1XU5E

Soluble methane monooxygenase hydroxylase-phenol soaked
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 62
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xu5E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xu5E02
1FZ9E 1FZHE 1FYZE 1FZ4E 1XU3E 1FZ0E 1XMFE 1FZ7E 1XVFE 1FZ8E 1MHYG 1XVDE 1FZ1E 1FZ6E 1XMHE 1XVBE 1XVCE 1MTYG 1XMGE 1XU5E 1FZ5E 1FZIE 1FZ2E 1XVGE 4GAMC 1XVEE 1FZ3E 1MHZG 1MMOG
chains in the Genus database with same CATH superfamily
4FJLA 2P1MB 4ICGC 2JHAA 4KHQA 4M3WA 1FYZE 4M41A 2FYOA 1XU3E 2LF3A 1NEXB 3NAEA 3TAFA 2MZWB 3N1EA 4KI6A 1XMFE 3LZJA 3LZIA 1XVFE 1LDKE 1MHYG 3LDBA 3QESA 3SQ2A 4KHUA 3UO3A 2MW2A 4M3YA 1FZ1E 2VJ5A 3HL8A 4DTUA 4EYWA 4JS5A 1WAFA 3QEPA 4KI4A 2OYQA 3SPYA 4KHYA 3TAEA 1MTYG 3UO2A 4DTNA 3TABA 4KHWA 3CFPA 1FXXA 2JQTA 2E31A 2H4TA 2MMBA 3J27A 4I9LA 3SI6A 3SJJA 3TL8B 3KD1E 4HCCA 2ATQA 1MMOG 3NCIA 2P1NB 1P22A 1FZ9E 4AKHA 1FS1A 3SUNA 4J2AA 3OGLB 1FPOA 1Q9XA 4J2BA 4FJGA 3HP9A 3SPZA 4DU3A 2QXFA 3OGKB 2DEBA 3C6NB 4I6JB 2VJ4A 4RG8A 4FJNA 4KHNA 3SUOA 1XVDE 2YB5A 4X5MA 4M45A 3SVIA 2JH8A 3LD8A 4M3TA 2P5OA 3C6PB 4DTJA 2PFTA 2P1PB 3HGKE 1FZ6E 3KD5E 1XMHE 1IH7A 4FJXA 3OGMB 3NHGA 1XU5E 3QEVA 3SQ0A 3QEWA 2OVPB 3RMBA 4FVMA 4ADNA 4FK0A 3BVOA 4FJIA 5IREA 3RMAA 4DTOA 2RKHA 1XVEE 4JS4A 3C6OB 4DU4A 3QNOA 3L2OB 4ADOA 4M3RA 5IZ7A 3L8BA 4QNDA 2JHCA 2OVQB 2RCUA 4E3SA 4FK4A 2LF6A 3J2PA 3QNNA 2K5SA 1FZ4E 4M3XA 2DY4A 3CQ8A 3CFOA 2P1QB 4J2EA 3L1NA 4FJKA 4M42A 1FZ0E 1CLQA 4EPHA 1FZ7E 3QERA 3UIQA 4FJ7A 3V7DB 2JHPA 3MKSB 4DTXA 4J2DA 4AKIA 5IBKB 4I9QA 3TAGA 4B08A 2OZSA 4HCBA 2HD0A 1XVBE 4DTMA 1XMGE 3C94A 1FZ5E 1FZIE 1WAJA 1XVGE 4KHSA 2FW3A 4AI6A 1FZ3E 3QETA 4FJMA 3SUPA 1MHZG 3SNNA 3NDKA 1XVCE 3K2OA 3TJYA 2B7MA 1Q9YA 3C95A 3NGIA 2B8IA 1FZHE 2OVRB 3E4WA 3N1BA 3SQ4A 2P5GA 2E32A 3RMDA 4FJJA 2DTUA 4DTSA 4RNGA 2OZMA 2JH9A 3CFRA 4IT5A 2PFVA 5H37A 4E4BA 1JW2A 4DU1A 2JPNA 4EP9A 3SUQA 1FZ8E 3LDSA 3RWUA 4FJ8A 4X5NA 4QNCA 4AKGA 3L0MA 1N1CA 4FJHA 4M3ZA 2VIXA 3SCXA 3WSOA 2B1EA 4DTRA 1XL3C 3HGLA 1IG9A 4FJ9A 3S9HA 4FJ5A 3QEXA 4M3UA 2P1OB 4JRPA 1FZ2E 4DTPA 4RL5A 3RMCA 3QEIA 4FK2A 4GAMC 3E4YA 3NE6A 3SQ1A 4JRQA
chains in the Genus database with same CATH topology
