3BVOA

Crystal structure of human co-chaperone protein hscb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
197
Chain Sequence
PRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human J-type co-chaperone HscB reveals a tetracysteine metal-binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Co-chaperone protein HscB, mitochondrial precursor
total genus 66
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
A PF18256 HscB_4_cys Co-chaperone HscB tetracysteine metal binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3bvoA01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3bvoA02
1FPOA 1FAFA 2LGWA 2M6YA 1IURA 1HDJA 2CUGA 4RWUA 2QWPB 2RKHA 3UCSC 2DMXA 2QWQB 1NZ6A 2EJ7A 1BQZA 1N4CA 1BQ0A 1N1CA 2LO1A 3APQA 2CTQA 2CTPA 2Y4TA 3AG7A 4J7ZA 3APOA 2GUZB 2QWOB 2CTWA 1XBLA 2YUAA 3UO3A 2CTRA 2QWNB 4IT5A 3UO2A 2QSAA 1GH6A 2DN9A 2N05A 2YS8A 2GUZA 2N04A 2OCHA 1WJZA 2Y4UA 3BVOA 2PF4E 2QWRB 4J80A 2L6LA 2KQXA
chains in the Genus database with same CATH superfamily
3QESA 3MD0A 1XL3C 2XT9A 2OCCB 4ADOA 5CMUA 4NXNO 3OEEG 3THOA 1WN7A 2JIZG 1LUWA 4AILC 1ZL8B 2EIJB 5IYBO 1XOUA 1SERA 2V1DA 2WLKA 2ZE7A 2ZR3A 1P49A 3MAQA 4FM2A 4D7SA 4D7TA 3SYCA 4X89A 4AKHA 3O9OA 4O4HA 3OE7G 3NGIA 2YC0A 4U7OA 4X5MA 4X1YA 3B77A 4I9QA 1BZKA 3SJBC 4CH3A 1JFFA 3PN1A 1RPOA 2VIXA 3RMBA 3K2OA 5BR8B 1SKVA 4JYCA 3JD4A 3X2QC 1ZSPA 5L3DA 2QXFA 1QHTA 5LGUA 4PD4F 3WSOA 1VF7A 5IZ7A 2WAMA 1N8RW 4TV8B 4MTFA 4DR1O 1WAJA 1O9HA 2UXBB 2B1IA 4JI2O 2OZMA 3HR0A 1N36B 3RYFA 4DR2O 4DTJA 4ASUG 3EXAA 3FYEB 5EYPB 1YTFB 2AZ2A 4RWUA 1XMHE 3ETGA 4I55B 1RSOB 3L75H 2Y48A 1R73A 4J10A 1XHZA 1QBZA 3SUQA 3APOA 3AK3A 3STLC 1FS1A 1Q90D 2CTWA 3HKDB 2CTRA 1HNXO 1EBOA 4R7CA 4X66O 3VQWA 4P9OA 2PF4E 4IT5A 2RMKB 3CCEV 5LXTA 1GM8A 5LMUB 2JRIA 4TV9A 2R70A 1N0JA 1Z5WA 4XDJA 4GKKB 1GN6A 5DEDA 