3TJYA

Structure of the pto-binding domain of hoppmal generated by limited chymotrypsin digestion
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
TGAVPRANRIVQQLVEAGADLANIRTMFRNMLRGEEMILSRAEQNVFLQHFPDMLPCGIDRNSELAIALREALRRADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Effector protein hopAB3
publication title Structural analysis of HopPmaL reveals the presence of a second adaptor domain common to the HopAB family of Pseudomonas syringae type III effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. maculicola
total genus 27
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.110 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3tjyA00
3HGLA 3TJYA 3HGKE 3SVIA
chains in the Genus database with same CATH superfamily
3SUQA 4JRPA 4FK2A 4J2BA 3MKSB 2P1NB 3C6PB 3HGKE 1FZ4E 1MHZG 2HD0A 4I9LA 3QESA 4DTRA 4DTPA 3SQ1A 3E4WA 2DTUA 2FW3A 2K5SA 4JS4A 4IT5A 4FJKA 3C95A 4ADOA 4KHWA 3SPYA 3E4YA 4EYWA 3SCXA 1FS1A 4KI4A 4FJ7A 1XL3C 1XVEE 1LDKE 3SUNA 3RMCA 3NHGA 4KI6A 4AKIA 4AKGA 1IH7A 3L1NA 1P22A 3L0MA 4E3SA 2H4TA 4AI6A 3OGMB 2DEBA 3C6OB 3LD8A 3QEXA 3NCIA 1FZ2E 4FJMA 1XMGE 4I6JB 3HP9A 2E32A 3N1EA 3LDBA 2JQTA 4DU4A 5IBKB 3CFPA 3CFOA 2P5OA 2DY4A 3CQ8A 3BVOA 4RNGA 2FYOA 4DU3A 3UO2A 4M3XA 4JS5A 3NAEA 3HL8A 3OGKB 2LF3A 3CFRA 4DU1A 4KHSA 4RG8A 3LZJA 3C94A 4J2AA 2P1OB 5IZ7A 4QNCA 1XVBE 2P5GA 3QNOA 4FJ9A 4FJ5A 2OVQB 5IREA 3QEVA 3TABA 4M3YA 3RMBA 3OGLB 1FPOA 1XVDE 3SI6A 2E31A 2P1PB 3SNNA 4X5MA 4JRQA 3QETA 2QXFA 3RMAA 1FZ6E 2JHCA 3RWUA 2PFTA 1WAFA 1FXXA 3QEWA 1FZ0E 2JHAA 2VIXA 3RMDA 1XMHE 3L8BA 2B1EA 4M3TA 2OVRB 3KD5E 4DTJA 3NE6A 4M45A 2P1QB 3K2OA 1FZIE 3QEIA 4FJHA 3J27A 4KHQA 3C6NB 1FZ1E 3TJYA 4M3WA 1WAJA 3SVIA 4QNDA 4M3RA 3KD1E 4DTNA 2RKHA 4ICGC 4DTUA 3UO3A 4M3ZA 3NGIA 1CLQA 1IG9A 2JHPA 4DTMA 4AKHA 1MHYG 1FZ7E 3V7DB 3SUOA 3LZIA 4E4BA 1FZ3E 4J2EA 4KHUA 2LF6A 3SUPA 4FJIA 1XVFE 3LDSA 3N1BA 2MW2A 2VJ5A 3SQ4A 2ATQA 1XMFE 1Q9XA 2JH8A 5H37A 2OYQA 4DTOA 4M42A 4EPHA 4FJ8A 2JPNA 2PFVA 2B7MA 3TAFA 3SJJA 1XU3E 4RL5A 2B8IA 3TAEA 4I9QA 4KHNA 1JW2A 3SQ0A 4GAMC 1FYZE 1XVGE 4HCCA 2MMBA 1XVCE 1XU5E 4KHYA 4DTXA 4J2DA 4X5NA 4B08A 1FZ5E 2JH9A 4M3UA 2P1MB 4M41A 3QEPA 4FK0A 3S9HA 2OZSA 3UIQA 2OVPB 3QERA 2OZMA 1FZ8E 3QNNA 3TL8B 4FJNA 3HGLA 3TAGA 3SQ2A 4FK4A 1NEXB 2YB5A 1N1CA 4FVMA 3NDKA 4DTSA 4HCBA 1MMOG 2VJ4A 4FJGA 4FJJA 4EP9A 4FJLA 1FZ9E 2MZWB 3WSOA 1FZHE 1Q9YA 3SPZA 3L2OB 2RCUA 4FJXA 3J2PA 1MTYG 4ADNA
