2JQTA

Structure of the bacterial replication origin-associated protein cnu
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
b'MTVQDYLLKFRKISSLESLEKLYDHLNYTLTDDQELINMYRAADHRRAELVSGGRLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-NS/stpA-binding protein 2
publication title Structure of the nucleoid-associated protein Cnu reveals common binding sites for H-NS in Cnu and Hha.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 2jqtA00
2MW2A 1JW2A 4ICGC 2JQTA 2K5SA
chains in the Genus database with same CATH superfamily
3RMBA 3LD8A 1XU5E 3WSOA 4X5MA 4DTSA 3NHGA 3E4YA 4DU4A 3QEWA 1XMHE 3TAGA 2P5GA 4JRPA 3KD1E 3SPZA 4I6JB 2P1PB 4FK4A 3OGLB 3C95A 4KHQA 3NDKA 3BVOA 2RKHA 2RCUA 1FS1A 2JHPA 1XVEE 4X5NA 1P22A 2FW3A 3C6NB 3C94A 3L0MA 3KD5E 4FJNA 1NEXB 3J2PA 3QEIA 1FZ6E 3RWUA 3SVIA 3SJJA 3L1NA 5IREA 3LDSA 3HL8A 3SNNA 3CFRA 1FZ4E 4M41A 2P1MB 1FZHE 3RMDA 4FJKA 1JW2A 2JH8A 2VIXA 4JS4A 3CQ8A 4RG8A 2DEBA 1WAFA 3NE6A 2DTUA 1XVCE 4KHWA 2OZSA 1XU3E 2PFVA 3SUQA 3RMCA 3SQ0A 3HP9A 4AKIA 3SQ2A 3UO3A 3V7DB 3QEXA 2JH9A 4I9QA 4J2AA 1IG9A 1XMGE 4M3RA 2OVQB 4ADNA 1FZ1E 3QNNA 2FYOA 2LF6A 2VJ5A 4FJIA 3MKSB 4FJJA 3TL8B 4HCCA 2MMBA 1CLQA 1XVGE 4EPHA 5IBKB 4M3TA 4DTRA 4DTOA 4M42A 3L2OB 3OGMB 3NGIA 3QEVA 2B8IA 4DTJA 4QNDA 3QESA 4KHUA 4M3XA 4AI6A 1FXXA 2JQTA 3SCXA 4KHYA 1MMOG 1FZ5E 1FZ3E 4EYWA 3NCIA 4FJHA 3UIQA 2JHAA 2B1EA 4QNCA 4FJ5A 1IH7A 2QXFA 3QEPA 1FPOA 3K2OA 1Q9YA 2B7MA 4KHSA 2PFTA 2LF3A 1FYZE 4E4BA 4ICGC 4FK0A 4ADOA 1MHYG 3OGKB 1FZ8E 2OVRB 3C6PB 3J27A 1XVDE 4GAMC 2MW2A 3QERA 3QETA 3SQ1A 2OYQA 4FJ9A 5H37A 3E4WA 2P5OA 4M45A 4FJ7A 4DTUA 1XVBE 2H4TA 1FZIE 4JRQA 4DTPA 4EP9A 2JHCA 3SPYA 3SUPA 2OZMA 3HGKE 2P1QB 4RNGA 3CFPA 4M3YA 3TAEA 1XVFE 4IT5A 2YB5A 2OVPB 4DTXA 3CFOA 3C6OB 3L8BA 4I9LA 3LZIA 4E3SA 4M3ZA 4DU3A 4AKHA 3S9HA 2P1NB 4DTNA 3SI6A 1MTYG 2E31A 1FZ2E 1N1CA 2ATQA 3HGLA 1XL3C 3SUNA 2E32A 3SQ4A 4J2BA 2JPNA 4HCBA 3SUOA 3NAEA 2HD0A 1MHZG 2K5SA 5IZ7A 4KI6A 4FVMA 4AKGA 2MZWB 3QNOA 1LDKE 3TAFA 4FJGA 3TJYA 1WAJA 4J2DA 4KHNA 4KI4A 4DTMA 2DY4A 3N1EA 1XMFE 4JS5A 4M3UA 3LDBA 4FJXA 2P1OB 4FJLA 1FZ0E 3RMAA 1Q9XA 4FJMA 2VJ4A 4B08A 4J2EA 4M3WA 1FZ9E 3UO2A 3LZJA 4DU1A 4FJ8A 3N1BA 4RL5A 4FK2A 3TABA 1FZ7E
chains in the Genus database with same CATH topology
2MW2A 1JW2A 4ICGC 2JQTA 2K5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MW2 A;  1JW2 A;  4ICG C;  2JQT A;  2K5S A; 
#chains in the Genus database with same CATH topology