1SETA 3QERA 4JI3B 4DTRA 3RYCB 4B7EA 4JYYA 4DRXA 1YEWA 3WB1A 1NR1A 3G67A 1AB3A 3KZIZ 4EB6A 3CRMA 3TAEA 1AR1B 4DV0O 3B4SA 4JASA 1FS0G 2VQEB 2QJ1A 1G6UA 2LJ2A 3NAEA 2AXTZ 1ZUQA 4HCCA 5IYZB 4UCOA 3L9DA 1ROPA 5JCOC 3QO5A 1HNWO 2IU0A 2YICA 4LF4B 4GKKO 4X1YB 1Y76A 3CXHF 2ZNJA 4GKJO 4JI3O 3OGIB 3CYOA 3OW2U 2E5LO 3V7DB 1YI2V 3E83A 4LFBB 3A0BZ 5LHGA 5IJ0B 3C6NB 4J7ZA 2K9PA 4IL6Z 3K59A 5JWPA 2JGDB 4DV0B 5EYPA 1NEXB 2W0FC 5C8YA 1KP2A 4NB5A 3H1KH 3E8HA 2Q5ZA 4KUMA 2ADPA 1AILA 5FPRA 1VQLV 1YVWA 4DR1B 2JGDA 1AJPA 3FKSG 5K1XA 1JW2A 1M90W 1MMOG 3WU2Z 5B1BB 1OCZC 4XDLA 5CA1B 2ZXWC 5A2QN 4AI6A 3E2EA 2LFSA 3OR6C 3LSUA 4J2BA 1WB8A 3RVZA 3JAKB 2EZOA 2OVPB 4WF9V 1XVDE 1E79G 4X62B 5A9GA 5LA6A 2XASA 3HGKE 2OYQA 2CK3G 3DC6A 2GHYA 1QLEB 2Q0OC 2JJ1G 1NTKH 3EVKA 2KKWA 4X1KB 2FL4A 1I5XA 4F6RA 1U97A 1PM9A 2DTUA 1YF2A 1ZL8A 3OFNG 2QR4A 3NE6A 2JJ2G 1R6KA 3ASOB 4TV8A 4ZI7B 3ZJZA 2CH7A 2EILB 5KUMA 5GW7A 4C7UA 4X88A 4QNHB 4X9QA 5ITZA 2NLJC 2P1OB 1MHYG 2CTPA 3C94A 1IBKO 3CP1A 5JVDA 2P6JA 4W4LA 3RN4A 3SPCA 1N0NA 4BW9A 4MS2A 3VOUA 1F7YA 2P1PB 4K8ZA 4UCSA 1NVPD 4IIJB 4IIJA 5IE9A 4U7NA 3SR2C 2O57A 5L3EA 4MSWC 4B3RO 4IGGA 1K92A 1NVPB 1FZ1E 4YJ2B 4JTAB 3JD0A 2F43G 1KQSU 1IBLB 4JZGA 2UXCB 3ZMSA 3D3QA 2OZSA 3G71V 1OCRC 2YB5A 5IY5B 2OTLV 3SQ0A 1DGSA 1HWYA 3BHPA 2IJJA 2VWJA 5IY5C 3ZMVA 4Z1VA 4JS5A 1VMGA 1F4NA 3SYOA 3W7UA 2DMXA 3P30A 3Q4HB 4LBEC 2X6BA 1AP6A 2WLIB 4PA3A 2YXLA 3E8FA 3C3SA 5B1AB 1XNRB 4GT1A 3RWRD 3ABMC 1LR1A 4X1KA 2ZIMA 4YJ3A 4RUEA 1AJQA 3DXRB 4KHWA 2V7QG 4YY3B 1YJWV 4JV5O 3P3NA 2AHYA 2H3OA 4YIOA 5LA6B 4UCTA 3ZHRA 2KG7B 1MHZG 5F2VO 5LHIA 3CE2A 2OCCC 4O2BB 2UXNA 4DRXB 3ZHVA 1S76D 2ZDIA 2RJZA 3AG1B 4JTCB 2XAQA 2JPNA 1Y66A 2EULA 1XBLA 2MK3A 2Q68A 4RAIA 3T2MA 3RGBA 3UO2A 2G38A 5BXZA 1RPRA 3OTOB 2UU9B 1VQ4V 1WP7A 1NJIW 5KHHA 2CUGA 4UB6Z 4QNCA 4B08A 5B1NA 3OD4A 