3TJYA

Structure of the pto-binding domain of hoppmal generated by limited chymotrypsin digestion
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
TGAVPRANRIVQQLVEAGADLANIRTMFRNMLRGEEMILSRAEQNVFLQHFPDMLPCGIDRNSELAIALREALRRADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of HopPmaL reveals the presence of a second adaptor domain common to the HopAB family of Pseudomonas syringae type III effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. maculicola
molecule tags Signaling protein
molecule keywords Effector protein hopAB3
total genus 27
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.110 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3tjyA00
3HGLA 3HGKE 3TJYA 3SVIA
chains in the Genus database with same CATH superfamily
1FYZE 2ATQA 3L8BA 1FZHE 2MZWB 3LDBA 3QERA 4FK4A 2DY4A 4AI6A 5IZ7A 1XMFE 2PFVA 4KHWA 4FJIA 2B7MA 3CQ8A 3SNNA 3TAFA 4HCCA 4KHSA 4M3RA 2YB5A 4GAMC 1FZ7E 2B8IA 3NE6A 3LZIA 3SQ4A 3SUPA 4FJ9A 3V7DB 4DTRA 1FZ6E 4M3UA 5IREA 1FZ8E 3K2OA 3SCXA 4M3TA 4M41A 4FJKA 4AKIA 1MTYG 3E4WA 2VJ5A 3MKSB 2RKHA 3LDSA 2P5OA 1XVGE 4FVMA 4QNCA 3SQ0A 3KD5E 2VJ4A 1Q9XA 4FJGA 4KHNA 4JS4A 2JH8A 4FJ5A 4FJLA 4HCBA 1XU5E 2LF3A 1IG9A 3WSOA 3CFRA 3QETA 3NAEA 3OGLB 3LD8A 3CFOA 1XL3C 4X5NA 3NDKA 4M3XA 4FJXA 4J2BA 2VIXA 2P1NB 2H4TA 3SUOA 4JRPA 1FZ0E 4JS5A 3SI6A 4KHQA 3C6NB 3S9HA 4M3YA 4I6JB 3QEWA 3TABA 3UIQA 4M42A 1MMOG 3TAGA 1FZ4E 3UO3A 1FZ5E 1XVFE 2P1PB 3HP9A 2JPNA 3C94A 1FPOA 1WAJA 3NHGA 2OZMA 2JHCA 4FJJA 4M3ZA 1XMHE 1FZ2E 1P22A 1XVBE 2QXFA 4ADOA 3UO2A 4AKHA 1FXXA 2MMBA 4KHYA 4I9LA 2FYOA 4DTNA 4E4BA 4M45A 1MHYG 1XU3E 2FW3A 3J27A 1WAFA 4DTXA 3HGKE 4J2AA 2MW2A 4RNGA 2RCUA 2P1QB 3L2OB 3SUQA 4J2EA 1XVEE 3LZJA 3SUNA 4FK2A 2P5GA 1FZ9E 4DU3A 3KD1E 2HD0A 2OYQA 2OZSA 1MHZG 3HGLA 4FJMA 3BVOA 4FJ7A 3SJJA 2OVPB 1N1CA 1Q9YA 4I9QA 3J2PA 2E32A 4X5MA 5H37A 1FZIE 4IT5A 2P1MB 2JQTA 3SVIA 4DU1A 3RMAA 4FJ8A 2JHPA 3QESA 4FJHA 1CLQA 1IH7A 4DTPA 3C95A 1XVDE 3TJYA 2B1EA 4KI4A 4FJNA 3RMDA 2P1OB 3L1NA 1FZ3E 2E31A 3RMCA 3SPYA 3RMBA 5IBKB 1NEXB 3SPZA 1LDKE 4DTMA 3E4YA 4FK0A 1XMGE 3C6OB 3TAEA 4E3SA 4QNDA 2OVRB 3NCIA 4ICGC 2OVQB 4EYWA 4KI6A 4AKGA 4J2DA 3QEVA 2DTUA 1FZ1E 4B08A 3CFPA 4JRQA 3SQ2A 4RG8A 3C6PB 3RWUA 1XVCE 4ADNA 1FS1A 2K5SA 3SQ1A 4EP9A 1JW2A 3QNOA 4DU4A 3N1BA 4EPHA 3QEIA 3TL8B 3N1EA 3OGKB 2PFTA 4M3WA 3NGIA 4KHUA 3QNNA 3QEPA 4RL5A 4DTJA 2DEBA 2JH9A 3L0MA 2JHAA 2LF6A 4DTOA 3QEXA 3HL8A 3OGMB 4DTUA 4DTSA
