3BVOA

Crystal structure of human co-chaperone protein hscb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
197
Chain Sequence
b'PRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Co-chaperone protein HscB, mitochondrial precursor
publication title Structure of human J-type co-chaperone HscB reveals a tetracysteine metal-binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 66
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
A PF18256 HscB_4_cys Co-chaperone HscB tetracysteine metal binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3bvoA01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3bvoA02
4IT5A 1GH6A 2GUZB 1XBLA 2OCHA 2QWQB 3APOA 4J80A 2L6LA 4RWUA 3BVOA 1FAFA 2N04A 2QSAA 2EJ7A 3AG7A 1IURA 2RKHA 1BQZA 2CTRA 3UO3A 2QWNB 3UCSC 3UO2A 2QWRB 1FPOA 2DN9A 2YUAA 1WJZA 3APQA 2CTPA 2M6YA 2DMXA 1BQ0A 1N1CA 2QWPB 2KQXA 2CUGA 2QWOB 1N4CA 2CTQA 2Y4UA 2CTWA 1NZ6A 2LO1A 2GUZA 4J7ZA 2YS8A 2N05A 2Y4TA 2PF4E 2LGWA 1HDJA
chains in the Genus database with same CATH superfamily
4DTJA 1M9NA 1AI7A 4JI6B 3QEIA 3H01A 5B1BB 4BWAA 1VF6A 1IZ3A 5EZYA 3QG5A 1NTMH 3FKSG 2DWEC 4DR6O 4LF8B 1K7DA 2Y69C 1LNQA 1FXKB 4N23A 2LW1A 3LNNA 3OM3B 5DECA 1QVGU 2ZR2A 1FYZE 2IU3A 4RO2A 5IYBO 1E1RG 2F66C 2WSSG 3CQ8A 2R9AA 4AKIA 4F6RA 4JS5A 5LYJA 3S9HA 4I9LA 3E8GA 3VQXA 2UXBO 1XHZA 3U10A 2LQTA 2XAFA 4FJ5A 3RVYA 5EC1C 5B1BC 3W7UA 2VQFB 5LXTB 3KCXA 3K5NA 5IJ0A 3CCUV 3CRQA 4LFAO 4MVUA 3L2OB 2XOKG 1S72V 2JEUA 1Q8IA 3JAWA 4P9OA 1Q81W 4I9WA 1TA8A 5K1PA 3F5WC 3KG2A 3CYOA 1FXKC 4PD4F 1XNQO 2UUCB 1QCEA 2CAZC 1US6A 2YIDA 2ZINA 4PI2A 2P1MB 4K8XA 4UXNA 1XMQO 2KG7A 1I94B 2BOCC 3U11A 1TVKB 2L35A 4K3AA 3MHSC 1SS3A 3B2EE 4DTOA 4FJGA 5J2UA 1XU5E 1WA8A 1KC8W 3TCUA 1OCRB 1H8HG 4G2KA 3FYIB 3E8HA 5GTIZ 3K3WA 2CTPA 1NR7A 4DTMA 3BCCH 4B3TB 2Y4UA 4WF9V 4DV0B 4AILC 1Y66A 4UVCA 1XNQB 5J9PC 4U3JA 4ZHQA 1Q43A 2CE4A 3ZBHA 5GONB 4BW5A 2IW5A 1N34O 1SKVA 5C93A 3CSXA 4DV3O 2AGAA 1EN6A 2LGQA 3H9VA 3HKEA 3CCLV 4FM2A 4R50A 3NXSA 2B8IA 4X1IB 1FXHA 3SUOA 2PI4A 1GN3A 3D3IA 1OCRC 3OEHG 2UXCB 4UB6Z 3OUSA 4MVRA 2XT9A 3AG2C 4ICGA 1SA0A 4PV1B 3T1YB 4I7ZB 5LBQA 1JR9A 1Z5WA 4PA6A 3S3XA 3NDKA 2M7WA 2HLDG 2DMXA 4MVSA 5B1AB 3TAEA 2CGNA 1VF7A 3G67A 4O4JA 1P7GA 3I5DA 3VQYA 3CCJV 1HR0O 3RMAA 1KYOF 2YIBA 2A9HA 4BW9A 3SPGA 4LR3A 2YC0A 4PJ0Z 1XEQA 1Y67A 2GBOA 1QR9A 5CB4A 3H1IH 4GCZA 3ZHSA 1RFYA 2CDYA 1L0NH 1NVPB 2VQEO 4EP9A 5C8YB 4MTGA 5FNVA 1QU7A 3K08A 1K73W 3FB6C 3NHGA 3FFQA 4O2AA 2WLNA 4UCTA 3LUTB 1MABG 4O4HA 4KHNA 2VIXA 1F51A 4DR2O 2EJRA 4JI4B 4L8JA 4I50B 2UUBB 1K97A 3K04A 1SQBH 3J2PA 4MW3A 2FMLA 1EN4A 2FKXA 1WP7A 5H37A 2X6BA 3BA8A 4BIUA 2OCCB 3ZMSA 1EM1A 4I4TA 4GZRB 5L3CA 3LDSA 4KI4A 1V54B 2XAQA 5BY1A 3C95A 2DY4A 1N32B 3BY6A 3CHXA 4K0KB 1THZA 4PDLA 2EINB 3SPIA 4R7CA 1YXBA 4EB6A 2HHHO 1JJ2U 4TOIA 1VQPV 1FS1A 5EZYB 3ZX6A 2B1EA 2HFEC 4FK4A 1MHYG 5LL6Y 4I0XB 4FJMA 3FB7C 4CH5A 1PV0A 4FLVA 3CCEV 3R65A 4DR3O 3ZN0A 2DWDC 3RMBA 3TJTA 4M3XA 3A2FA 1I0HA 3U0ZA 4YIOA 4GX1A 1HNWO 2OCCC 3QNEA 5KHGA 2YXHA 1XMOB 5JH7A 4CH3A 2LF3A 4JYCA 2EINC 2JRIA 1R6TA 4EFEA 3NGIA 4FLYA 2WLIB 3QO8A 2EJ7A 3BEHA 4EFBA 3LZIA 1KKCA 4RG8A 5BR8B 4M42A 4DTUA 4FVMA 1WN7A 5IYZB 4X1YB 4LF7B 3N1BA 3B40A 3QF7A 2WLKA 4FFBB 4X62O 4DR1O 3V7DB 5LOVB 2KQXA 2WLJA 5KA6A 1WB8A 1SQGA 2BTQA 5KUMA 3CC4V 3WG7C 1W0KG 5IWAO 3UQ8A 1ROPA 2OTJV 4GKKB 2V4DA 2RCVA 4LWSB 5BZBA 4XDLA 2E76B 3JCZA 3DXRB 5LP6A 3QVNA 4CC5A 4PA3A 1GMGA 3FB8C 3TAFA 2ZE8A 2RJZA 1NI8A 1ZUQA 1P22A 1WJZA 3K5OA 3ZCCA 5IY5B 2P4KA 3L72H 1N4CA 5JQGA 4TV8B 4DUZB 4B3MO 2YI8A 3TAGA 4DR1B 4G27B 2C2AA 3JSNA 1B6QA 1U97A 4RWUA 4ZHQB 3E2EA 3QO5A 2PI5A 3CCMV 1KU9A 3HR0A 1H8EG 3E8FA 3UO2A 5JVDA 2FYUH 1MZFA 1RSOB 3SUNA 3SYAA 4DV2B 4Z1MG 3M8AA 4QPJA 4NB5A 3K79A 1TUBB 2QM4A 5CN0A 1QVFU 4NTXA 5CBFA 2LJ2A 1K33A 5IY5C 4B3MB 2MMBA 2ZNJA 3N2GB 2JJ2G 3CFRA 1Q9YA 3HGKE 3SUPA 3KD1E 3CJHB 4G28B 4JI2B 1FZHE 1OCZB 2ZM6B 1NTKH 4YHHB 2NNUA 1XVDE 4X1KA 5LMNB 1NR1A 1D5NA 4BIOA 3JASB 4UCOA 2ADQB 4NXMB 4J2AA 1PL0A 1TAEA 2YDEA 1SETA 4X66O 3VQWA 1YDXA 4QJFB 5D5QA 4FIPC 3K59A 3CEIA 1ZAUA 1FZ2E 5CA1A 2DOSA 4D7TA 4EKWA 3MHHC 5KX5B 1S3JA 4L87A 4M45A 1MG1A 5B5EZ 1UFIA 4TUYB 4DU1A 5ITZA 4JI7O 4GUNA 4O2AB 2YSUB 5FPRA 3RWUA 4PDRA 3QEWA 1M57B 4FJJA 3OTOO 2JS3A 3WB0A 2Q9LA 3FX7A 2CTQA 5BXZA 4GX2A 1CLQA 3RMDA 4JGSA 3OW2U 5KA5A 1QNMA 5EYPB 5DN6G 4PA9A 2RN9A 3ABKB 3ETDA 3H1LH 1XNRB 2Q0AA 1IG9A 5KHIA 4M3UA 4H33A 1NH2B 5B1OA 4ADOA 3JATA 3QEVA 4A5UB 3CP1A 2RMKB 3H1JH 