4FJLA 2P1MB 2JHAA 4KHQA 4M3WA 1FYZE 4M41A 2FYOA 1XU3E 2LF3A 1NEXB 3NAEA 3TAFA 2MZWB 3N1EA 4KI6A 1XMFE 3LZJA 3LZIA 1XVFE 1LDKE 1MHYG 3LDBA 3QESA 3SQ2A 4KHUA 4M3YA 1FZ1E 2VJ5A 3HL8A 4DTUA 4EYWA 4JS5A 1WAFA 3QEPA 4KI4A 2OYQA 3SPYA 4KHYA 3TAEA 1MTYG 4DTNA 3TABA 4KHWA 3CFPA 1FXXA 2MMBA 2E31A 2H4TA 3J27A 4I9LA 3SI6A 3SJJA 3TL8B 3KD1E 4HCCA 2ATQA 1MMOG 3NCIA 2P1NB 1P22A 1FZ9E 4AKHA 1FS1A 3SUNA 4J2AA 3OGLB 1Q9XA 4J2BA 4FJGA 3HP9A 3SPZA 4DU3A 2QXFA 3OGKB 2DEBA 3C6NB 4I6JB 2VJ4A 4RG8A 4FJNA 4KHNA 3SUOA 1XVDE 2YB5A 4X5MA 4M45A 3SVIA 2JH8A 3LD8A 4M3TA 2P5OA 3C6PB 4DTJA 2PFTA 2P1PB 3HGKE 1FZ6E 3KD5E 1XMHE 1IH7A 4FJXA 3OGMB 3NHGA 1XU5E 3QEVA 3SQ0A 3QEWA 2OVPB 3RMBA 4FVMA 4ADNA 4FK0A 4FJIA 5IREA 3RMAA 4DTOA 1XVEE 4JS4A 3C6OB 4DU4A 3QNOA 3L2OB 4ADOA 4M3RA 5IZ7A 3L8BA 4QNDA 2JHCA 2OVQB 2RCUA 4E3SA 4FK4A 2LF6A 3J2PA 3QNNA 4M3XA 1FZ4E 2DY4A 3CQ8A 3CFOA 2P1QB 4J2EA 3L1NA 4FJKA 4M42A 1FZ0E 1CLQA 4EPHA 1FZ7E 3QERA 3UIQA 4FJ7A 3V7DB 2JHPA 3MKSB 4DTXA 4J2DA 4AKIA 5IBKB 4I9QA 3TAGA 4B08A 2OZSA 4HCBA 2HD0A 1XVBE 4DTMA 1XMGE 3C94A 1FZ5E 1FZIE 1WAJA 1XVGE 4KHSA 2FW3A 4AI6A 1FZ3E 3QETA 4FJMA 3SUPA 1MHZG 3SNNA 3NDKA 1XVCE 3K2OA 3TJYA 2B7MA 1Q9YA 3C95A 3NGIA 2B8IA 1FZHE 2OVRB 3E4WA 3N1BA 3SQ4A 2P5GA 2E32A 3RMDA 4FJJA 2DTUA 4DTSA 4RNGA 2OZMA 2JH9A 3CFRA 2PFVA 5H37A 4E4BA 4DU1A 2JPNA 4EP9A 3SUQA 1FZ8E 3LDSA 3RWUA 4FJ8A 4X5NA 4QNCA 4AKGA 3L0MA 4FJHA 4M3ZA 2VIXA 3SCXA 3WSOA 2B1EA 4DTRA 1XL3C 3HGLA 1IG9A 4FJ9A 3S9HA 4FJ5A 3QEXA 4M3UA 2P1OB 4JRPA 1FZ2E 4DTPA 4RL5A 3RMCA 3QEIA 4FK2A 4GAMC 3E4YA 3NE6A 3SQ1A 4JRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ9 E;  1FZH E;  1FYZ E;  1FZ4 E;  1XU3 E;  1FZ0 E;  1XMF E;  1FZ7 E;  1XVF E;  1FZ8 E;  1MHY G;  1XVD E;  1FZ1 E;  1FZ6 E;  1XMH E;  1XVB E;  1XVC E;  1MTY G;  1XMG E;  1XU5 E;  1FZ5 E;  1FZI E;  1FZ2 E;  1XVG E;  4GAM C;  1XVE E;  1FZ3 E;  1MHZ G;  1MMO G; 
#chains in the Genus database with same CATH topology
 4FJL A;  2P1M B;  4ICG C;  2JHA A;  4KHQ A;  4M3W A;  1FYZ E;  4M41 A;  2FYO A;  1XU3 E;  2LF3 A;  1NEX B;  3NAE A;  3TAF A;  2MZW B;  3N1E A;  4KI6 A;  1XMF E;  3LZJ A;  3LZI A;  1XVF E;  1LDK E;  1MHY G;  3LDB A;  3QES A;  3SQ2 A;  4KHU A;  3UO3 A;  2MW2 A;  4M3Y A;  1FZ1 E;  2VJ5 A;  3HL8 A;  4DTU A;  4EYW A;  4JS5 A;  1WAF A;  3QEP A;  4KI4 A;  2OYQ A;  3SPY A;  4KHY A;  