3TJYA

Structure of the pto-binding domain of hoppmal generated by limited chymotrypsin digestion
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
TGAVPRANRIVQQLVEAGADLANIRTMFRNMLRGEEMILSRAEQNVFLQHFPDMLPCGIDRNSELAIALREALRRADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Effector protein hopAB3
publication title Structural analysis of HopPmaL reveals the presence of a second adaptor domain common to the HopAB family of Pseudomonas syringae type III effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. maculicola
molecule tags Signaling protein
total genus 27
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.110 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3tjyA00
3TJYA 3SVIA 3HGLA 3HGKE
chains in the Genus database with same CATH superfamily
1FXXA 3K2OA 1Q9XA 2MMBA 2FYOA 3NAEA 4FJ8A 3KD1E 3UO2A 4KHSA 4M3YA 4DTOA 2P5GA 3KD5E 2VJ4A 3QEPA 4FJGA 4DTUA 4AKGA 1XVEE 2B8IA 4GAMC 2ATQA 2OVPB 1WAFA 4KHYA 3TJYA 2JHAA 2RKHA 2DTUA 1P22A 3NGIA 1WAJA 2B7MA 4DTXA 4FJHA 3HP9A 2PFVA 1FZ0E 2DY4A 3N1BA 3OGLB 4RNGA 3SVIA 3LZIA 3TAFA 4JS5A 4J2EA 4EPHA 3RMAA 1XU5E 4JS4A 3RMDA 2P1QB 3HL8A 3LDBA 4KHUA 3SQ2A 4RL5A 4M3TA 2JPNA 1XU3E 3E4YA 4RG8A 4X5MA 2YB5A 3C95A 3QNNA 3RMBA 4DTJA 4FJKA 4I9LA 4X5NA 3HGKE 3CFPA 3SCXA 1IG9A 4QNDA 4DTNA 1LDKE 3TABA 4DU4A 1FZ5E 1XVGE 4M3WA 4M45A 2LF3A 3C6OB 1FZ3E 1XL3C 4FJ7A 3SUQA 3SUOA 4ADOA 2K5SA 4AKHA 2E31A 1XVDE 2OZSA 4KI6A 4KHWA 1FPOA 3NE6A 4DU1A 3TAEA 1Q9YA 3NHGA 4J2DA 4FJNA 4M42A 1XMHE 3CFRA 3E4WA 2OVRB 2P1NB 3SQ1A 1XVBE 2JHPA 3L1NA 3UO3A 1XVCE 4DTRA 1FZ1E 3QETA 3QEVA 2RCUA 4FJIA 3MKSB 1XMFE 1XVFE 2JQTA 3HGLA 4FJ5A 3S9HA 1MMOG 4FJ9A 1JW2A 3V7DB 3QEWA 2JH8A 3J2PA 4FK0A 2E32A 4KHNA 2DEBA 4KHQA 5H37A 1FZ2E 2VJ5A 3UIQA 1MHZG 3LD8A 2P1OB 3J27A 4DU3A 3SJJA 4FK2A 2MZWB 4DTSA 1FZ8E 3QEIA 4FJJA 3BVOA 2P5OA 1CLQA 4ICGC 3C94A 1FZHE 3SUNA 4IT5A 4M3RA 3N1EA 3SI6A 4J2BA 3L0MA 3QERA 1FZ9E 3C6PB 4EYWA 1MHYG 3SUPA 3QNOA 3OGKB 3WSOA 3SNNA 4FJLA 5IREA 4QNCA 3LDSA 4FK4A 1MTYG 3SPYA 4M3XA 3OGMB 3L2OB 3TL8B 2P1MB 5IZ7A 4KI4A 2MW2A 1IH7A 2JH9A 4I9QA 3RMCA 4E3SA 5IBKB 4ADNA 3L8BA 4AKIA 2VIXA 3QESA 2LF6A 2OYQA 1N1CA 4M41A 3CFOA 2OVQB 3C6NB 2B1EA 2P1PB 4M3ZA 1FYZE 4E4BA 1FZ4E 4EP9A 3TAGA 2H4TA 4FVMA 2PFTA 4DTPA 2OZMA 4FJXA 2JHCA 4FJMA 3SPZA 4M3UA 4AI6A 3SQ4A 2QXFA 4HCBA 3CQ8A 2FW3A 3LZJA 1FZ6E 2HD0A 4J2AA 1XMGE 1FZ7E 3NCIA 3QEXA 1NEXB 1FS1A 4DTMA 4JRQA 4JRPA 3SQ0A 3RWUA 4B08A 3NDKA 1FZIE 4HCCA 4I6JB