2R72A 1M57C 4DTPA 4IHJA 4JI0B 4IIJA 1JOYA 4J41A 1VQLV 3TL8B 2WPDG 3RFRA 4JYAB 2QWNB 1Z5VA 4O2BA 5KHHA 2FYOA 3ZHVA 1FZ3E 2FL4A 1SZTA 1WAJA 4ZKIA 1E1QG 4AI8A 2ITCC 3B8MA 4E4BA 2W0FC 2OT5A 2LO1A 4DR5B 1M1KW 4QNDA 4IT5A 5JH7B 3RYFB 4TQDA 1JJOA 2QWQB 4TWKA 4JI8O 1Y74A 3K03A 1URFA 2EIKB 4HZ3A 3ASOB 2LP7A 1I08A 1EN5A 3Q4HA 5EK0A 3OFNG 1Q3EA 3HKDB 5L3BA 4CH6A 2HD0A 4TQFA 4LF4O 3GVMA 2FB5A 1K5QA 2W0XA 4H13B 1H38A 1B04A 4DV5O 2F93B 5H6QA 3RYCB 1JPXA 2LF6A 4X8AA 2PYJA 4LFCO 4IYHA 2JVDA 3N27A 2P5OA 1PP9H 2YEVA 2EIKC 4JI6O 3I56V 3ASOC 3JARA 2PYLA 3EXAA 1AROP 1NU1H 4O4LA 4JI5B 4B3SB 4YJ3A 2Q6AA 5LGTA 4ZOLA 2MZWB 1M93A 1CEZA 2VRZA 3UCSC 2A06H 4K8ZA 1AR5A 1FZ1E 4QGPA 1AVMA 3G4SV 3DGEA 4J7KA 3LDCA 4LF8O 2QXFA 4AKHA 5EBMC 2UUAB 2YIAA 4LNUB 3E4WA 1N33B 1XL6A 2P7TC 4LFCB 2QTSA 2VJ4A 3T4DA 3JD2A 3KCYA 4CC6A 4UFZA 2IH1C 1FFXA 3JYCA 3M99B 1BCCH 3ABMB 1CPYA 3CS5A 2OTLV 2WA4A 1S76D 1OV9A 5EIBD 2Q4PA 1M5IA 1FZ9E 3SUQA 1VQKV 2EBOA 2VQFO 3SYPA 5CA0A 5TISZ 2ATKC 2DJVA 1H2NA 4UV8A 3J27A 1MSWD 4HNAA 2UU9B 2ZQMA 2HG5C 2P1PB 3D8CA 5IJ9B 1FAFA 5J2TA 2H3OA 2DYRC 1VF5B 3JCUZ 2UUCO 3DC5A 1M4UA 1RM1B 5IYDO 4PHZA 4FZ0A 1I94O 1Q90D 3R66A 2E75B 4JAAA 1FS0G 4FFKA 3UT5A 3K2OA 5B66Z 5KMGB 4JPRA 1AILA 1BSMA 3ABMC 3QERA 1AI4A 4JRQA 3VOUA 2K9PA 1K4DC 3AK2A 3RYIA 2YI9A 1PD3A 5KAIZ 4B7EA 3SPCA 3L74H 2JQTA 2QA4V 3W7XA 2Q8VA 4CS4A 1N8RW 1ORQC 4B3TO 1XL3C 4DV0O 1BMFG 4H44B 2K1EA 3CXCU 3OGCC 4TV9B 1L8DA 1RPRA 2XAHA 4UV9A 4W4KA 1DTOA 4OX9B 4F6EA 3L1NA 2VWKA 4Z1VA 4Q6GA 2FTKA 4AQYB 2E5LB 4QNHB 3JAMN 2X0LA 5JWPA 5FL7G 3JALA 3APQA 4WBNB 3CC2V 2LW7A 2UXCO 4B3RB 2JK5C 3OGKB 3P3PA 3CXHF 1O9HA 2ZT9B 4X65B 4ADNA 2CH7B 4DV6O 3T1YO 1F4NA 2XASA 5JCOA 2JH9A 2N04A 4GKJB 1IBMB 3J7AU 4LH6A 3L9DA 1IVSA 3PN1A 3ABUA 2BSKB 4X20A 1U96A 5IBKB 2QGNA 1HWYA 3BAAA 3FAVA 3T1CA 2HR3A 2RCUA 2IJHA 4J10A 4WFFA 4KI6A 3IFXA 3CRCA 3J80N 2V1DA 1GN2A 3SGIA 1RP3B 4DV6B 1GAXA 3BPZA 1NBMG 3HKCA 1YJ9V 1Y76B 4DV1B 3MAQA 1ENVA 3BHPA 1J5EB 2MW2A 1Q7YW 4KXRA 5GTHZ 4O4IA 2CTWA 4FLWA 1EFRG 2JHAA 3M7MX 2JGDB 1BS3A 3ZRWB 2OCHA 4FM0A 1JFFA 1GM8A 2Y48A 5LA6B 4JI4O 5E1AC 2UUBO 2ADPA 3HL8A 3KKYA 3E8BA 5DM6V 1FD9A 4P9PA 2D3OW 2YUAA 1PNMA 2EILB 1SQQH 1W59A 1WAFA 4JI1O 4DRXB 1IBKO 4DW0A 1K4CC 1N32O 3QEPA 3ABTA 3MD0A 3L73H 2B1IA 4K0KO 2Q7GA 2YEVB 2QEXV 4DR7O 2LFSA 3L70H 4YJ2B 5A2QN 4I55A 1N36B 3CX5F 1UPGA 5B1AC 3OR6C 4H37A 1BQZA 3AG1B 2HKOA 3CRAA 2DYSB 1S0VA 1PKXA 3ZS8C 3K0GA 4MSWC 4LFBB 1D5AA 1KQSU 4JTAB 3GWKC 1X59A 3ZHTA 1NKDA 1GM9A 3JD4A 4FM1A 4JAVA 2EZPA 4NKGB 5BMVB 2AHZA 1GM7A 1XMHE 1MMMA 1PNLA 3OEEG 2EILC 2FW3A 4JI1B 1IBKB 2F95B 3AG7A 5IZ7A 4JRPA 4DR7B 2ZDIC 1VP7A 1XUQA 1XMOO 1AJQA 3D36C 1Z2GA 2WAMA 3SYCA 1YTFD 3G71V 2GTSA 2P4VA 3ZMZA 4M3RA 2UXDB 1LDKE 4J7ZA 1Q6UA 2DQ3A 5CA0B 4FJ9A 2ILMA 2A79B 2DYSC 2WLMA 3K9AA 3OMIB 3TJYA 3ZMUA 3ZHUA 1XVGE 1ZX3A 4HNAB 3OAAG 5BR8O 4FLTA 1SERA 2DE0X 3P3NA 2ODMA 3CPWU 4LF7O 1AJNA 2E74B 3SDLA 5LGUA 2IJJA 5JJEB 1H2SB 1VQOV 1BE3H 5CBGA 3AG4B 1V54C 3X2QB 4QPKA 4F6RB 4GKKO 5LYJB 3A0BZ 3CD6V 1AI5A 4LF9B 3N2KA 2OZMA 3CCQV 2OZSA 3RN4A 3L71H 1VMGA 3L75H 3LSUA 3RYHA 1IXMA 4M3TA 5IJ0B 2K5SA 3RYIB 2DQ0A 2NLJC 1EZJA 2YICA 4E2LA 1B06A 4DUZO 3OE7G 1JW2A 1GK9A 2QKCA 3JAWB 1G8MA 1Q6IA 3ETQA 1YJWV 3TABA 1WNSA 4PI0A 4EYWA 2IH3C 4RL5A 2QM7A 3E89A 2KG7B 4DUYB 2QM8A 1KECA 4RQEA 3AG4C 4X89A 1N0JA 3CRMA 1GN4A 3X2QC 4DV2O 5J2UB 1WA8B 1Q9XA 3SPZA 4FJXA 2KSDA 1FXVA 3OD4A 5L3DA 2Y0IA 2GUZA 1KKDA 3NCIA 1XOUA 1IXBA 4DU3A 1GRJA 1ZSPA 2QDOA 3OTFA 4U3JB 3SR2C 4QE7A 4WFGA 2JS5A 3KZIZ 4JI2O 4FJLA 3B09A 2ZM6O 4ASUG 3T1HB 3T4ZA 2QTOA 4YHHO 4X88A 3SPHA 4UCRA 5LMNO 2QKAA 1AI6A 5FLXN 1K5SA 3HKEB 4NXMO 4JASA 4FJKA 1DLBA 4DV7B 1KB9F 3UKMA 5HFLA 5KHKA 2OIEA 3CCRV 2ZNIA 4DTRA 2O57A 2IBZH 3BABA 5KAFZ 2RKHA 2P1QB 3P32A 1YEWA 1FPOA 1KP3A 2DN9A 1SA0B 1IBLB 2E3CA 2P06A 4DYLA 5IREA 2R70A 1QHTA 4NVPA 3NR7A 2H8PC 4FJ7A 1JMKC 1WP8A 4FZ1A 4KHPB 3OGIB 1E79G 4O4JB 2QR4A 3KD5E 2IJIA 1T5EA 3WB2A 3N1EA 4NXNO 1FFTB 3A8TA 4YIPA 4DTNA 1HP8A 3S3WA 3K57A 4CZZA 5CB4B 3WB1A 3RBZA 4GLXA 1FXKA 5B1NA 3ABLB 3SJJA 2E31A 1K8AW 2EZOA 3I55V 1XNRO 4JI3B 4ICGC 1VEWA 4MVMA 4XDKA 3CB2A 5FNVB 4DU4A 4GT1A 4QIWF 1OCZC 3C6PB 1XDCA 3E22A 4XBFA 3UO3A 1PPJH 1AJPA 2Q68A 4FMTA 4JS4A 4O4HB 4JTCB 4LP8A 4YY3B 5LXTA 4JI0O 4NXNB 2RNBA 3QNOA 1ZL8A 4B08A 1S5JA 3CFOA 4JYAO 1HNXO 4I4TB 1YZBA 4QE9A 3OMAB 3F5TA 3TXQA 3EFFK 2X6AA 5CMUA 1AR4A 1VQ6V 3LSQA 2ZKOA 2GHYA 1XHXA 3J81N 3SPYA 3G6BA 4DR5O 3HP9A 2PFVA 3K5MA 2A7WA 4DV4O 