2JQTA

Structure of the bacterial replication origin-associated protein cnu
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
MTVQDYLLKFRKISSLESLEKLYDHLNYTLTDDQELINMYRAADHRRAELVSGGRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords H-NS/stpA-binding protein 2
publication title Structure of the nucleoid-associated protein Cnu reveals common binding sites for H-NS in Cnu and Hha.
pubmed doi rcsb
source organism Escherichia coli
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 2jqtA00
2JQTA 2K5SA 4ICGC 2MW2A 1JW2A
chains in the Genus database with same CATH superfamily
1FZ0E 2JQTA 2FW3A 3J27A 3NHGA 2OYQA 3RWUA 3SVIA 3V7DB 4J2DA 4DTPA 3QEWA 3TAFA 4EPHA 4JS4A 4DTSA 3SPYA 4FJXA 2PFVA 4KI6A 4DTJA 3RMBA 1FZHE 2P5GA 2MMBA 4FJMA 4KHYA 5H37A 3TAGA 4AKHA 4FK4A 4M42A 3SI6A 3RMDA 3CFOA 4JS5A 3QEIA 4M3WA 1MHZG 1Q9YA 4M3RA 4FJKA 4FJJA 3UO2A 4FJ5A 2VJ5A 3OGMB 3SNNA 3E4YA 3SUNA 3SJJA 2MZWB 3OGKB 1JW2A 4KHNA 1XU3E 3TABA 3TL8B 3KD5E 2LF6A 3N1EA 2OZSA 1XVBE 4FJIA 4IT5A 4M3UA 4HCCA 1FZ8E 3NE6A 3CQ8A 2QXFA 3NAEA 2JHPA 3WSOA 4FJGA 4DTNA 1FZ9E 3LDSA 2P1QB 4B08A 3S9HA 2H4TA 2JH8A 1FZ7E 3HL8A 4KHWA 1FZ5E 3HP9A 1XVGE 4FJ7A 2OVPB 2P1NB 4HCBA 4KHSA 1N1CA 2K5SA 4E4BA 4DTOA 3RMCA 3CFPA 2JH9A 2JHCA 1FPOA 2VIXA 3C6OB 3TJYA 4FJ8A 2FYOA 3SCXA 4FJHA 4I9QA 1NEXB 3NDKA 4M41A 3TAEA 1FZ3E 4M3ZA 3BVOA 4QNDA 2ATQA 3N1BA 2RKHA 3SQ2A 3SUQA 1XVEE 1FZIE 3NGIA 2OVRB 2JHAA 4RNGA 4JRQA 1MMOG 1CLQA 4M3YA 4AKIA 4M3XA 1IG9A 3QESA 3QEXA 4DTXA 4RG8A 3L0MA 4AKGA 4FJ9A 2DTUA 2P1OB 3LZJA 1XVCE 3LDBA 1WAFA 2OZMA 2B8IA 3QETA 2YB5A 4J2BA 2VJ4A 1FZ4E 1FZ2E 4EYWA 3SUOA 1FZ6E 2MW2A 4ADOA 4FJNA 1FS1A 1FZ1E 3SPZA 1Q9XA 4FVMA 4X5MA 1WAJA 3C6PB 4GAMC 2P1PB 3UIQA 3J2PA 1IH7A 2JPNA 2LF3A 4I9LA 4DTRA 3SQ4A 3QNOA 3C94A 4EP9A 3K2OA 2B7MA 3QEPA 4M45A 1MTYG 3LZIA 2E31A 3SQ1A 3KD1E 2P1MB 4X5NA 1XL3C 1XU5E 3LD8A 2P5OA 1LDKE 3L2OB 4FK2A 1XVDE 4KHQA 4QNCA 4E3SA 1XMHE 4DU3A 3QEVA 4M3TA 2OVQB 3HGKE 4I6JB 3OGLB 4DU4A 4FK0A 3NCIA 3SUPA 3MKSB 4FJLA 1MHYG 2E32A 3HGLA 3L1NA 3RMAA 4ADNA 4KI4A 3SQ0A 4KHUA 4J2EA 5IZ7A 1XMFE 3L8BA 1P22A 4DTMA 1FXXA 2B1EA 2HD0A 3UO3A 4RL5A 3CFRA 3QNNA 5IREA 5IBKB 4J2AA 2DY4A 2RCUA 4DTUA 3QERA 3C6NB 4AI6A 3C95A 2DEBA 4ICGC 1XVFE 2PFTA 1XMGE 3E4WA 4DU1A 1FYZE 4JRPA
chains in the Genus database with same CATH topology
2JQTA 2K5SA 4ICGC 2MW2A 1JW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQT A;  2K5S A;  4ICG C;  2MW2 A;  1JW2 A; 
#chains in the Genus database with same CATH topology
