3BVOA

Crystal structure of human co-chaperone protein hscb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
197
Chain Sequence
PRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Co-chaperone protein HscB, mitochondrial precursor
publication title Structure of human J-type co-chaperone HscB reveals a tetracysteine metal-binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 66
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
A PF18256 HscB_4_cys Co-chaperone HscB tetracysteine metal binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3bvoA01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3bvoA02
2CTWA 1WJZA 2DN9A 2GUZB 2L6LA 2QWQB 1FPOA 2CTPA 2GUZA 2Y4UA 3APOA 3UO2A 2KQXA 2OCHA 4J7ZA 2LO1A 2PF4E 2RKHA 1N4CA 4RWUA 2YS8A 1BQZA 3UCSC 2YUAA 2QWOB 1BQ0A 3APQA 2QSAA 2LGWA 1XBLA 4J80A 1HDJA 4IT5A 3UO3A 1GH6A 2QWPB 2N04A 2DMXA 2QWNB 2QWRB 1FAFA 2CUGA 1IURA 1N1CA 1NZ6A 2CTRA 2CTQA 2Y4TA 3AG7A 3BVOA 2EJ7A 2N05A 2M6YA
chains in the Genus database with same CATH superfamily
1AJPA 2PFTA 5KUKA 2DYSC 3QO8A 4NVPA 1GM8A 5IE9A 5DECA 4YY3O 1JJOA 4RQFA 3OW2U 1NKDA 1FZHE 2ZQMA 4DV6O 2YI8A 4JAVA 3HKCB 1N33O 1XILA 3W7TA 4YXWG 4KHWA 1TVKA 1GAXA 4FK4A 5KMGA 2F95B 4C7UA 4DR3B 1FXKC 3JAWA 1VF6C 3H9VA 1IZ3A 2LFSA 2XAJA 3OTOO 1E1RG 2LO1A 2UXBO 4P9OA 3CB2A 4R6ZA 1QLNA 1YJNV 4DK1A 3FAVB 5LMNB 4LF4O 4FM1A 3RYCB 2ZDIA 3J80N 2W6IG 2N04A 4FJMA 1QCEA 1Q90D 5IYZA 4E3SA 3H1LH 3SYOA 3D8CA 3SGIA 3RWUA 4X66O 2IH3C 2GUZB 1D5AA 3C6PB 2F66C 1FZ7E 3BEHA 1Y76A 2VJ5A 4UVAA 2BSKB 4DU4A 4JYYA 2LF6A 4U3FH 4TV8B 2LGWA 1XBLA 3K08A 5L3FA 2JIZG 4OX9O 4HYOA 2CGOA 1OHHG 1COWG 1BE3H 5KLVH 1Q8IA 5IBKB 5JWPA 2UXDO 2D2CB 4TV9B 4JTDB 1SKVA 1RPRA 1JVMA 1IDSA 1FS0G 1P22A 3QEIA 5CA1A 3T4ZA 1VF6A 1XVBE 3B40A 1FS1A 2MZWB 5HFLA 4PDLA 4DW1A 2ETNA 1SZXA 1NS1A 5KX5B 4KHNA 2HJFC 3ZHTA 3SUNA 2Z0AA 4O2AB 5JH7A 3W7XA 3JD1A 4DV3B 3UO2A 1O9HA 3RYIA 3ZHSA 3E89A 3C95A 1SQBH 2B9ZA 3SJBC 3OFNG 4DR4O 3KKYA 3TGUH 4DR7B 4KUMA 3LSQA 2JDIG 3L75H 4MT8A 4JYAB 2DTUA 3AG4C 3LNNA 2YXLA 3ETGA 3K5OA 3AG3C 3PN1A 4BIZA 3F5WC 3J2PA 4I4TA 2KG7B 2PF4E 3CRQA 1VARA 5TISZ 2VJ4A 4Z1VA 1YJ9V 3CCEV 1OCRC 1K5QA 1MMOG 2P67A 3IAYA 3WB2A 1YZBA 1N34O 5B1OA 2DQ3A 3B2EE 1AR1B 3SPZA 1Q82W 2WLIB 2ZKOA 2ZE7A 1I5YA 2EIKB 2QWQB 1XREA 4J41A 1SQFA 4UB6Z 4I0XB 4BR6A 2QEXV 2YEVA 3FAVA 4JI8B 3SI6A 4DTUA 4Q6GA 3Q4HA 2OT5A 1XMHE 3B8MA 1N0JA 4CZZA 4JAUA 5KHJA 4E2LA 2F1MA 4YIPA 1MSDA 3L70H 4ZHQB 4B3TB 1S5HC 2X6CA 1M4UA 1ZTEA 3ABKC 1EBOA 1TA8A 1Y67A 2L35A 2W6JG 1BSMA 4PD4F 3A0BZ 1GH6A 3ZN1A 4LF5B 1S3JA 3NHGA 1WP7A 4WF9V 1MG1A 1XQ8A 3ETQA 2E74B 4F6EA 3JD4A 3EVKA 3OT7A 3X2QB 1YHQV 3NDKA 3CRMA 4MVOA 2QKSA 4LC1A 3ZS8C 2F43G 3TETA 4D7TA 4FLYA 4GX2A 5BMVB 2XT9A 4NTWA 4P30A 1H2KA 4QJFB 5KX5A 5B66Z 4FLUA 3JAKA 4PA3A 1EN6A 2CTWA 2RJZA 5KHHA 4YHHO 1BHBA 3N1BA 3KD5E 4EYWA 3S3XA 2B5UA 2W0FC 4FMTA 5K1PA 2A3QA 5L3GA 4CC5A 1FZIE 5KHKA 4BWAA 4B3RB 2FL4A 4H44B 1GMGA 1VQLV 4JI5O 2BOBC 2A79B 1VEWA 2E5LB 4FM2A 2NLJC 2A06H 4CS2A 1BQ0A 2UUAO 5BY1A 3BPZA 4J80A 4WFBV 1Q5OA 4B3SB 3ABLB 2QWPB 4M3ZA 4IHJB 4M41A 4AKGA 1XHZA 4J2DA 2P1QB 5B1BC 4LF8B 1WN7A 3CCVV 5CBHA 1L1FA 3STZC 2CTPA 5H6QA 3AG1B 3ZMVA 4ZIBA 4DV5B 5LP6B 4DR2B 4I0XA 3RW0A 2AZ0A 3WB1A 1RM1B 2A9HA 1XMGE 4X1IA 1HDJA 2Q7HA 3CJHB 1H8HG 2JEUA 4AKIA 3CCUV 2PUSA 3HKDA 3E22B 1IXMA 2AXTZ 4JV5O 4FJKA 4M3XA 4X9QA 1JFFA 1OCCC 4KP4A 2ARHA 3QEVA 4HAMA 2XHBA 2YXYA 1HNXO 3SCXA 4TQFA 4RWUA 4WFGA 3SUPA 3SPCA 4FJJA 2IU3A 2X7RB 3K5MA 5LOVB 3CC2V 3QNNA 4JI7O 1QLEC 3TK1A 1IURA 4DXWA 1HNWB 5B3SB 2LW1A 4DV1O 3STLC 2HP8A 1GTOA 3T1YB 3OE7G 3K5LA 1QQCA 2JGUA 1BMFG 3KG2A 1J5EO 3OTFA 3T2MA 1FYZE 1BQZA 2FW3A 2QTSA 5LA6A 3SUQA 3N2GA 4JYBA 1GM9A 4LP8A 1KB9F 3ZIAG 3ZJZA 4D6TH 1M5IA 1BHAA 1E79G 4UV9A 2QKAA 4NXNB 4O4JA 1NH2B 3SQ4A 4MTFA 3VQXA 3LDEA 2VQEB 3M99B 3OMIB 4FJCC 1AR5A 4NR1A 1LUWA 5H9CA 3RBZA 4TSFG 1FXXA 5LYJB 4I6JB 1W2BU 1XI1A 4JGSA 1XMQB 4MTGA 5EBWC 3G67A 2VQFO 1HR0O 4LH7A 2DMXA 4PJ0Z 3WG7B 3DXRB 2QGNA 1R3KC 3QNOA 4GZRB 4L87A 3I5DA 4YY3B 4QPJA 4X62O 5FLXN 2EIJC 2HR3A 1XMOO 2EZPA 3N27A 3R65A 4DV6B 3G80A 4DTMA 4IHJA 1XU3E 1H2MA 3GVMA 4J42A 3AG2C 3L8BA 2DYRB 2NR5A 3HKEA 1VF5B 1DK1A 2UUBO 2ZIOA 3LDCA 5LP6A 1MSWD 3UCSC 3H1JH 4DTPA 1K5SA 4FJIA 4MVRA 4EFBA 4I50B 1I94O 3CXHF 2P06A 2Q9LA 3RYHB 1JW2A 1VP7A 1P49A 3PJSK 4IIJB 2P1MB 1EZVH 3BFRA 4DRXB 2W0XA 4MS2A 4BW9A 3RN4A 4ZOLA 3J27A 2JJ2G 4YJ3B 3JATA 4LR3A 5FPOA 4UXNA 3OGCC 5LOVA 2WLMA 1AI4A 2GTSA 1S5JA 