2JQTA

Structure of the bacterial replication origin-associated protein cnu
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
MTVQDYLLKFRKISSLESLEKLYDHLNYTLTDDQELINMYRAADHRRAELVSGGRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-NS/stpA-binding protein 2
publication title Structure of the nucleoid-associated protein Cnu reveals common binding sites for H-NS in Cnu and Hha.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 2jqtA00
2MW2A 4ICGC 2JQTA 2K5SA 1JW2A
chains in the Genus database with same CATH superfamily
3OGLB 4DTNA 4M41A 1Q9XA 1FYZE 5IREA 3QEPA 1MHYG 1XVGE 4KHUA 1FZ0E 4DTUA 2JHAA 3V7DB 4M3XA 1FZ6E 3UO3A 3TAGA 3SUQA 4J2BA 1FZ1E 4AKGA 4E4BA 3QEIA 3SUNA 1FZ5E 2P5GA 3SPZA 3SNNA 1XVDE 4FJNA 3RMAA 4HCBA 3SUPA 4X5NA 3C6OB 1XVBE 1JW2A 1FZ9E 3KD1E 2E32A 3E4WA 4M45A 4JS4A 2LF6A 4FJXA 4ICGC 3RWUA 4E3SA 3QERA 2QXFA 4AI6A 3MKSB 1NEXB 2OVRB 4QNDA 3NHGA 3CQ8A 3SCXA 3SPYA 3UIQA 4FJGA 3NCIA 4M3TA 3LDBA 2B7MA 4FJJA 4JRPA 4DTSA 5IBKB 3KD5E 4M3RA 3CFOA 4FK0A 4J2DA 3SUOA 3CFRA 4EPHA 4FJ9A 3OGMB 2JHPA 3CFPA 2JHCA 3TAFA 4RG8A 1N1CA 3QESA 1FZIE 4HCCA 4M42A 3L0MA 1MHZG 2VIXA 2RCUA 2MZWB 4JS5A 4FJIA 4J2EA 2DTUA 2LF3A 1WAFA 4B08A 4JRQA 4RL5A 4FJLA 3TJYA 4KHNA 4FJHA 1XVCE 4IT5A 1XMHE 3L1NA 3SQ0A 4KHYA 1FZ7E 4DTPA 1XMGE 2OVPB 3NE6A 4KI6A 5H37A 3SVIA 2E31A 4I9QA 4DTXA 3C6NB 2P1MB 1IG9A 3QNNA 2PFTA 2JPNA 3C95A 4RNGA 3TABA 4FK2A 2P1PB 3NGIA 4DTMA 4EP9A 3C6PB 3RMDA 1CLQA 1FZ8E 4I9LA 4KHSA 3C94A 3TL8B 3HGLA 2P5OA 2VJ5A 3LZJA 3RMBA 3UO2A 4M3ZA 4AKHA 1FS1A 3SQ1A 2B8IA 3QEWA 3NDKA 3S9HA 3SJJA 2JQTA 4DTJA 1XVEE 2RKHA 1FZ4E 2K5SA 3WSOA 3NAEA 3LZIA 4FJMA 4I6JB 4FVMA 3RMCA 4FJ5A 4AKIA 2JH9A 3J2PA 3QEVA 1WAJA 2PFVA 4QNCA 4FJ8A 4DTRA 2P1QB 4EYWA 1XU3E 2HD0A 4DU3A 3L2OB 2OVQB 3QETA 2FYOA 1XL3C 4DU1A 1MMOG 1XU5E 4ADNA 2OZSA 2YB5A 4FK4A 2ATQA 3SI6A 5IZ7A 1FXXA 2H4TA 1XMFE 3SQ2A 3E4YA 2DEBA 4FJ7A 2JH8A 3SQ4A 1Q9YA 2MMBA 3HGKE 3J27A 4GAMC 2OZMA 3QNOA 3BVOA 1FZHE 2P1NB 4X5MA 1FPOA 2OYQA 1IH7A 1MTYG 2MW2A 2P1OB 3QEXA 2DY4A 3OGKB 4FJKA 4J2AA 1FZ3E 1LDKE 4M3WA 1FZ2E 3TAEA 3N1EA 4KI4A 3L8BA 3LD8A 4DTOA 1XVFE 4M3UA 4DU4A 3HL8A 1P22A 2B1EA 3N1BA 4M3YA 4ADOA 2VJ4A 4KHWA 4KHQA 3K2OA 3HP9A 3LDSA 2FW3A
chains in the Genus database with same CATH topology
2MW2A 4ICGC 2JQTA 2K5SA 1JW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MW2 A;  4ICG C;  2JQT A;  2K5S A;  1JW2 A; 
#chains in the Genus database with same CATH topology
