4 E;  1FZ5 E;  1FZH E;  1XMH E;  1XVE E;  1FZI E;  1XVF E;  1FZ7 E;  1FZ1 E;  1FZ2 E;  1FZ6 E;  1MMO G;  1FYZ E;  1FZ9 E;  1FZ3 E;  1XMG E;  1FZ0 E;  1XU3 E;  1FZ8 E;  4GAM C;  1XVB E;  1XMF E;  1MHZ G; 
#chains in the Genus database with same CATH topology
 2B8I A;  3V7D B;  5IZ7 A;  2P5G A;  4FJL A;  2DEB A;  1XVG E;  2P5O A;  2B7M A;  5H37 A;  2RKH A;  1FZ4 E;  2MMB A;  4RL5 A;  4KI6 A;  1FZI E;  4M3T A;  3HGK E;  4QNC A;  4EYW A;  3NCI A;  3L8B A;  3CFO A;  4I9L A;  3SI6 A;  1FZ1 E;  4QND A;  4DTP A;  4HCC A;  4FJI A;  4AKG A;  3RWU A;  1FS1 A;  1MMO G;  2E31 A;  4RG8 A;  3LZJ A;  3OGK B;  3SPY A;  1NEX B;  4M3U A;  3NHG A;  3RMD A;  1LDK E;  3TAB A;  2JHC A;  2FW3 A;  4M3R A;  3QEW A;  3QET A;  2P1N B;  1Q9X A;  2JQT A;  1XL3 C;  3C6O B;  4FJM A;  2JH8 A;  4M41 A;  2LF6 A;  3N1E A;  4FVM A;  3SQ4 A;  4B08 A;  4KHU A;  1FZ5 E;  1XU5 E;  3NGI A;  4I9Q A;  3TAE A;  2DY4 A;  4E4B A;  4DU1 A;  3TJY A;  4EP9 A;  4KHQ A;  2OVR B;  2VJ5 A;  3SVI A;  3QEX A;  3CQ8 A;  4ADO A;  4FJ9 A;  3SQ2 A;  3TAF A;  4J2A A;  4DU4 A;  1XVF E;  1FZ7 E;  4JRP A;  3LD8 A;  3CFP A;  3QER A;  3SUQ A;  4J2E A;  4M3Z A;  4AKI A;  2DTU A;  1FZ2 E;  1IH7 A;  2VJ4 A;  3E4Y A;  3UO2 A;  4DTO A;  4DU3 A;  1FYZ E;  3NE6 A;  3SQ1 A;  4AI6 A;  1XMG E;  4DTS A;  3OGL B;  2JHA A;  3C6P B;  2OYQ A;  1XU3 E;  3CFR A;  2P1P B;  4DTR A;  3RMA A;  4JRQ A;  5IBK B;  4FJG A;  1XVB E;  4FJN A;  3HGL A;  3RMB A;  3SQ0 A;  4IT5 A;  4FK0 A;  3KD5 E;  4I6J B;  3HP9 A;  1MTY G;  3J27 A;  3LDS A;  3RMC A;  3OGM B;  1FPO A;  1Q9Y A;  1MHY G;  2LF3 A;  3SUO A;  3LZI A;  1FXX A;  3BVO A;  1FZH E;  3L2O B;  3QEI A;  3QEP A;  1XMH E;  2PFT A;  4J2B A;  3L1N A;  3J2P A;  4KHY A;  2OVQ B;  4X5N A;  4AKH A;  1CLQ A;  4DTU A;  4M3Y A;  4FJ5 A;  3K2O A;  3TL8 B;  3SJJ A;  4FJJ A;  3SUP A;  1FZ6 E;  4FJX A;  4FK2 A;  1FZ9 E;  5IRE A;  1IG9 A;  4KI4 A;  4ICG C;  2P1O B;  4FJK A;  4JS4 A;  3QNN A;  3WSO A;  4FJH A;  2OVP B;  2ATQ A;  3NDK A;  1N1C A;  4JS5 A;  4KHN A;  2PFV A;  3E4W A;  1XMF E;  2HD0 A;  3LDB A;  1MHZ G;  4ADN A;  3S9H A;  3C94 A;  1XVC E;  3C95 A;  2JH9 A;  3N1B A;  2MW2 A;  1XVD E;  2QXF A;  4HCB A;  3UO3 A;  2MZW B;  3C6N B;  2P1Q B;  4X5M A;  3KD1 E;  2JHP A;  1XVE E;  4DTX A;  4FK4 A;  2JPN A;  3QES A;  1P22 A;  2B1E A;  4M42 A;  4DTN A;  2E32 A;  2VIX A;  2H4T A;  1WAF A;  4DTJ A;  3QNO A;  3SPZ A;  3SCX A;  4J2D A;  1FZ3 E;  4DTM A;  3HL8 A;  3L0M A;  4FJ8 A;  4M3X A;  3SNN A;  1FZ0 E;  2RCU A;  4E3S A;  2FYO A;  2K5S A;  4RNG A;  2P1M B;  3TAG A;  1FZ8 E;  3NAE A;  3SUN A;  2OZS A;  1WAJ A;  3UIQ A;  4KHW A;  4FJ7 A;  4GAM C;  4M45 A;  3MKS B;  4KHS A;  4M3W A;  3QEV A;  2YB5 A;  4EPH A;  2OZM A;  1JW2 A; 