4LWSB 5H37A 5EBMC 3K0GA 5D5QA 2UUCO 4RAIA 3M8AA 4FJGA 1JPXA 3TCUA 1M9NA 1GKFA 4GKKO 3APOA 1WAJA 2MW2A 2VWKA 4I55A 2YSUB 5IWAO 2LGQA 5JQGA 5BZBA 4F6RB 3K3WA 2OVRB 3LSSA 5DM6V 3DSQA 2IJHA 4YIOA 4M3YA 4LCUC 1Q86W 1QR8A 1N32O 4KHPB 2N05A 3O9OA 3HP9A 2AGAA 4MVMA 3QO7A 2OCHA 4K0KB 2RKHA 1QR9A 2RN9A 4DV4O 2PI4A 3ML0A 5A2QN 1FFXB 1F4MA 4ICGC 4X65O 4FK0A 1IBKO 1TUBA 5CBGA 1KP3A 3DXRA 4J2BA 4LFAB 1IX9A 2OTJV 4O4IB 4B3MO 3G6EV 3W7WA 4JI4O 1ZLZA 2B8IA 4FJXA 4HNAA 3I55V 1M56B 2UXCB 1FXKB 1XNQO 4EP9A 1XMFE 2A0LA 4QGPA 5KA5A 3SR2C 3QO5A 4DUZO 4QNCA 2ZXWB 1YTFD 1RP3B 1GO3F 1K34A 3ASOB 1Y74A 3OUSA 1VIBA 3CFRA 1FJGO 3SVIA 5E79Z 2OCCC 2EX3A 2GBOA 1YSCA 2FMLA 3CC7V 3ZN0A 2H4TA 4JI2O 3KCXA 4JAAA 2NNUA 2B1EA 1MOFA 4KXRA 3CRAA 3RYFB 3LZJA 2C2AA 1PNLA 3P32A 2HHHO 2QWNB 4CS3A 2P7TC 1IBLB 3R66A 1Q81W 3ASNC 3LUTB 4LF9O 1EFRG 4ICGA 1FPOA 5JVDB 3L73H 4DUYO 1KKCA 5LHIA 1X59A 1LDKE 1VQKV 5GONB 2VRZA 4DR6O 3E35A 3SYPA 4KHYA 1XVCE 1UJWB 1MHZG 4LF6B 4UCUA 3I56V 1AVMA 3NXSA 1VQNV 4O2BB 2DWDC 1K4DC 4FJLA 1GK9A 2XOKG 5H6RA 3ZHVA 3WSOA 4UCSA 3TXQA 2IU0A 5D5PA 4O4LA 3H01A 5AG2A 4JI3B 1AP5A 1RSOA 4B08A 3OMAB 3L74H 2YIBD 2WWWA 4CH6A 5J9PC 1YJWV 1MABG 4LFCO 2AZ2A 3CE2A 2P90A 3FD9A 3ZX6A 1XDCA 4NB5A 2CTQA 2CDYA 4WFHA 1YDXA 1NVPB 4R7CA 1SQGA 4GX1A 1MZEA 4JTCB 2FKXA 2WLLB 2JJ1G 2F4VO 4XDKA 3L71H 5IY5B 4H37A 1R6KA 3S9HA 3MHSC 2M7WA 1LR1A 3JD3A 3SPGA 2QKCA 3F5TA 1KU9A 1LUVA 1VF7A 4JI5B 3H1HH 1BS3A 3FB7C 3E8BA 3QVNA 1AI5A 4JTAB 5KHGA 4BAYA 2B1GA 4DYLA 3JARB 4DV0B 3SPHA 2UUAB 4LBEC 1G1XB 4ASUG 2YB5A 4TUYA 2ZM6O 4TWKA 1R73A 3ZRWB 3KZIZ 4UFZA 4KHSA 3BY6A 3MDSA 2YI9A 4IYHA 4QNHB 2LF3A 1OCOB 4FK5C 4I9WA 4DV7B 4U7NA 4FM0A 1L0NH 5L3BA 4PA7A 3W7SA 2B1IA 4CH5A 1X4TA 3ZRXA 3HKCA 2PYLA 2QM7A 3SYQA 4E4EA 4NXMO 1IG9A 4DR5O 1VQ6V 4JI0O 4GYCB 2VWJA 3B4SA 3T1CA 1SQXH 3SJQC 1R3JC 5LHGA 4GKJO 1ZWIC 3ZMTA 2R9RB 3UM7A 1HNXB 1QVGU 4CH4A 1IVSA 5GONA 3G71V 2CH7B 1AR4A 3IC7A 2ATQA 3RYCA 4FLZA 1TAEA 2V7QG 2ZE8A 1JR9A 1ZL8B 4DV1B 4PI2A 4X89A 3OUFA 2EIMB 1VQPV 2GUZA 3RVZA 3E8FA 1M57B 4B7EA 4AQYO 3HB3B 4FFKA 3MKSB 2OVPB 1UFIA 3CSXA 3CCLV 3GB7C 2BSKA 5B1NA 1A32A 3CXCU 4TV8A 3RMCA 2IJIA 1JMKC 4N21A 2G38A 1D5NA 2BTOA 3FB8C 5LXTB 4FK2A 4LF7B 3MD0A 2GDSA 3CRCA 1P7GA 1H2LA 2ZR3A 1URFA 4MW3A 4TV9A 2EINB 2K5SA 1BCCH 4DK0A 5C93A 1R3LC 4J7ZA 3E2EA 2WLLA 1M90W 3D36A 4DW0A 2BCCH 2QTOA 2B7MA 4J7KA 4RQEA 4X64O 1DGSA 3CCRV 3ABMB 1NH2D 2XTAA 3FFQA 5IJ9B 3JD0A 1NT2B 4FJNA 2M6YA 2JS3A 1GN3A 4PDRA 4O2AA 4K8XA 2WSSG 1R3IC 2Q69A 2V4DA 4OPHA 5J2TB 3HL8A 1RPOA 1XMOB 3ZHRA 5LGNA 2HG5C 1KD1W 5E1AC 2HJDA 4N23A 4FZ0A 1ZX3A 3JAMN 5BR8O 1QHTA 1TUEB 3U10A 4FLWA 3O65A 3L1NA 2H8PC 3ICXA 3TL8B 4EEQA 1OCZB 3TAFA 2ZR2A 1ZUQA 1Q6IA 2KQXA 2YDEA 2KG7A 1FKAO 4KHUA 2ZIMA 4G2KA 3BA8A 1B06A 2GSMB 1Q3EA 4HCBA 3P3PA 3IJ4A 3UO3A 3X2QC 4LNUB 3CQ8A 2CK3G 1Y6XA 3VQWA 2HKOA 5C8YB 2LW7A 2WLIA 3K03A 1PL4A 1SA0B 4W4LA 1DTOA 3NCIA 2FYUH 4DV3O 2WLNA 4WFAV 3SQ2A 5FNVB 1WA8B 2IBZH 1R6NA 5ITZB 4JI1B 4DTRA 3EFFK 1XL4A 4DR7O 5IJ0B 4FJHA 2Q0OC 1S5LZ 2Y0IA 2ITDC 3DC6A 3UKMA 4JYAO 1F7YA 3ETEA 4AI8A 5GTIZ 2MMBA 2OVQB 2IJKA 4GKKB 1HP8A 1FXVA 1JOYA 1P84F 4ZHQA 2Q5ZA 5IWAB 2IH1C 1GM7A 2RCUA 4QE7A 3C94A 2PZSA 3CFPA 4P2ZA 2R72A 3CFOA 5LXTA 2EILB 2QWRB 1CPYA 4RG8A 1Q9YA 5EZYB 1GN6A 4FIPC 5B1AB 4KI6A 5L3DA 3ZEDA 1I5XA 2DN9A 1AILA 3DC5A 3ABLC 5CA0B 5CB4B 4ADNA 4DV4B 1CLQA 3TAEA 3HGLA 1OV9A 1KUQA 4X65B 5BMVA 2ZE5A 2ADPA 3LZIA 3A8TA 1BGYH 2Y69B 2XASA 4U3JB 4B3MB 1AB3A 3AG1C 1AJQA 5LP6C 3E4YA 4I7ZB 1OJHA 2WLJA 1RM1C 5J2TA 5DN6G 4B3TO 4W4KA 2ZT9B 2R9AA 2UU9O 4I9QA 1N4CA 1WPXA 1MMMA 2QDOA 5LGUA 1NEXB 4G28B 3BRCA 3OD4A 1IBMB 1HNZO 2WLHA 1SZTA 4X20B 1K9MW 3K06A 4CBCA 2IW5A 4LF5O 1MA1A 3ZCCA 3RFRA 1K8AW 2EZOA 3IC9A 1Q9XA 3JALB 4Q20A 4NTXA 2XAFA 5J2UB 1ORQC 1MNGA 5HFMA 4DR1O 2NN4A 5KA6A 2LJ2A 1SERA 5B3SC 3UT5B 3NR7A 4WFEA 2FB5A 2HHHB 1N33B 1XVEE 2X6BA 4UCTA 3W7UA 1FZ6E 1Z2GA 3DTUB 5C8YA 2CGNA 3AK1A 3A0HZ 3ZHUA 1SA0A 1PNMA 4BIOA 3UIQA 1XL6A 4DUYB 1U96A 3OTOB 3FKSG 2UXBB 1EM1A 1WA8A 5JCOA 2QXFA 4MVUA 4LF4B 4KHQA 1XL3C 4H0LB 1XVDE 2P22C 2OWOA 4FPPA 4MVSA 2DW4A 1K92A 1QNMA 3CJHA 3QESA 4H13B 1FAFA 4UCOA 4B3RO 1K3EA 3E22A 1UPGA 4X66B 4QE9A 3K58A 3CMAV 4PELA 1VQ7V 4UVBA 3F7YC 3OGLB 3AK2A 3C6NB 3WG7C 1CP9A 3D3IA 3OAAG 3NE6A 3WFVA 4OX9B 2JK5C 4LH6A 2YIAA 2OZMA 1HW7A 5KMGB 4GUNA 1JJ2U 3BA9A 3JAWB 5EZYA 4Z1MG 1GN2A 1US6A 1DF4A 2QE7G 2UXDB 4U7OA 3N2KB 4GX0A 3T1HO 1V54B 2H94A 4M3UA 3FYEB 2JGDB 4GAMC 2HEPA 1WP8A 3JASB 3SNNA 