chains in the Genus database with same CATH topology
1FYZE 2ATQA 3L8BA 1FZHE 2MZWB 3LDBA 3QERA 4FK4A 2DY4A 4AI6A 5IZ7A 1XMFE 2PFVA 4KHWA 4FJIA 2B7MA 3CQ8A 3SNNA 3TAFA 4HCCA 4KHSA 4M3RA 2YB5A 4GAMC 1FZ7E 2B8IA 3NE6A 3LZIA 3SQ4A 3SUPA 4FJ9A 3V7DB 4DTRA 1FZ6E 4M3UA 5IREA 1FZ8E 3K2OA 3SCXA 4M3TA 4M41A 4FJKA 4AKIA 1MTYG 3E4WA 2VJ5A 3MKSB 3LDSA 2P5OA 1XVGE 4FVMA 4QNCA 3SQ0A 3KD5E 2VJ4A 1Q9XA 4FJGA 4KHNA 4JS4A 2JH8A 4FJ5A 4FJLA 4HCBA 1XU5E 2LF3A 1IG9A 3WSOA 3CFRA 3QETA 3NAEA 3OGLB 3LD8A 3CFOA 1XL3C 4X5NA 3NDKA 4M3XA 4FJXA 4J2BA 2VIXA 2P1NB 2H4TA 3SUOA 4JRPA 1FZ0E 4JS5A 3SI6A 4KHQA 3C6NB 3S9HA 4M3YA 4I6JB 3QEWA 3TABA 3UIQA 4M42A 1MMOG 3TAGA 1FZ4E 1FZ5E 1XVFE 2P1PB 3HP9A 2JPNA 3C94A 4FJJA 1WAJA 3NHGA 2OZMA 2JHCA 4M3ZA 1XMHE 1FZ2E 1P22A 1XVBE 2QXFA 4ADOA 4AKHA 1FXXA 2MMBA 4KHYA 4I9LA 2FYOA 4DTNA 4E4BA 4M45A 1MHYG 1XU3E 3J27A 2FW3A 1WAFA 4DTXA 3HGKE 4J2AA 4RNGA 2RCUA 2P1QB 3L2OB 3SUQA 4J2EA 1XVEE 3LZJA 3SUNA 4FK2A 2P5GA 1FZ9E 4DU3A 3KD1E 2HD0A 2OYQA 2OZSA 1MHZG 3HGLA 4FJMA 4FJ7A 3SJJA 2OVPB 4I9QA 1Q9YA 3J2PA 2E32A 4X5MA 5H37A 1FZIE 2P1MB 3RMAA 3SVIA 4DU1A 4FJ8A 2JHPA 3QESA 4FJHA 1CLQA 1IH7A 4DTPA 3C95A 1XVDE 3TJYA 2B1EA 4KI4A 4FJNA 3RMDA 2P1OB 3L1NA 1FZ3E 2E31A 3RMCA 3SPYA 3RMBA 5IBKB 1NEXB 3SPZA 1LDKE 4DTMA 3E4YA 4FK0A 1XMGE 3C6OB 3TAEA 4E3SA 4QNDA 2OVRB 3NCIA 2OVQB 4EYWA 4KI6A 4AKGA 4J2DA 3QEVA 2DTUA 1FZ1E 4B08A 3CFPA 4JRQA 3SQ2A 4RG8A 3C6PB 3RWUA 1XVCE 4ADNA 1FS1A 3SQ1A 4EP9A 3QNOA 4DU4A 3N1BA 4EPHA 3QEIA 3TL8B 3N1EA 3OGKB 2PFTA 4M3WA 3NGIA 4KHUA 3QNNA 3QEPA 4RL5A 4DTJA 2DEBA 2JH9A 3L0MA 2JHAA 2LF6A 4DTOA 3QEXA 3HL8A 3OGMB 4DTUA 4DTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HGL A;  3HGK E;  3TJY A;  3SVI A; 
#chains in the Genus database with same CATH topology
 1FYZ E;  2ATQ A;  3L8B A;  1FZH E;  2MZW B;  3LDB A;  3QER A;  4FK4 A;  2DY4 A;  4AI6 A;  5IZ7 A;  1XMF E;  2PFV A;  4KHW A;  4FJI A;  2B7M A;  3CQ8 A;  3SNN A;  3TAF A;  4HCC A;  4KHS A;  4M3R A;  2YB5 A;  4GAM C;  1FZ7 E;  2B8I A;  3NE6 A;  3LZI A;  3SQ4 A;  3SUP A;  4FJ9 A;  3V7D B;  4DTR A;  1FZ6 E;  4M3U A;  5IRE A;  1FZ8 E;  3K2O A;  3SCX