chains in the Genus database with same CATH topology
1FXXA 3K2OA 1Q9XA 2MMBA 2FYOA 3NAEA 4FJ8A 3KD1E 4KHSA 4M3YA 4DTOA 2P5GA 3KD5E 2VJ4A 3QEPA 4FJGA 4DTUA 4AKGA 1XVEE 2B8IA 4GAMC 2ATQA 2OVPB 1WAFA 4KHYA 3TJYA 2JHAA 2DTUA 1P22A 3NGIA 1WAJA 2B7MA 4DTXA 4FJHA 3HP9A 2PFVA 1FZ0E 2DY4A 3N1BA 3OGLB 4RNGA 3SVIA 3LZIA 3TAFA 4JS5A 4J2EA 4EPHA 1XU5E 4JS4A 3RMDA 2P1QB 3HL8A 3LDBA 4KHUA 3SQ2A 4RL5A 4M3TA 2JPNA 1XU3E 3E4YA 4RG8A 4X5MA 2YB5A 3C95A 3QNNA 3RMBA 4DTJA 4FJKA 4I9LA 4X5NA 3HGKE 3CFPA 3SCXA 1IG9A 4QNDA 4DTNA 1LDKE 3TABA 4DU4A 1FZ5E 1XVGE 4M3WA 4M45A 2LF3A 3C6OB 1FZ3E 1XL3C 4FJ7A 3SUQA 3SUOA 4ADOA 4AKHA 2E31A 1XVDE 2OZSA 4KI6A 4KHWA 3NE6A 4DU1A 3TAEA 1Q9YA 3NHGA 4J2DA 4FJNA 4M42A 1XMHE 3CFRA 3E4WA 2OVRB 2P1NB 3SQ1A 1XVBE 2JHPA 3L1NA 3QETA 1XVCE 4DTRA 1FZ1E 3QEVA 3RMAA 2RCUA 4FJIA 3MKSB 1XMFE 1XVFE 3HGLA 4FJ5A 3S9HA 1MMOG 4FJ9A 3V7DB 3QEWA 2JH8A 3J2PA 4FK0A 2E32A 4KHNA 2DEBA 4KHQA 5H37A 1FZ2E 2VJ5A 3UIQA 1MHZG 3LD8A 2P1OB 3J27A 4DU3A 3SJJA 4FK2A 2MZWB 4DTSA 1FZ8E 3QEIA 4FJJA 2P5OA 1CLQA 3C94A 1FZHE 3SUNA 4M3RA 3N1EA 3SI6A 4J2BA 3L0MA 3QERA 1FZ9E 3C6PB 4EYWA 1MHYG 3SUPA 3QNOA 3OGKB 3WSOA 3SNNA 4FJLA 5IREA 4QNCA 3LDSA 4FK4A 1MTYG 3SPYA 4M3XA 3OGMB 3L2OB 3TL8B 2P1MB 5IZ7A 4KI4A 1IH7A 2JH9A 4I9QA 3RMCA 4E3SA 5IBKB 4ADNA 3L8BA 4AKIA 2VIXA 3QESA 2LF6A 2OYQA 4M41A 3CFOA 2OVQB 3C6NB 2B1EA 2P1PB 4M3ZA 1FYZE 4E4BA 1FZ4E 4EP9A 3TAGA 2H4TA 4FVMA 2PFTA 4DTPA 2OZMA 4FJXA 2JHCA 4FJMA 3SPZA 4M3UA 4AI6A 3SQ4A 2QXFA 4HCBA 3CQ8A 2FW3A 3LZJA 1FZ6E 2HD0A 4J2AA 1XMGE 1FZ7E 3NCIA 3QEXA 1NEXB 1FS1A 4DTMA 4JRQA 4JRPA 3SQ0A 3RWUA 4B08A 3NDKA 1FZIE 4HCCA 4I6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJY A;  3SVI A;  3HGL A;  3HGK E; 
#chains in the Genus database with same CATH topology
 1FXX A;  3K2O A;  1Q9X A;  2MMB A;  2FYO A;  3NAE A;  4FJ8 A;  3KD1 E;  3UO2 A;  4KHS A;  4M3Y A;  4DTO A;  2P5G A;  3KD5 E;  2VJ4 A;  3QEP A;  4FJG A;  4DTU A;  4AKG A;  1XVE E;  2B8I A;  4GAM C;  2ATQ A;  2OVP B;  1WAF A;  4KHY A;  3TJY A;  2JHA A;  2RKH A;  2DTU A;  1P22 A;  3NGI A;  1WAJ A;  2B7M A;  4DTX A;  4FJH A;  3HP9 A;  