1IXBA 2JEXA 2Q68A 1F4NA 4DR2O 5K1XA 4JZGA 4BW5A 3K04A 2DYRC 4L8JA 2HD0A 2JHAA 3TJYA 3M7MX 4HBNA 1V55B 1W0JG 2YICA 5IYZB 4U3JA 1JCHA 1VQOV 1LNQA 5IYBO 3P3NA 1H2GA 2P1NB 4UUJC 5GW7A 3N1EA 3RMDA 1Y76B 3OGKB 1NBMG 1FZ8E 2GHYA 4DR4B 1KYOF 3JYCA 1KKDA 5LYJA 3K0DA 1F23A 2DYSB 4ZI7B 1B6QA 1H2NA 2F93B 1PV0A 3RMAA 5LBQA 3SQ0A 2XNDG 1N1CA 1HNWO 2PY5A 2P4VA 2ADQB 2K1EA 3P30A 1MTYG 5LGTA 3T1YO 1HWYA 1Q6UA 1I0HA 3OEHG 3SYCA 1H38A 2BE3A 5CA1B 1CXZB 3QTCA 3SDLA 2P1OB 1N36O 1YITV 4FVMA 4AILC 1VQ5V 1N34B 4J7JA 5CBFA 3CCMV 2CE4A 2BTQB 4DR5B 2YXHA 1NTMH 5JH7B 2PFVA 3C3TA 3JD2A 1XVFE 4DV2O 3SQ1A 2ILMA 4JYCA 2DY4A 4DTXA 1PL0A 1XEQA 5EIBC 1SQVH 4I50A 3VOUA 3RYHA 3OEEG 3D3QA 3C6OB 5EBLC 1XOUA 4PI0A 3THOA 4IIJA 4AQYB 1H8EG 4I4TB 2AW9A 5JJJB 2YIDA 1SF9A 4DRXA 4YJ3A 4R50A 3LSUA 2DOSA 3G6BA 1FZ5E 2ZNJA 1M56C 1Y66A 5FL7G 4A5UB 1SRYA 3TXSA 4LWSA 2JHCA 2P5OA 3ETDA 3SPYA 3N2KA 2JGDA 1YIJV 4G27B 4CS4A 4KI4A 3JASA 1GRJA 1JQ0A 2Q8VA 2ZXWC 4X1YB 2YEVB 4JRPA 4JZ2A 4DO2A 2EULA 3BABA 3J7AU 4X64B 2QSAA 1KC8W 3ASOC 4F6RA 3Q4HB 1WPBA 4IT5A 2DJVA 1VMGA 2E76B 3QNEA 1O9GA 2H3OA 3ZHQA 4FLXA 4UV8A 2P5GA 2OZSA 4JF3A 5GTHZ 1K97A 2EBOA 4YHHB 1XHXA 3AG4B 3CCQV 2Q6AA 5KUMA 3ZMSA 2K9PA 2EJRA 3HPLC 2QWOB 3AG3B 3QERA 4ZI7A 1FFXA 1QBZA 5BR8B 4OXSA 4Z2WA 3K57A 5L3CA 2ZCEA 4LFBO 1SQPH 3VBBA 4O4IA 1OCRB 3AEIA 3QG5A 1T5EA 4J2EA 4FFBB 4J10A 5IDJA 3GWKC 2JH8A 4BIUA 3TJTA 1FXKA 4FLTA 4AKHA 2YS8A 4MW8A 1JX9A 5LHHA 1MZFA 4RUEA 2IM9A 3FB6C 3CHXA 1PPJH 3UQ8A 4HZ3A 1THZA 1E1QG 2BTQA 3KD1E 1NI8A 5JJEB 1OZ0A 1Y4MA 4PA4A 3JAKB 3K59A 2Q7EA 4KHPO 1XNRO 3L72H 4KFMA 1H2SB 1FFTB 2DWEC 4M3WA 4JI6O 5CA3A 5EC2C 2DE0X 4FLVA 4K0KO 2VS0A 2JH9A 2JVDA 5EC1C 5LMUO 3ABKB 4XBFA 3CCSV 2KB1A 3RYFA 3B77A 4LFAO 3D36C 3J81N 4JRQA 2GTAA 4JV5B 3IGAC 4FJ5A 1YTFB 4NYKA 5IY5C 2KSDA 5JVDA 2QM8A 2UXCO 4IGGA 2Y0PA 2WAMA 4GT1A 3SJAC 3A0RA 4P9PA 2PI5A 1AI7A 1XVGE 1NU1H 3CYOA 4WCEV 4ADOA 1PP9H 4JI7B 2PYJA 3CD6V 1VQ9V 3FYIB 3VQYA 3SJJA 4O2BA 1AJNA 3TABA 3DGEA 1EZJA 1EN5A 1L8DA 3E4WA 1J5EB 4PA6A 4X1YA 2JS5A 3CS5A 3LDSA 2RNBA 4E4BA 4X1IB 2FYOA 4J2AA 1OCOC 4GCZA 2BOCC 1AROP 2ODMA 2P4KA 3HKDB 4M45A 1IBLO 5H2FZ 5EYPB 1JA8A 3H1KH 2OIGA 1ROPA 4DR3O 3E8GA 5JJNB 1AP6A 1JFFB 2LP7A 3CCJV 2UU9B 3EHBB 1D2DA 2QM4A 3QEWA 2E31A 4PV1B 2P1PB 3CEIA 2E75B 3VQVA 3ZMZA 1HNZB 4K35A 5LMNO 3RT3C 3NGIA 2CAZC 2EIKC 1BT8A 5KAFZ 4OGQB 2VQFB 4RNGA 1HR0B 4HCCA 4KL1A 4QIWF 4LF6O 4MSWC 1L0LH 4PDMA 2EJ7A 2R70A 3ABTA 4FFBA 4H33A 1YVWA 3GWOA 1FZ2E 3RWRD 3HGKE 4XDLA 2Q7GA 3QEPA 4X62B 4DR1B 5B1BB 3JARA 2ATKC 3QETA 1KECA 4O4HB 4JI3O 2JPNA 3S3WA 3MHHC 1BZKA 5IT9N 5LA6B 3N2GB 4UCVA 2EIMC 5IZ7A 1WB7A 1V9PA 4X5MA 1M57C 3SUOA 4GX5A 3ZRWA 2XAHA 4X88A 1Z5WA 4O4JB 3ZMUA 4EPHA 1R6TA 4GLXA 4J9YB 4DU3A 2UUBB 4R8CA 3SPJA 2P6JA 3K79A 5B5EZ 3H1IH 3BAAA 4PDVA 4JASA 1OCCB 3E83A 2YC0A 3K9AA 3JCUZ 5CN0A 1PM9A 1YCIA 2EINC 3NAEA 4QPKA 1I94B 2UXXA 1WAFA 3WU2Z 3MAQA 2ZD9A 2PGGA 2JHPA 3CWBH 5IREA 1FD9A 3ABMC 3B09A 1QLEB 4AI6A 3HR0A 4XDJA 3U11A 3JCZA 3OGIB 3FB5C 4YJ2B 4DV0O 2F23A 1GN4A 1FZ4E 4JS5A 2CH7A 4X1KB 2QJ1A 4TOIA 2OIEA 2Y48A 2D3OW 1VQMV 1WLEA 1ZL8A 5BXZA 3CP1A 4NTYA 4FJ8A 2RMKB 2UUCB 1N0NA 2WLKA 1B3QA 3E8HA 2XUMA 3T1HB 3HKEB 3K2OA 3CX5F 2Y4UA 4DV7O 4F4LA 4MTOA 1K7DA 1NTZH 1G6UA 3OR6C 1G4YB 3V7DB 3IFXA 3ZRVA 1OCZC 1WB8A 2Q0AA 3BCCH 2HVKC 2CUGA 1XUQA 5EYPA 1BL8A 1N32B 1FZ9E 2WA3A 1IH7A 1SQQH 2V1DA 4RUFA 1WNSA 1B04A 2UXNA 1N8RW 4ZOLB 1S76D 4J9ZB 3JATB 4JPRA 1P4RA 5LL6Y 4EB6B 4JI8O 1FXHA 1IBKB 4K8ZA 1SC5B 2EIJB 5IJ9A 5EIBD 2YIBA 2JQTA 3TAGA 4WBNB 2CTRA 5IYCO 1DF5A 2E32A 2YUAA 5JCOC 3HKBB 4FZ1A 4JI4B 3U0ZA 1WJZA 2Q4PA 5DEDA 4AHCA 4DTJA 3OMNB 2MW2B 4X5NA 5L3EA 4I55B 5JQGB 4PHZA 4DTNA 3AG2B 2Q67A 1FZ3E 1N36B 1XNQB 4O4HA 4J11A 1K73W 4I5SA 4DUZB 4LF7O 3LDDA 1ZSPA 1FYJA 3OGMB 1PNKA 4FJ9A 1NJIW 3WB0A 1FJGB 3SYAA 2JRIA 2VIXA 3FX7A 4RO2A 4DV2B 4M3RA 1NTKH 4DU1A 4ZBMA 1QVFU 2EILC 2A7WA 4JI2B 2HVJC 1YI2V 2Q73A 4ABMA 5B1AC 1TUBB 3K9SA 3RMBA 4I9LA 2X0LA 3OR7C 4CC6A 4LNUA 1VQ8V 4EFEA 4JS4A 4HNAB 4LF9B 1M1KW 2Z5UA 4YJ2A 5FNVA 2Y69C 1U97A 3T4DA 4X1KA 5ITZA 1PKXA 1CEZA 4DR6B 1ENVA 1PD3A 3BHPA 1M93A 5IJ0A 1S0VA 1FZ0E 2ITCC 5KAIZ 3RGBA 2X6AA 2Y4TA 1Y74B 2OTLV 5FPRA 4EKWA 5EK0A 3L9DA 2LFRA 1NR7A 1SS3A 1P7BA 1NR1A 1TGOA 3CPWU 2E5LO 1YXBA 3LNMB 4ZKIA 3ABUA 4RL5A 3A2FA 2FTKA 4UCRA 4B3SO 3ZBHA 4FJ7A 3QF7A 4MTXA 4LFCB 3L0MA 3OM3B 4OPAA 1TVKB 1S72V 3AK3A 2XAQA 4LF8O 4DTSA 2E3CA 2AHYA 5CA0A 5CB4A 5IYDO 1F51A 2MK3A 4DV5O 1R1BA 2F4VB 1K33A 4TT3G 