4EB6B 1TVKA 2N74A 1Q86W 1S77D 3ZN1A 3ZRVA 1QBZA 1YIJV 2JGUA 5DEDA 3WU2Z 4DR4B 3DC6A 1GN6A 3K58A 2JH8A 4WFEA 1IX9A 3O9OA 1NS1A 2GV9A 1R3JC 2Z3YA 1V55B 2ITDC 2Q0OC 2VWJA 1HNXB 1W0JG 2HJFC 1SF9A 1QLEB 2PTMA 1N1CA 2A3QA 4FLUA 3P30A 1VQ7V 2Q73A 5GONA 4UVAA 4YXWG 3ABKC 2Q67A 1K9MW 5HFMA 3E4YA 4DV4B 3CWBH 4J2EA 2MK3A 2G38A 4WFAV 3SYOA 1XMFE 4M3YA 3K0DA 4PDMA 2ZE5A 1JX9A 5H2FZ 1DGSA 4X1IA 5LHIA 4DK0A 4MVZA 2JJ1G 3FB5C 2GDSA 4JI5O 4B3SO 3SQ4A 3K06A 1HDJA 1SESA 4BIZA 2BTQB 3APOA 3ASNB 3D3QA 3RW0A 1GKFA 3STLC 3NE6A 2B1GA 4I9QA 1QLEC 5EBLC 3LDBA 1DF5A 2QWRB 1OCOB 1FJGB 4U3FH 3VBBA 3LZJA 5KLVH 2OIGA 2OVPB 2UUAO 3ZHRA 1PM9A 1Y6XA 5LP6B 4KP4A 1N33O 2R9RB 3TXSA 3IJ4A 4JZ2A 4FK2A 1KBHA 1JA8A 5JQGB 1KP2A 1NEXB 4EEQA 4I6JB 2RDCA 1BZKA 4RNGA 2P22C 1QR8A 3ICXA 2PZSA 4Q20A 5K1XA 2BCCH 2AZ2A 3MKSB 1AP6A 3G80A 3LDEA 5JVDB 4PDVA 3SJAC 3ASNC 2UU9O 1NZ6A 3A0RA 5LMUO 2AW9A 4JV5B 1OCOC 1GH6A 1OJHA 1WB7A 5LP6C 3SCXA 4X64B 4M3ZA 4I50A 2EULA 1R73A 2UXNA 3B77A 1XVFE 1NQTA 2AZ0A 1BQ0A 1XL4A 2H94A 5F2VO 1AP5A 3BFRA 2P1OB 5D5PA 2JPNA 2JIZG 3RWRD 5GW7A 4RUEA 4X1KB 3AK3A 3GWOA 3ZHQA 2W6JG 4FLZA 5IT9N 2DW4A 2ETNA 2WLHA 3HB3B 5CA3A 5LMUB 1Q5OA 3PJSK 1VQ8V 1XVCE 4J11A 1L1FA 4BAYA 4X5NA 1HNZB 4JTDB 1H2KA 1A32A 4KL1A 2Q7EA 1OCCB 1QLNA 4OX9O 4I0XA 1KD1W 2PUSA 5CA1B 4KHQA 2IJKA 4AQYO 4JYBA 2E5LO 2L6LA 1K3EA 1GTOA 3OGMB 4Z2WA 5ITZB 3GB7C 3E22B 4B3RO 3VQVA 5H5NA 1FYJA 5L3FA 4X65O 1RPOA 1FZ8E 1MTYG 2JDIG 1R6NA 1MHZG 1H2LA 2WLIA 1VQ5V 4GKJO 1IBMO 1DF4A 3TGUH 4R8CA 3OT7A 1ZL8B 3BVOA 1RM1C 4DR6B 1ZTEA 4ABMA 1NJIW 1OCCC 2ZIOA 5IYZA 3C6OB 4X1YA 3SJQC 4FFBA 3QESA 5LOVA 1P7BA 3E83A 3OMNB 4J2BA 3QNNA 3SPJA 4CH4A 1XMGE 2H4TA 1XI1A 4AKGA 4LF5O 1MMOG 2DTUA 2P6JA 3JATB 1VARA 2PF4E 4LWSA 2UXBB 1BHAA 4GX0A 3L0MA 2NR5A 3DXRA 4CBCA 1I5YA 1NVPD 4IHJB 3QO7A 3THOA 1SQPH 2RQ6A 4DV1O 2P67A 2DEBA 4IIJB 1J5EO 2X6CA 1MA1A 4UB8Z 3G6EV 4LFAB 3RVZA 4QNCA 3HKBA 4TV8A 3AG2B 4O2BB 4MS2A 4LF5B 3SI6A 1VQ9V 4LC1A 1XMQB 2GTAA 4EPHA 1S5LZ 4NR1A 2V7QG 1RSOA 4PA7A 1WPBA 1F7YA 5IYCO 1Y74B 3CMAV 2BOBC 5L3GA 3TK1A 2ZXWB 1TUBA 1EZVH 4OGQB 3Q4HB 5EIBC 3SJBC 2P1NB 1N36O 2F1MA 3N2GA 1X4TA 4J9ZB 1LR1A 1ZLZA 3CJHA 4FK5C 4LFBO 2D2CB 3ZJZA 3SQ0A 3W7TA 1FKAO 4P30A 1N34B 1XILA 1L0LH 1I5XA 4DV3B 1XVBE 3JASA 4X5MA 3AK1A 3LNMB 2N05A 3K5LA 1F23A 1YVWA 4JF3A 4HCBA 2ZR3A 1FZIE 3JARB 1VIBA 4O4LB 2ZXWC 1OZ0A 3JD0A 2XTAA 4YJ3B 2IU0A 1M90W 4ZOLB 2ATQA 1AB3A 3JSLA 2UXDO 4J7JA 1P84F 5KX5A 1VQNV 3E35A 3JD3A 1UJWB 4CS3A 1Q82W 4UUJC 1VQ4V 3H1HH 4TUYA 1NT2B 4D7SA 1YSCA 2XNDG 4ZI7A 5H9CA 4J80A 3SQ2A 4X9QA 4DK1A 1QQCA 1HR0B 4DTXA 2JEXA 2R9IA 1TUEB 4DW1A 4E4EA 1FFXB 1D2DA 1R3LC 2F23A 1N0NA 4LF9O 1YCIA 3LDDA 1NTZH 3ZIAG 2W6IG 3CCVV 4OPAA 5EYPA 3AG1C 3ZMVA 3H1KH 1P49A 1XBLA 2VQEB 3C94A 4PA4A 2EIMB 1EBOA 1COWG 2HP8A 3ETGA 5J2TB 3AG3B 2KKWA 3NAEA 4DR2B 2IM9A 3ZMTA 1FZ5E 4RUFA 4KHWA 4U7NA 3SQ1A 3JAKA 4IL6Z 4AI6A 4DUYO 3UT5B 3WFVA 4GAMC 1LUVA 2ZE7A 4WFBV 3WG7B 1BT8A 2WLLA 3EHBB 3W7WA 1VF6C 2A0LA 5EC2C 1XVEE 3K9SA 1K92A 2VJ5A 1FZ4E 2B7MA 2ZCEA 2P5GA 1IH7A 3RYFA 1MOFA 4FJCC 4XDJA 2EIMC 2HHHB 4KHUA 1M56B 1DK1A 4FLXA 3TETA 3AG3C 1O9GA 3DTUB 3T1HO 1K34A 3BRCA 3W7SA 4M3WA 4LCUC 5AG2A 1IURA 4RQFA 4UVBA 5H6RA 3RT3C 4E3SA 1B3QA 4DR3B 5KHJA 3WSOA 4DV7O 3HKDA 2Q7HA 2UXXA 3JALB 2Q5ZA 1J95A 2YIBD 2B5UA 1HNWB 4HBNA 4MTXA 2Y4TA 3C3SA 5KUKA 2EX3A 2BTOA 2XUMA 4LF6O 4UCVA 3B4SA 1IBLO 4KFMA 3RYCA 1YTFB 4ZBMA 1WAZA 4J42A 4HCCA 2P90A 1M56C 3QETA 4UCSA 1W2BU 1FZ0E 1KMIZ 4IYIA 4FJIA 2HJDA 3HKBB 3ML0A 5B3SB 4J2DA 2JHCA 1R3KC 4X20B 4KHPO 2YS8A 1I7FA 2YXLA 5LHGA 4X62B 3FAVB 4HAMA 4HYOA 1FZ7E 4LH7A 5IWAB 5IE9A 3B8NA 2OYQA 1JCHA 3CRRA 4LF6B 1BGYH 4F4LA 1LUWA 2B9ZA 1WLEA 2YXYA 3ZEDA 4AHCA 3EVKA 4ZIBA 3HKCB 4LNUA 2QWPB 2QWOB 3IC9A 1G1XB 4JI3O 2MW2B 2Y0PA 4J9YB 1CXZB 3E86A 1NH2D 1BL8A 4O4IB 5JCOC 1F4MA 5LHHA 3OUFA 2OWOA 2QSAA 3UM7A 1JFFB 2CTRA 4OXSA 3STZC 5B3SC 2WA3A 4MT8A 1JQ0A 3FYEB 4YY3O 4UCUA 5A9GA 2M6YA 3IAYA 1H2MA 1TGOA 3SJCC 5FPOA 5IJ9A 1G4YB 3C3TA 3F7YC 4MTOA 3IC7A 1SC5B 4FJNA 3SYQA 4JYYA 2HEPA 1CP9A 4I55B 2AHYA 1SQVH 4B7KA 2PY5A 2PFTA 1S5HC 5EBWC 5KMGA 2LFRA 2Z5UA 1IDSA 4DR4O 2LGWA 3SVIA 5E79Z 4NTWA 1SZXA 2CGOA 4ZI7B 3LSSA 4JAUA 4K35A 1AR1B 4KHYA 1GO3F 1FXXA 5JJJB 3ABLC 4TV9A 3QEXA 1XU3E 3L8BA 5IDJA 4DTSA 4X66B 4WCEV 2XAJA 3UIQA 5L3EA 3CCSV 1XREA 3ZRSA 2F4VO 1ZWIC 3RGBA 2QJ1A 3HPLC 3OR7C 4PELA 4NTYA 4MVQA 3C90A 4RAIA 2XHBA 4WBNA 4FK0A 3AEIA 4JI7B 3QTCA 3T2MA 2ZE6A 3IGAC 1FZ6E 3OTOB 3A0HZ 2WWWA 2CH7A 