3TJYA

Structure of the pto-binding domain of hoppmal generated by limited chymotrypsin digestion
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
b'TGAVPRANRIVQQLVEAGADLANIRTMFRNMLRGEEMILSRAEQNVFLQHFPDMLPCGIDRNSELAIALREALRRADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Effector protein hopAB3
publication title Structural analysis of HopPmaL reveals the presence of a second adaptor domain common to the HopAB family of Pseudomonas syringae type III effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. maculicola
molecule tags Signaling protein
total genus 27
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.110 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3tjyA00
3TJYA 3HGLA 3HGKE 3SVIA
chains in the Genus database with same CATH superfamily
3QEIA 3L1NA 1CLQA 4DU3A 3LDSA 1XU5E 4AKGA 2PFVA 4ICGC 3V7DB 4M45A 3TAFA 4I9QA 4KHYA 4FJXA 4FJMA 2DTUA 4JRQA 3C6NB 1FZ0E 2P1PB 2YB5A 3QEVA 1FS1A 4KHNA 4DTUA 4FJIA 3CFPA 2OVPB 3UIQA 3CFRA 2RCUA 3NAEA 3SPZA 1NEXB 2OYQA 4FJKA 1FZ9E 3LZIA 4DTSA 3SQ2A 4J2BA 3QNOA 4DTXA 3SUPA 1FYZE 2LF6A 3E4WA 1XVDE 2MW2A 3QERA 1MMOG 2DEBA 1FPOA 2OZMA 4HCCA 4M3ZA 3SQ1A 4DTPA 2H4TA 2P5GA 1FXXA 2JHCA 3L0MA 3UO3A 3LZJA 3SI6A 1FZ7E 4FJHA 4KHQA 1N1CA 1P22A 2FW3A 1XVGE 4DU4A 4DTJA 3L8BA 3K2OA 4KI4A 3SQ4A 2VJ4A 4M3XA 3HGKE 1FZ3E 3HL8A 4RL5A 3SUNA 2P1NB 3RWUA 1WAFA 3NHGA 3QESA 2E31A 4FJJA 4KHSA 3S9HA 2HD0A 4M3TA 3NCIA 3NE6A 1FZ4E 3TJYA 3UO2A 3N1BA 4EP9A 1FZ2E 1WAJA 2LF3A 1FZ5E 3HP9A 4GAMC 4AKIA 1MTYG 4EYWA 2JH8A 4RG8A 2OVRB 3NDKA 1Q9YA 1XMGE 4KI6A 3TL8B 4DTOA 3SNNA 4FJ9A 1XU3E 3RMCA 2P1MB 4I6JB 4AKHA 5IREA 5IBKB 3CQ8A 4M3WA 4M41A 2QXFA 2OZSA 3J2PA 4M3RA 3NGIA 3QEPA 4FJ7A 3WSOA 4IT5A 3C95A 4X5MA 3SUOA 2P5OA 3LD8A 4FK4A 3J27A 4FJ8A 2PFTA 4E3SA 4QNDA 4FJ5A 2RKHA 4M3UA 4J2AA 3SPYA 2VJ5A 3OGLB 2JHPA 2B8IA 4JRPA 2MMBA 2JH9A 4M42A 4E4BA 2JPNA 3RMBA 1IG9A 4FK0A 1XL3C 4JS4A 1FZ6E 3BVOA 3TAGA 3RMAA 1JW2A 2P1QB 4ADNA 2K5SA 2VIXA 2P1OB 3SUQA 1XVFE 4ADOA 4FJLA 4J2EA 2DY4A 1XMHE 1MHZG 3QNNA 3OGKB 4RNGA 4FJGA 2ATQA 3RMDA 3C6PB 4X5NA 3KD1E 4J2DA 4I9LA 3TABA 4KHUA 3N1EA 2OVQB 1FZ1E 2MZWB 4QNCA 2JQTA 3SVIA 3LDBA 3MKSB 1FZ8E 3OGMB 1XMFE 2E32A 2FYOA 2B1EA 3SCXA 4FVMA 3SJJA 4M3YA 2B7MA 4AI6A 1IH7A 4DTRA 1XVCE 3C6OB 3QEXA 3SQ0A 1Q9XA 3E4YA 1FZHE 1XVEE 1FZIE 3CFOA 3HGLA 4EPHA 4KHWA 1MHYG 2JHAA 5H37A 4B08A 5IZ7A 3L2OB 3QETA 4FJNA 4JS5A 4DTNA 1LDKE 4DTMA 3KD5E 4HCBA 3QEWA 3TAEA 3C94A 4FK2A 1XVBE 4DU1A