chains in the Genus database with same CATH topology
3SUQA 4JRPA 4FK2A 4J2BA 3MKSB 2P1NB 3C6PB 3HGKE 1FZ4E 1MHZG 2HD0A 4I9LA 3QESA 4DTRA 4DTPA 3SQ1A 3E4WA 2DTUA 2FW3A 4JS4A 4FJKA 3C95A 4ADOA 4KHWA 3SPYA 3E4YA 4EYWA 3SCXA 1FS1A 4KI4A 4FJ7A 1XL3C 1XVEE 1LDKE 3SUNA 3RMCA 3NHGA 4KI6A 4AKIA 4AKGA 1IH7A 3L1NA 1P22A 3L0MA 4E3SA 2H4TA 4AI6A 3OGMB 2DEBA 3C6OB 3LD8A 3QEXA 3NCIA 1FZ2E 4FJMA 1XMGE 4I6JB 3HP9A 2E32A 3N1EA 3LDBA 4DU4A 5IBKB 3CFPA 3CFOA 2P5OA 2DY4A 3CQ8A 4RNGA 2FYOA 4DU3A 4M3XA 4JS5A 3NAEA 3HL8A 3OGKB 2LF3A 3CFRA 4DU1A 4KHSA 4RG8A 3LZJA 3C94A 4J2AA 2P1OB 5IZ7A 4QNCA 1XVBE 2P5GA 3QNOA 4FJ9A 4FJ5A 2OVQB 5IREA 3QEVA 3TABA 4M3YA 3RMBA 3OGLB 1XVDE 3SI6A 2E31A 2P1PB 3SNNA 4X5MA 4JRQA 3QETA 2QXFA 3RMAA 1FZ6E 2JHCA 3RWUA 2PFTA 1WAFA 1FXXA 3QEWA 1FZ0E 2JHAA 2VIXA 3RMDA 1XMHE 3L8BA 2B1EA 4M3TA 2OVRB 3KD5E 4DTJA 3NE6A 4M45A 2P1QB 3K2OA 1FZIE 3QEIA 4FJHA 3J27A 4KHQA 3C6NB 1FZ1E 3TJYA 4M3WA 1WAJA 3SVIA 4QNDA 4M3RA 3KD1E 4DTNA 1CLQA 4DTUA 4M3ZA 3NGIA 1IG9A 2JHPA 4DTMA 4AKHA 1MHYG 1FZ7E 3V7DB 3SUOA 3LZIA 4E4BA 1FZ3E 4J2EA 4KHUA 2LF6A 3SUPA 4FJIA 1XVFE 3LDSA 3N1BA 2VJ5A 3SQ4A 2ATQA 1XMFE 1Q9XA 2JH8A 5H37A 2OYQA 4DTOA 4M42A 4EPHA 4FJ8A 2JPNA 2PFVA 2B7MA 3TAFA 3SJJA 1XU3E 4RL5A 2B8IA 3TAEA 4I9QA 4KHNA 3SQ0A 4GAMC 1FYZE 1XVGE 4HCCA 2MMBA 1XVCE 1XU5E 4KHYA 4DTXA 4J2DA 4X5NA 4B08A 1FZ5E 2JH9A 4M3UA 2P1MB 4M41A 3QEPA 4FK0A 3S9HA 2OZSA 3UIQA 2OVPB 3QERA 2OZMA 1FZ8E 3QNNA 3TL8B 4FJNA 3HGLA 3TAGA 3SQ2A 4FK4A 1NEXB 2YB5A 4FVMA 3NDKA 4DTSA 4HCBA 1MMOG 2VJ4A 4FJGA 4FJJA 4EP9A 4FJLA 1FZ9E 2MZWB 3WSOA 1FZHE 1Q9YA 3SPZA 3L2OB 2RCUA 4FJXA 3J2PA 1MTYG 4ADNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HGL A;  3TJY A;  3HGK E;  3SVI A; 
#chains in the Genus database with same CATH topology
 3SUQ A;  4JRP A;  4FK2 A;  4J2B A;  3MKS B;  2P1N B;  3C6P B;  3HGK E;  1FZ4 E;  1MHZ G;  2HD0 A;  4I9L A;  3QES A;  4DTR A;  4DTP A;  3SQ1 A;  3E4W A;  2DTU A;  2FW3 A;  2K5S A;  4JS4 A;  4IT5 A;  4FJK A;  3C95 A;  4ADO A;  4KHW A;  3SPY A;  3E4Y A;  4EYW A;  3SCX A;  1FS1 A;  4KI4 A;  4FJ7 A;  1XL3 C;  1XVE E;  1LDK E;  3SUN A;  3RMC A;  3NHG A;  