4E4BA

Structure of the fusidic acid resistance protein fusb
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Far1
publication title Investigating the FusB:EF-G interface
rcsb
source organism Staphylococcus aureus
molecule tags Metal binding protein
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
A PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4e4bA01
4E4BA 4ADNA 4ADOA 2MZWB 2YB5A
chains in the Genus database with same CATH superfamily
1FZ8E 2P1MB 3L2OB 3C6NB 3NGIA 1FS1A 4DTSA 4M45A 1FZHE 4JS5A 3SI6A 4B08A 4KI4A 1XVDE 3BVOA 3KD1E 1XMFE 4J2EA 3QEIA 2MW2A 3QNNA 2P1NB 4M3XA 3TL8B 2OVRB 3NHGA 1XVBE 1FZ5E 3QESA 3LD8A 4HCCA 4DTXA 2JQTA 4JS4A 4M3YA 3N1EA 3N1BA 3TAEA 1WAJA 3SQ0A 3SNNA 4FJ7A 4KHYA 4AKGA 4QNDA 3QEXA 4DTPA 3HL8A 1MHZG 1XMHE 3K2OA 3UO3A 2DY4A 4X5NA 3HGLA 1LDKE 3QEPA 3QEWA 5IBKB 4DTRA 1WAFA 3QNOA 3SJJA 2OVQB 3NCIA 2DEBA 3OGMB 4M3RA 4E4BA 3CFRA 3SPZA 4FK0A 3LDBA 4FJXA 4FJMA 3E4YA 2E31A 4FJJA 4KHUA 1XL3C 3RMBA 2ATQA 2P1QB 2PFTA 4RNGA 3V7DB 4FJIA 3L0MA 4KHNA 2B7MA 4ADNA 1IG9A 2FYOA 4ADOA 1MHYG 1XMGE 3SVIA 3UO2A 3SUPA 4DTMA 2B1EA 4FK2A 3NE6A 4KHQA 4M41A 4I6JB 2OZSA 1XVCE 4RL5A 3J27A 3L1NA 4IT5A 3SQ2A 4AKHA 4DTNA 1FZ0E 4DU3A 3MKSB 4DU1A 3E4WA 3WSOA 3KD5E 1FZ3E 3HGKE 4EP9A 3C6PB 3LZJA 2VJ4A 4I9QA 1CLQA 1JW2A 1XU5E 1XU3E 2MZWB 3LZIA 2JHAA 1FZ1E 2FW3A 1Q9YA 4FJHA 3SQ1A 5H37A 3LDSA 4FJGA 4ICGC 3NDKA 3C94A 3OGLB 2VJ5A 3SPYA 1FZ6E 4X5MA 2OVPB 3HP9A 2YB5A 2RCUA 4FVMA 4E3SA 3RWUA 3QETA 3SUOA 4HCBA 3TAGA 4I9LA 4J2BA 3UIQA 3NAEA 4KHSA 4M3UA 3L8BA 2LF3A 4KHWA 4M3TA 2JHCA 2H4TA 4DTJA 3OGKB 3SUQA 3RMAA 4J2AA 4FJ8A 3QERA 3SCXA 2P5OA 4FJLA 1FZ7E 3TAFA 4AKIA 2B8IA 4DTOA 2JH9A 4AI6A 2QXFA 2MMBA 2P1OB 4M42A 4DTUA 4EPHA 3J2PA 1FXXA 1N1CA 4M3WA 1XVEE 2OYQA 2OZMA 4GAMC 3C95A 2P1PB 3QEVA 4KI6A 4FJNA 1XVGE 3SUNA 1FZ2E 3CFPA 3CQ8A 3SQ4A 1NEXB 2RKHA 4DU4A 3TABA 2JH8A 3RMDA 4FK4A 4EYWA 4JRQA 2E32A 4QNCA 1IH7A 5IREA 4FJ5A 1FZ9E 4FJ9A 2VIXA 2DTUA 5IZ7A 1XVFE 3TJYA 2LF6A 1FYZE 1MTYG 4J2DA 3CFOA 4FJKA 1FZIE 1FZ4E 4JRPA 3RMCA 1Q9XA 1P22A 4M3ZA 2P5GA 1MMOG 2JPNA 2HD0A 2JHPA 2PFVA 1FPOA 4RG8A 3S9HA 2K5SA 3C6OB
chains in the Genus database with same CATH topology