2PFV A;  1FZ0 E;  2DY4 A;  3N1B A;  3OGL B;  4RNG A;  3SVI A;  3LZI A;  3TAF A;  4JS5 A;  4J2E A;  4EPH A;  3RMA A;  1XU5 E;  4JS4 A;  3RMD A;  2P1Q B;  3HL8 A;  3LDB A;  4KHU A;  3SQ2 A;  4RL5 A;  4M3T A;  2JPN A;  1XU3 E;  3E4Y A;  4RG8 A;  4X5M A;  2YB5 A;  3C95 A;  3QNN A;  3RMB A;  4DTJ A;  4FJK A;  4I9L A;  4X5N A;  3HGK E;  3CFP A;  3SCX A;  1IG9 A;  4QND A;  4DTN A;  1LDK E;  3TAB A;  4DU4 A;  1FZ5 E;  1XVG E;  4M3W A;  4M45 A;  2LF3 A;  3C6O B;  1FZ3 E;  1XL3 C;  4FJ7 A;  3SUQ A;  3SUO A;  4ADO A;  2K5S A;  4AKH A;  2E31 A;  1XVD E;  2OZS A;  4KI6 A;  4KHW A;  1FPO A;  3NE6 A;  4DU1 A;  3TAE A;  1Q9Y A;  3NHG A;  4J2D A;  4FJN A;  4M42 A;  1XMH E;  3CFR A;  3E4W A;  2OVR B;  2P1N B;  3SQ1 A;  1XVB E;  2JHP A;  3L1N A;  3UO3 A;  1XVC E;  4DTR A;  1FZ1 E;  3QET A;  3QEV A;  2RCU A;  4FJI A;  3MKS B;  1XMF E;  1XVF E;  2JQT A;  3HGL A;  4FJ5 A;  3S9H A;  1MMO G;  4FJ9 A;  1JW2 A;  3V7D B;  3QEW A;  2JH8 A;  3J2P A;  4FK0 A;  2E32 A;  4KHN A;  2DEB A;  4KHQ A;  5H37 A;  1FZ2 E;  2VJ5 A;  3UIQ A;  1MHZ G;  3LD8 A;  2P1O B;  3J27 A;  4DU3 A;  3SJJ A;  4FK2 A;  2MZW B;  4DTS A;  1FZ8 E;  3QEI A;  4FJJ A;  3BVO A;  2P5O A;  1CLQ A;  4ICG C;  3C94 A;  1FZH E;  3SUN A;  4IT5 A;  4M3R A;  3N1E A;  3SI6 A;  4J2B A;  3L0M A;  3QER A;  1FZ9 E;  3C6P B;  4EYW A;  1MHY G;  3SUP A;  3QNO A;  3OGK B;  3WSO A;  3SNN A;  4FJL A;  5IRE A;  4QNC A;  3LDS A;  4FK4 A;  1MTY G;  3SPY A;  4M3X A;  3OGM B;  3L2O B;  3TL8 B;  2P1M B;  5IZ7 A;  4KI4 A;  2MW2 A;  1IH7 A;  2JH9 A;  4I9Q A;  3RMC A;  4E3S A;  5IBK B;  4ADN A;  3L8B A;  4AKI A;  2VIX A;  3QES A;  2LF6 A;  2OYQ A;  1N1C A;  4M41 A;  3CFO A;  2OVQ B;  3C6N B;  2B1E A;  2P1P B;  4M3Z A;  1FYZ E;  4E4B A;  1FZ4 E;  4EP9 A;  3TAG A;  2H4T A;  4FVM A;  2PFT A;  4DTP A;  2OZM A;  4FJX A;  2JHC A;  4FJM A;  3SPZ A;  4M3U A;  4AI6 A;  3SQ4 A;  2QXF A;  4HCB A;  3CQ8 A;  2FW3 A;  3LZJ A;  1FZ6 E;  2HD0 A;  4J2A A;  1XMG E;  1FZ7 E;  3NCI A;  3QEX A;  1NEX B;  1FS1 A;  4DTM A;  4JRQ A;  4JRP A;  3SQ0 A;  3RWU A;  4B08 A;  3NDK A;  1FZI E;  4HCC A;  4I6J B; 
#chains in the Genus database with same CATH homology