3TAE A;  1MTY G;  3UO2 A;  4DTN A;  3TAB A;  4KHW A;  3CFP A;  1FXX A;  2JQT A;  2E31 A;  2H4T A;  2MMB A;  3J27 A;  4I9L A;  3SI6 A;  3SJJ A;  3TL8 B;  3KD1 E;  4HCC A;  2ATQ A;  1MMO G;  3NCI A;  2P1N B;  1P22 A;  1FZ9 E;  4AKH A;  1FS1 A;  3SUN A;  4J2A A;  3OGL B;  1FPO A;  1Q9X A;  4J2B A;  4FJG A;  3HP9 A;  3SPZ A;  4DU3 A;  2QXF A;  3OGK B;  2DEB A;  3C6N B;  4I6J B;  2VJ4 A;  4RG8 A;  4FJN A;  4KHN A;  3SUO A;  1XVD E;  2YB5 A;  4X5M A;  4M45 A;  3SVI A;  2JH8 A;  3LD8 A;  4M3T A;  2P5O A;  3C6P B;  4DTJ A;  2PFT A;  2P1P B;  3HGK E;  1FZ6 E;  3KD5 E;  1XMH E;  1IH7 A;  4FJX A;  3OGM B;  3NHG A;  1XU5 E;  3QEV A;  3SQ0 A;  3QEW A;  2OVP B;  3RMB A;  4FVM A;  4ADN A;  4FK0 A;  3BVO A;  4FJI A;  5IRE A;  3RMA A;  4DTO A;  2RKH A;  1XVE E;  4JS4 A;  3C6O B;  4DU4 A;  3QNO A;  3L2O B;  4ADO A;  4M3R A;  5IZ7 A;  3L8B A;  4QND A;  2JHC A;  2OVQ B;  2RCU A;  4E3S A;  4FK4 A;  2LF6 A;  3J2P A;  3QNN A;  2K5S A;  1FZ4 E;  4M3X A;  2DY4 A;  3CQ8 A;  3CFO A;  2P1Q B;  4J2E A;  3L1N A;  4FJK A;  4M42 A;  1FZ0 E;  1CLQ A;  4EPH A;  1FZ7 E;  3QER A;  3UIQ A;  4FJ7 A;  3V7D B;  2JHP A;  3MKS B;  4DTX A;  4J2D A;  4AKI A;  5IBK B;  4I9Q A;  3TAG A;  4B08 A;  2OZS A;  4HCB A;  2HD0 A;  1XVB E;  4DTM A;  1XMG E;  3C94 A;  1FZ5 E;  1FZI E;  1WAJ A;  1XVG E;  4KHS A;  2FW3 A;  4AI6 A;  1FZ3 E;  3QET A;  4FJM A;  3SUP A;  1MHZ G;  3SNN A;  3NDK A;  1XVC E;  3K2O A;  3TJY A;  2B7M A;  1Q9Y A;  3C95 A;  3NGI A;  2B8I A;  1FZH E;  2OVR B;  3E4W A;  3N1B A;  3SQ4 A;  2P5G A;  2E32 A;  3RMD A;  4FJJ A;  2DTU A;  4DTS A;  4RNG A;  2OZM A;  2JH9 A;  3CFR A;  4IT5 A;  2PFV A;  5H37 A;  4E4B A;  1JW2 A;  4DU1 A;  2JPN A;  4EP9 A;  3SUQ A;  1FZ8 E;  3LDS A;  3RWU A;  4FJ8 A;  4X5N A;  4QNC A;  4AKG A;  3L0M A;  1N1C A;  4FJH A;  4M3Z A;  2VIX A;  3SCX A;  3WSO A;  2B1E A;  4DTR A;  1XL3 C;  3HGL A;  1IG9 A;  4FJ9 A;  3S9H A;  4FJ5 A;  3QEX A;  4M3U A;  2P1O B;  4JRP A;  1FZ2 E;  4DTP A;  4RL5 A;  3RMC A;  3QEI A;  4FK2 A;  4GAM C;  3E4Y A;  3NE6 A;  3SQ1 A;  4JRQ A; 
#chains in the Genus database with same CATH homology