A;  4M3T A;  4M41 A;  4FJK A;  4AKI A;  1MTY G;  3E4W A;  2VJ5 A;  3MKS B;  2RKH A;  3LDS A;  2P5O A;  1XVG E;  4FVM A;  4QNC A;  3SQ0 A;  3KD5 E;  2VJ4 A;  1Q9X A;  4FJG A;  4KHN A;  4JS4 A;  2JH8 A;  4FJ5 A;  4FJL A;  4HCB A;  1XU5 E;  2LF3 A;  1IG9 A;  3WSO A;  3CFR A;  3QET A;  3NAE A;  3OGL B;  3LD8 A;  3CFO A;  1XL3 C;  4X5N A;  3NDK A;  4M3X A;  4FJX A;  4J2B A;  2VIX A;  2P1N B;  2H4T A;  3SUO A;  4JRP A;  1FZ0 E;  4JS5 A;  3SI6 A;  4KHQ A;  3C6N B;  3S9H A;  4M3Y A;  4I6J B;  3QEW A;  3TAB A;  3UIQ A;  4M42 A;  1MMO G;  3TAG A;  1FZ4 E;  3UO3 A;  1FZ5 E;  1XVF E;  2P1P B;  3HP9 A;  2JPN A;  3C94 A;  1FPO A;  1WAJ A;  3NHG A;  2OZM A;  2JHC A;  4FJJ A;  4M3Z A;  1XMH E;  1FZ2 E;  1P22 A;  1XVB E;  2QXF A;  4ADO A;  3UO2 A;  4AKH A;  1FXX A;  2MMB A;  4KHY A;  4I9L A;  2FYO A;  4DTN A;  4E4B A;  4M45 A;  1MHY G;  1XU3 E;  2FW3 A;  3J27 A;  1WAF A;  4DTX A;  3HGK E;  4J2A A;  2MW2 A;  4RNG A;  2RCU A;  2P1Q B;  3L2O B;  3SUQ A;  4J2E A;  1XVE E;  3LZJ A;  3SUN A;  4FK2 A;  2P5G A;  1FZ9 E;  4DU3 A;  3KD1 E;  2HD0 A;  2OYQ A;  2OZS A;  1MHZ G;  3HGL A;  4FJM A;  3BVO A;  4FJ7 A;  3SJJ A;  2OVP B;  1N1C A;  1Q9Y A;  4I9Q A;  3J2P A;  2E32 A;  4X5M A;  5H37 A;  1FZI E;  4IT5 A;  2P1M B;  2JQT A;  3SVI A;  4DU1 A;  3RMA A;  4FJ8 A;  2JHP A;  3QES A;  4FJH A;  1CLQ A;  1IH7 A;  4DTP A;  3C95 A;  1XVD E;  3TJY A;  2B1E A;  4KI4 A;  4FJN A;  3RMD A;  2P1O B;  3L1N A;  1FZ3 E;  2E31 A;  3RMC A;  3SPY A;  3RMB A;  5IBK B;  1NEX B;  3SPZ A;  1LDK E;  4DTM A;  3E4Y A;  4FK0 A;  1XMG E;  3C6O B;  3TAE A;  4E3S A;  4QND A;  2OVR B;  3NCI A;  4ICG C;  2OVQ B;  4EYW A;  4KI6 A;  4AKG A;  4J2D A;  3QEV A;  2DTU A;  1FZ1 E;  4B08 A;  3CFP A;  4JRQ A;  3SQ2 A;  4RG8 A;  3C6P B;  3RWU A;  1XVC E;  4ADN A;  1FS1 A;  2K5S A;  3SQ1 A;  4EP9 A;  1JW2 A;  3QNO A;  4DU4 A;  3N1B A;  4EPH A;  3QEI A;  3TL8 B;  3N1E A;  3OGK B;  2PFT A;  4M3W A;  3NGI A;  4KHU A;  3QNN A;  3QEP A;  4RL5 A;  4DTJ A;  2DEB A;  2JH9 A;  3L0M A;  2JHA A;  2LF6 A;  4DTO A;  3QEX A;  3HL8 A;  3OGM B;  4DTU A;  4DTS A; 
#chains in the Genus database with same CATH homology