chains in the Genus database with same CATH topology
3QEIA 3L1NA 1CLQA 4DU3A 3LDSA 1XU5E 4AKGA 2PFVA 3V7DB 4KHYA 4M45A 3TAFA 4I9QA 4FJXA 4FJMA 2DTUA 4JRQA 3C6NB 1FZ0E 2P1PB 2YB5A 3QEVA 1FS1A 4KHNA 4DTUA 4FJIA 3CFPA 2OVPB 3UIQA 3CFRA 2RCUA 3NAEA 3SPZA 1NEXB 2OYQA 4FJKA 1FZ9E 3LZIA 4DTSA 3SQ2A 4J2BA 3QNOA 4DTXA 3SUPA 1FYZE 2LF6A 3E4WA 1XVDE 3QERA 1MMOG 2DEBA 2OZMA 4HCCA 4M3ZA 3SQ1A 4DTPA 2H4TA 2P5GA 1FXXA 2JHCA 3L0MA 3LZJA 3SI6A 4FJHA 1FZ7E 4KHQA 1P22A 2FW3A 1XVGE 4DU4A 4DTJA 3L8BA 3K2OA 4KI4A 3SQ4A 2VJ4A 4M3XA 3HGKE 1FZ3E 3HL8A 4RL5A 3SUNA 2P1NB 3RWUA 1WAFA 3NHGA 3QESA 2E31A 4FJJA 4KHSA 3S9HA 2HD0A 4M3TA 3NCIA 3NE6A 1FZ4E 3TJYA 3N1BA 4EP9A 1FZ2E 1WAJA 2LF3A 1FZ5E 3HP9A 4GAMC 4AKIA 1MTYG 4EYWA 2JH8A 4RG8A 2OVRB 3NDKA 1Q9YA 1XMGE 4KI6A 3TL8B 4DTOA 3SNNA 4FJ9A 1XU3E 3RMCA 2P1MB 4I6JB 4AKHA 5IREA 5IBKB 3CQ8A 4M3WA 4M41A 2QXFA 2OZSA 3J2PA 4M3RA 3NGIA 3QEPA 4FJ7A 3WSOA 3C95A 4X5MA 3SUOA 2P5OA 3LD8A 4FK4A 3J27A 4FJ8A 2PFTA 4E3SA 4QNDA 4FJ5A 4M3UA 4J2AA 3SPYA 2VJ5A 3OGLB 2JHPA 2B8IA 4JRPA 2MMBA 2JH9A 4M42A 4E4BA 2JPNA 3RMBA 1IG9A 4FK0A 1XL3C 4JS4A 1FZ6E 3TAGA 3RMAA 2P1QB 4ADNA 2VIXA 2P1OB 3SUQA 1XVFE 4ADOA 4FJLA 4J2EA 2DY4A 1XMHE 1MHZG 3QNNA 3OGKB 4RNGA 4FJGA 2ATQA 3RMDA 3C6PB 4X5NA 3KD1E 4J2DA 4I9LA 3TABA 4KHUA 3N1EA 2OVQB 1FZ1E 2MZWB 4QNCA 3SVIA 3LDBA 3MKSB 1FZ8E 3OGMB 1XMFE 2E32A 2FYOA 2B1EA 3SCXA 4FVMA 3SJJA 4M3YA 2B7MA 4AI6A 1IH7A 4DTRA 1XVCE 3C6OB 3QEXA 3SQ0A 1Q9XA 3E4YA 1FZHE 1XVEE 1FZIE 3CFOA 3HGLA 4EPHA 4KHWA 1MHYG 2JHAA 5H37A 4B08A 5IZ7A 3L2OB 3QETA 4FJNA 4JS5A 4DTNA 1LDKE 4DTMA 3KD5E 4HCBA 3QEWA 3TAEA 3C94A 4FK2A 1XVBE 4DU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJY A;  3HGL A;  3HGK E;  3SVI A; 
#chains in the Genus database with same CATH topology
 3QEI A;  3L1N A;  1CLQ A;  4DU3 A;  3LDS A;  1XU5 E;  4AKG A;  2PFV A;  4ICG C;  3V7D B;  4M45 A;  3TAF A;  4I9Q A;  4KHY A;  4FJX A;  4FJM A;  2DTU A;  4JRQ A;  3C6N B;  1FZ0 E;  2P1P B;  2YB5 A;  3QEV A;  1FS1 A;  4KHN A;  4DTU A;  4FJI A;  3CFP A;  2OVP B;  3UIQ A;  3CFR A;  2RCU A;  3NAE A;  3SPZ A;  1NEX B;  2OYQ A;  4FJK A;  