4E4BA

Structure of the fusidic acid resistance protein fusb
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Far1
publication title Investigating the FusB:EF-G interface
rcsb
source organism Staphylococcus aureus
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
A PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4e4bA01
4ADNA 4ADOA 4E4BA 2YB5A 2MZWB
chains in the Genus database with same CATH superfamily
1FYZE 3SNNA 3SUQA 3NHGA 3TAGA 4M42A 2ATQA 1WAJA 3MKSB 3SQ2A 2YB5A 3SQ4A 2E31A 2JPNA 2OVRB 4FJXA 1FZHE 4M3XA 1XVDE 4FJ9A 3RWUA 2VJ5A 2JHCA 2FW3A 4ADNA 3KD1E 1FZ9E 3LDBA 3N1EA 5IZ7A 1FXXA 3SUOA 2OZSA 2VJ4A 4FK2A 3K2OA 2JH8A 3BVOA 3HL8A 1LDKE 4HCBA 4RNGA 4DU3A 3C95A 3SCXA 2LF3A 2H4TA 1N1CA 4JS5A 3C6NB 4DTPA 3QNOA 3QEXA 3SQ0A 3E4YA 3KD5E 4FJ8A 4RL5A 3TJYA 3TABA 1MHYG 1MMOG 4DU1A 4I6JB 3HP9A 4DTJA 3QESA 1WAFA 3L2OB 3J27A 1XMGE 4FJNA 3C6PB 2MW2A 3SPZA 3NDKA 4M3TA 4RG8A 2DTUA 1FZ6E 2OVPB 2B7MA 4KHNA 4X5MA 4KHYA 1XVBE 3SUNA 4FJKA 4FJ5A 5IREA 4KHSA 1IH7A 1XU3E 1Q9XA 4KI6A 4AKGA 4M41A 1Q9YA 3QEPA 2FYOA 2E32A 4QNCA 2P1QB 2JQTA 4ICGC 3SI6A 4J2BA 2JHAA 4J2DA 4DTSA 4GAMC 5IBKB 4AKHA 1FS1A 3UO2A 3LZIA 3SQ1A 3OGKB 1FZ4E 4B08A 4JRQA 3QETA 3SPYA 1CLQA 2B1EA 3L8BA 3C94A 1XVFE 3NAEA 2JH9A 4IT5A 3RMDA 4FJMA 2K5SA 2RCUA 1P22A 4AKIA 3LDSA 4E3SA 3UO3A 4FJGA 4KHWA 4DTUA 1FPOA 1XL3C 3E4WA 3NGIA 4JS4A 2OYQA 4I9LA 2OVQB 2HD0A 4E4BA 3QEWA 4DTOA 1FZ0E 2B8IA 3QERA 3SJJA 2QXFA 3CFRA 4FJ7A 4EYWA 4HCCA 4KI4A 3RMBA 4FK4A 2P1MB 2RKHA 4I9QA 4M3WA 3QNNA 3UIQA 2P1PB 1MHZG 1XVCE 3LZJA 3V7DB 4FK0A 1FZ3E 1FZ5E 3SVIA 4JRPA 4QNDA 4M3YA 2DEBA 3L1NA 4DTXA 4M3UA 4M3ZA 2MMBA 2PFVA 4ADOA 4DTMA 4M3RA 1FZ2E 2DY4A 1FZ1E 4EP9A 3CFOA 5H37A 1XU5E 3RMAA 1NEXB 4DU4A 4J2AA 2JHPA 3CQ8A 4DTRA 3CFPA 3QEIA 3TL8B 3TAFA 2OZMA 4KHQA 2P5GA 3OGMB 3WSOA 1XMFE 3QEVA 3S9HA 3NE6A 4DTNA 1FZIE 1XVEE 4X5NA 2VIXA 1JW2A 4EPHA 2P1OB 1FZ7E 1IG9A 3N1BA 1MTYG 3C6OB 3HGLA 3NCIA 1XMHE 1XVGE 4FJJA 4J2EA 1FZ8E 2P5OA 4FJHA 4KHUA 3LD8A 2LF6A 4FJIA 3TAEA 2PFTA 2P1NB 4AI6A 3SUPA 3J2PA 3L0MA 3HGKE 4FVMA 3OGLB 2MZWB 4M45A 3RMCA 4FJLA
chains in the Genus database with same CATH topology