 4FJL A;  2P1M B;  2JHA A;  4KHQ A;  4M3W A;  1FYZ E;  4M41 A;  2FYO A;  1XU3 E;  2LF3 A;  1NEX B;  3NAE A;  3TAF A;  2MZW B;  3N1E A;  4KI6 A;  1XMF E;  3LZJ A;  3LZI A;  1XVF E;  1LDK E;  1MHY G;  3LDB A;  3QES A;  3SQ2 A;  4KHU A;  4M3Y A;  1FZ1 E;  2VJ5 A;  3HL8 A;  4DTU A;  4EYW A;  4JS5 A;  1WAF A;  3QEP A;  4KI4 A;  2OYQ A;  3SPY A;  4KHY A;  3TAE A;  1MTY G;  4DTN A;  3TAB A;  4KHW A;  3CFP A;  1FXX A;  2MMB A;  2E31 A;  2H4T A;  3J27 A;  4I9L A;  3SI6 A;  3SJJ A;  3TL8 B;  3KD1 E;  4HCC A;  2ATQ A;  1MMO G;  3NCI A;  2P1N B;  1P22 A;  1FZ9 E;  4AKH A;  1FS1 A;  3SUN A;  4J2A A;  3OGL B;  1Q9X A;  4J2B A;  4FJG A;  3HP9 A;  3SPZ A;  4DU3 A;  2QXF A;  3OGK B;  2DEB A;  3C6N B;  4I6J B;  2VJ4 A;  4RG8 A;  4FJN A;  4KHN A;  3SUO A;  1XVD E;  2YB5 A;  4X5M A;  4M45 A;  3SVI A;  2JH8 A;  3LD8 A;  4M3T A;  2P5O A;  3C6P B;  4DTJ A;  2PFT A;  2P1P B;  3HGK E;  1FZ6 E;  3KD5 E;  1XMH E;  1IH7 A;  4FJX A;  3OGM B;  3NHG A;  1XU5 E;  3QEV A;  3SQ0 A;  3QEW A;  2OVP B;  3RMB A;  4FVM A;  4ADN A;  4FK0 A;  4FJI A;  5IRE A;  3RMA A;  4DTO A;  1XVE E;  4JS4 A;  3C6O B;  4DU4 A;  3QNO A;  3L2O B;  4ADO A;  4M3R A;  5IZ7 A;  3L8B A;  4QND A;  2JHC A;  2OVQ B;  2RCU A;  4E3S A;  4FK4 A;  2LF6 A;  3J2P A;  3QNN A;  4M3X A;  1FZ4 E;  2DY4 A;  3CQ8 A;  3CFO A;  2P1Q B;  4J2E A;  3L1N A;  4FJK A;  4M42 A;  1FZ0 E;  1CLQ A;  4EPH A;  1FZ7 E;  3QER A;  3UIQ A;  4FJ7 A;  3V7D B;  2JHP A;  3MKS B;  4DTX A;  4J2D A;  4AKI A;  5IBK B;  4I9Q A;  3TAG A;  4B08 A;  2OZS A;  4HCB A;  2HD0 A;  1XVB E;  4DTM A;  1XMG E;  3C94 A;  1FZ5 E;  1FZI E;  1WAJ A;  1XVG E;  4KHS A;  2FW3 A;  4AI6 A;  1FZ3 E;  3QET A;  4FJM A;  3SUP A;  1MHZ G;  3SNN A;  3NDK A;  1XVC E;  3K2O A;  3TJY A;  2B7M A;  1Q9Y A;  3C95 A;  3NGI A;  2B8I A;  1FZH E;  2OVR B;  3E4W A;  3N1B A;  3SQ4 A;  2P5G A;  2E32 A;  3RMD A;  4FJJ A;  2DTU A;  4DTS A;  4RNG A;  2OZM A;  2JH9 A;  3CFR A;  2PFV A;  5H37 A;  4E4B A;  4DU1 A;  2JPN A;  4EP9 A;  3SUQ A;  1FZ8 E;  3LDS A;  3RWU A;  4FJ8 A;  4X5N A;  4QNC A;  4AKG A;  3L0M A;  4FJH A;  4M3Z A;  2VIX A;  3SCX A;  3WSO A;  2B1E A;  4DTR A;  1XL3 C;  3HGL A;  1IG9 A;  4FJ9 A;  3S9H A;  4FJ5 A;  3QEX A;  4M3U A;  2P1O B;  4JRP A;  1FZ2 E;  4DTP A;  4RL5 A;  3RMC A;  3QEI A;  4FK2 A;  4GAM C;  3E4Y A;  3NE6 A;  3SQ1 A;  4JRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...