1FZ9 E;  3LZI A;  4DTS A;  3SQ2 A;  4J2B A;  3QNO A;  4DTX A;  3SUP A;  1FYZ E;  2LF6 A;  3E4W A;  1XVD E;  2MW2 A;  3QER A;  1MMO G;  2DEB A;  1FPO A;  2OZM A;  4HCC A;  4M3Z A;  3SQ1 A;  4DTP A;  2H4T A;  2P5G A;  1FXX A;  2JHC A;  3L0M A;  3UO3 A;  3LZJ A;  3SI6 A;  1FZ7 E;  4FJH A;  4KHQ A;  1N1C A;  1P22 A;  2FW3 A;  1XVG E;  4DU4 A;  4DTJ A;  3L8B A;  3K2O A;  4KI4 A;  3SQ4 A;  2VJ4 A;  4M3X A;  3HGK E;  1FZ3 E;  3HL8 A;  4RL5 A;  3SUN A;  2P1N B;  3RWU A;  1WAF A;  3NHG A;  3QES A;  2E31 A;  4FJJ A;  4KHS A;  3S9H A;  2HD0 A;  4M3T A;  3NCI A;  3NE6 A;  1FZ4 E;  3TJY A;  3UO2 A;  3N1B A;  4EP9 A;  1FZ2 E;  1WAJ A;  2LF3 A;  1FZ5 E;  3HP9 A;  4GAM C;  4AKI A;  1MTY G;  4EYW A;  2JH8 A;  4RG8 A;  2OVR B;  3NDK A;  1Q9Y A;  1XMG E;  4KI6 A;  3TL8 B;  4DTO A;  3SNN A;  4FJ9 A;  1XU3 E;  3RMC A;  2P1M B;  4I6J B;  4AKH A;  5IRE A;  5IBK B;  3CQ8 A;  4M3W A;  4M41 A;  2QXF A;  2OZS A;  3J2P A;  4M3R A;  3NGI A;  3QEP A;  4FJ7 A;  3WSO A;  4IT5 A;  3C95 A;  4X5M A;  3SUO A;  2P5O A;  3LD8 A;  4FK4 A;  3J27 A;  4FJ8 A;  2PFT A;  4E3S A;  4QND A;  4FJ5 A;  2RKH A;  4M3U A;  4J2A A;  3SPY A;  2VJ5 A;  3OGL B;  2JHP A;  2B8I A;  4JRP A;  2MMB A;  2JH9 A;  4M42 A;  4E4B A;  2JPN A;  3RMB A;  1IG9 A;  4FK0 A;  1XL3 C;  4JS4 A;  1FZ6 E;  3BVO A;  3TAG A;  3RMA A;  1JW2 A;  2P1Q B;  4ADN A;  2K5S A;  2VIX A;  2P1O B;  3SUQ A;  1XVF E;  4ADO A;  4FJL A;  4J2E A;  2DY4 A;  1XMH E;  1MHZ G;  3QNN A;  3OGK B;  4RNG A;  4FJG A;  2ATQ A;  3RMD A;  3C6P B;  4X5N A;  3KD1 E;  4J2D A;  4I9L A;  3TAB A;  4KHU A;  3N1E A;  2OVQ B;  1FZ1 E;  2MZW B;  4QNC A;  2JQT A;  3SVI A;  3LDB A;  3MKS B;  1FZ8 E;  3OGM B;  1XMF E;  2E32 A;  2FYO A;  2B1E A;  3SCX A;  4FVM A;  3SJJ A;  4M3Y A;  2B7M A;  4AI6 A;  1IH7 A;  4DTR A;  1XVC E;  3C6O B;  3QEX A;  3SQ0 A;  1Q9X A;  3E4Y A;  1FZH E;  1XVE E;  1FZI E;  3CFO A;  3HGL A;  4EPH A;  4KHW A;  1MHY G;  2JHA A;  5H37 A;  4B08 A;  5IZ7 A;  3L2O B;  3QET A;  4FJN A;  4JS5 A;  4DTN A;  1LDK E;  4DTM A;  3KD5 E;  4HCB A;  3QEW A;  3TAE A;  3C94 A;  4FK2 A;  1XVB E;  4DU1 A; 
#chains in the Genus database with same CATH homology