1FZ8E 2P1MB 3L2OB 3C6NB 3NGIA 1FS1A 4DTSA 4M45A 1FZHE 4JS5A 3SI6A 4B08A 4KI4A 1XVDE 3KD1E 1XMFE 4J2EA 3QEIA 3QNNA 2P1NB 4M3XA 3TL8B 2OVRB 3NHGA 1XVBE 1FZ5E 3QESA 3LD8A 4HCCA 4DTXA 4JS4A 4M3YA 3N1EA 3N1BA 3TAEA 1WAJA 3SQ0A 3SNNA 4FJ7A 4KHYA 4AKGA 4QNDA 3QEXA 4DTPA 3HL8A 1MHZG 1XMHE 3K2OA 2DY4A 4X5NA 3HGLA 1LDKE 3QEPA 3QEWA 5IBKB 4DTRA 1WAFA 3QNOA 3SJJA 2OVQB 3NCIA 2DEBA 3OGMB 4M3RA 4E4BA 3CFRA 3SPZA 4FK0A 3LDBA 4FJXA 4FJMA 3E4YA 2E31A 4FJJA 4KHUA 1XL3C 3RMBA 2ATQA 2P1QB 2PFTA 4RNGA 3V7DB 4FJIA 3L0MA 4KHNA 2B7MA 4ADNA 1IG9A 2FYOA 4ADOA 1MHYG 1XMGE 3SVIA 3SUPA 4FK2A 4DTMA 2B1EA 3NE6A 4KHQA 4M41A 4I6JB 2OZSA 1XVCE 4RL5A 3J27A 3L1NA 4AKHA 3SQ2A 4DTNA 1FZ0E 4DU3A 3MKSB 4DU1A 3E4WA 3WSOA 3KD5E 1FZ3E 3HGKE 4EP9A 3C6PB 3LZJA 2VJ4A 4I9QA 1CLQA 1XU5E 1XU3E 2MZWB 3LZIA 2JHAA 1FZ1E 2FW3A 1Q9YA 4FJHA 3SQ1A 5H37A 3LDSA 4FJGA 3NDKA 3C94A 3OGLB 2VJ5A 3SPYA 1FZ6E 4X5MA 2OVPB 3HP9A 2YB5A 2RCUA 4FVMA 4E3SA 3RWUA 3QETA 3SUOA 4HCBA 3TAGA 4I9LA 4J2BA 3UIQA 3NAEA 4KHSA 4M3UA 3L8BA 2LF3A 4KHWA 4M3TA 2JHCA 2H4TA 4DTJA 3OGKB 3SUQA 3RMAA 4J2AA 4FJ8A 3QERA 3SCXA 2P5OA 4FJLA 1FZ7E 3TAFA 4AKIA 2B8IA 4DTOA 2JH9A 4AI6A 2QXFA 2MMBA 2P1OB 4M42A 4DTUA 4EPHA 3J2PA 1FXXA 4M3WA 1XVEE 2OYQA 2OZMA 4GAMC 3C95A 2P1PB 3QEVA 4KI6A 4FJNA 1XVGE 3SUNA 1FZ2E 3CFPA 3CQ8A 3SQ4A 1NEXB 4DU4A 3TABA 2JH8A 3RMDA 4FK4A 4EYWA 4JRQA 2E32A 4QNCA 1IH7A 5IREA 4FJ5A 1FZ9E 4FJ9A 2VIXA 2DTUA 5IZ7A 1XVFE 3TJYA 2LF6A 1FYZE 1MTYG 4J2DA 3CFOA 4FJKA 1FZIE 1FZ4E 4JRPA 3RMCA 1Q9XA 1P22A 4M3ZA 2P5GA 1MMOG 2JPNA 2HD0A 2JHPA 2PFVA 4RG8A 3S9HA 3C6OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E4B A;  4ADN A;  4ADO A;  2MZW B;  2YB5 A; 
#chains in the Genus database with same CATH topology
 1FZ8 E;  2P1M B;  3L2O B;  3C6N B;  3NGI A;  1FS1 A;  4DTS A;  4M45 A;  1FZH E;  4JS5 A;  3SI6 A;  4B08 A;  4KI4 A;  1XVD E;  3BVO A;  3KD1 E;  1XMF E;  4J2E A;  3QEI A;  2MW2 A;  3QNN A;  2P1N B;  4M3X A;  3TL8 B;  2OVR B;  3NHG A;  1XVB E;  1FZ5 E;  3QES A;  3LD8 A;  4HCC A;  4DTX A;  2JQT A;  4JS4 A;  4M3Y A;  3N1E A;  3N1B A;  3TAE A;  1WAJ A;  3SQ0 A;  3SNN A;  4FJ7 A;  4KHY A;  4AKG A;  4QND A;  3QEX A;  4DTP A;  3HL8 A;  1MHZ G;  1XMH E;  3K2O A;  3UO3 A;  2DY4 A;  4X5N A;  3HGL