2QR4A 4EB6A 4JI1O 2HFEC 1G8MA 1KMIZ 1NQTA 4X8AA 1NVPD 2ZINA 1I08A 1DLBA 4LFBB 4NKGB 4WFFA 1EN4A 1NZ6A 4WBNA 3HKBA 3C90A 1WAZA 3SJCC 3KCYA 1ZAUA 1YF2A 1VQ4V 5F2VO 1SESA 3SPIA 4IL6Z 2N74A 4PA9A 3G4SV 5H5NA 4O4LB 4MVZA 1QU7A 3EXAA 1RSOB 5CMUA 2KKWA 1W59A 1K4CC 4TQDA 3ZRSA 2ZE6A 1YEWA 4DTOA 2ZM6B 4X20A 2OCCB 3C3SA 1Q43A 3JSLA 2DQ0A 3AG7A 3F7VC 1XNRB 2PTMA 2RDCA 2OYQA 2O57A 4JI6B 2L6LA 1I7FA 4IYIA 4MVQA 1KQSU 4CH3A 3JALA 3RVYA 4B7KA 5J2UA 1W0KG 2GV9A 1XU5E 1FZ1E 5KHIA 3ASNB 5LMUB 1J95A 2LQTA 5A9GA 3UT5A 1V54C 2RQ6A 3K5NA 1MHYG 3B8NA 4K3AA 3CRRA 4NXMB 1Q6HA 3CC4V 3BVOA 4M42A 4JI0B 1RFYA 4NXNO 3QEXA 4UB8Z 2ZDIC 2RCVA 2ZNIA 4GKJB 2DEBA 2WA4A 2R9IA 2Z3YA 1AI6A 3RYIB 2VQEO 1KP2A 1V55C 2QA4V 4D7SA 2HLDG 1Q7YW 3L2OB 3CMEV 1KBHA 2AHZA 3LDBA 3APQA 4UVCA 4M3TA 1Z5VA 1IBMO 1XMQO 4TUYB 4QNDA 3LD8A 2XAGA 1SETA 3E86A 1S77D 2WPDG 3JSNA 2IJJA
chains in the Genus database with same CATH topology
2CTWA 1WJZA 2DN9A 2GUZB 2L6LA 2QWQB 1FPOA 2CTPA 2GUZA 2Y4UA 3APOA 3UO2A 2KQXA 2OCHA 4J7ZA 2LO1A 2PF4E 2RKHA 1N4CA 4RWUA 2YS8A 1BQZA 3UCSC 2YUAA 2QWOB 1BQ0A 3APQA 2QSAA 2LGWA 1XBLA 4J80A 1HDJA 4IT5A 3UO3A 1GH6A 2QWPB 2N04A 2DMXA 2QWNB 2QWRB 1FAFA 2CUGA 1IURA 1N1CA 1NZ6A 2CTRA 2CTQA 2Y4TA 3AG7A 3BVOA 2EJ7A 2N05A 2M6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTW A;  1WJZ A;  2DN9 A;  2GUZ B;  2L6L A;  2QWQ B;  1FPO A;  2CTP A;  2GUZ A;  2Y4U A;  3APO A;  3UO2 A;  2KQX A;  2OCH A;  4J7Z A;  2LO1 A;  2PF4 E;  2RKH A;  1N4C A;  4RWU A;  2YS8 A;  1BQZ A;  3UCS C;  2YUA A;  2QWO B;  1BQ0 A;  3APQ A;  2QSA A;  2LGW A;  1XBL A;  4J80 A;  1HDJ A;  4IT5 A;  3UO3 A;  1GH6 A;  2QWP B;  2N04 A;  2DMX A;  2QWN B;  2QWR B;  1FAF A;  2CUG A;  1IUR A;  1N1C A;  1NZ6 A;  2CTR A;  2CTQ A;  2Y4T A;  3AG7 A;  3BVO A;  2EJ7 A;  2N05 A;  2M6Y A; 
#chains in the Genus database with same CATH topology
 1AJP A;  2PFT A;  5KUK A;  2DYS C;  3QO8 A;  4NVP A;  1GM8 A;  5IE9 A;  5DEC A;  4YY3 O;  1JJO A;  4RQF A;  3OW2 U;  1NKD A;  1FZH E;  2ZQM A;  4DV6 O;  2YI8 A;  4JAV A;  3HKC B;  1N33 O;  1XIL A;  3W7T A;  4YXW G;  4KHW A;  1TVK A;  1GAX A;  4FK4 A;  5KMG A;  2F95 B;  4C7U A;  4DR3 B;  1FXK C;  3JAW A;  1VF6 C;  3H9V A;  1IZ3 A;  2LFS A;  2XAJ A;  3OTO O;  1E1R G;  2LO1 A;  2UXB O;  4P9O A;  3CB2 A;  4R6Z A;  1QLN A;  1YJN V;  4DK1 A;  3FAV B;  5LMN B;  4LF4 O;  4FM1 A;  3RYC B;  2ZDI A;  3J80 N;  2W6I G;  2N04 A;  4FJM A;  1QCE A;  1Q90 D;  5IYZ A;  4E3S A;  3H1L H;  3SYO A;  3D8C A;  3SGI A;  3RWU A;  4X66 O;  2IH3 C;  2GUZ B;  1D5A A;  3C6P B;  2F66 C;  1FZ7 E;  3BEH A;  1Y76 A;  2VJ5 A;  4UVA A;  2BSK B;  4DU4 A;  4JYY A;  2LF6 A;  4U3F H;  4TV8 B;  2LGW A;  1XBL A;  3K08 A;  5L3F A;  2JIZ G;  4OX9 O;  4HYO A;  2CGO A;  1OHH G;  1COW G;  1BE3 H;  5KLV H;  1Q8I A;  5IBK B;  5JWP A;  2UXD O;  2D2C B;  4TV9 B;  4JTD B;  1SKV A;  1RPR A;  1JVM A;  1IDS A;  1FS0 G;  1P22 A;  3QEI A;  5CA1 A;  3T4Z A;  1VF6 A;  1XVB E;  3B40 A;  1FS1 A;  2MZW B;  5HFL A;  4PDL A;  4DW1 A;  2ETN A;  1SZX A;  1NS1 A;  5KX5 B;  4KHN A;  2HJF C;  3ZHT A;  3SUN A;  2Z0A A;  4O2A B;  5JH7 A;  3W7X A;  3JD1 A;  4DV3 B;  3UO2 A;  1O9H A;  3RYI A;  3ZHS A;  3E89 A;  3C95 A;  1SQB H;  2B9Z A;  3SJB C;  3OFN G;  4DR4 O;  3KKY A;  3TGU H;  4DR7 B;  4KUM A;  3LSQ A;  2JDI G;  3L75 H;  4MT8 A;  4JYA B;  2DTU A;  3AG4 C;  3LNN A;  2YXL A;  3ETG A;  3K5O A;  3AG3 C;  3PN1 A;  4BIZ A;  3F5W C;  3J2P A;  4I4T A;  2KG7 B;  2PF4 E;  3CRQ A;  1VAR A;  5TIS Z;  2VJ4 A;  4Z1V A;  1YJ9 V;  3CCE V;  1OCR C;  1K5Q A;  1MMO G;  2P67 A;  3IAY A;  3WB2 A;  1YZB A;  1N34 O;  5B1O A;  2DQ3 A;  3B2E E;  1AR1 B;  3SPZ A;  1Q82 W;  2WLI B;  2ZKO A;  2ZE7 A;  1I5Y A;  2EIK B;  2QWQ B;  1XRE A;  4J41 A;  1SQF A;  4UB6 Z;  4I0X B;  4BR6 A;  2QEX V;  2YEV A;  3FAV A;  4JI8 B;  3SI6 A;  4DTU A;  4Q6G A;  3Q4H A;  2OT5 A;  1XMH E;  3B8M A;  1N0J A;  4CZZ A;  4JAU A;  5KHJ A;  4E2L A;  2F1M A;  4YIP A;  1MSD A;  3L70 H;  4ZHQ B;  4B3T B;  1S5H C;  2X6C A;  1M4U A;  1ZTE A;  3ABK C;  1EBO A;  1TA8 A;  1Y67 A;  2L35 A;  2W6J G;  1BSM A;  4PD4 F;  3A0B Z;  1GH6 A;  3ZN1 A;  4LF5 B;  1S3J A;  3NHG A;  1WP7 A;  4WF9 V;  1MG1 A;  1XQ8 A;  3ETQ A;  2E74 B;  4F6E A;  3JD4 A;  3EVK A;  3OT7 A;  3X2Q B;  1YHQ V;  3NDK A;  3CRM A;  4MVO A;  2QKS A;  4LC1 A;  3ZS8 C;  2F43 G;  3TET A;  4D7T A;  4FLY A;  4GX2 A;  5BMV B;  2XT9 A;  4NTW A;  4P30 A;  1H2K A;  4QJF B;  5KX5 A;  