2CK3G 4P2ZA 1R3IC 2YB5A 1MZEA 3O65A 3JAKB 2E32A 3JD1A 4MTFA 3N2KB 1JVMA 2X7RB 1YHQV 3CMEV 1FJGO 2PGGA 2AXTZ 2ZIMA 3RYHB 2EIJB 2F4VB 3CFPA 2BSKA 4FPPA 2WLLB 1WPXA 1Q6HA 2VS0A 1PNKA 5JJNB 2XAGA 2F43G 3OGLB 1MNGA 3CE2A 1YJNV 4MW8A 4D6TH 1V55C 2KB1A 1HW7A 4FJHA 4LBEC 2NN4A 1BHBA 1V9PA 1Y76A 1VQMV 3BA9A 3DSQA 3MDSA 4DO2A 4TT3G 1PL4A 1R6KA 4U7OA 4IGGA 3SNNA 4JV5O 4R6ZA 2JGDA 3ZRWA 1SQFA 4MVOA 2HVJC 4X64O 2EIJC 5LA6A 1SQXH 2ZD9A 2GUZB 2ARHA 2Q69A 3CC7V 1KUQA 3RMCA 2OVRB 1OHHG 1Y4MA 4GYCB 4JI8B 5LGNA 3LD8A 1R1BA 5CBHA 3ZRXA 2QKSA 3F7VC 4I5SA 2ZDIA 4NYKA 4DRXA 4M41A 2HVKC 4GX5A 5C8YA 2Z0AA 3D36A 4BR6A 4H0LB 4FJ8A 3FD9A 4YJ2A 4C7UA 2GSMB 4W4LA 1YITV 1MSDA 2BE3A 4TSFG 1HNZO 1XQ8A 3HGLA 4LF4B 4WFHA 2Y69B 1H2GA 4OPHA 1P4RA 2OVQB 4KHSA 4N21A 2JHPA 4KUMA 2DYRB 4DV5B 5BMVA 4JZGA 1YI2V 2CUGA 4DXWA 1YF2A 3C6NB 1G6UA 1SRYA 2QE7G 3ETEA 4CS2A
chains in the Genus database with same CATH topology
4IT5A 1GH6A 2GUZB 1XBLA 2OCHA 2QWQB 3APOA 4J80A 2L6LA 4RWUA 3BVOA 1FAFA 2N04A 2QSAA 2EJ7A 3AG7A 1IURA 2RKHA 1BQZA 2CTRA 3UO3A 2QWNB 3UCSC 3UO2A 2QWRB 1FPOA 2DN9A 2YUAA 1WJZA 3APQA 2CTPA 2M6YA 2DMXA 1BQ0A 1N1CA 2QWPB 2KQXA 2CUGA 2QWOB 1N4CA 2CTQA 2Y4UA 2CTWA 1NZ6A 2LO1A 2GUZA 4J7ZA 2YS8A 2N05A 2Y4TA 2PF4E 2LGWA 1HDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT5 A;  1GH6 A;  2GUZ B;  1XBL A;  2OCH A;  2QWQ B;  3APO A;  4J80 A;  2L6L A;  4RWU A;  3BVO A;  1FAF A;  2N04 A;  2QSA A;  2EJ7 A;  3AG7 A;  1IUR A;  2RKH A;  1BQZ A;  2CTR A;  3UO3 A;  2QWN B;  3UCS C;  3UO2 A;  2QWR B;  1FPO A;  2DN9 A;  2YUA A;  1WJZ A;  3APQ A;  2CTP A;  2M6Y A;  2DMX A;  1BQ0 A;  1N1C A;  2QWP B;  2KQX A;  2CUG A;  2QWO B;  1N4C A;  2CTQ A;  2Y4U A;  2CTW A;  1NZ6 A;  2LO1 A;  2GUZ A;  4J7Z A;  2YS8 A;  2N05 A;  2Y4T A;  2PF4 E;  2LGW A;  1HDJ A; 
#chains in the Genus database with same CATH topology
 4DTJ A;  1M9N A;  1AI7 A;  4JI6 B;  3QEI A;  3H01 A;  5B1B B;  4BWA A;  1VF6 A;  1IZ3 A;  5EZY A;  3QG5 A;  1NTM H;  3FKS G;  2DWE C;  4DR6 O;  4LF8 B;  1K7D A;  2Y69 C;  1LNQ A;  1FXK B;  4N23 A;  2LW1 A;  3LNN A;  3OM3 B;  5DEC A;  1QVG U;  2ZR2 A;  1FYZ E;  2IU3 A;  4RO2 A;  5IYB O;  1E1R G;  2F66 C;  2WSS G;  3CQ8 A;  2R9A A;  4AKI A;  4F6R A;  4JS5 A;  5LYJ A;  3S9H A;  4I9L A;  3E8G A;  3VQX A;  2UXB O;  1XHZ A;  3U10 A;  2LQT A;  2XAF A;  4FJ5 A;  3RVY A;  5EC1 C;  5B1B C;  3W7U A;  2VQF B;  5LXT B;  3KCX A;  3K5N A;  5IJ0 A;  3CCU V;  3CRQ A;  4LFA O;  4MVU A;  3L2O B;  2XOK G;  1S72 V;  2JEU A;  1Q8I A;  3JAW A;  4P9O A;  1Q81 W;  4I9W A;  1TA8 A;  5K1P A;  3F5W C;  3KG2 A;  3CYO A;  1FXK C;  4PD4 F;  1XNQ O;  2UUC B;  1QCE A;  2CAZ C;  1US6 A;  2YID A;  2ZIN A;  4PI2 A;  2P1M B;  4K8X A;  4UXN A;  1XMQ O;  2KG7 A;  1I94 B;  2BOC C;  3U11 A;  1TVK B;  2L35 A;  4K3A A;  3MHS C;  1SS3 A;  3B2E E;  4DTO A;  4FJG A;  5J2U A;  1XU5 E;  1WA8 A;  1KC8 W;  3TCU A;  1OCR B;  1H8H G;  4G2K A;  3FYI B;  3E8H A;  5GTI Z;  3K3W A;  2CTP A;  1NR7 A;  4DTM A;  3BCC H;  4B3T B;  2Y4U A;  4WF9 V;  4DV0 B;  4AIL C;  1Y66 A;  4UVC A;  1XNQ B;  5J9P C;  4U3J A;  4ZHQ A;  1Q43 A;  2CE4 A;  3ZBH A;  5GON B;  4BW5 A;  2IW5 A;  1N34 O;  1SKV A;  5C93 A;  3CSX A;  4DV3 O;  2AGA A;  1EN6 A;  2LGQ A;  3H9V A;  3HKE A;  3CCL V;  4FM2 A;  4R50 A;  3NXS A;  2B8I A;  4X1I B;  1FXH A;  3SUO A;  2PI4 A;  1GN3 A;  3D3I A;  1OCR C;  3OEH G;  2UXC B;  4UB6 Z;  3OUS A;  4MVR A;  2XT9 A;  3AG2 C;  4ICG A;  1SA0 A;  4PV1 B;  3T1Y B;  4I7Z B;  5LBQ A;  1JR9 A;  1Z5W A;  4PA6 A;  3S3X A;  3NDK A;  2M7W A;  2HLD G;  2DMX A;  4MVS A;  5B1A B;  3TAE A;  2CGN A;  1VF7 A;  3G67 A;  4O4J A;  1P7G A;  3I5D A;  3VQY A;  3CCJ V;  1HR0 O;  3RMA A;  1KYO F;  2YIB A;  2A9H A;  4BW9 A;  3SPG A;  4LR3 A;  2YC0 A;  4PJ0 Z;  1XEQ A;  1Y67 A;  2GBO A;  1QR9 A;  5CB4 A;  3H1I H;  4GCZ A;  3ZHS A;  1RFY A;  2CDY A;  1L0N H;  1NVP B;  2VQE O;  4EP9 A;  5C8Y B;  4MTG A;  5FNV A;  1QU7 A;  3K08 A;  1K73 W;  3FB6 C;  3NHG A;  3FFQ A;  4O2A A;  2WLN A;  4UCT A;  3LUT B;  1MAB G;  4O4H A;  4KHN A;  2VIX A;  1F51 A;  4DR2 O;  2EJR A;  4JI4 B;  4L8J A;  4I50 B;  2UUB B;  1K97 A;  3K04 A;  1SQB H;  3J2P A;  4MW3 A;  2FML A;  1EN4 A;  2FKX A;  1WP7 A;  5H37 A;  2X6B A;  3BA8 A;  4BIU A;  2OCC B;  3ZMS A;  1EM1 A;  4I4T A;  4GZR B;  5L3C A;  3LDS A;  4KI4 A;  1V54 B;  2XAQ A;  5BY1 A;  3C95 A;  2DY4 A;  1N32 B;  3BY6 A;  3CHX A;  4K0K B;  1THZ A;  4PDL A;  2EIN B;  