4KI6 A;  4AKI A;  4AKG A;  1IH7 A;  3L1N A;  1P22 A;  3L0M A;  4E3S A;  2H4T A;  4AI6 A;  3OGM B;  2DEB A;  3C6O B;  3LD8 A;  3QEX A;  3NCI A;  1FZ2 E;  4FJM A;  1XMG E;  4I6J B;  3HP9 A;  2E32 A;  3N1E A;  3LDB A;  2JQT A;  4DU4 A;  5IBK B;  3CFP A;  3CFO A;  2P5O A;  2DY4 A;  3CQ8 A;  3BVO A;  4RNG A;  2FYO A;  4DU3 A;  3UO2 A;  4M3X A;  4JS5 A;  3NAE A;  3HL8 A;  3OGK B;  2LF3 A;  3CFR A;  4DU1 A;  4KHS A;  4RG8 A;  3LZJ A;  3C94 A;  4J2A A;  2P1O B;  5IZ7 A;  4QNC A;  1XVB E;  2P5G A;  3QNO A;  4FJ9 A;  4FJ5 A;  2OVQ B;  5IRE A;  3QEV A;  3TAB A;  4M3Y A;  3RMB A;  3OGL B;  1FPO A;  1XVD E;  3SI6 A;  2E31 A;  2P1P B;  3SNN A;  4X5M A;  4JRQ A;  3QET A;  2QXF A;  3RMA A;  1FZ6 E;  2JHC A;  3RWU A;  2PFT A;  1WAF A;  1FXX A;  3QEW A;  1FZ0 E;  2JHA A;  2VIX A;  3RMD A;  1XMH E;  3L8B A;  2B1E A;  4M3T A;  2OVR B;  3KD5 E;  4DTJ A;  3NE6 A;  4M45 A;  2P1Q B;  3K2O A;  1FZI E;  3QEI A;  4FJH A;  3J27 A;  4KHQ A;  3C6N B;  1FZ1 E;  3TJY A;  4M3W A;  1WAJ A;  3SVI A;  4QND A;  4M3R A;  3KD1 E;  4DTN A;  2RKH A;  4ICG C;  4DTU A;  3UO3 A;  4M3Z A;  3NGI A;  1CLQ A;  1IG9 A;  2JHP A;  4DTM A;  4AKH A;  1MHY G;  1FZ7 E;  3V7D B;  3SUO A;  3LZI A;  4E4B A;  1FZ3 E;  4J2E A;  4KHU A;  2LF6 A;  3SUP A;  4FJI A;  1XVF E;  3LDS A;  3N1B A;  2MW2 A;  2VJ5 A;  3SQ4 A;  2ATQ A;  1XMF E;  1Q9X A;  2JH8 A;  5H37 A;  2OYQ A;  4DTO A;  4M42 A;  4EPH A;  4FJ8 A;  2JPN A;  2PFV A;  2B7M A;  3TAF A;  3SJJ A;  1XU3 E;  4RL5 A;  2B8I A;  3TAE A;  4I9Q A;  4KHN A;  1JW2 A;  3SQ0 A;  4GAM C;  1FYZ E;  1XVG E;  4HCC A;  2MMB A;  1XVC E;  1XU5 E;  4KHY A;  4DTX A;  4J2D A;  4X5N A;  4B08 A;  1FZ5 E;  2JH9 A;  4M3U A;  2P1M B;  4M41 A;  3QEP A;  4FK0 A;  3S9H A;  2OZS A;  3UIQ A;  2OVP B;  3QER A;  2OZM A;  1FZ8 E;  3QNN A;  3TL8 B;  4FJN A;  3HGL A;  3TAG A;  3SQ2 A;  4FK4 A;  1NEX B;  2YB5 A;  1N1C A;  4FVM A;  3NDK A;  4DTS A;  4HCB A;  1MMO G;  2VJ4 A;  4FJG A;  4FJJ A;  4EP9 A;  4FJL A;  1FZ9 E;  2MZW B;  3WSO A;  1FZH E;  1Q9Y A;  3SPZ A;  3L2O B;  2RCU A;  4FJX A;  3J2P A;  1MTY G;  4ADN A; 
#chains in the Genus database with same CATH homology