1FYZE 3SNNA 3SUQA 3NHGA 3TAGA 4M42A 2ATQA 1WAJA 3MKSB 3SQ2A 2YB5A 3SQ4A 2E31A 2JPNA 2OVRB 4FJXA 1FZHE 4M3XA 1XVDE 4FJ9A 3RWUA 2VJ5A 2JHCA 2FW3A 4ADNA 3KD1E 1FZ9E 3LDBA 3N1EA 5IZ7A 1FXXA 3SUOA 2OZSA 2VJ4A 4FK2A 3K2OA 2JH8A 3HL8A 1LDKE 4HCBA 4RNGA 4DU3A 3C95A 3SCXA 2LF3A 2H4TA 4JS5A 3QNOA 3C6NB 4DTPA 3QEXA 3SQ0A 2OYQA 3E4YA 3KD5E 4FJ8A 4RL5A 3TJYA 3TABA 1MHYG 1MMOG 4DU1A 4I6JB 3HP9A 4DTJA 3QESA 1WAFA 3L2OB 3J27A 1XMGE 4FJNA 3C6PB 3SPZA 3NDKA 4M3TA 4RG8A 2DTUA 1FZ6E 2OVPB 2B7MA 4KHNA 4X5MA 4KHYA 1XVBE 3SUNA 4FJKA 4FJ5A 5IREA 4KHSA 1IH7A 1XU3E 1Q9XA 4KI6A 4AKGA 4M41A 1Q9YA 3QEPA 2FYOA 2E32A 4QNCA 2P1QB 3SI6A 4J2BA 2JHAA 4J2DA 4DTSA 4GAMC 5IBKB 4AKHA 1FS1A 3LZIA 4FK0A 3SQ1A 3OGKB 1FZ4E 4B08A 4JRQA 3QETA 3SPYA 1CLQA 2B1EA 3L8BA 3C94A 1XVFE 3NAEA 2JH9A 3RMDA 4FJMA 2RCUA 1P22A 4AKIA 3LDSA 4E3SA 4KHWA 4FJGA 4DTUA 1XL3C 3E4WA 3NGIA 4JS4A 4I9LA 2OVQB 2HD0A 4E4BA 3QEWA 4DTOA 1FZ0E 2B8IA 3QERA 3SJJA 2QXFA 3CFRA 4FJ7A 4EYWA 4HCCA 4KI4A 3RMBA 4FK4A 2P1MB 4I9QA 4M3WA 3QNNA 3UIQA 2P1PB 1MHZG 1XVCE 3LZJA 3V7DB 1FZ3E 1FZ5E 3SVIA 4JRPA 4QNDA 4M3YA 2DEBA 3L1NA 4DTXA 4M3UA 4M3ZA 2MMBA 2PFVA 4ADOA 4DTMA 4M3RA 1FZ2E 2DY4A 1FZ1E 4EP9A 3CFOA 5H37A 1XU5E 3RMAA 1NEXB 4DU4A 4J2AA 2JHPA 3CQ8A 4DTRA 3CFPA 3QEIA 3TL8B 3TAFA 2OZMA 4KHQA 2P5GA 3OGMB 3WSOA 1XMFE 3QEVA 3S9HA 3NE6A 4DTNA 1FZIE 1XVEE 4X5NA 2VIXA 4EPHA 2P1OB 1FZ7E 1IG9A 3N1BA 1MTYG 3C6OB 3HGLA 3NCIA 1XMHE 1XVGE 4FJJA 4J2EA 1FZ8E 2P5OA 4FJHA 4KHUA 3LD8A 2LF6A 4FJIA 3TAEA 2PFTA 2P1NB 4AI6A 3SUPA 3J2PA 3L0MA 3HGKE 4FVMA 3OGLB 2MZWB 4M45A 3RMCA 4FJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ADN A;  4ADO A;  4E4B A;  2YB5 A;  2MZW B; 
#chains in the Genus database with same CATH topology
 1FYZ E;  3SNN A;  3SUQ A;  3NHG A;  3TAG A;  4M42 A;  2ATQ A;  1WAJ A;  3MKS B;  3SQ2 A;  2YB5 A;  3SQ4 A;  2E31 A;  2JPN A;  2OVR B;  4FJX A;  1FZH E;  4M3X A;  1XVD E;  4FJ9 A;  3RWU A;  2VJ5 A;  2JHC A;  2FW3 A;  4ADN A;  3KD1 E;  1FZ9 E;  3LDB A;  3N1E A;  5IZ7 A;  1FXX A;  3SUO A;  2OZS A;  2VJ4 A;  4FK2 A;  3K2O A;  2JH8 A;  3BVO A;  3HL8 A;  1LDK E;  4HCB A;  4RNG A;  4DU3 A;  3C95 A;  3SCX A;  2LF3 A;  2H4T A;  1N1C A;  4JS5 A;  3C6N B;  4DTP A;  3QNO A;  3QEX A;  3SQ0 A;  3E4Y A;  3KD5 E;  4FJ8 