 1FYZ E;  2ATQ A;  3L8B A;  1FZH E;  2MZW B;  3LDB A;  3QER A;  4FK4 A;  2DY4 A;  4AI6 A;  5IZ7 A;  1XMF E;  2PFV A;  4KHW A;  4FJI A;  2B7M A;  3CQ8 A;  3SNN A;  3TAF A;  4HCC A;  4KHS A;  4M3R A;  2YB5 A;  4GAM C;  1FZ7 E;  2B8I A;  3NE6 A;  3LZI A;  3SQ4 A;  3SUP A;  4FJ9 A;  3V7D B;  4DTR A;  1FZ6 E;  4M3U A;  5IRE A;  1FZ8 E;  3K2O A;  3SCX A;  4M3T A;  4M41 A;  4FJK A;  4AKI A;  1MTY G;  3E4W A;  2VJ5 A;  3MKS B;  3LDS A;  2P5O A;  1XVG E;  4FVM A;  4QNC A;  3SQ0 A;  3KD5 E;  2VJ4 A;  1Q9X A;  4FJG A;  4KHN A;  4JS4 A;  2JH8 A;  4FJ5 A;  4FJL A;  4HCB A;  1XU5 E;  2LF3 A;  1IG9 A;  3WSO A;  3CFR A;  3QET A;  3NAE A;  3OGL B;  3LD8 A;  3CFO A;  1XL3 C;  4X5N A;  3NDK A;  4M3X A;  4FJX A;  4J2B A;  2VIX A;  2P1N B;  2H4T A;  3SUO A;  4JRP A;  1FZ0 E;  4JS5 A;  3SI6 A;  4KHQ A;  3C6N B;  3S9H A;  4M3Y A;  4I6J B;  3QEW A;  3TAB A;  3UIQ A;  4M42 A;  1MMO G;  3TAG A;  1FZ4 E;  1FZ5 E;  1XVF E;  2P1P B;  3HP9 A;  2JPN A;  3C94 A;  4FJJ A;  1WAJ A;  3NHG A;  2OZM A;  2JHC A;  4M3Z A;  1XMH E;  1FZ2 E;  1P22 A;  1XVB E;  2QXF A;  4ADO A;  4AKH A;  1FXX A;  2MMB A;  4KHY A;  4I9L A;  2FYO A;  4DTN A;  4E4B A;  4M45 A;  1MHY G;  1XU3 E;  3J27 A;  2FW3 A;  1WAF A;  4DTX A;  3HGK E;  4J2A A;  4RNG A;  2RCU A;  2P1Q B;  3L2O B;  3SUQ A;  4J2E A;  1XVE E;  3LZJ A;  3SUN A;  4FK2 A;  2P5G A;  1FZ9 E;  4DU3 A;  3KD1 E;  2HD0 A;  2OYQ A;  2OZS A;  1MHZ G;  3HGL A;  4FJM A;  4FJ7 A;  3SJJ A;  2OVP B;  4I9Q A;  1Q9Y A;  3J2P A;  2E32 A;  4X5M A;  5H37 A;  1FZI E;  2P1M B;  3RMA A;  3SVI A;  4DU1 A;  4FJ8 A;  2JHP A;  3QES A;  4FJH A;  1CLQ A;  1IH7 A;  4DTP A;  3C95 A;  1XVD E;  3TJY A;  2B1E A;  4KI4 A;  4FJN A;  3RMD A;  2P1O B;  3L1N A;  1FZ3 E;  2E31 A;  3RMC A;  3SPY A;  3RMB A;  5IBK B;  1NEX B;  3SPZ A;  1LDK E;  4DTM A;  3E4Y A;  4FK0 A;  1XMG E;  3C6O B;  3TAE A;  4E3S A;  4QND A;  2OVR B;  3NCI A;  2OVQ B;  4EYW A;  4KI6 A;  4AKG A;  4J2D A;  3QEV A;  2DTU A;  1FZ1 E;  4B08 A;  3CFP A;  4JRQ A;  3SQ2 A;  4RG8 A;  3C6P B;  3RWU A;  1XVC E;  4ADN A;  1FS1 A;  3SQ1 A;  4EP9 A;  3QNO A;  4DU4 A;  3N1B A;  4EPH A;  3QEI A;  3TL8 B;  3N1E A;  3OGK B;  2PFT A;  4M3W A;  3NGI A;  4KHU A;  3QNN A;  3QEP A;  4RL5 A;  4DTJ A;  2DEB A;  2JH9 A;  3L0M A;  2JHA A;  2LF6 A;  4DTO A;  3QEX A;  3HL8 A;  3OGM B;  4DTU A;  4DTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...