 3SUQ A;  4JRP A;  4FK2 A;  4J2B A;  3MKS B;  2P1N B;  3C6P B;  3HGK E;  1FZ4 E;  1MHZ G;  2HD0 A;  4I9L A;  3QES A;  4DTR A;  4DTP A;  3SQ1 A;  3E4W A;  2DTU A;  2FW3 A;  4JS4 A;  4FJK A;  3C95 A;  4ADO A;  4KHW A;  3SPY A;  3E4Y A;  4EYW A;  3SCX A;  1FS1 A;  4KI4 A;  4FJ7 A;  1XL3 C;  1XVE E;  1LDK E;  3SUN A;  3RMC A;  3NHG A;  4KI6 A;  4AKI A;  4AKG A;  1IH7 A;  3L1N A;  1P22 A;  3L0M A;  4E3S A;  2H4T A;  4AI6 A;  3OGM B;  2DEB A;  3C6O B;  3LD8 A;  3QEX A;  3NCI A;  1FZ2 E;  4FJM A;  1XMG E;  4I6J B;  3HP9 A;  2E32 A;  3N1E A;  3LDB A;  4DU4 A;  5IBK B;  3CFP A;  3CFO A;  2P5O A;  2DY4 A;  3CQ8 A;  4RNG A;  2FYO A;  4DU3 A;  4M3X A;  4JS5 A;  3NAE A;  3HL8 A;  3OGK B;  2LF3 A;  3CFR A;  4DU1 A;  4KHS A;  4RG8 A;  3LZJ A;  3C94 A;  4J2A A;  2P1O B;  5IZ7 A;  4QNC A;  1XVB E;  2P5G A;  3QNO A;  4FJ9 A;  4FJ5 A;  2OVQ B;  5IRE A;  3QEV A;  3TAB A;  4M3Y A;  3RMB A;  3OGL B;  1XVD E;  3SI6 A;  2E31 A;  2P1P B;  3SNN A;  4X5M A;  4JRQ A;  3QET A;  2QXF A;  3RMA A;  1FZ6 E;  2JHC A;  3RWU A;  2PFT A;  1WAF A;  1FXX A;  3QEW A;  1FZ0 E;  2JHA A;  2VIX A;  3RMD A;  1XMH E;  3L8B A;  2B1E A;  4M3T A;  2OVR B;  3KD5 E;  4DTJ A;  3NE6 A;  4M45 A;  2P1Q B;  3K2O A;  1FZI E;  3QEI A;  4FJH A;  3J27 A;  4KHQ A;  3C6N B;  1FZ1 E;  3TJY A;  4M3W A;  1WAJ A;  3SVI A;  4QND A;  4M3R A;  3KD1 E;  4DTN A;  1CLQ A;  4DTU A;  4M3Z A;  3NGI A;  1IG9 A;  2JHP A;  4DTM A;  4AKH A;  1MHY G;  1FZ7 E;  3V7D B;  3SUO A;  3LZI A;  4E4B A;  1FZ3 E;  4J2E A;  4KHU A;  2LF6 A;  3SUP A;  4FJI A;  1XVF E;  3LDS A;  3N1B A;  2VJ5 A;  3SQ4 A;  2ATQ A;  1XMF E;  1Q9X A;  2JH8 A;  5H37 A;  2OYQ A;  4DTO A;  4M42 A;  4EPH A;  4FJ8 A;  2JPN A;  2PFV A;  2B7M A;  3TAF A;  3SJJ A;  1XU3 E;  4RL5 A;  2B8I A;  3TAE A;  4I9Q A;  4KHN A;  3SQ0 A;  4GAM C;  1FYZ E;  1XVG E;  4HCC A;  2MMB A;  1XVC E;  1XU5 E;  4KHY A;  4DTX A;  4J2D A;  4X5N A;  4B08 A;  1FZ5 E;  2JH9 A;  4M3U A;  2P1M B;  4M41 A;  3QEP A;  4FK0 A;  3S9H A;  2OZS A;  3UIQ A;  2OVP B;  3QER A;  2OZM A;  1FZ8 E;  3QNN A;  3TL8 B;  4FJN A;  3HGL A;  3TAG A;  3SQ2 A;  4FK4 A;  1NEX B;  2YB5 A;  4FVM A;  3NDK A;  4DTS A;  4HCB A;  1MMO G;  2VJ4 A;  4FJG A;  4FJJ A;  4EP9 A;  4FJL A;  1FZ9 E;  2MZW B;  3WSO A;  1FZH E;  1Q9Y A;  3SPZ A;  3L2O B;  2RCU A;  4FJX A;  3J2P A;  1MTY G;  4ADN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...