5B66 Z;  4FLU A;  3JAK A;  4PA3 A;  1EN6 A;  2CTW A;  2RJZ A;  5KHH A;  4YHH O;  1BHB A;  3N1B A;  3KD5 E;  4EYW A;  3S3X A;  2B5U A;  2W0F C;  4FMT A;  5K1P A;  2A3Q A;  5L3G A;  4CC5 A;  1FZI E;  5KHK A;  4BWA A;  4B3R B;  2FL4 A;  4H44 B;  1GMG A;  1VQL V;  4JI5 O;  2BOB C;  2A79 B;  1VEW A;  2E5L B;  4FM2 A;  2NLJ C;  2A06 H;  4CS2 A;  1BQ0 A;  2UUA O;  5BY1 A;  3BPZ A;  4J80 A;  4WFB V;  1Q5O A;  4B3S B;  3ABL B;  2QWP B;  4M3Z A;  4IHJ B;  4M41 A;  4AKG A;  1XHZ A;  4J2D A;  2P1Q B;  5B1B C;  4LF8 B;  1WN7 A;  3CCV V;  5CBH A;  1L1F A;  3STZ C;  2CTP A;  5H6Q A;  3AG1 B;  3ZMV A;  4ZIB A;  4DV5 B;  5LP6 B;  4DR2 B;  4I0X A;  3RW0 A;  2AZ0 A;  3WB1 A;  1RM1 B;  2A9H A;  1XMG E;  4X1I A;  1HDJ A;  2Q7H A;  3CJH B;  1H8H G;  2JEU A;  4AKI A;  3CCU V;  2PUS A;  3HKD A;  3E22 B;  1IXM A;  2AXT Z;  4JV5 O;  4FJK A;  4M3X A;  4X9Q A;  1JFF A;  1OCC C;  4KP4 A;  2ARH A;  3QEV A;  4HAM A;  2XHB A;  2YXY A;  1HNX O;  3SCX A;  4TQF A;  4RWU A;  4WFG A;  3SUP A;  3SPC A;  4FJJ A;  2IU3 A;  2X7R B;  3K5M A;  5LOV B;  3CC2 V;  3QNN A;  4JI7 O;  1QLE C;  3TK1 A;  1IUR A;  4DXW A;  1HNW B;  5B3S B;  2LW1 A;  4DV1 O;  3STL C;  2HP8 A;  1GTO A;  3T1Y B;  3OE7 G;  3K5L A;  1QQC A;  2JGU A;  1BMF G;  3KG2 A;  1J5E O;  3OTF A;  3T2M A;  1FYZ E;  1BQZ A;  2FW3 A;  2QTS A;  5LA6 A;  3SUQ A;  3N2G A;  4JYB A;  1GM9 A;  4LP8 A;  1KB9 F;  3ZIA G;  3ZJZ A;  4D6T H;  1M5I A;  1BHA A;  1E79 G;  4UV9 A;  2QKA A;  4NXN B;  4O4J A;  1NH2 B;  3SQ4 A;  4MTF A;  3VQX A;  3LDE A;  2VQE B;  3M99 B;  3OMI B;  4FJC C;  1AR5 A;  4NR1 A;  1LUW A;  5H9C A;  3RBZ A;  4TSF G;  1FXX A;  5LYJ B;  4I6J B;  1W2B U;  1XI1 A;  4JGS A;  1XMQ B;  4MTG A;  5EBW C;  3G67 A;  2VQF O;  1HR0 O;  4LH7 A;  2DMX A;  4PJ0 Z;  3WG7 B;  3DXR B;  2QGN A;  1R3K C;  3QNO A;  4GZR B;  4L87 A;  3I5D A;  4YY3 B;  4QPJ A;  4X62 O;  5FLX N;  2EIJ C;  2HR3 A;  1XMO O;  2EZP A;  3N27 A;  3R65 A;  4DV6 B;  3G80 A;  4DTM A;  4IHJ A;  1XU3 E;  1H2M A;  3GVM A;  4J42 A;  3AG2 C;  3L8B A;  2DYR B;  2NR5 A;  3HKE A;  1VF5 B;  1DK1 A;  2UUB O;  2ZIO A;  3LDC A;  5LP6 A;  1MSW D;  3UCS C;  3H1J H;  4DTP A;  1K5S A;  4FJI A;  4MVR A;  4EFB A;  4I50 B;  1I94 O;  3CXH F;  2P06 A;  2Q9L A;  3RYH B;  1JW2 A;  1VP7 A;  1P49 A;  3PJS K;  4IIJ B;  2P1M B;  1EZV H;  3BFR A;  4DRX B;  2W0X A;  4MS2 A;  4BW9 A;  3RN4 A;  4ZOL A;  3J27 A;  2JJ2 G;  4YJ3 B;  3JAT A;  4LR3 A;  5FPO A;  4UXN A;  3OGC C;  5LOV A;  2WLM A;  1AI4 A;  2GTS A;  1S5J A;  4LWS B;  5H37 A;  5EBM C;  3K0G A;  5D5Q A;  2UUC O;  4RAI A;  3M8A A;  4FJG A;  1JPX A;  3TCU A;  1M9N A;  1GKF A;  4GKK O;  3APO A;  1WAJ A;  2MW2 A;  2VWK A;  4I55 A;  2YSU B;  5IWA O;  2LGQ A;  5JQG A;  5BZB A;  4F6R B;  3K3W A;  2OVR B;  3LSS A;  5DM6 V;  3DSQ A;  2IJH A;  4YIO A;  4M3Y A;  4LCU C;  1Q86 W;  1QR8 A;  1N32 O;  4KHP B;  2N05 A;  3O9O A;  3HP9 A;  2AGA A;  4MVM A;  3QO7 A;  2OCH A;  4K0K B;  2RKH A;  1QR9 A;  2RN9 A;  4DV4 O;  2PI4 A;  3ML0 A;  5A2Q N;  1FFX B;  1F4M A;  4ICG C;  4X65 O;  4FK0 A;  1IBK O;  1TUB A;  5CBG A;  1KP3 A;  3DXR A;  4J2B A;  4LFA B;  1IX9 A;  2OTJ V;  4O4I B;  4B3M O;  3G6E V;  3W7W A;  4JI4 O;  1ZLZ A;  2B8I A;  4FJX A;  4HNA A;  3I55 V;  1M56 B;  2UXC B;  1FXK B;  1XNQ O;  4EP9 A;  1XMF E;  2A0L A;  4QGP A;  5KA5 A;  3SR2 C;  3QO5 A;  4DUZ O;  4QNC A;  2ZXW B;  1YTF D;  1RP3 B;  1GO3 F;  1K34 A;  3ASO B;  1Y74 A;  3OUS A;  1VIB A;  3CFR A;  1FJG O;  3SVI A;  5E79 Z;  2OCC C;  2EX3 A;  2GBO A;  1YSC A;  2FML A;  3CC7 V;  3ZN0 A;  2H4T A;  4JI2 O;  3KCX A;  4JAA A;  2NNU A;  2B1E A;  1MOF A;  4KXR A;  3CRA A;  3RYF B;  3LZJ A;  2C2A A;  1PNL A;  3P32 A;  2HHH O;  2QWN B;  4CS3 A;  2P7T C;  1IBL B;  3R66 A;  1Q81 W;  3ASN C;  3LUT B;  4LF9 O;  1EFR G;  4ICG A;  1FPO A;  5JVD B;  3L73 H;  4DUY O;  1KKC A;  5LHI A;  1X59 A;  1LDK E;  1VQK V;  5GON B;  2VRZ A;  4DR6 O;  3E35 A;  3SYP A;  4KHY A;  1XVC E;  1UJW B;  1MHZ G;  4LF6 B;  4UCU A;  3I56 V;  1AVM A;  3NXS A;  1VQN V;  4O2B B;  2DWD C;  1K4D C;  4FJL A;  1GK9 A;  2XOK G;  5H6R A;  3ZHV A;  3WSO A;  4UCS A;  3TXQ A;  2IU0 A;  5D5P A;  4O4L A;  3H01 A;  5AG2 A;  4JI3 B;  1AP5 A;  1RSO A;  4B08 A;  3OMA B;  3L74 H;  2YIB D;  2WWW A;  4CH6 A;  5J9P C;  1YJW V;  1MAB G;  4LFC O;  2AZ2 A;  3CE2 A;  2P90 A;  3FD9 A;  3ZX6 A;  1XDC A;  4NB5 A;  2CTQ A;  2CDY A;  4WFH A;  1YDX A;  1NVP B;  4R7C A;  1SQG A;  4GX1 A;  