3SPI A;  4R7C A;  1YXB A;  4EB6 A;  2HHH O;  1JJ2 U;  4TOI A;  1VQP V;  1FS1 A;  5EZY B;  3ZX6 A;  2B1E A;  2HFE C;  4FK4 A;  1MHY G;  5LL6 Y;  4I0X B;  4FJM A;  3FB7 C;  4CH5 A;  1PV0 A;  4FLV A;  3CCE V;  3R65 A;  4DR3 O;  3ZN0 A;  2DWD C;  3RMB A;  3TJT A;  4M3X A;  3A2F A;  1I0H A;  3U0Z A;  4YIO A;  4GX1 A;  1HNW O;  2OCC C;  3QNE A;  5KHG A;  2YXH A;  1XMO B;  5JH7 A;  4CH3 A;  2LF3 A;  4JYC A;  2EIN C;  2JRI A;  1R6T A;  4EFE A;  3NGI A;  4FLY A;  2WLI B;  3QO8 A;  2EJ7 A;  3BEH A;  4EFB A;  3LZI A;  1KKC A;  4RG8 A;  5BR8 B;  4M42 A;  4DTU A;  4FVM A;  1WN7 A;  5IYZ B;  4X1Y B;  4LF7 B;  3N1B A;  3B40 A;  3QF7 A;  2WLK A;  4FFB B;  4X62 O;  4DR1 O;  3V7D B;  5LOV B;  2KQX A;  2WLJ A;  5KA6 A;  1WB8 A;  1SQG A;  2BTQ A;  5KUM A;  3CC4 V;  3WG7 C;  1W0K G;  5IWA O;  3UQ8 A;  1ROP A;  2OTJ V;  4GKK B;  2V4D A;  2RCV A;  4LWS B;  5BZB A;  4XDL A;  2E76 B;  3JCZ A;  3DXR B;  5LP6 A;  3QVN A;  4CC5 A;  4PA3 A;  1GMG A;  3FB8 C;  3TAF A;  2ZE8 A;  2RJZ A;  1NI8 A;  1ZUQ A;  1P22 A;  1WJZ A;  3K5O A;  3ZCC A;  5IY5 B;  2P4K A;  3L72 H;  1N4C A;  5JQG A;  4TV8 B;  4DUZ B;  4B3M O;  2YI8 A;  3TAG A;  4DR1 B;  4G27 B;  2C2A A;  3JSN A;  1B6Q A;  1U97 A;  4RWU A;  4ZHQ B;  3E2E A;  3QO5 A;  2PI5 A;  3CCM V;  1KU9 A;  3HR0 A;  1H8E G;  3E8F A;  3UO2 A;  5JVD A;  2FYU H;  1MZF A;  1RSO B;  3SUN A;  3SYA A;  4DV2 B;  4Z1M G;  3M8A A;  4QPJ A;  4NB5 A;  3K79 A;  1TUB B;  2QM4 A;  5CN0 A;  1QVF U;  4NTX A;  5CBF A;  2LJ2 A;  1K33 A;  5IY5 C;  4B3M B;  2MMB A;  2ZNJ A;  3N2G B;  2JJ2 G;  3CFR A;  1Q9Y A;  3HGK E;  3SUP A;  3KD1 E;  3CJH B;  4G28 B;  4JI2 B;  1FZH E;  1OCZ B;  2ZM6 B;  1NTK H;  4YHH B;  2NNU A;  1XVD E;  4X1K A;  5LMN B;  1NR1 A;  1D5N A;  4BIO A;  3JAS B;  4UCO A;  2ADQ B;  4NXM B;  4J2A A;  1PL0 A;  1TAE A;  2YDE A;  1SET A;  4X66 O;  3VQW A;  1YDX A;  4QJF B;  5D5Q A;  4FIP C;  3K59 A;  3CEI A;  1ZAU A;  1FZ2 E;  5CA1 A;  2DOS A;  4D7T A;  4EKW A;  3MHH C;  5KX5 B;  1S3J A;  4L87 A;  4M45 A;  1MG1 A;  5B5E Z;  1UFI A;  4TUY B;  4DU1 A;  5ITZ A;  4JI7 O;  4GUN A;  4O2A B;  2YSU B;  5FPR A;  3RWU A;  4PDR A;  3QEW A;  1M57 B;  4FJJ A;  3OTO O;  2JS3 A;  3WB0 A;  2Q9L A;  3FX7 A;  2CTQ A;  5BXZ A;  4GX2 A;  1CLQ A;  3RMD A;  4JGS A;  3OW2 U;  5KA5 A;  1QNM A;  5EYP B;  5DN6 G;  4PA9 A;  2RN9 A;  3ABK B;  3ETD A;  3H1L H;  1XNR B;  2Q0A A;  1IG9 A;  5KHI A;  4M3U A;  4H33 A;  1NH2 B;  5B1O A;  4ADO A;  3JAT A;  3QEV A;  4A5U B;  3CP1 A;  2RMK B;  3H1J H;  2R72 A;  1M57 C;  4DTP A;  4IHJ A;  4JI0 B;  4IIJ A;  1JOY A;  4J41 A;  1VQL V;  3TL8 B;  2WPD G;  3RFR A;  4JYA B;  2QWN B;  1Z5V A;  4O2B A;  5KHH A;  2FYO A;  3ZHV A;  1FZ3 E;  2FL4 A;  1SZT A;  1WAJ A;  4ZKI A;  1E1Q G;  4AI8 A;  2ITC C;  3B8M A;  4E4B A;  2W0F C;  2OT5 A;  2LO1 A;  4DR5 B;  1M1K W;  4QND A;  4IT5 A;  5JH7 B;  3RYF B;  4TQD A;  1JJO A;  2QWQ B;  4TWK A;  4JI8 O;  1Y74 A;  3K03 A;  1URF A;  2EIK B;  4HZ3 A;  3ASO B;  2LP7 A;  1I08 A;  1EN5 A;  3Q4H A;  5EK0 A;  3OFN G;  1Q3E A;  3HKD B;  5L3B A;  4CH6 A;  2HD0 A;  4TQF A;  4LF4 O;  3GVM A;  2FB5 A;  1K5Q A;  2W0X A;  4H13 B;  1H38 A;  1B04 A;  4DV5 O;  2F93 B;  5H6Q A;  3RYC B;  1JPX A;  2LF6 A;  4X8A A;  2PYJ A;  4LFC O;  4IYH A;  2JVD A;  3N27 A;  2P5O A;  1PP9 H;  2YEV A;  2EIK C;  4JI6 O;  3I56 V;  3ASO C;  3JAR A;  2PYL A;  3EXA A;  1ARO P;  1NU1 H;  4O4L A;  4JI5 B;  4B3S B;  4YJ3 A;  2Q6A A;  5LGT A;  4ZOL A;  2MZW B;  1M93 A;  1CEZ A;  2VRZ A;  3UCS C;  2A06 H;  4K8Z A;  1AR5 A;  1FZ1 E;  4QGP A;  1AVM A;  3G4S V;  3DGE A;  4J7K A;  3LDC A;  4LF8 O;  2QXF A;  4AKH A;  5EBM C;  2UUA B;  2YIA A;  4LNU B;  3E4W A;  1N33 B;  1XL6 A;  2P7T C;  4LFC B;  2QTS A;  2VJ4 A;  3T4D A;  3JD2 A;  3KCY A;  4CC6 A;  4UFZ A;  2IH1 C;  1FFX A;  3JYC A;  3M99 B;  1BCC H;  3ABM B;  1CPY A;  3CS5 A;  2OTL V;  2WA4 A;  1S76 D;  1OV9 A;  5EIB D;  2Q4P A;  1M5I A;  1FZ9 E;  3SUQ A;  1VQK V;  2EBO A;  2VQF O;  3SYP A;  5CA0 A;  5TIS Z;  2ATK C;  2DJV A;  1H2N A;  4UV8 A;  3J27 A;  1MSW D;  4HNA A;  2UU9 B;  2ZQM A;  2HG5 C;  2P1P B;  3D8C A;  5IJ9 B;  1FAF A;  5J2T A;  2H3O A;  2DYR C;  1VF5 B;  3JCU Z;  2UUC O;  3DC5 A;  1M4U A;  1RM1 B;  5IYD O;  4PHZ A;  4FZ0 A;  1I94 O;  1Q90 D;  3R66 A;  2E75 B;  4JAA A;  1FS0 G;  4FFK A;  3UT5 A;  3K2O A;  5B66 Z;  5KMG B;  4JPR A;  1AIL A;  1BSM A;  3ABM C;  3QER A;  1AI4 A;  4JRQ A;  3VOU A;  2K9P A;  1K4D