A;  1LDK E;  3QEP A;  3QEW A;  5IBK B;  4DTR A;  1WAF A;  3QNO A;  3SJJ A;  2OVQ B;  3NCI A;  2DEB A;  3OGM B;  4M3R A;  4E4B A;  3CFR A;  3SPZ A;  4FK0 A;  3LDB A;  4FJX A;  4FJM A;  3E4Y A;  2E31 A;  4FJJ A;  4KHU A;  1XL3 C;  3RMB A;  2ATQ A;  2P1Q B;  2PFT A;  4RNG A;  3V7D B;  4FJI A;  3L0M A;  4KHN A;  2B7M A;  4ADN A;  1IG9 A;  2FYO A;  4ADO A;  1MHY G;  1XMG E;  3SVI A;  3UO2 A;  3SUP A;  4DTM A;  2B1E A;  4FK2 A;  3NE6 A;  4KHQ A;  4M41 A;  4I6J B;  2OZS A;  1XVC E;  4RL5 A;  3J27 A;  3L1N A;  4IT5 A;  3SQ2 A;  4AKH A;  4DTN A;  1FZ0 E;  4DU3 A;  3MKS B;  4DU1 A;  3E4W A;  3WSO A;  3KD5 E;  1FZ3 E;  3HGK E;  4EP9 A;  3C6P B;  3LZJ A;  2VJ4 A;  4I9Q A;  1CLQ A;  1JW2 A;  1XU5 E;  1XU3 E;  2MZW B;  3LZI A;  2JHA A;  1FZ1 E;  2FW3 A;  1Q9Y A;  4FJH A;  3SQ1 A;  5H37 A;  3LDS A;  4FJG A;  4ICG C;  3NDK A;  3C94 A;  3OGL B;  2VJ5 A;  3SPY A;  1FZ6 E;  4X5M A;  2OVP B;  3HP9 A;  2YB5 A;  2RCU A;  4FVM A;  4E3S A;  3RWU A;  3QET A;  3SUO A;  4HCB A;  3TAG A;  4I9L A;  4J2B A;  3UIQ A;  3NAE A;  4KHS A;  4M3U A;  3L8B A;  2LF3 A;  4KHW A;  4M3T A;  2JHC A;  2H4T A;  4DTJ A;  3OGK B;  3SUQ A;  3RMA A;  4J2A A;  4FJ8 A;  3QER A;  3SCX A;  2P5O A;  4FJL A;  1FZ7 E;  3TAF A;  4AKI A;  2B8I A;  4DTO A;  2JH9 A;  4AI6 A;  2QXF A;  2MMB A;  2P1O B;  4M42 A;  4DTU A;  4EPH A;  3J2P A;  1FXX A;  1N1C A;  4M3W A;  1XVE E;  2OYQ A;  2OZM A;  4GAM C;  3C95 A;  2P1P B;  3QEV A;  4KI6 A;  4FJN A;  1XVG E;  3SUN A;  1FZ2 E;  3CFP A;  3CQ8 A;  3SQ4 A;  1NEX B;  2RKH A;  4DU4 A;  3TAB A;  2JH8 A;  3RMD A;  4FK4 A;  4EYW A;  4JRQ A;  2E32 A;  4QNC A;  1IH7 A;  5IRE A;  4FJ5 A;  1FZ9 E;  4FJ9 A;  2VIX A;  2DTU A;  5IZ7 A;  1XVF E;  3TJY A;  2LF6 A;  1FYZ E;  1MTY G;  4J2D A;  3CFO A;  4FJK A;  1FZI E;  1FZ4 E;  4JRP A;  3RMC A;  1Q9X A;  1P22 A;  4M3Z A;  2P5G A;  1MMO G;  2JPN A;  2HD0 A;  2JHP A;  2PFV A;  1FPO A;  4RG8 A;  3S9H A;  2K5S A;  3C6O B; 
#chains in the Genus database with same CATH homology