 3OGL B;  4DTN A;  4M41 A;  1Q9X A;  1FYZ E;  5IRE A;  3QEP A;  1MHY G;  1XVG E;  4KHU A;  1FZ0 E;  4DTU A;  2JHA A;  3V7D B;  4M3X A;  1FZ6 E;  3UO3 A;  3TAG A;  3SUQ A;  4J2B A;  1FZ1 E;  4AKG A;  4E4B A;  3QEI A;  3SUN A;  1FZ5 E;  2P5G A;  3SPZ A;  3SNN A;  1XVD E;  4FJN A;  3RMA A;  4HCB A;  3SUP A;  4X5N A;  3C6O B;  1XVB E;  1JW2 A;  1FZ9 E;  3KD1 E;  2E32 A;  3E4W A;  4M45 A;  4JS4 A;  2LF6 A;  4FJX A;  4ICG C;  3RWU A;  4E3S A;  3QER A;  2QXF A;  4AI6 A;  3MKS B;  1NEX B;  2OVR B;  4QND A;  3NHG A;  3CQ8 A;  3SCX A;  3SPY A;  3UIQ A;  4FJG A;  3NCI A;  4M3T A;  3LDB A;  2B7M A;  4FJJ A;  4JRP A;  4DTS A;  5IBK B;  3KD5 E;  4M3R A;  3CFO A;  4FK0 A;  4J2D A;  3SUO A;  3CFR A;  4EPH A;  4FJ9 A;  3OGM B;  2JHP A;  3CFP A;  2JHC A;  3TAF A;  4RG8 A;  1N1C A;  3QES A;  1FZI E;  4HCC A;  4M42 A;  3L0M A;  1MHZ G;  2VIX A;  2RCU A;  2MZW B;  4JS5 A;  4FJI A;  4J2E A;  2DTU A;  2LF3 A;  1WAF A;  4B08 A;  4JRQ A;  4RL5 A;  4FJL A;  3TJY A;  4KHN A;  4FJH A;  1XVC E;  4IT5 A;  1XMH E;  3L1N A;  3SQ0 A;  4KHY A;  1FZ7 E;  4DTP A;  1XMG E;  2OVP B;  3NE6 A;  4KI6 A;  5H37 A;  3SVI A;  2E31 A;  4I9Q A;  4DTX A;  3C6N B;  2P1M B;  1IG9 A;  3QNN A;  2PFT A;  2JPN A;  3C95 A;  4RNG A;  3TAB A;  4FK2 A;  2P1P B;  3NGI A;  4DTM A;  4EP9 A;  3C6P B;  3RMD A;  1CLQ A;  1FZ8 E;  4I9L A;  4KHS A;  3C94 A;  3TL8 B;  3HGL A;  2P5O A;  2VJ5 A;  3LZJ A;  3RMB A;  3UO2 A;  4M3Z A;  4AKH A;  1FS1 A;  3SQ1 A;  2B8I A;  3QEW A;  3NDK A;  3S9H A;  3SJJ A;  2JQT A;  4DTJ A;  1XVE E;  2RKH A;  1FZ4 E;  2K5S A;  3WSO A;  3NAE A;  3LZI A;  4FJM A;  4I6J B;  4FVM A;  3RMC A;  4FJ5 A;  4AKI A;  2JH9 A;  3J2P A;  3QEV A;  1WAJ A;  2PFV A;  4QNC A;  4FJ8 A;  4DTR A;  2P1Q B;  4EYW A;  1XU3 E;  2HD0 A;  4DU3 A;  3L2O B;  2OVQ B;  3QET A;  2FYO A;  1XL3 C;  4DU1 A;  1MMO G;  1XU5 E;  4ADN A;  2OZS A;  2YB5 A;  4FK4 A;  2ATQ A;  3SI6 A;  5IZ7 A;  1FXX A;  2H4T A;  1XMF E;  3SQ2 A;  3E4Y A;  2DEB A;  4FJ7 A;  2JH8 A;  3SQ4 A;  1Q9Y A;  2MMB A;  3HGK E;  3J27 A;  4GAM C;  2OZM A;  3QNO A;  3BVO A;  1FZH E;  2P1N B;  4X5M A;  1FPO A;  2OYQ A;  1IH7 A;  1MTY G;  2MW2 A;  2P1O B;  3QEX A;  2DY4 A;  3OGK B;  4FJK A;  4J2A A;  1FZ3 E;  1LDK E;  4M3W A;  1FZ2 E;  3TAE A;  3N1E A;  4KI4 A;  3L8B A;  3LD8 A;  4DTO A;  1XVF E;  4M3U A;  4DU4 A;  3HL8 A;  1P22 A;  2B1E A;  3N1B A;  4M3Y A;  4ADO A;  2VJ4 A;  4KHW A;  4KHQ A;  3K2O A;  3HP9 A;  3LDS A;  2FW3 A; 
#chains in the Genus database with same CATH homology
 2MW2 A;  4ICG C;  2JQT A;  2K5S A;  1JW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...