1MZE A;  4JTC B;  2FKX A;  2WLL B;  2JJ1 G;  2F4V O;  4XDK A;  3L71 H;  5IY5 B;  4H37 A;  1R6K A;  3S9H A;  3MHS C;  2M7W A;  1LR1 A;  3JD3 A;  3SPG A;  2QKC A;  3F5T A;  1KU9 A;  1LUV A;  1VF7 A;  4JI5 B;  3H1H H;  1BS3 A;  3FB7 C;  3E8B A;  3QVN A;  1AI5 A;  4JTA B;  5KHG A;  4BAY A;  2B1G A;  4DYL A;  3JAR B;  4DV0 B;  3SPH A;  2UUA B;  4LBE C;  1G1X B;  4ASU G;  2YB5 A;  4TUY A;  2ZM6 O;  4TWK A;  1R73 A;  3ZRW B;  3KZI Z;  4UFZ A;  4KHS A;  3BY6 A;  3MDS A;  2YI9 A;  4IYH A;  4QNH B;  2LF3 A;  1OCO B;  4FK5 C;  4I9W A;  4DV7 B;  4U7N A;  4FM0 A;  1L0N H;  5L3B A;  4PA7 A;  3W7S A;  2B1I A;  4CH5 A;  1X4T A;  3ZRX A;  3HKC A;  2PYL A;  2QM7 A;  3SYQ A;  4E4E A;  4NXM O;  1IG9 A;  4DR5 O;  1VQ6 V;  4JI0 O;  4GYC B;  2VWJ A;  3B4S A;  3T1C A;  1SQX H;  3SJQ C;  1R3J C;  5LHG A;  4GKJ O;  1ZWI C;  3ZMT A;  2R9R B;  3UM7 A;  1HNX B;  1QVG U;  4CH4 A;  1IVS A;  5GON A;  3G71 V;  2CH7 B;  1AR4 A;  3IC7 A;  2ATQ A;  3RYC A;  4FLZ A;  1TAE A;  2V7Q G;  2ZE8 A;  1JR9 A;  1ZL8 B;  4DV1 B;  4PI2 A;  4X89 A;  3OUF A;  2EIM B;  1VQP V;  2GUZ A;  3RVZ A;  3E8F A;  1M57 B;  4B7E A;  4AQY O;  3HB3 B;  4FFK A;  3MKS B;  2OVP B;  1UFI A;  3CSX A;  3CCL V;  3GB7 C;  2BSK A;  5B1N A;  1A32 A;  3CXC U;  4TV8 A;  3RMC A;  2IJI A;  1JMK C;  4N21 A;  2G38 A;  1D5N A;  2BTO A;  3FB8 C;  5LXT B;  4FK2 A;  4LF7 B;  3MD0 A;  2GDS A;  3CRC A;  1P7G A;  1H2L A;  2ZR3 A;  1URF A;  4MW3 A;  4TV9 A;  2EIN B;  2K5S A;  1BCC H;  4DK0 A;  5C93 A;  1R3L C;  4J7Z A;  3E2E A;  2WLL A;  1M90 W;  3D36 A;  4DW0 A;  2BCC H;  2QTO A;  2B7M A;  4J7K A;  4RQE A;  4X64 O;  1DGS A;  3CCR V;  3ABM B;  1NH2 D;  2XTA A;  3FFQ A;  5IJ9 B;  3JD0 A;  1NT2 B;  4FJN A;  2M6Y A;  2JS3 A;  1GN3 A;  4PDR A;  4O2A A;  4K8X A;  2WSS G;  1R3I C;  2Q69 A;  2V4D A;  4OPH A;  5J2T B;  3HL8 A;  1RPO A;  1XMO B;  3ZHR A;  5LGN A;  2HG5 C;  1KD1 W;  5E1A C;  2HJD A;  4N23 A;  4FZ0 A;  1ZX3 A;  3JAM N;  5BR8 O;  1QHT A;  1TUE B;  3U10 A;  4FLW A;  3O65 A;  3L1N A;  2H8P C;  3ICX A;  3TL8 B;  4EEQ A;  1OCZ B;  3TAF A;  2ZR2 A;  1ZUQ A;  1Q6I A;  2KQX A;  2YDE A;  2KG7 A;  1FKA O;  4KHU A;  2ZIM A;  4G2K A;  3BA8 A;  1B06 A;  2GSM B;  1Q3E A;  4HCB A;  3P3P A;  3IJ4 A;  3UO3 A;  3X2Q C;  4LNU B;  3CQ8 A;  2CK3 G;  1Y6X A;  3VQW A;  2HKO A;  5C8Y B;  2LW7 A;  2WLI A;  3K03 A;  1PL4 A;  1SA0 B;  4W4L A;  1DTO A;  3NCI A;  2FYU H;  4DV3 O;  2WLN A;  4WFA V;  3SQ2 A;  5FNV B;  1WA8 B;  2IBZ H;  1R6N A;  5ITZ B;  4JI1 B;  4DTR A;  3EFF K;  1XL4 A;  4DR7 O;  5IJ0 B;  4FJH A;  2Q0O C;  1S5L Z;  2Y0I A;  2ITD C;  3DC6 A;  3UKM A;  4JYA O;  1F7Y A;  3ETE A;  4AI8 A;  5GTI Z;  2MMB A;  2OVQ B;  2IJK A;  4GKK B;  1HP8 A;  1FXV A;  1JOY A;  1P84 F;  4ZHQ A;  2Q5Z A;  5IWA B;  2IH1 C;  1GM7 A;  2RCU A;  4QE7 A;  3C94 A;  2PZS A;  3CFP A;  4P2Z A;  2R72 A;  3CFO A;  5LXT A;  2EIL B;  2QWR B;  1CPY A;  4RG8 A;  1Q9Y A;  5EZY B;  1GN6 A;  4FIP C;  5B1A B;  4KI6 A;  5L3D A;  3ZED A;  1I5X A;  2DN9 A;  1AIL A;  3DC5 A;  3ABL C;  5CA0 B;  5CB4 B;  4ADN A;  4DV4 B;  1CLQ A;  3TAE A;  3HGL A;  1OV9 A;  1KUQ A;  4X65 B;  5BMV A;  2ZE5 A;  2ADP A;  3LZI A;  3A8T A;  1BGY H;  2Y69 B;  2XAS A;  4U3J B;  4B3M B;  1AB3 A;  3AG1 C;  1AJQ A;  5LP6 C;  3E4Y A;  4I7Z B;  1OJH A;  2WLJ A;  1RM1 C;  5J2T A;  5DN6 G;  4B3T O;  4W4K A;  2ZT9 B;  2R9A A;  2UU9 O;  4I9Q A;  1N4C A;  1WPX A;  1MMM A;  2QDO A;  5LGU A;  1NEX B;  4G28 B;  3BRC A;  3OD4 A;  1IBM B;  1HNZ O;  2WLH A;  1SZT A;  4X20 B;  1K9M W;  3K06 A;  4CBC A;  2IW5 A;  4LF5 O;  1MA1 A;  3ZCC A;  3RFR A;  1K8A W;  2EZO A;  3IC9 A;  1Q9X A;  3JAL B;  4Q20 A;  4NTX A;  2XAF A;  5J2U B;  1ORQ C;  1MNG A;  5HFM A;  4DR1 O;  2NN4 A;  5KA6 A;  2LJ2 A;  1SER A;  5B3S C;  3UT5 B;  3NR7 A;  4WFE A;  2FB5 A;  2HHH B;  1N33 B;  1XVE E;  2X6B A;  4UCT A;  3W7U A;  1FZ6 E;  1Z2G A;  3DTU B;  5C8Y A;  2CGN A;  3AK1 A;  3A0H Z;  3ZHU A;  1SA0 A;  1PNM A;  4BIO A;  3UIQ A;  1XL6 A;  4DUY B;  1U96 A;  3OTO B;  3FKS G;  2UXB B;  1EM1 A;  1WA8 A;  5JCO A;  2QXF A;  4MVU A;  4LF4 B;  4KHQ A;  1XL3 C;  4H0L B;  1XVD E;  2P22 C;  2OWO A;  4FPP A;  4MVS A;  2DW4 A;  1K92 A;  1QNM A;  3CJH A;  3QES A;  4H13 B;  1FAF A;  4UCO A;  4B3R O;  1K3E A;  3E22 A;  1UPG A;  4X66 B;  4QE9 A;  3K58 A;  3CMA V;  4PEL A;  1VQ7 V;  4UVB A;  3F7Y C;  3OGL B;  3AK2 A;  3C6N B;  3WG7 C;  1CP9 A;  3D3I A;  3OAA G;  3NE6 A;  3WFV A;  4OX9 