3TJYA

Structure of the pto-binding domain of hoppmal generated by limited chymotrypsin digestion
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
TGAVPRANRIVQQLVEAGADLANIRTMFRNMLRGEEMILSRAEQNVFLQHFPDMLPCGIDRNSELAIALREALRRADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of HopPmaL reveals the presence of a second adaptor domain common to the HopAB family of Pseudomonas syringae type III effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. maculicola
molecule tags Signaling protein
molecule keywords Effector protein hopAB3
total genus 27
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.110 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3tjyA00
3HGLA 3HGKE 3TJYA 3SVIA
chains in the Genus database with same CATH superfamily
2B7MA 3N1EA 1MHYG 3SQ2A 3RMDA 3N1BA 2MW2A 3CFPA 4AI6A 2OVPB 2P1QB 2P5GA 4KHUA 3SPZA 3SNNA 3SUOA 4FK2A 2QXFA 3SCXA 4J2AA 4M3XA 1JW2A 3NDKA 4RG8A 3QEWA 2OVRB 3UO2A 3SUNA 3QEPA 2YB5A 1N1CA 2VJ4A 3L1NA 3QNNA 3WSOA 2RCUA 3HGKE 3SQ4A 1FPOA 4E3SA 2DTUA 4DTXA 3QEXA 4FJ7A 4GAMC 3TAEA 1FZ7E 3E4YA 3C6NB 4DU1A 4J2EA 4FJJA 2B1EA 1FS1A 3J27A 3SUQA 2JHAA 4ADOA 3SVIA 3SPYA 4J2DA 4FJNA 4M3WA 4DTJA 4FJXA 4M42A 2DEBA 4KHQA 1FZ4E 4ADNA 4DTMA 3QESA 1MMOG 1IH7A 3L0MA 3RMCA 2JHCA 4KHYA 4JS5A 4KHSA 1XVFE 1IG9A 3KD5E 2FW3A 4FK4A 4JS4A 4M45A 4FJGA 3C95A 4FK0A 4M3UA 2JHPA 3OGMB 1P22A 2JQTA 3TAGA 1FZ2E 4M41A 3BVOA 3MKSB 5IZ7A 4DU3A 4DTSA 2P1MB 3L2OB 3NGIA 1XVCE 4I6JB 1XMGE 4QNCA 4ICGC 1MHZG 1XL3C 2JPNA 1MTYG 4DTPA 1WAFA 1FZ1E 3C6OB 3LD8A 2ATQA 4X5MA 1XU5E 3NCIA 4RL5A 3LZIA 2H4TA 4KI4A 3C94A 4FJ5A 1FZHE 1Q9XA 2PFTA 3LDBA 5H37A 3TABA 3TL8B 3CFRA 4DU4A 3QNOA 1NEXB 2OZMA 4DTOA 4EYWA 3LDSA 2B8IA 4I9QA 1XMFE 1CLQA 4FJIA 2JH9A 3NHGA 3NAEA 4FJLA 3TAFA 4M3YA 3OGLB 3LZJA 3SUPA 4IT5A 1WAJA 3K2OA 4AKHA 1FYZE 1XMHE 3RMAA 1FZ0E 1XVEE 3HGLA 3V7DB 3NE6A 3S9HA 4AKGA 4RNGA 5IREA 3E4WA 2RKHA 1FZ3E 4HCCA 1XVBE 3OGKB 1FZ6E 2PFVA 4M3TA 4EP9A 2P1OB 1XVDE 2LF6A 3C6PB 4FJ9A 3QERA 3SQ0A 4E4BA 4FJKA 2VJ5A 4AKIA 4KHWA 2VIXA 4JRQA 1FZIE 4EPHA 2P1PB 2MZWB 4FJHA 4DTUA 4M3ZA 3QETA 1XU3E 2LF3A 3HP9A 4B08A 4QNDA 2E31A 3QEIA 3J2PA 3UO3A 4DTNA 3HL8A 3L8BA 1FZ8E 2P1NB 2OVQB 3UIQA 3TJYA 3RWUA 1FZ5E 2E32A 4I9LA 4HCBA 3SI6A 2OZSA 4J2BA 4FVMA 3SJJA 4KI6A 3RMBA 2HD0A 5IBKB 2DY4A 3CQ8A 4JRPA 4FJMA 2K5SA 4KHNA 2OYQA 1LDKE 1XVGE 4FJ8A 1Q9YA 3QEVA 2MMBA 4DTRA 3SQ1A 4X5NA 2P5OA 2FYOA 3CFOA 1FXXA 2JH8A 3KD1E 1FZ9E 4M3RA