 1FZ0 E;  2JQT A;  2FW3 A;  3J27 A;  3NHG A;  2OYQ A;  3RWU A;  3SVI A;  3V7D B;  4J2D A;  4DTP A;  3QEW A;  3TAF A;  4EPH A;  4JS4 A;  4DTS A;  3SPY A;  4FJX A;  2PFV A;  4KI6 A;  4DTJ A;  3RMB A;  1FZH E;  2P5G A;  2MMB A;  4FJM A;  4KHY A;  5H37 A;  3TAG A;  4AKH A;  4FK4 A;  4M42 A;  3SI6 A;  3RMD A;  3CFO A;  4JS5 A;  3QEI A;  4M3W A;  1MHZ G;  1Q9Y A;  4M3R A;  4FJK A;  4FJJ A;  3UO2 A;  4FJ5 A;  2VJ5 A;  3OGM B;  3SNN A;  3E4Y A;  3SUN A;  3SJJ A;  2MZW B;  3OGK B;  1JW2 A;  4KHN A;  1XU3 E;  3TAB A;  3TL8 B;  3KD5 E;  2LF6 A;  3N1E A;  2OZS A;  1XVB E;  4FJI A;  4IT5 A;  4M3U A;  4HCC A;  1FZ8 E;  3NE6 A;  3CQ8 A;  2QXF A;  3NAE A;  2JHP A;  3WSO A;  4FJG A;  4DTN A;  1FZ9 E;  3LDS A;  2P1Q B;  4B08 A;  3S9H A;  2H4T A;  2JH8 A;  1FZ7 E;  3HL8 A;  4KHW A;  1FZ5 E;  3HP9 A;  1XVG E;  4FJ7 A;  2OVP B;  2P1N B;  4HCB A;  4KHS A;  1N1C A;  2K5S A;  4E4B A;  4DTO A;  3RMC A;  3CFP A;  2JH9 A;  2JHC A;  1FPO A;  2VIX A;  3C6O B;  3TJY A;  4FJ8 A;  2FYO A;  3SCX A;  4FJH A;  4I9Q A;  1NEX B;  3NDK A;  4M41 A;  3TAE A;  1FZ3 E;  4M3Z A;  3BVO A;  4QND A;  2ATQ A;  3N1B A;  2RKH A;  3SQ2 A;  3SUQ A;  1XVE E;  1FZI E;  3NGI A;  2OVR B;  2JHA A;  4RNG A;  4JRQ A;  1MMO G;  1CLQ A;  4M3Y A;  4AKI A;  4M3X A;  1IG9 A;  3QES A;  3QEX A;  4DTX A;  4RG8 A;  3L0M A;  4AKG A;  4FJ9 A;  2DTU A;  2P1O B;  3LZJ A;  1XVC E;  3LDB A;  1WAF A;  2OZM A;  2B8I A;  3QET A;  2YB5 A;  4J2B A;  2VJ4 A;  1FZ4 E;  1FZ2 E;  4EYW A;  3SUO A;  1FZ6 E;  2MW2 A;  4ADO A;  4FJN A;  1FS1 A;  1FZ1 E;  3SPZ A;  1Q9X A;  4FVM A;  4X5M A;  1WAJ A;  3C6P B;  4GAM C;  2P1P B;  3UIQ A;  3J2P A;  1IH7 A;  2JPN A;  2LF3 A;  4I9L A;  4DTR A;  3SQ4 A;  3QNO A;  3C94 A;  4EP9 A;  3K2O A;  2B7M A;  3QEP A;  4M45 A;  1MTY G;  3LZI A;  2E31 A;  3SQ1 A;  3KD1 E;  2P1M B;  4X5N A;  1XL3 C;  1XU5 E;  3LD8 A;  2P5O A;  1LDK E;  3L2O B;  4FK2 A;  1XVD E;  4KHQ A;  4QNC A;  4E3S A;  1XMH E;  4DU3 A;  3QEV A;  4M3T A;  2OVQ B;  3HGK E;  4I6J B;  3OGL B;  4DU4 A;  4FK0 A;  3NCI A;  3SUP A;  3MKS B;  4FJL A;  1MHY G;  2E32 A;  3HGL A;  3L1N A;  3RMA A;  4ADN A;  4KI4 A;  3SQ0 A;  4KHU A;  4J2E A;  5IZ7 A;  1XMF E;  3L8B A;  1P22 A;  4DTM A;  1FXX A;  2B1E A;  2HD0 A;  3UO3 A;  4RL5 A;  3CFR A;  3QNN A;  5IRE A;  5IBK B;  4J2A A;  2DY4 A;  2RCU A;  4DTU A;  3QER A;  3C6N B;  4AI6 A;  3C95 A;  2DEB A;  4ICG C;  1XVF E;  2PFT A;  1XMG E;  3E4W A;  4DU1 A;  1FYZ E;  4JRP A; 
#chains in the Genus database with same CATH homology
 2JQT A;  2K5S A;  4ICG C;  2MW2 A;  1JW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...