C;  3AK2 A;  3RYI A;  2YI9 A;  1PD3 A;  5KAI Z;  4B7E A;  3SPC A;  3L74 H;  2JQT A;  2QA4 V;  3W7X A;  2Q8V A;  4CS4 A;  1N8R W;  1ORQ C;  4B3T O;  1XL3 C;  4DV0 O;  1BMF G;  4H44 B;  2K1E A;  3CXC U;  3OGC C;  4TV9 B;  1L8D A;  1RPR A;  2XAH A;  4UV9 A;  4W4K A;  1DTO A;  4OX9 B;  4F6E A;  3L1N A;  2VWK A;  4Z1V A;  4Q6G A;  2FTK A;  4AQY B;  2E5L B;  4QNH B;  3JAM N;  2X0L A;  5JWP A;  5FL7 G;  3JAL A;  3APQ A;  4WBN B;  3CC2 V;  2LW7 A;  2UXC O;  4B3R B;  2JK5 C;  3OGK B;  3P3P A;  3CXH F;  1O9H A;  2ZT9 B;  4X65 B;  4ADN A;  2CH7 B;  4DV6 O;  3T1Y O;  1F4N A;  2XAS A;  5JCO A;  2JH9 A;  2N04 A;  4GKJ B;  1IBM B;  3J7A U;  4LH6 A;  3L9D A;  1IVS A;  3PN1 A;  3ABU A;  2BSK B;  4X20 A;  1U96 A;  5IBK B;  2QGN A;  1HWY A;  3BAA A;  3FAV A;  3T1C A;  2HR3 A;  2RCU A;  2IJH A;  4J10 A;  4WFF A;  4KI6 A;  3IFX A;  3CRC A;  3J80 N;  2V1D A;  1GN2 A;  3SGI A;  1RP3 B;  4DV6 B;  1GAX A;  3BPZ A;  1NBM G;  3HKC A;  1YJ9 V;  1Y76 B;  4DV1 B;  3MAQ A;  1ENV A;  3BHP A;  1J5E B;  2MW2 A;  1Q7Y W;  4KXR A;  5GTH Z;  4O4I A;  2CTW A;  4FLW A;  1EFR G;  2JHA A;  3M7M X;  2JGD B;  1BS3 A;  3ZRW B;  2OCH A;  4FM0 A;  1JFF A;  1GM8 A;  2Y48 A;  5LA6 B;  4JI4 O;  5E1A C;  2UUB O;  2ADP A;  3HL8 A;  3KKY A;  3E8B A;  5DM6 V;  1FD9 A;  4P9P A;  2D3O W;  2YUA A;  1PNM A;  2EIL B;  1SQQ H;  1W59 A;  1WAF A;  4JI1 O;  4DRX B;  1IBK O;  4DW0 A;  1K4C C;  1N32 O;  3QEP A;  3ABT A;  3MD0 A;  3L73 H;  2B1I A;  4K0K O;  2Q7G A;  2YEV B;  2QEX V;  4DR7 O;  2LFS A;  3L70 H;  4YJ2 B;  5A2Q N;  4I55 A;  1N36 B;  3CX5 F;  1UPG A;  5B1A C;  3OR6 C;  4H37 A;  1BQZ A;  3AG1 B;  2HKO A;  3CRA A;  2DYS B;  1S0V A;  1PKX A;  3ZS8 C;  3K0G A;  4MSW C;  4LFB B;  1D5A A;  1KQS U;  4JTA B;  3GWK C;  1X59 A;  3ZHT A;  1NKD A;  1GM9 A;  3JD4 A;  4FM1 A;  4JAV A;  2EZP A;  4NKG B;  5BMV B;  2AHZ A;  1GM7 A;  1XMH E;  1MMM A;  1PNL A;  3OEE G;  2EIL C;  2FW3 A;  4JI1 B;  1IBK B;  2F95 B;  3AG7 A;  5IZ7 A;  4JRP A;  4DR7 B;  2ZDI C;  1VP7 A;  1XUQ A;  1XMO O;  1AJQ A;  3D36 C;  1Z2G A;  2WAM A;  3SYC A;  1YTF D;  3G71 V;  2GTS A;  2P4V A;  3ZMZ A;  4M3R A;  2UXD B;  1LDK E;  4J7Z A;  1Q6U A;  2DQ3 A;  5CA0 B;  4FJ9 A;  2ILM A;  2A79 B;  2DYS C;  2WLM A;  3K9A A;  3OMI B;  3TJY A;  3ZMU A;  3ZHU A;  1XVG E;  1ZX3 A;  4HNA B;  3OAA G;  5BR8 O;  4FLT A;  1SER A;  2DE0 X;  3P3N A;  2ODM A;  3CPW U;  4LF7 O;  1AJN A;  2E74 B;  3SDL A;  5LGU A;  2IJJ A;  5JJE B;  1H2S B;  1VQO V;  1BE3 H;  5CBG A;  3AG4 B;  1V54 C;  3X2Q B;  4QPK A;  4F6R B;  4GKK O;  5LYJ B;  3A0B Z;  3CD6 V;  1AI5 A;  4LF9 B;  3N2K A;  2OZM A;  3CCQ V;  2OZS A;  3RN4 A;  3L71 H;  1VMG A;  3L75 H;  3LSU A;  3RYH A;  1IXM A;  4M3T A;  5IJ0 B;  2K5S A;  3RYI B;  2DQ0 A;  2NLJ C;  1EZJ A;  2YIC A;  4E2L A;  1B06 A;  4DUZ O;  3OE7 G;  1JW2 A;  1GK9 A;  2QKC A;  3JAW B;  1G8M A;  1Q6I A;  3ETQ A;  1YJW V;  3TAB A;  1WNS A;  4PI0 A;  4EYW A;  2IH3 C;  4RL5 A;  2QM7 A;  3E89 A;  2KG7 B;  4DUY B;  2QM8 A;  1KEC A;  4RQE A;  3AG4 C;  4X89 A;  1N0J A;  3CRM A;  1GN4 A;  3X2Q C;  4DV2 O;  5J2U B;  1WA8 B;  1Q9X A;  3SPZ A;  4FJX A;  2KSD A;  1FXV A;  3OD4 A;  5L3D A;  2Y0I A;  2GUZ A;  1KKD A;  3NCI A;  1XOU A;  1IXB A;  4DU3 A;  1GRJ A;  1ZSP A;  2QDO A;  3OTF A;  4U3J B;  3SR2 C;  4QE7 A;  4WFG A;  2JS5 A;  3KZI Z;  4JI2 O;  4FJL A;  3B09 A;  2ZM6 O;  4ASU G;  3T1H B;  3T4Z A;  2QTO A;  4YHH O;  4X88 A;  3SPH A;  4UCR A;  5LMN O;  2QKA A;  1AI6 A;  5FLX N;  1K5S A;  3HKE B;  4NXM O;  4JAS A;  4FJK A;  1DLB A;  4DV7 B;  1KB9 F;  3UKM A;  5HFL A;  5KHK A;  2OIE A;  3CCR V;  2ZNI A;  4DTR A;  2O57 A;  2IBZ H;  3BAB A;  5KAF Z;  2RKH A;  2P1Q B;  3P32 A;  1YEW A;  1FPO A;  1KP3 A;  2DN9 A;  1SA0 B;  1IBL B;  2E3C A;  2P06 A;  4DYL A;  5IRE A;  2R70 A;  1QHT A;  4NVP A;  3NR7 A;  2H8P C;  4FJ7 A;  1JMK C;  1WP8 A;  4FZ1 A;  4KHP B;  3OGI B;  1E79 G;  4O4J B;  2QR4 A;  3KD5 E;  2IJI A;  1T5E A;  3WB2 A;  3N1E A;  4NXN O;  1FFT B;  3A8T A;  4YIP A;  4DTN A;  1HP8 A;  3S3W A;  3K57 A;  4CZZ A;  5CB4 B;  3WB1 A;  3RBZ A;  4GLX A;  1FXK A;  5B1N A;  3ABL B;  3SJJ A;  2E31 A;  1K8A W;  2EZO A;  3I55 V;  1XNR O;  4JI3 B;  4ICG C;  1VEW A;  4MVM A;  4XDK A;  3CB2 A;  5FNV B;  4DU4 A;  4GT1 A;  4QIW F;  1OCZ C;  3C6P B;  1XDC A;  3E22 A;  4XBF A;  3UO3 A;  1PPJ H;  1AJP A;  2Q68 A;  4FMT A;  4JS4 A;  4O4H B;  4JTC B;  4LP8 A;  4YY3 B;  5LXT A;  4JI0 O;  4NXN B;  2RNB