chains in the Genus database with same CATH topology
2B7MA 3N1EA 1MHYG 3SQ2A 3RMDA 3N1BA 3CFPA 4AI6A 2OVPB 2P1QB 2P5GA 4KHUA 3SPZA 3SNNA 3SUOA 4FK2A 2QXFA 3SCXA 4J2AA 4M3XA 3NDKA 4RG8A 3QEWA 2OVRB 3SUNA 3QEPA 1IG9A 2YB5A 3L1NA 2VJ4A 4FJXA 3QNNA 3WSOA 2RCUA 3HGKE 3SQ4A 4E3SA 2DTUA 4DTXA 3QEXA 4FJ7A 4GAMC 3TAEA 1FZ7E 3E4YA 3C6NB 4DU1A 4J2EA 4FJJA 2B1EA 1FS1A 3J27A 4M3WA 2JHAA 4ADOA 3SVIA 3SPYA 4J2DA 4FJNA 4DTJA 4M42A 2DEBA 4KHQA 1FZ4E 4ADNA 4DTMA 3QESA 1MMOG 1IH7A 3L0MA 3RMCA 2JHCA 4KHYA 4JS5A 4KHSA 1XVFE 3KD5E 2FW3A 4FK4A 4JS4A 4M45A 4FJGA 3C95A 4FK0A 4M3UA 2JHPA 3OGMB 1P22A 3SUQA 3TAGA 1FZ2E 4M41A 3MKSB 5IZ7A 4DU3A 4DTSA 2P1MB 3L2OB 3NGIA 1XVCE 4I6JB 1XMGE 4QNCA 1MHZG 1XL3C 2JPNA 1MTYG 4DTPA 1WAFA 1FZ1E 3C6OB 3LD8A 2ATQA 4X5MA 1XU5E 3NCIA 4RL5A 3LZIA 2H4TA 4KI4A 3C94A 4FJ5A 1FZHE 1Q9XA 2PFTA 3LDBA 5H37A 3TABA 3TL8B 3CFRA 4DU4A 3QNOA 1NEXB 2OZMA 4DTOA 4EYWA 3LDSA 2B8IA 4I9QA 1XMFE 1CLQA 4FJIA 2JH9A 3NHGA 3NAEA 4FJLA 3TAFA 4M3YA 3OGLB 3LZJA 3SUPA 4AKHA 1WAJA 3K2OA 1FYZE 1XMHE 3RMAA 1FZ0E 1XVEE 3HGLA 3V7DB 3NE6A 3S9HA 4AKGA 4RNGA 5IREA 3E4WA 1FZ3E 4HCCA 1XVBE 3OGKB 1FZ6E 2PFVA 4M3TA 4EP9A 2P1OB 1XVDE 2LF6A 3C6PB 4FJ9A 3QERA 3SQ0A 4E4BA 4FJKA 2VJ5A 4AKIA 4KHWA 2VIXA 4JRQA 1FZIE 4EPHA 2P1PB 2MZWB 4FJHA 4DTUA 4M3ZA 3QETA 1XU3E 2LF3A 3HP9A 4B08A 4QNDA 2E31A 3QEIA 3J2PA 4DTNA 3HL8A 3L8BA 1FZ8E 2P1NB 2OVQB 3UIQA 3TJYA 3RWUA 1FZ5E 2E32A 4I9LA 4HCBA 3SI6A 2OZSA 4J2BA 4FVMA 3SJJA 4KI6A 3RMBA 2HD0A 5IBKB 2DY4A 3CQ8A 4JRPA 4FJMA 4KHNA 2OYQA 1LDKE 1XVGE 4FJ8A 1Q9YA 3QEVA 2MMBA 4DTRA 3SQ1A 4X5NA 2P5OA 2FYOA 3CFOA 1FXXA 2JH8A 3KD1E 1FZ9E 4M3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HGL A;  3HGK E;  3TJY A;  3SVI A; 
#chains in the Genus database with same CATH topology
 2B7M A;  3N1E A;  1MHY G;  3SQ2 A;  3RMD A;  3N1B A;  2MW2 A;  3CFP A;  4AI6 A;  2OVP B;  2P1Q B;  2P5G A;  4KHU A;  3SPZ A;  3SNN A;  3SUO A;  4FK2 A;  2QXF A;  3SCX A;  4J2A A;  4M3X A;  1JW2 A;  3NDK A;  4RG8 A;  3QEW A;  2OVR B;  3UO2 A;  3SUN A;  3QEP A;  2YB5 A;  1N1C A;  2VJ4 A;  3L1N A;  3QNN A;  3WSO A;  2RCU A;  3HGK E;  3SQ4 A;  1FPO