B;  2JK5 C;  4LH6 A;  2YIA A;  2OZM A;  1HW7 A;  5KMG B;  4GUN A;  1JJ2 U;  3BA9 A;  3JAW B;  5EZY A;  4Z1M G;  1GN2 A;  1US6 A;  1DF4 A;  2QE7 G;  2UXD B;  4U7O A;  3N2K B;  4GX0 A;  3T1H O;  1V54 B;  2H94 A;  4M3U A;  3FYE B;  2JGD B;  4GAM C;  2HEP A;  1WP8 A;  3JAS B;  3SNN A;  1IXB A;  2JEX A;  2Q68 A;  1F4N A;  4DR2 O;  5K1X A;  4JZG A;  4BW5 A;  3K04 A;  2DYR C;  4L8J A;  2HD0 A;  2JHA A;  3TJY A;  3M7M X;  4HBN A;  1V55 B;  1W0J G;  2YIC A;  5IYZ B;  4U3J A;  1JCH A;  1VQO V;  1LNQ A;  5IYB O;  3P3N A;  1H2G A;  2P1N B;  4UUJ C;  5GW7 A;  3N1E A;  3RMD A;  1Y76 B;  3OGK B;  1NBM G;  1FZ8 E;  2GHY A;  4DR4 B;  1KYO F;  3JYC A;  1KKD A;  5LYJ A;  3K0D A;  1F23 A;  2DYS B;  4ZI7 B;  1B6Q A;  1H2N A;  2F93 B;  1PV0 A;  3RMA A;  5LBQ A;  3SQ0 A;  2XND G;  1N1C A;  1HNW O;  2PY5 A;  2P4V A;  2ADQ B;  2K1E A;  3P30 A;  1MTY G;  5LGT A;  3T1Y O;  1HWY A;  1Q6U A;  1I0H A;  3OEH G;  3SYC A;  1H38 A;  2BE3 A;  5CA1 B;  1CXZ B;  3QTC A;  3SDL A;  2P1O B;  1N36 O;  1YIT V;  4FVM A;  4AIL C;  1VQ5 V;  1N34 B;  4J7J A;  5CBF A;  3CCM V;  2CE4 A;  2BTQ B;  4DR5 B;  2YXH A;  1NTM H;  5JH7 B;  2PFV A;  3C3T A;  3JD2 A;  1XVF E;  4DV2 O;  3SQ1 A;  2ILM A;  4JYC A;  2DY4 A;  4DTX A;  1PL0 A;  1XEQ A;  5EIB C;  1SQV H;  4I50 A;  3VOU A;  3RYH A;  3OEE G;  3D3Q A;  3C6O B;  5EBL C;  1XOU A;  4PI0 A;  3THO A;  4IIJ A;  4AQY B;  1H8E G;  4I4T B;  2AW9 A;  5JJJ B;  2YID A;  1SF9 A;  4DRX A;  4YJ3 A;  4R50 A;  3LSU A;  2DOS A;  3G6B A;  1FZ5 E;  2ZNJ A;  1M56 C;  1Y66 A;  5FL7 G;  4A5U B;  1SRY A;  3TXS A;  4LWS A;  2JHC A;  2P5O A;  3ETD A;  3SPY A;  3N2K A;  2JGD A;  1YIJ V;  4G27 B;  4CS4 A;  4KI4 A;  3JAS A;  1GRJ A;  1JQ0 A;  2Q8V A;  2ZXW C;  4X1Y B;  2YEV B;  4JRP A;  4JZ2 A;  4DO2 A;  2EUL A;  3BAB A;  3J7A U;  4X64 B;  2QSA A;  1KC8 W;  3ASO C;  4F6R A;  3Q4H B;  1WPB A;  4IT5 A;  2DJV A;  1VMG A;  2E76 B;  3QNE A;  1O9G A;  2H3O A;  3ZHQ A;  4FLX A;  4UV8 A;  2P5G A;  2OZS A;  4JF3 A;  5GTH Z;  1K97 A;  2EBO A;  4YHH B;  1XHX A;  3AG4 B;  3CCQ V;  2Q6A A;  5KUM A;  3ZMS A;  2K9P A;  2EJR A;  3HPL C;  2QWO B;  3AG3 B;  3QER A;  4ZI7 A;  1FFX A;  1QBZ A;  5BR8 B;  4OXS A;  4Z2W A;  3K57 A;  5L3C A;  2ZCE A;  4LFB O;  1SQP H;  3VBB A;  4O4I A;  1OCR B;  3AEI A;  3QG5 A;  1T5E A;  4J2E A;  4FFB B;  4J10 A;  5IDJ A;  3GWK C;  2JH8 A;  4BIU A;  3TJT A;  1FXK A;  4FLT A;  4AKH A;  2YS8 A;  4MW8 A;  1JX9 A;  5LHH A;  1MZF A;  4RUE A;  2IM9 A;  3FB6 C;  3CHX A;  1PPJ H;  3UQ8 A;  4HZ3 A;  1THZ A;  1E1Q G;  2BTQ A;  3KD1 E;  1NI8 A;  5JJE B;  1OZ0 A;  1Y4M A;  4PA4 A;  3JAK B;  3K59 A;  2Q7E A;  4KHP O;  1XNR O;  3L72 H;  4KFM A;  1H2S B;  1FFT B;  2DWE C;  4M3W A;  4JI6 O;  5CA3 A;  5EC2 C;  2DE0 X;  4FLV A;  4K0K O;  2VS0 A;  2JH9 A;  2JVD A;  5EC1 C;  5LMU O;  3ABK B;  4XBF A;  3CCS V;  2KB1 A;  3RYF A;  3B77 A;  4LFA O;  3D36 C;  3J81 N;  4JRQ A;  2GTA A;  4JV5 B;  3IGA C;  4FJ5 A;  1YTF B;  4NYK A;  5IY5 C;  2KSD A;  5JVD A;  2QM8 A;  2UXC O;  4IGG A;  2Y0P A;  2WAM A;  4GT1 A;  3SJA C;  3A0R A;  4P9P A;  2PI5 A;  1AI7 A;  1XVG E;  1NU1 H;  3CYO A;  4WCE V;  4ADO A;  1PP9 H;  4JI7 B;  2PYJ A;  3CD6 V;  1VQ9 V;  3FYI B;  3VQY A;  3SJJ A;  4O2B A;  1AJN A;  3TAB A;  3DGE A;  1EZJ A;  1EN5 A;  1L8D A;  3E4W A;  1J5E B;  4PA6 A;  4X1Y A;  2JS5 A;  3CS5 A;  3LDS A;  2RNB A;  4E4B A;  4X1I B;  2FYO A;  4J2A A;  1OCO C;  4GCZ A;  2BOC C;  1ARO P;  2ODM A;  2P4K A;  3HKD B;  4M45 A;  1IBL O;  5H2F Z;  5EYP B;  1JA8 A;  3H1K H;  2OIG A;  1ROP A;  4DR3 O;  3E8G A;  5JJN B;  1AP6 A;  1JFF B;  2LP7 A;  3CCJ V;  2UU9 B;  3EHB B;  1D2D A;  2QM4 A;  3QEW A;  2E31 A;  4PV1 B;  2P1P B;  3CEI A;  2E75 B;  3VQV A;  3ZMZ A;  1HNZ B;  4K35 A;  5LMN O;  3RT3 C;  3NGI A;  2CAZ C;  2EIK C;  1BT8 A;  5KAF Z;  4OGQ B;  2VQF B;  4RNG A;  1HR0 B;  4HCC A;  4KL1 A;  4QIW F;  4LF6 O;  4MSW C;  1L0L H;  4PDM A;  2EJ7 A;  2R70 A;  3ABT A;  4FFB A;  4H33 A;  1YVW A;  3GWO A;  1FZ2 E;  3RWR D;  3HGK E;  4XDL A;  2Q7G A;  3QEP A;  4X62 B;  4DR1 B;  5B1B B;  3JAR A;  2ATK C;  3QET A;  1KEC A;  4O4H B;  4JI3 O;  2JPN A;  3S3W A;  3MHH C;  1BZK A;  5IT9 N;  5LA6 B;  3N2G B;  4UCV A;  2EIM C;  5IZ7 A;  1WB7 A;  1V9P A;  4X5M A;  1M57 C;  3SUO A;  4GX5 A;  3ZRW A;  2XAH A;  4X88 A;  1Z5W A;  4O4J B;  3ZMU A;  4EPH A;  1R6T A;  4GLX A;  4J9Y B;  4DU3 A;  2UUB B;  4R8C A;  3SPJ A;  2P6J A;  3K79 A;  5B5E Z;  