#chains in the Genus database with same CATH homology
 2B8I A;  3V7D B;  5IZ7 A;  2P5G A;  4FJL A;  2DEB A;  1XVG E;  2P5O A;  2B7M A;  5H37 A;  1FZ4 E;  2MMB A;  4RL5 A;  4KI6 A;  1FZI E;  3HGK E;  4QNC A;  4EYW A;  3NCI A;  3L8B A;  3CFO A;  4I9L A;  3SI6 A;  1FZ1 E;  4QND A;  4DTP A;  4HCC A;  4FJI A;  4AKG A;  3RWU A;  1FS1 A;  1MMO G;  2E31 A;  4RG8 A;  3LZJ A;  3OGK B;  3SPY A;  1NEX B;  4M3U A;  3NHG A;  3RMD A;  1LDK E;  3TAB A;  2JHC A;  2FW3 A;  4M3R A;  3QEW A;  3QET A;  2P1N B;  1Q9X A;  1XL3 C;  3C6O B;  4FJM A;  2JH8 A;  4M41 A;  2LF6 A;  3N1E A;  4FVM A;  3SQ4 A;  4B08 A;  4KHU A;  1FZ5 E;  1XU5 E;  3NGI A;  4I9Q A;  3TAE A;  2DY4 A;  4E4B A;  4DU1 A;  3TJY A;  4EP9 A;  4KHQ A;  2OVR B;  2VJ5 A;  3SVI A;  3QEX A;  3CQ8 A;  4ADO A;  4FJ9 A;  3SQ2 A;  3TAF A;  4J2A A;  4DU4 A;  1XVF E;  1FZ7 E;  4JRP A;  3LD8 A;  3CFP A;  3QER A;  3SUQ A;  4J2E A;  4M3Z A;  4AKI A;  2DTU A;  1FZ2 E;  1IH7 A;  2VJ4 A;  3E4Y A;  4DTO A;  4DU3 A;  1FYZ E;  3NE6 A;  3SQ1 A;  4AI6 A;  1XMG E;  4DTS A;  3OGL B;  2JHA A;  3C6P B;  2OYQ A;  1XU3 E;  3CFR A;  2P1P B;  4DTR A;  3RMA A;  4JRQ A;  5IBK B;  4FJG A;  1XVB E;  4FJN A;  3HGL A;  3RMB A;  3SQ0 A;  4FK0 A;  3KD5 E;  4I6J B;  3HP9 A;  1MTY G;  3J27 A;  3LDS A;  3RMC A;  3OGM B;  1Q9Y A;  1MHY G;  2LF3 A;  3SUO A;  3LZI A;  1FXX A;  1FZH E;  3L2O B;  3QEI A;  3QEP A;  1XMH E;  2PFT A;  4J2B A;  3L1N A;  3J2P A;  4KHY A;  2OVQ B;  4X5N A;  4AKH A;  1CLQ A;  4DTU A;  4M3Y A;  4FJ5 A;  3K2O A;  3TL8 B;  3SJJ A;  4FJJ A;  3SUP A;  1FZ6 E;  4FJX A;  4FK2 A;  1FZ9 E;  5IRE A;  1IG9 A;  4KI4 A;  2P1O B;  4FJK A;  4JS4 A;  3QNN A;  3WSO A;  4FJH A;  2OVP B;  2ATQ A;  3NDK A;  4KHN A;  4JS5 A;  2PFV A;  3E4W A;  1XMF E;  2HD0 A;  3LDB A;  1MHZ G;  4ADN A;  3S9H A;  3C94 A;  1XVC E;  3C95 A;  2JH9 A;  3N1B A;  1XVD E;  2QXF A;  4HCB A;  2MZW B;  3C6N B;  2P1Q B;  4X5M A;  3KD1 E;  2JHP A;  1XVE E;  4DTX A;  4FK4 A;  2JPN A;  3QES A;  1P22 A;  2B1E A;  4M42 A;  4DTN A;  2E32 A;  2VIX A;  2H4T A;  1WAF A;  4DTJ A;  3QNO A;  3SPZ A;  3SCX A;  4J2D A;  1FZ3 E;  4DTM A;  3HL8 A;  3L0M A;  4FJ8 A;  4M3X A;  3SNN A;  1FZ0 E;  2RCU A;  4E3S A;  2FYO A;  4RNG A;  3TAG A;  2P1M B;  3SUN A;  1FZ8 E;  3NAE A;  2OZS A;  4KHW A;  1WAJ A;  3UIQ A;  4M3T A;  4FJ7 A;  4GAM C;  4M45 A;  3MKS B;  4KHS A;  4M3W A;  3QEV A;  2YB5 A;  4EPH A;  2OZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...