A;  4E3S A;  2DTU A;  4DTX A;  3QEX A;  4FJ7 A;  4GAM C;  3TAE A;  1FZ7 E;  3E4Y A;  3C6N B;  4DU1 A;  4J2E A;  4FJJ A;  2B1E A;  1FS1 A;  3J27 A;  3SUQ A;  2JHA A;  4ADO A;  3SVI A;  3SPY A;  4J2D A;  4FJN A;  4M3W A;  4DTJ A;  4FJX A;  4M42 A;  2DEB A;  4KHQ A;  1FZ4 E;  4ADN A;  4DTM A;  3QES A;  1MMO G;  1IH7 A;  3L0M A;  3RMC A;  2JHC A;  4KHY A;  4JS5 A;  4KHS A;  1XVF E;  1IG9 A;  3KD5 E;  2FW3 A;  4FK4 A;  4JS4 A;  4M45 A;  4FJG A;  3C95 A;  4FK0 A;  4M3U A;  2JHP A;  3OGM B;  1P22 A;  2JQT A;  3TAG A;  1FZ2 E;  4M41 A;  3BVO A;  3MKS B;  5IZ7 A;  4DU3 A;  4DTS A;  2P1M B;  3L2O B;  3NGI A;  1XVC E;  4I6J B;  1XMG E;  4QNC A;  4ICG C;  1MHZ G;  1XL3 C;  2JPN A;  1MTY G;  4DTP A;  1WAF A;  1FZ1 E;  3C6O B;  3LD8 A;  2ATQ A;  4X5M A;  1XU5 E;  3NCI A;  4RL5 A;  3LZI A;  2H4T A;  4KI4 A;  3C94 A;  4FJ5 A;  1FZH E;  1Q9X A;  2PFT A;  3LDB A;  5H37 A;  3TAB A;  3TL8 B;  3CFR A;  4DU4 A;  3QNO A;  1NEX B;  2OZM A;  4DTO A;  4EYW A;  3LDS A;  2B8I A;  4I9Q A;  1XMF E;  1CLQ A;  4FJI A;  2JH9 A;  3NHG A;  3NAE A;  4FJL A;  3TAF A;  4M3Y A;  3OGL B;  3LZJ A;  3SUP A;  4IT5 A;  1WAJ A;  3K2O A;  4AKH A;  1FYZ E;  1XMH E;  3RMA A;  1FZ0 E;  1XVE E;  3HGL A;  3V7D B;  3NE6 A;  3S9H A;  4AKG A;  4RNG A;  5IRE A;  3E4W A;  2RKH A;  1FZ3 E;  4HCC A;  1XVB E;  3OGK B;  1FZ6 E;  2PFV A;  4M3T A;  4EP9 A;  2P1O B;  1XVD E;  2LF6 A;  3C6P B;  4FJ9 A;  3QER A;  3SQ0 A;  4E4B A;  4FJK A;  2VJ5 A;  4AKI A;  4KHW A;  2VIX A;  4JRQ A;  1FZI E;  4EPH A;  2P1P B;  2MZW B;  4FJH A;  4DTU A;  4M3Z A;  3QET A;  1XU3 E;  2LF3 A;  3HP9 A;  4B08 A;  4QND A;  2E31 A;  3QEI A;  3J2P A;  3UO3 A;  4DTN A;  3HL8 A;  3L8B A;  1FZ8 E;  2P1N B;  2OVQ B;  3UIQ A;  3TJY A;  3RWU A;  1FZ5 E;  2E32 A;  4I9L A;  4HCB A;  3SI6 A;  2OZS A;  4J2B A;  4FVM A;  3SJJ A;  4KI6 A;  3RMB A;  2HD0 A;  5IBK B;  2DY4 A;  3CQ8 A;  4JRP A;  4FJM A;  2K5S A;  4KHN A;  2OYQ A;  1LDK E;  1XVG E;  4FJ8 A;  1Q9Y A;  3QEV A;  2MMB A;  4DTR A;  3SQ1 A;  4X5N A;  2P5O A;  2FYO A;  3CFO A;  1FXX A;  2JH8 A;  3KD1 E;  1FZ9 E;  4M3R A; 
#chains in the Genus database with same CATH homology