A;  4RL5 A;  3TJY A;  3TAB A;  1MHY G;  1MMO G;  4DU1 A;  4I6J B;  3HP9 A;  4DTJ A;  3QES A;  1WAF A;  3L2O B;  3J27 A;  1XMG E;  4FJN A;  3C6P B;  2MW2 A;  3SPZ A;  3NDK A;  4M3T A;  4RG8 A;  2DTU A;  1FZ6 E;  2OVP B;  2B7M A;  4KHN A;  4X5M A;  4KHY A;  1XVB E;  3SUN A;  4FJK A;  4FJ5 A;  5IRE A;  4KHS A;  1IH7 A;  1XU3 E;  1Q9X A;  4KI6 A;  4AKG A;  4M41 A;  1Q9Y A;  3QEP A;  2FYO A;  2E32 A;  4QNC A;  2P1Q B;  2JQT A;  4ICG C;  3SI6 A;  4J2B A;  2JHA A;  4J2D A;  4DTS A;  4GAM C;  5IBK B;  4AKH A;  1FS1 A;  3UO2 A;  3LZI A;  3SQ1 A;  3OGK B;  1FZ4 E;  4B08 A;  4JRQ A;  3QET A;  3SPY A;  1CLQ A;  2B1E A;  3L8B A;  3C94 A;  1XVF E;  3NAE A;  2JH9 A;  4IT5 A;  3RMD A;  4FJM A;  2K5S A;  2RCU A;  1P22 A;  4AKI A;  3LDS A;  4E3S A;  3UO3 A;  4FJG A;  4KHW A;  4DTU A;  1FPO A;  1XL3 C;  3E4W A;  3NGI A;  4JS4 A;  2OYQ A;  4I9L A;  2OVQ B;  2HD0 A;  4E4B A;  3QEW A;  4DTO A;  1FZ0 E;  2B8I A;  3QER A;  3SJJ A;  2QXF A;  3CFR A;  4FJ7 A;  4EYW A;  4HCC A;  4KI4 A;  3RMB A;  4FK4 A;  2P1M B;  2RKH A;  4I9Q A;  4M3W A;  3QNN A;  3UIQ A;  2P1P B;  1MHZ G;  1XVC E;  3LZJ A;  3V7D B;  4FK0 A;  1FZ3 E;  1FZ5 E;  3SVI A;  4JRP A;  4QND A;  4M3Y A;  2DEB A;  3L1N A;  4DTX A;  4M3U A;  4M3Z A;  2MMB A;  2PFV A;  4ADO A;  4DTM A;  4M3R A;  1FZ2 E;  2DY4 A;  1FZ1 E;  4EP9 A;  3CFO A;  5H37 A;  1XU5 E;  3RMA A;  1NEX B;  4DU4 A;  4J2A A;  2JHP A;  3CQ8 A;  4DTR A;  3CFP A;  3QEI A;  3TL8 B;  3TAF A;  2OZM A;  4KHQ A;  2P5G A;  3OGM B;  3WSO A;  1XMF E;  3QEV A;  3S9H A;  3NE6 A;  4DTN A;  1FZI E;  1XVE E;  4X5N A;  2VIX A;  1JW2 A;  4EPH A;  2P1O B;  1FZ7 E;  1IG9 A;  3N1B A;  1MTY G;  3C6O B;  3HGL A;  3NCI A;  1XMH E;  1XVG E;  4FJJ A;  4J2E A;  1FZ8 E;  2P5O A;  4FJH A;  4KHU A;  3LD8 A;  2LF6 A;  4FJI A;  3TAE A;  2PFT A;  2P1N B;  4AI6 A;  3SUP A;  3J2P A;  3L0M A;  3HGK E;  4FVM A;  3OGL B;  2MZW B;  4M45 A;  3RMC A;  4FJL A; 
#chains in the Genus database with same CATH homology