3H1I H;  3BAA A;  4PDV A;  4JAS A;  1OCC B;  3E83 A;  2YC0 A;  3K9A A;  3JCU Z;  5CN0 A;  1PM9 A;  1YCI A;  2EIN C;  3NAE A;  4QPK A;  1I94 B;  2UXX A;  1WAF A;  3WU2 Z;  3MAQ A;  2ZD9 A;  2PGG A;  2JHP A;  3CWB H;  5IRE A;  1FD9 A;  3ABM C;  3B09 A;  1QLE B;  4AI6 A;  3HR0 A;  4XDJ A;  3U11 A;  3JCZ A;  3OGI B;  3FB5 C;  4YJ2 B;  4DV0 O;  2F23 A;  1GN4 A;  1FZ4 E;  4JS5 A;  2CH7 A;  4X1K B;  2QJ1 A;  4TOI A;  2OIE A;  2Y48 A;  2D3O W;  1VQM V;  1WLE A;  1ZL8 A;  5BXZ A;  3CP1 A;  4NTY A;  4FJ8 A;  2RMK B;  2UUC B;  1N0N A;  2WLK A;  1B3Q A;  3E8H A;  2XUM A;  3T1H B;  3HKE B;  3K2O A;  3CX5 F;  2Y4U A;  4DV7 O;  4F4L A;  4MTO A;  1K7D A;  1NTZ H;  1G6U A;  3OR6 C;  1G4Y B;  3V7D B;  3IFX A;  3ZRV A;  1OCZ C;  1WB8 A;  2Q0A A;  3BCC H;  2HVK C;  2CUG A;  1XUQ A;  5EYP A;  1BL8 A;  1N32 B;  1FZ9 E;  2WA3 A;  1IH7 A;  1SQQ H;  2V1D A;  4RUF A;  1WNS A;  1B04 A;  2UXN A;  1N8R W;  4ZOL B;  1S76 D;  4J9Z B;  3JAT B;  4JPR A;  1P4R A;  5LL6 Y;  4EB6 B;  4JI8 O;  1FXH A;  1IBK B;  4K8Z A;  1SC5 B;  2EIJ B;  5IJ9 A;  5EIB D;  2YIB A;  2JQT A;  3TAG A;  4WBN B;  2CTR A;  5IYC O;  1DF5 A;  2E32 A;  2YUA A;  5JCO C;  3HKB B;  4FZ1 A;  4JI4 B;  3U0Z A;  1WJZ A;  2Q4P A;  5DED A;  4AHC A;  4DTJ A;  3OMN B;  2MW2 B;  4X5N A;  5L3E A;  4I55 B;  5JQG B;  4PHZ A;  4DTN A;  3AG2 B;  2Q67 A;  1FZ3 E;  1N36 B;  1XNQ B;  4O4H A;  4J11 A;  1K73 W;  4I5S A;  4DUZ B;  4LF7 O;  3LDD A;  1ZSP A;  1FYJ A;  3OGM B;  1PNK A;  4FJ9 A;  1NJI W;  3WB0 A;  1FJG B;  3SYA A;  2JRI A;  2VIX A;  3FX7 A;  4RO2 A;  4DV2 B;  4M3R A;  1NTK H;  4DU1 A;  4ZBM A;  1QVF U;  2EIL C;  2A7W A;  4JI2 B;  2HVJ C;  1YI2 V;  2Q73 A;  4ABM A;  5B1A C;  1TUB B;  3K9S A;  3RMB A;  4I9L A;  2X0L A;  3OR7 C;  4CC6 A;  4LNU A;  1VQ8 V;  4EFE A;  4JS4 A;  4HNA B;  4LF9 B;  1M1K W;  2Z5U A;  4YJ2 A;  5FNV A;  2Y69 C;  1U97 A;  3T4D A;  4X1K A;  5ITZ A;  1PKX A;  1CEZ A;  4DR6 B;  1ENV A;  1PD3 A;  3BHP A;  1M93 A;  5IJ0 A;  1S0V A;  1FZ0 E;  2ITC C;  5KAI Z;  3RGB A;  2X6A A;  2Y4T A;  1Y74 B;  2OTL V;  5FPR A;  4EKW A;  5EK0 A;  3L9D A;  2LFR A;  1NR7 A;  1SS3 A;  1P7B A;  1NR1 A;  1TGO A;  3CPW U;  2E5L O;  1YXB A;  3LNM B;  4ZKI A;  3ABU A;  4RL5 A;  3A2F A;  2FTK A;  4UCR A;  4B3S O;  3ZBH A;  4FJ7 A;  3QF7 A;  4MTX A;  4LFC B;  3L0M A;  3OM3 B;  4OPA A;  1TVK B;  1S72 V;  3AK3 A;  2XAQ A;  4LF8 O;  4DTS A;  2E3C A;  2AHY A;  5CA0 A;  5CB4 A;  5IYD O;  1F51 A;  2MK3 A;  4DV5 O;  1R1B A;  2F4V B;  1K33 A;  4TT3 G;  2QR4 A;  4EB6 A;  4JI1 O;  2HFE C;  1G8M A;  1KMI Z;  1NQT A;  4X8A A;  1NVP D;  2ZIN A;  1I08 A;  1DLB A;  4LFB B;  4NKG B;  4WFF A;  1EN4 A;  1NZ6 A;  4WBN A;  3HKB A;  3C90 A;  1WAZ A;  3SJC C;  3KCY A;  1ZAU A;  1YF2 A;  1VQ4 V;  5F2V O;  1SES A;  3SPI A;  4IL6 Z;  2N74 A;  4PA9 A;  3G4S V;  5H5N A;  4O4L B;  4MVZ A;  1QU7 A;  3EXA A;  1RSO B;  5CMU A;  2KKW A;  1W59 A;  1K4C C;  4TQD A;  3ZRS A;  2ZE6 A;  1YEW A;  4DTO A;  2ZM6 B;  4X20 A;  2OCC B;  3C3S A;  1Q43 A;  3JSL A;  2DQ0 A;  3AG7 A;  3F7V C;  1XNR B;  2PTM A;  2RDC A;  2OYQ A;  2O57 A;  4JI6 B;  2L6L A;  1I7F A;  4IYI A;  4MVQ A;  1KQS U;  4CH3 A;  3JAL A;  3RVY A;  4B7K A;  5J2U A;  1W0K G;  2GV9 A;  1XU5 E;  1FZ1 E;  5KHI A;  3ASN B;  5LMU B;  1J95 A;  2LQT A;  5A9G A;  3UT5 A;  1V54 C;  2RQ6 A;  3K5N A;  1MHY G;  3B8N A;  4K3A A;  3CRR A;  4NXM B;  1Q6H A;  3CC4 V;  3BVO A;  4M42 A;  4JI0 B;  1RFY A;  4NXN O;  3QEX A;  4UB8 Z;  2ZDI C;  2RCV A;  2ZNI A;  4GKJ B;  2DEB A;  2WA4 A;  2R9I A;  2Z3Y A;  1AI6 A;  3RYI B;  2VQE O;  1KP2 A;  1V55 C;  2QA4 V;  4D7S A;  2HLD G;  1Q7Y W;  3L2O B;  3CME V;  1KBH A;  2AHZ A;  3LDB A;  3APQ A;  4UVC A;  4M3T A;  1Z5V A;  1IBM O;  1XMQ O;  4TUY B;  4QND A;  3LD8 A;  2XAG A;  1SET A;  3E86 A;  1S77 D;  2WPD G;  3JSN A;  2IJJ A; 
#chains in the Genus database with same CATH homology
 2CTW A;  1WJZ A;  2DN9 A;  2GUZ B;  2L6L A;  2QWQ B;  1FPO A;  2CTP A;  2GUZ A;  2Y4U A;  3APO A;  3UO2 A;  2KQX A;  2OCH A;  4J7Z A;  2LO1 A;  2PF4 E;  2RKH A;  1N4C A;  4RWU A;  2YS8 A;  1BQZ A;  3UCS C;  2YUA A;  2QWO B;  1BQ0 A;  3APQ A;  2QSA A;  2LGW A;  1XBL A;  4J80 A;  1HDJ A;  4IT5 A;  3UO3 A;  1GH6 A;  2QWP B;  2N04 A;  2DMX A;  2QWN B;  2QWR B;  1FAF A;  2CUG A;  1IUR A;  1N1C A;  1NZ6 A;  2CTR A;  2CTQ A;  2Y4T A;  3AG7 A;  3BVO A;  2EJ7 A;  2N05 A;  2M6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...