A;  3QNO A;  1ZL8 A;  4B08 A;  1S5J A;  3CFO A;  4JYA O;  1HNX O;  4I4T B;  1YZB A;  4QE9 A;  3OMA B;  3F5T A;  3TXQ A;  3EFF K;  2X6A A;  5CMU A;  1AR4 A;  1VQ6 V;  3LSQ A;  2ZKO A;  2GHY A;  1XHX A;  3J81 N;  3SPY A;  3G6B A;  4DR5 O;  3HP9 A;  2PFV A;  3K5M A;  2A7W A;  4DV4 O;  4EB6 B;  1TVK A;  2N74 A;  1Q86 W;  1S77 D;  3ZN1 A;  3ZRV A;  1QBZ A;  1YIJ V;  2JGU A;  5DED A;  3WU2 Z;  4DR4 B;  3DC6 A;  1GN6 A;  3K58 A;  2JH8 A;  4WFE A;  1IX9 A;  3O9O A;  1NS1 A;  2GV9 A;  1R3J C;  2Z3Y A;  1V55 B;  2ITD C;  2Q0O C;  2VWJ A;  1HNX B;  1W0J G;  2HJF C;  1SF9 A;  1QLE B;  2PTM A;  1N1C A;  2A3Q A;  4FLU A;  3P30 A;  1VQ7 V;  2Q73 A;  5GON A;  4UVA A;  4YXW G;  3ABK C;  2Q67 A;  1K9M W;  5HFM A;  3E4Y A;  4DV4 B;  3CWB H;  4J2E A;  2MK3 A;  2G38 A;  4WFA V;  3SYO A;  1XMF E;  4M3Y A;  3K0D A;  4PDM A;  2ZE5 A;  1JX9 A;  5H2F Z;  1DGS A;  4X1I A;  5LHI A;  4DK0 A;  4MVZ A;  2JJ1 G;  3FB5 C;  2GDS A;  4JI5 O;  4B3S O;  3SQ4 A;  3K06 A;  1HDJ A;  1SES A;  4BIZ A;  2BTQ B;  3APO A;  3ASN B;  3D3Q A;  3RW0 A;  1GKF A;  3STL C;  3NE6 A;  2B1G A;  4I9Q A;  1QLE C;  5EBL C;  3LDB A;  1DF5 A;  2QWR B;  1OCO B;  1FJG B;  4U3F H;  3VBB A;  3LZJ A;  5KLV H;  2OIG A;  2OVP B;  2UUA O;  3ZHR A;  1PM9 A;  1Y6X A;  5LP6 B;  4KP4 A;  1N33 O;  2R9R B;  3TXS A;  3IJ4 A;  4JZ2 A;  4FK2 A;  1KBH A;  1JA8 A;  5JQG B;  1KP2 A;  1NEX B;  4EEQ A;  4I6J B;  2RDC A;  1BZK A;  4RNG A;  2P22 C;  1QR8 A;  3ICX A;  2PZS A;  4Q20 A;  5K1X A;  2BCC H;  2AZ2 A;  3MKS B;  1AP6 A;  3G80 A;  3LDE A;  5JVD B;  4PDV A;  3SJA C;  3ASN C;  2UU9 O;  1NZ6 A;  3A0R A;  5LMU O;  2AW9 A;  4JV5 B;  1OCO C;  1GH6 A;  1OJH A;  1WB7 A;  5LP6 C;  3SCX A;  4X64 B;  4M3Z A;  4I50 A;  2EUL A;  1R73 A;  2UXN A;  3B77 A;  1XVF E;  1NQT A;  2AZ0 A;  1BQ0 A;  1XL4 A;  2H94 A;  5F2V O;  1AP5 A;  3BFR A;  2P1O B;  5D5P A;  2JPN A;  2JIZ G;  3RWR D;  5GW7 A;  4RUE A;  4X1K B;  3AK3 A;  3GWO A;  3ZHQ A;  2W6J G;  4FLZ A;  5IT9 N;  2DW4 A;  2ETN A;  2WLH A;  3HB3 B;  5CA3 A;  5LMU B;  1Q5O A;  3PJS K;  1VQ8 V;  1XVC E;  4J11 A;  1L1F A;  4BAY A;  4X5N A;  1HNZ B;  4JTD B;  1H2K A;  1A32 A;  4KL1 A;  2Q7E A;  1OCC B;  1QLN A;  4OX9 O;  4I0X A;  1KD1 W;  2PUS A;  5CA1 B;  4KHQ A;  2IJK A;  4AQY O;  4JYB A;  2E5L O;  2L6L A;  1K3E A;  1GTO A;  3OGM B;  4Z2W A;  5ITZ B;  3GB7 C;  3E22 B;  4B3R O;  3VQV A;  5H5N A;  1FYJ A;  5L3F A;  4X65 O;  1RPO A;  1FZ8 E;  1MTY G;  2JDI G;  1R6N A;  1MHZ G;  1H2L A;  2WLI A;  1VQ5 V;  4GKJ O;  1IBM O;  1DF4 A;  3TGU H;  4R8C A;  3OT7 A;  1ZL8 B;  3BVO A;  1RM1 C;  4DR6 B;  1ZTE A;  4ABM A;  1NJI W;  1OCC C;  2ZIO A;  5IYZ A;  3C6O B;  4X1Y A;  3SJQ C;  4FFB A;  3QES A;  5LOV A;  1P7B A;  3E83 A;  3OMN B;  4J2B A;  3QNN A;  3SPJ A;  4CH4 A;  1XMG E;  2H4T A;  1XI1 A;  4AKG A;  4LF5 O;  1MMO G;  2DTU A;  2P6J A;  3JAT B;  1VAR A;  2PF4 E;  4LWS A;  2UXB B;  1BHA A;  4GX0 A;  3L0M A;  2NR5 A;  3DXR A;  4CBC A;  1I5Y A;  1NVP D;  4IHJ B;  3QO7 A;  3THO A;  1SQP H;  2RQ6 A;  4DV1 O;  2P67 A;  2DEB A;  4IIJ B;  1J5E O;  2X6C A;  1MA1 A;  4UB8 Z;  3G6E V;  4LFA B;  3RVZ A;  4QNC A;  3HKB A;  4TV8 A;  3AG2 B;  4O2B B;  4MS2 A;  4LF5 B;  3SI6 A;  1VQ9 V;  4LC1 A;  1XMQ B;  2GTA A;  4EPH A;  1S5L Z;  4NR1 A;  2V7Q G;  1RSO A;  4PA7 A;  1WPB A;  1F7Y A;  5IYC O;  1Y74 B;  3CMA V;  2BOB C;  5L3G A;  3TK1 A;  2ZXW B;  1TUB A;  1EZV H;  4OGQ B;  3Q4H B;  5EIB C;  3SJB C;  2P1N B;  1N36 O;  2F1M A;  3N2G A;  1X4T A;  4J9Z B;  1LR1 A;  1ZLZ A;  3CJH A;  4FK5 C;  4LFB O;  2D2C B;  3ZJZ A;  3SQ0 A;  3W7T A;  1FKA O;  4P30 A;  1N34 B;  1XIL A;  1L0L H;  1I5X A;  4DV3 B;  1XVB E;  3JAS A;  4X5M A;  3AK1 A;  3LNM B;  2N05 A;  3K5L A;  1F23 A;  1YVW A;  4JF3 A;  4HCB A;  2ZR3 A;  1FZI E;  3JAR B;  1VIB A;  4O4L B;  2ZXW C;  1OZ0 A;  3JD0 A;  2XTA A;  4YJ3 B;  2IU0 A;  1M90 W;  4ZOL B;  2ATQ A;  1AB3 A;  3JSL A;  2UXD O;  4J7J A;  1P84 F;  5KX5 A;  1VQN V;  3E35 A;  3JD3 A;  1UJW B;  4CS3 A;  1Q82 W;  4UUJ C;  1VQ4 V;  3H1H H;  4TUY A;  1NT2 B;  4D7S A;  1YSC A;  2XND G;  4ZI7 A;  5H9C A;  4J80 A;  3SQ2 A;  4X9Q A;  4DK1 A;  1QQC A;  1HR0 B;  4DTX A;  2JEX A;  2R9I A;  1TUE B;  4DW1 A;  4E4E A;  1FFX B;  1D2D A;  1R3L C;  2F23 A;  1N0N A;  4LF9 O;  1YCI A;  3LDD A;  1NTZ H;  3ZIA G;  2W6I G;  3CCV V;  4OPA A;  5EYP A;  3AG1 C;  3ZMV A;  3H1K H;  1P49 A;  1XBL A;  2VQE B;  3C94 A;  4PA4 A;  2EIM B;  1EBO A;  