 3RMB A;  3LD8 A;  1XU5 E;  3WSO A;  4X5M A;  4DTS A;  3NHG A;  3E4Y A;  4DU4 A;  3QEW A;  1XMH E;  3TAG A;  2P5G A;  4JRP A;  3KD1 E;  3SPZ A;  4I6J B;  2P1P B;  4FK4 A;  3OGL B;  3C95 A;  4KHQ A;  3NDK A;  3BVO A;  2RKH A;  2RCU A;  1FS1 A;  2JHP A;  1XVE E;  4X5N A;  1P22 A;  2FW3 A;  3C6N B;  3C94 A;  3L0M A;  3KD5 E;  4FJN A;  1NEX B;  3J2P A;  3QEI A;  1FZ6 E;  3RWU A;  3SVI A;  3SJJ A;  3L1N A;  5IRE A;  3LDS A;  3HL8 A;  3SNN A;  3CFR A;  1FZ4 E;  4M41 A;  2P1M B;  1FZH E;  3RMD A;  4FJK A;  1JW2 A;  2JH8 A;  2VIX A;  4JS4 A;  3CQ8 A;  4RG8 A;  2DEB A;  1WAF A;  3NE6 A;  2DTU A;  1XVC E;  4KHW A;  2OZS A;  1XU3 E;  2PFV A;  3SUQ A;  3RMC A;  3SQ0 A;  3HP9 A;  4AKI A;  3SQ2 A;  3UO3 A;  3V7D B;  3QEX A;  2JH9 A;  4I9Q A;  4J2A A;  1IG9 A;  1XMG E;  4M3R A;  2OVQ B;  4ADN A;  1FZ1 E;  3QNN A;  2FYO A;  2LF6 A;  2VJ5 A;  4FJI A;  3MKS B;  4FJJ A;  3TL8 B;  4HCC A;  2MMB A;  1CLQ A;  1XVG E;  4EPH A;  5IBK B;  4M3T A;  4DTR A;  4DTO A;  4M42 A;  3L2O B;  3OGM B;  3NGI A;  3QEV A;  2B8I A;  4DTJ A;  4QND A;  3QES A;  4KHU A;  4M3X A;  4AI6 A;  1FXX A;  2JQT A;  3SCX A;  4KHY A;  1MMO G;  1FZ5 E;  1FZ3 E;  4EYW A;  3NCI A;  4FJH A;  3UIQ A;  2JHA A;  2B1E A;  4QNC A;  4FJ5 A;  1IH7 A;  2QXF A;  3QEP A;  1FPO A;  3K2O A;  1Q9Y A;  2B7M A;  4KHS A;  2PFT A;  2LF3 A;  1FYZ E;  4E4B A;  4ICG C;  4FK0 A;  4ADO A;  1MHY G;  3OGK B;  1FZ8 E;  2OVR B;  3C6P B;  3J27 A;  1XVD E;  4GAM C;  2MW2 A;  3QER A;  3QET A;  3SQ1 A;  2OYQ A;  4FJ9 A;  5H37 A;  3E4W A;  2P5O A;  4M45 A;  4FJ7 A;  4DTU A;  1XVB E;  2H4T A;  1FZI E;  4JRQ A;  4DTP A;  4EP9 A;  2JHC A;  3SPY A;  3SUP A;  2OZM A;  3HGK E;  2P1Q B;  4RNG A;  3CFP A;  4M3Y A;  3TAE A;  1XVF E;  4IT5 A;  2YB5 A;  2OVP B;  4DTX A;  3CFO A;  3C6O B;  3L8B A;  4I9L A;  3LZI A;  4E3S A;  4M3Z A;  4DU3 A;  4AKH A;  3S9H A;  2P1N B;  4DTN A;  3SI6 A;  1MTY G;  2E31 A;  1FZ2 E;  1N1C A;  2ATQ A;  3HGL A;  1XL3 C;  3SUN A;  2E32 A;  3SQ4 A;  4J2B A;  2JPN A;  4HCB A;  3SUO A;  3NAE A;  2HD0 A;  1MHZ G;  2K5S A;  5IZ7 A;  4KI6 A;  4FVM A;  4AKG A;  2MZW B;  3QNO A;  1LDK E;  3TAF A;  4FJG A;  3TJY A;  1WAJ A;  4J2D A;  4KHN A;  4KI4 A;  4DTM A;  2DY4 A;  3N1E A;  1XMF E;  4JS5 A;  4M3U A;  3LDB A;  4FJX A;  2P1O B;  4FJL A;  1FZ0 E;  3RMA A;  1Q9X A;  4FJM A;  2VJ4 A;  4B08 A;  4J2E A;  4M3W A;  1FZ9 E;  3UO2 A;  3LZJ A;  4DU1 A;  4FJ8 A;  3N1B A;  4RL5 A;  4FK2 A;  3TAB A;  1FZ7 E; 
#chains in the Genus database with same CATH homology
 2MW2 A;  1JW2 A;  4ICG C;  2JQT A;  2K5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...