 1FYZ E;  3SNN A;  3SUQ A;  3NHG A;  3TAG A;  4M42 A;  2ATQ A;  1WAJ A;  3MKS B;  3SQ2 A;  2YB5 A;  3SQ4 A;  2E31 A;  2JPN A;  2OVR B;  4FJX A;  1FZH E;  4M3X A;  1XVD E;  4FJ9 A;  3RWU A;  2VJ5 A;  2JHC A;  2FW3 A;  4ADN A;  3KD1 E;  1FZ9 E;  3LDB A;  3N1E A;  5IZ7 A;  1FXX A;  3SUO A;  2OZS A;  2VJ4 A;  4FK2 A;  3K2O A;  2JH8 A;  3HL8 A;  1LDK E;  4HCB A;  4RNG A;  4DU3 A;  3C95 A;  3SCX A;  2LF3 A;  2H4T A;  4JS5 A;  3QNO A;  3C6N B;  4DTP A;  3QEX A;  3SQ0 A;  2OYQ A;  3E4Y A;  3KD5 E;  4FJ8 A;  4RL5 A;  3TJY A;  3TAB A;  1MHY G;  1MMO G;  4DU1 A;  4I6J B;  3HP9 A;  4DTJ A;  3QES A;  1WAF A;  3L2O B;  3J27 A;  1XMG E;  4FJN A;  3C6P B;  3SPZ A;  3NDK A;  4M3T A;  4RG8 A;  2DTU A;  1FZ6 E;  2OVP B;  2B7M A;  4KHN A;  4X5M A;  4KHY A;  1XVB E;  3SUN A;  4FJK A;  4FJ5 A;  5IRE A;  4KHS A;  1IH7 A;  1XU3 E;  1Q9X A;  4KI6 A;  4AKG A;  4M41 A;  1Q9Y A;  3QEP A;  2FYO A;  2E32 A;  4QNC A;  2P1Q B;  3SI6 A;  4J2B A;  2JHA A;  4J2D A;  4DTS A;  4GAM C;  5IBK B;  4AKH A;  1FS1 A;  3LZI A;  4FK0 A;  3SQ1 A;  3OGK B;  1FZ4 E;  4B08 A;  4JRQ A;  3QET A;  3SPY A;  1CLQ A;  2B1E A;  3L8B A;  3C94 A;  1XVF E;  3NAE A;  2JH9 A;  3RMD A;  4FJM A;  2RCU A;  1P22 A;  4AKI A;  3LDS A;  4E3S A;  4KHW A;  4FJG A;  4DTU A;  1XL3 C;  3E4W A;  3NGI A;  4JS4 A;  4I9L A;  2OVQ B;  2HD0 A;  4E4B A;  3QEW A;  4DTO A;  1FZ0 E;  2B8I A;  3QER A;  3SJJ A;  2QXF A;  3CFR A;  4FJ7 A;  4EYW A;  4HCC A;  4KI4 A;  3RMB A;  4FK4 A;  2P1M B;  4I9Q A;  4M3W A;  3QNN A;  3UIQ A;  2P1P B;  1MHZ G;  1XVC E;  3LZJ A;  3V7D B;  1FZ3 E;  1FZ5 E;  3SVI A;  4JRP A;  4QND A;  4M3Y A;  2DEB A;  3L1N A;  4DTX A;  4M3U A;  4M3Z A;  2MMB A;  2PFV A;  4ADO A;  4DTM A;  4M3R A;  1FZ2 E;  2DY4 A;  1FZ1 E;  4EP9 A;  3CFO A;  5H37 A;  1XU5 E;  3RMA A;  1NEX B;  4DU4 A;  4J2A A;  2JHP A;  3CQ8 A;  4DTR A;  3CFP A;  3QEI A;  3TL8 B;  3TAF A;  2OZM A;  4KHQ A;  2P5G A;  3OGM B;  3WSO A;  1XMF E;  3QEV A;  3S9H A;  3NE6 A;  4DTN A;  1FZI E;  1XVE E;  4X5N A;  2VIX A;  4EPH A;  2P1O B;  1FZ7 E;  1IG9 A;  3N1B A;  1MTY G;  3C6O B;  3HGL A;  3NCI A;  1XMH E;  1XVG E;  4FJJ A;  4J2E A;  1FZ8 E;  2P5O A;  4FJH A;  4KHU A;  3LD8 A;  2LF6 A;  4FJI A;  3TAE A;  2PFT A;  2P1N B;  4AI6 A;  3SUP A;  3J2P A;  3L0M A;  3HGK E;  4FVM A;  3OGL B;  2MZW B;  4M45 A;  3RMC A;  4FJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...