 1FZ8 E;  2P1M B;  3L2O B;  3C6N B;  3NGI A;  1FS1 A;  4DTS A;  4M45 A;  1FZH E;  4JS5 A;  3SI6 A;  4B08 A;  4KI4 A;  1XVD E;  3KD1 E;  1XMF E;  4J2E A;  3QEI A;  3QNN A;  2P1N B;  4M3X A;  3TL8 B;  2OVR B;  3NHG A;  1XVB E;  1FZ5 E;  3QES A;  3LD8 A;  4HCC A;  4DTX A;  4JS4 A;  4M3Y A;  3N1E A;  3N1B A;  3TAE A;  1WAJ A;  3SQ0 A;  3SNN A;  4FJ7 A;  4KHY A;  4AKG A;  4QND A;  3QEX A;  4DTP A;  3HL8 A;  1MHZ G;  1XMH E;  3K2O A;  2DY4 A;  4X5N A;  3HGL A;  1LDK E;  3QEP A;  3QEW A;  5IBK B;  4DTR A;  1WAF A;  3QNO A;  3SJJ A;  2OVQ B;  3NCI A;  2DEB A;  3OGM B;  4M3R A;  4E4B A;  3CFR A;  3SPZ A;  4FK0 A;  3LDB A;  4FJX A;  4FJM A;  3E4Y A;  2E31 A;  4FJJ A;  4KHU A;  1XL3 C;  3RMB A;  2ATQ A;  2P1Q B;  2PFT A;  4RNG A;  3V7D B;  4FJI A;  3L0M A;  4KHN A;  2B7M A;  4ADN A;  1IG9 A;  2FYO A;  4ADO A;  1MHY G;  1XMG E;  3SVI A;  3SUP A;  4FK2 A;  4DTM A;  2B1E A;  3NE6 A;  4KHQ A;  4M41 A;  4I6J B;  2OZS A;  1XVC E;  4RL5 A;  3J27 A;  3L1N A;  4AKH A;  3SQ2 A;  4DTN A;  1FZ0 E;  4DU3 A;  3MKS B;  4DU1 A;  3E4W A;  3WSO A;  3KD5 E;  1FZ3 E;  3HGK E;  4EP9 A;  3C6P B;  3LZJ A;  2VJ4 A;  4I9Q A;  1CLQ A;  1XU5 E;  1XU3 E;  2MZW B;  3LZI A;  2JHA A;  1FZ1 E;  2FW3 A;  1Q9Y A;  4FJH A;  3SQ1 A;  5H37 A;  3LDS A;  4FJG A;  3NDK A;  3C94 A;  3OGL B;  2VJ5 A;  3SPY A;  1FZ6 E;  4X5M A;  2OVP B;  3HP9 A;  2YB5 A;  2RCU A;  4FVM A;  4E3S A;  3RWU A;  3QET A;  3SUO A;  4HCB A;  3TAG A;  4I9L A;  4J2B A;  3UIQ A;  3NAE A;  4KHS A;  4M3U A;  3L8B A;  2LF3 A;  4KHW A;  4M3T A;  2JHC A;  2H4T A;  4DTJ A;  3OGK B;  3SUQ A;  3RMA A;  4J2A A;  4FJ8 A;  3QER A;  3SCX A;  2P5O A;  4FJL A;  1FZ7 E;  3TAF A;  4AKI A;  2B8I A;  4DTO A;  2JH9 A;  4AI6 A;  2QXF A;  2MMB A;  2P1O B;  4M42 A;  4DTU A;  4EPH A;  3J2P A;  1FXX A;  4M3W A;  1XVE E;  2OYQ A;  2OZM A;  4GAM C;  3C95 A;  2P1P B;  3QEV A;  4KI6 A;  4FJN A;  1XVG E;  3SUN A;  1FZ2 E;  3CFP A;  3CQ8 A;  3SQ4 A;  1NEX B;  4DU4 A;  3TAB A;  2JH8 A;  3RMD A;  4FK4 A;  4EYW A;  4JRQ A;  2E32 A;  4QNC A;  1IH7 A;  5IRE A;  4FJ5 A;  1FZ9 E;  4FJ9 A;  2VIX A;  2DTU A;  5IZ7 A;  1XVF E;  3TJY A;  2LF6 A;  1FYZ E;  1MTY G;  4J2D A;  3CFO A;  4FJK A;  1FZI E;  1FZ4 E;  4JRP A;  3RMC A;  1Q9X A;  1P22 A;  4M3Z A;  2P5G A;  1MMO G;  2JPN A;  2HD0 A;  2JHP A;  2PFV A;  4RG8 A;  3S9H A;  3C6O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...