 3QEI A;  3L1N A;  1CLQ A;  4DU3 A;  3LDS A;  1XU5 E;  4AKG A;  2PFV A;  3V7D B;  4KHY A;  4M45 A;  3TAF A;  4I9Q A;  4FJX A;  4FJM A;  2DTU A;  4JRQ A;  3C6N B;  1FZ0 E;  2P1P B;  2YB5 A;  3QEV A;  1FS1 A;  4KHN A;  4DTU A;  4FJI A;  3CFP A;  2OVP B;  3UIQ A;  3CFR A;  2RCU A;  3NAE A;  3SPZ A;  1NEX B;  2OYQ A;  4FJK A;  1FZ9 E;  3LZI A;  4DTS A;  3SQ2 A;  4J2B A;  3QNO A;  4DTX A;  3SUP A;  1FYZ E;  2LF6 A;  3E4W A;  1XVD E;  3QER A;  1MMO G;  2DEB A;  2OZM A;  4HCC A;  4M3Z A;  3SQ1 A;  4DTP A;  2H4T A;  2P5G A;  1FXX A;  2JHC A;  3L0M A;  3LZJ A;  3SI6 A;  4FJH A;  1FZ7 E;  4KHQ A;  1P22 A;  2FW3 A;  1XVG E;  4DU4 A;  4DTJ A;  3L8B A;  3K2O A;  4KI4 A;  3SQ4 A;  2VJ4 A;  4M3X A;  3HGK E;  1FZ3 E;  3HL8 A;  4RL5 A;  3SUN A;  2P1N B;  3RWU A;  1WAF A;  3NHG A;  3QES A;  2E31 A;  4FJJ A;  4KHS A;  3S9H A;  2HD0 A;  4M3T A;  3NCI A;  3NE6 A;  1FZ4 E;  3TJY A;  3N1B A;  4EP9 A;  1FZ2 E;  1WAJ A;  2LF3 A;  1FZ5 E;  3HP9 A;  4GAM C;  4AKI A;  1MTY G;  4EYW A;  2JH8 A;  4RG8 A;  2OVR B;  3NDK A;  1Q9Y A;  1XMG E;  4KI6 A;  3TL8 B;  4DTO A;  3SNN A;  4FJ9 A;  1XU3 E;  3RMC A;  2P1M B;  4I6J B;  4AKH A;  5IRE A;  5IBK B;  3CQ8 A;  4M3W A;  4M41 A;  2QXF A;  2OZS A;  3J2P A;  4M3R A;  3NGI A;  3QEP A;  4FJ7 A;  3WSO A;  3C95 A;  4X5M A;  3SUO A;  2P5O A;  3LD8 A;  4FK4 A;  3J27 A;  4FJ8 A;  2PFT A;  4E3S A;  4QND A;  4FJ5 A;  4M3U A;  4J2A A;  3SPY A;  2VJ5 A;  3OGL B;  2JHP A;  2B8I A;  4JRP A;  2MMB A;  2JH9 A;  4M42 A;  4E4B A;  2JPN A;  3RMB A;  1IG9 A;  4FK0 A;  1XL3 C;  4JS4 A;  1FZ6 E;  3TAG A;  3RMA A;  2P1Q B;  4ADN A;  2VIX A;  2P1O B;  3SUQ A;  1XVF E;  4ADO A;  4FJL A;  4J2E A;  2DY4 A;  1XMH E;  1MHZ G;  3QNN A;  3OGK B;  4RNG A;  4FJG A;  2ATQ A;  3RMD A;  3C6P B;  4X5N A;  3KD1 E;  4J2D A;  4I9L A;  3TAB A;  4KHU A;  3N1E A;  2OVQ B;  1FZ1 E;  2MZW B;  4QNC A;  3SVI A;  3LDB A;  3MKS B;  1FZ8 E;  3OGM B;  1XMF E;  2E32 A;  2FYO A;  2B1E A;  3SCX A;  4FVM A;  3SJJ A;  4M3Y A;  2B7M A;  4AI6 A;  1IH7 A;  4DTR A;  1XVC E;  3C6O B;  3QEX A;  3SQ0 A;  1Q9X A;  3E4Y A;  1FZH E;  1XVE E;  1FZI E;  3CFO A;  3HGL A;  4EPH A;  4KHW A;  1MHY G;  2JHA A;  5H37 A;  4B08 A;  5IZ7 A;  3L2O B;  3QET A;  4FJN A;  4JS5 A;  4DTN A;  1LDK E;  4DTM A;  3KD5 E;  4HCB A;  3QEW A;  3TAE A;  3C94 A;  4FK2 A;  1XVB E;  4DU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...