1COW G;  2HP8 A;  3ETG A;  5J2T B;  3AG3 B;  2KKW A;  3NAE A;  4DR2 B;  2IM9 A;  3ZMT A;  1FZ5 E;  4RUF A;  4KHW A;  4U7N A;  3SQ1 A;  3JAK A;  4IL6 Z;  4AI6 A;  4DUY O;  3UT5 B;  3WFV A;  4GAM C;  1LUV A;  2ZE7 A;  4WFB V;  3WG7 B;  1BT8 A;  2WLL A;  3EHB B;  3W7W A;  1VF6 C;  2A0L A;  5EC2 C;  1XVE E;  3K9S A;  1K92 A;  2VJ5 A;  1FZ4 E;  2B7M A;  2ZCE A;  2P5G A;  1IH7 A;  3RYF A;  1MOF A;  4FJC C;  4XDJ A;  2EIM C;  2HHH B;  4KHU A;  1M56 B;  1DK1 A;  4FLX A;  3TET A;  3AG3 C;  1O9G A;  3DTU B;  3T1H O;  1K34 A;  3BRC A;  3W7S A;  4M3W A;  4LCU C;  5AG2 A;  1IUR A;  4RQF A;  4UVB A;  5H6R A;  3RT3 C;  4E3S A;  1B3Q A;  4DR3 B;  5KHJ A;  3WSO A;  4DV7 O;  3HKD A;  2Q7H A;  2UXX A;  3JAL B;  2Q5Z A;  1J95 A;  2YIB D;  2B5U A;  1HNW B;  4HBN A;  4MTX A;  2Y4T A;  3C3S A;  5KUK A;  2EX3 A;  2BTO A;  2XUM A;  4LF6 O;  4UCV A;  3B4S A;  1IBL O;  4KFM A;  3RYC A;  1YTF B;  4ZBM A;  1WAZ A;  4J42 A;  4HCC A;  2P90 A;  1M56 C;  3QET A;  4UCS A;  1W2B U;  1FZ0 E;  1KMI Z;  4IYI A;  4FJI A;  2HJD A;  3HKB B;  3ML0 A;  5B3S B;  4J2D A;  2JHC A;  1R3K C;  4X20 B;  4KHP O;  2YS8 A;  1I7F A;  2YXL A;  5LHG A;  4X62 B;  3FAV B;  4HAM A;  4HYO A;  1FZ7 E;  4LH7 A;  5IWA B;  5IE9 A;  3B8N A;  2OYQ A;  1JCH A;  3CRR A;  4LF6 B;  1BGY H;  4F4L A;  1LUW A;  2B9Z A;  1WLE A;  2YXY A;  3ZED A;  4AHC A;  3EVK A;  4ZIB A;  3HKC B;  4LNU A;  2QWP B;  2QWO B;  3IC9 A;  1G1X B;  4JI3 O;  2MW2 B;  2Y0P A;  4J9Y B;  1CXZ B;  3E86 A;  1NH2 D;  1BL8 A;  4O4I B;  5JCO C;  1F4M A;  5LHH A;  3OUF A;  2OWO A;  2QSA A;  3UM7 A;  1JFF B;  2CTR A;  4OXS A;  3STZ C;  5B3S C;  2WA3 A;  4MT8 A;  1JQ0 A;  3FYE B;  4YY3 O;  4UCU A;  5A9G A;  2M6Y A;  3IAY A;  1H2M A;  1TGO A;  3SJC C;  5FPO A;  5IJ9 A;  1G4Y B;  3C3T A;  3F7Y C;  4MTO A;  3IC7 A;  1SC5 B;  4FJN A;  3SYQ A;  4JYY A;  2HEP A;  1CP9 A;  4I55 B;  2AHY A;  1SQV H;  4B7K A;  2PY5 A;  2PFT A;  1S5H C;  5EBW C;  5KMG A;  2LFR A;  2Z5U A;  1IDS A;  4DR4 O;  2LGW A;  3SVI A;  5E79 Z;  4NTW A;  1SZX A;  2CGO A;  4ZI7 B;  3LSS A;  4JAU A;  4K35 A;  1AR1 B;  4KHY A;  1GO3 F;  1FXX A;  5JJJ B;  3ABL C;  4TV9 A;  3QEX A;  1XU3 E;  3L8B A;  5IDJ A;  4DTS A;  4X66 B;  4WCE V;  2XAJ A;  3UIQ A;  5L3E A;  3CCS V;  1XRE A;  3ZRS A;  2F4V O;  1ZWI C;  3RGB A;  2QJ1 A;  3HPL C;  3OR7 C;  4PEL A;  4NTY A;  4MVQ A;  3C90 A;  4RAI A;  2XHB A;  4WBN A;  4FK0 A;  3AEI A;  4JI7 B;  3QTC A;  3T2M A;  2ZE6 A;  3IGA C;  1FZ6 E;  3OTO B;  3A0H Z;  2WWW A;  2CH7 A;  2CK3 G;  4P2Z A;  1R3I C;  2YB5 A;  1MZE A;  3O65 A;  3JAK B;  2E32 A;  3JD1 A;  4MTF A;  3N2K B;  1JVM A;  2X7R B;  1YHQ V;  3CME V;  1FJG O;  2PGG A;  2AXT Z;  2ZIM A;  3RYH B;  2EIJ B;  2F4V B;  3CFP A;  2BSK A;  4FPP A;  2WLL B;  1WPX A;  1Q6H A;  2VS0 A;  1PNK A;  5JJN B;  2XAG A;  2F43 G;  3OGL B;  1MNG A;  3CE2 A;  1YJN V;  4MW8 A;  4D6T H;  1V55 C;  2KB1 A;  1HW7 A;  4FJH A;  4LBE C;  2NN4 A;  1BHB A;  1V9P A;  1Y76 A;  1VQM V;  3BA9 A;  3DSQ A;  3MDS A;  4DO2 A;  4TT3 G;  1PL4 A;  1R6K A;  4U7O A;  4IGG A;  3SNN A;  4JV5 O;  4R6Z A;  2JGD A;  3ZRW A;  1SQF A;  4MVO A;  2HVJ C;  4X64 O;  2EIJ C;  5LA6 A;  1SQX H;  2ZD9 A;  2GUZ B;  2ARH A;  2Q69 A;  3CC7 V;  1KUQ A;  3RMC A;  2OVR B;  1OHH G;  1Y4M A;  4GYC B;  4JI8 B;  5LGN A;  3LD8 A;  1R1B A;  5CBH A;  3ZRX A;  2QKS A;  3F7V C;  4I5S A;  2ZDI A;  4NYK A;  4DRX A;  4M41 A;  2HVK C;  4GX5 A;  5C8Y A;  2Z0A A;  3D36 A;  4BR6 A;  4H0L B;  4FJ8 A;  3FD9 A;  4YJ2 A;  4C7U A;  2GSM B;  4W4L A;  1YIT V;  1MSD A;  2BE3 A;  4TSF G;  1HNZ O;  1XQ8 A;  3HGL A;  4LF4 B;  4WFH A;  2Y69 B;  1H2G A;  4OPH A;  1P4R A;  2OVQ B;  4KHS A;  4N21 A;  2JHP A;  4KUM A;  2DYR B;  4DV5 B;  5BMV A;  4JZG A;  1YI2 V;  2CUG A;  4DXW A;  1YF2 A;  3C6N B;  1G6U A;  1SRY A;  2QE7 G;  3ETE A;  4CS2 A; 
#chains in the Genus database with same CATH homology
 4IT5 A;  1GH6 A;  2GUZ B;  1XBL A;  2OCH A;  2QWQ B;  3APO A;  4J80 A;  2L6L A;  4RWU A;  3BVO A;  1FAF A;  2N04 A;  2QSA A;  2EJ7 A;  3AG7 A;  1IUR A;  2RKH A;  1BQZ A;  2CTR A;  3UO3 A;  2QWN B;  3UCS C;  3UO2 A;  2QWR B;  1FPO A;  2DN9 A;  2YUA A;  1WJZ A;  3APQ A;  2CTP A;  2M6Y A;  2DMX A;  1BQ0 A;  1N1C A;  2QWP B;  2KQX A;  2CUG A;  2QWO B;  1N4C A;  2CTQ A;  2Y4U A;  2CTW A;  1NZ6 A;  2LO1 A;  2GUZ A;  4J7Z A;  2YS8 A;  2N05 A;  2Y4T A;  2PF4 E;  2LGW A;  1HDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...