 2B7M A;  3N1E A;  1MHY G;  3SQ2 A;  3RMD A;  3N1B A;  3CFP A;  4AI6 A;  2OVP B;  2P1Q B;  2P5G A;  4KHU A;  3SPZ A;  3SNN A;  3SUO A;  4FK2 A;  2QXF A;  3SCX A;  4J2A A;  4M3X A;  3NDK A;  4RG8 A;  3QEW A;  2OVR B;  3SUN A;  3QEP A;  1IG9 A;  2YB5 A;  3L1N A;  2VJ4 A;  4FJX A;  3QNN A;  3WSO A;  2RCU A;  3HGK E;  3SQ4 A;  4E3S A;  2DTU A;  4DTX A;  3QEX A;  4FJ7 A;  4GAM C;  3TAE A;  1FZ7 E;  3E4Y A;  3C6N B;  4DU1 A;  4J2E A;  4FJJ A;  2B1E A;  1FS1 A;  3J27 A;  4M3W A;  2JHA A;  4ADO A;  3SVI A;  3SPY A;  4J2D A;  4FJN A;  4DTJ A;  4M42 A;  2DEB A;  4KHQ A;  1FZ4 E;  4ADN A;  4DTM A;  3QES A;  1MMO G;  1IH7 A;  3L0M A;  3RMC A;  2JHC A;  4KHY A;  4JS5 A;  4KHS A;  1XVF E;  3KD5 E;  2FW3 A;  4FK4 A;  4JS4 A;  4M45 A;  4FJG A;  3C95 A;  4FK0 A;  4M3U A;  2JHP A;  3OGM B;  1P22 A;  3SUQ A;  3TAG A;  1FZ2 E;  4M41 A;  3MKS B;  5IZ7 A;  4DU3 A;  4DTS A;  2P1M B;  3L2O B;  3NGI A;  1XVC E;  4I6J B;  1XMG E;  4QNC A;  1MHZ G;  1XL3 C;  2JPN A;  1MTY G;  4DTP A;  1WAF A;  1FZ1 E;  3C6O B;  3LD8 A;  2ATQ A;  4X5M A;  1XU5 E;  3NCI A;  4RL5 A;  3LZI A;  2H4T A;  4KI4 A;  3C94 A;  4FJ5 A;  1FZH E;  1Q9X A;  2PFT A;  3LDB A;  5H37 A;  3TAB A;  3TL8 B;  3CFR A;  4DU4 A;  3QNO A;  1NEX B;  2OZM A;  4DTO A;  4EYW A;  3LDS A;  2B8I A;  4I9Q A;  1XMF E;  1CLQ A;  4FJI A;  2JH9 A;  3NHG A;  3NAE A;  4FJL A;  3TAF A;  4M3Y A;  3OGL B;  3LZJ A;  3SUP A;  4AKH A;  1WAJ A;  3K2O A;  1FYZ E;  1XMH E;  3RMA A;  1FZ0 E;  1XVE E;  3HGL A;  3V7D B;  3NE6 A;  3S9H A;  4AKG A;  4RNG A;  5IRE A;  3E4W A;  1FZ3 E;  4HCC A;  1XVB E;  3OGK B;  1FZ6 E;  2PFV A;  4M3T A;  4EP9 A;  2P1O B;  1XVD E;  2LF6 A;  3C6P B;  4FJ9 A;  3QER A;  3SQ0 A;  4E4B A;  4FJK A;  2VJ5 A;  4AKI A;  4KHW A;  2VIX A;  4JRQ A;  1FZI E;  4EPH A;  2P1P B;  2MZW B;  4FJH A;  4DTU A;  4M3Z A;  3QET A;  1XU3 E;  2LF3 A;  3HP9 A;  4B08 A;  4QND A;  2E31 A;  3QEI A;  3J2P A;  4DTN A;  3HL8 A;  3L8B A;  1FZ8 E;  2P1N B;  2OVQ B;  3UIQ A;  3TJY A;  3RWU A;  1FZ5 E;  2E32 A;  4I9L A;  4HCB A;  3SI6 A;  2OZS A;  4J2B A;  4FVM A;  3SJJ A;  4KI6 A;  3RMB A;  2HD0 A;  5IBK B;  2DY4 A;  3CQ8 A;  4JRP A;  4FJM A;  4KHN A;  2OYQ A;  1LDK E;  1XVG E;  4FJ8 A;  1Q9Y A;  3QEV A;  2MMB A;  4DTR A;  3SQ1 A;  4X5N A;  2P5O A;  2FYO A;  3CFO A;  1FXX A;  2JH8 A;  3KD1 E;  1FZ9 E;  4M3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...