 1FXX A;  3K2O A;  1Q9X A;  2MMB A;  2FYO A;  3NAE A;  4FJ8 A;  3KD1 E;  4KHS A;  4M3Y A;  4DTO A;  2P5G A;  3KD5 E;  2VJ4 A;  3QEP A;  4FJG A;  4DTU A;  4AKG A;  1XVE E;  2B8I A;  4GAM C;  2ATQ A;  2OVP B;  1WAF A;  4KHY A;  3TJY A;  2JHA A;  2DTU A;  1P22 A;  3NGI A;  1WAJ A;  2B7M A;  4DTX A;  4FJH A;  3HP9 A;  2PFV A;  1FZ0 E;  2DY4 A;  3N1B A;  3OGL B;  4RNG A;  3SVI A;  3LZI A;  3TAF A;  4JS5 A;  4J2E A;  4EPH A;  1XU5 E;  4JS4 A;  3RMD A;  2P1Q B;  3HL8 A;  3LDB A;  4KHU A;  3SQ2 A;  4RL5 A;  4M3T A;  2JPN A;  1XU3 E;  3E4Y A;  4RG8 A;  4X5M A;  2YB5 A;  3C95 A;  3QNN A;  3RMB A;  4DTJ A;  4FJK A;  4I9L A;  4X5N A;  3HGK E;  3CFP A;  3SCX A;  1IG9 A;  4QND A;  4DTN A;  1LDK E;  3TAB A;  4DU4 A;  1FZ5 E;  1XVG E;  4M3W A;  4M45 A;  2LF3 A;  3C6O B;  1FZ3 E;  1XL3 C;  4FJ7 A;  3SUQ A;  3SUO A;  4ADO A;  4AKH A;  2E31 A;  1XVD E;  2OZS A;  4KI6 A;  4KHW A;  3NE6 A;  4DU1 A;  3TAE A;  1Q9Y A;  3NHG A;  4J2D A;  4FJN A;  4M42 A;  1XMH E;  3CFR A;  3E4W A;  2OVR B;  2P1N B;  3SQ1 A;  1XVB E;  2JHP A;  3L1N A;  3QET A;  1XVC E;  4DTR A;  1FZ1 E;  3QEV A;  3RMA A;  2RCU A;  4FJI A;  3MKS B;  1XMF E;  1XVF E;  3HGL A;  4FJ5 A;  3S9H A;  1MMO G;  4FJ9 A;  3V7D B;  3QEW A;  2JH8 A;  3J2P A;  4FK0 A;  2E32 A;  4KHN A;  2DEB A;  4KHQ A;  5H37 A;  1FZ2 E;  2VJ5 A;  3UIQ A;  1MHZ G;  3LD8 A;  2P1O B;  3J27 A;  4DU3 A;  3SJJ A;  4FK2 A;  2MZW B;  4DTS A;  1FZ8 E;  3QEI A;  4FJJ A;  2P5O A;  1CLQ A;  3C94 A;  1FZH E;  3SUN A;  4M3R A;  3N1E A;  3SI6 A;  4J2B A;  3L0M A;  3QER A;  1FZ9 E;  3C6P B;  4EYW A;  1MHY G;  3SUP A;  3QNO A;  3OGK B;  3WSO A;  3SNN A;  4FJL A;  5IRE A;  4QNC A;  3LDS A;  4FK4 A;  1MTY G;  3SPY A;  4M3X A;  3OGM B;  3L2O B;  3TL8 B;  2P1M B;  5IZ7 A;  4KI4 A;  1IH7 A;  2JH9 A;  4I9Q A;  3RMC A;  4E3S A;  5IBK B;  4ADN A;  3L8B A;  4AKI A;  2VIX A;  3QES A;  2LF6 A;  2OYQ A;  4M41 A;  3CFO A;  2OVQ B;  3C6N B;  2B1E A;  2P1P B;  4M3Z A;  1FYZ E;  4E4B A;  1FZ4 E;  4EP9 A;  3TAG A;  2H4T A;  4FVM A;  2PFT A;  4DTP A;  2OZM A;  4FJX A;  2JHC A;  4FJM A;  3SPZ A;  4M3U A;  4AI6 A;  3SQ4 A;  2QXF A;  4HCB A;  3CQ8 A;  2FW3 A;  3LZJ A;  1FZ6 E;  2HD0 A;  4J2A A;  1XMG E;  1FZ7 E;  3NCI A;  3QEX A;  1NEX B;  1FS1 A;  4DTM A;  4JRQ A;  4JRP A;  3SQ0 A;  3RWU A;  4B08 A;  3NDK A;  1FZI E;  4HCC A;  4I6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...