2V4DA 1FXVA 4FJ8A 1W0KG 5KHGA 3CCSV 1HR0O 5D5PA 1CEZA 3LDBA 4JRQA 2W6IG 1PPJH 1OJHA 2JVDA 4J9YB 3IC9A 4LNUB 4LH6A 3ZRWA 1R1BA 1ZTEA 1MOFA 2XAFA 2DJVA 1R6NA 4H33A 4RL5A 5IJ0A 1LUVA 1OCCB 3LD8A 2IH3C 2GV9A 4FVMA 4YJ3B 3SYPA 3CHXA 1Y74A 3J27A 4UCUA 2JS3A 2IU3A 4RQEA 1VF6A 1BQZA 2JH8A 1N1CA 3ASOC 3LZJA 1KP3A 2HJDA 3SVIA 1D5AA 3H1JH 3W7WA 1QLEC 2A06H 4HZ3A 2E5LB 3OGKB 2UUBB 5IYZA 3BRCA 4MTXA 1SS3A 2DWDC 4HCBA 4LWSA 4UXNA 5JH7A 1GN2A 3L73H 4DUZO 2F95B 1K34A 5LMUO 1XU3E 2N74A 1SQQH 2ZCEA 2ARHA 2P1QB 3MDSA 2DYSC 2XAHA 5C8YB 3CCUV 1FPOA 1GK9A 3K04A 2QA4V 4UV8A 2UUAB 4JAVA 4FJKA 4P30A 1YDXA 3APQA 1SQFA 4FLUA 4X20B 4TWKA 4YY3O 4WFBV 3I55V 4GUNA 4ZI7A 3J80N 3K08A 4CS3A 1Y76B 2P5GA 1QU7A 2OTJV 3AEIA 1GH6A 2PYJA 1R3LC 2E74B 3QVNA 2Q7HA 2XHBA 4E2LA 5E1AC 3AG2B 4OGQB 1VQKV 1VQOV 2W6JG 3TCUA 2Q7GA 3ZN0A 5JJNB 5JCOA 1XVGE 1VF6C 4MVMA 1UFIA 3ZHSA 1K7DA 3QO8A 2YDEA 4I0XA 1AJNA 4FLTA 3SCXA 3N1BA 2VWKA 2HFEC 1T5EA 5EIBC 4M3RA 2M7WA 1XILA 1EN5A 2JK5C 3F7YC 3C90A 3WB2A 5ITZB 3MKSB 3RMDA 4RG8A 4FZ0A 4Z1MG 1WLEA 2FKXA 4NTWA 1SA0A 3OMNB 1RM1C 2ZE8A 2ZNIA 1XMGE 1I94O 1NTMH 1A32A 4I7ZB 1XMOO 3KG2A 1YJ9V 3L71H 3KCXA 1GRJA 3NCIA 3BABA 4FJIA 4FJJA 4LF7O 2LO1A 4R8CA 3SPHA 1P7GA 3AG7A 1HNZO 4ZOLA 2P22C 2LFRA 4FFBB 2OIEA 4UUJC 4ICGC 2GBOA 1Q9YA 4O2AA 3FAVB 1GMGA 4KL1A 4FJLA 4LH7A 4JI7B 2CDYA 4KHNA 2BTQB 2EIKC 4YHHB 1B04A 2XAJA 4KHPO 1SQVH 1RM1B 4JYAB 2HKOA 5HFLA 5EC2C 4UVCA 1IBKB 1BMFG 3BY6A 4DTMA 2Z3YA 4GZRB 1VQ7V 1HDJA 3CB2A 2H94A 1U96A 1P4RA 4F6RB 3CXCU 4LF6B 2VJ5A 2WLMA 1HNWB 1QCEA 3ZHUA 3QNOA 4WCEV 4M3XA 2YIBD 3MHSC 1WJZA 3CFRA 1PV0A 2QWRB 4AI8A 2L6LA 2Q8VA 3OUFA 3CX5F 4KHPB 4YHHO 1XREA 3H01A 2Y0PA 3DTUB 3CSXA 2HHHB 3HL8A 1VQ6V 1W2BU 4K0KO 2DEBA 4I4TB 3K0GA 2NR5A 4DR7B 1SF9A 4JI0B 2HD0A 3KD5E 1OZ0A 2IJIA 1J5EB 4O4LA 2M6YA 1XHXA 3F5TA 2JHPA 3HP9A 1D5NA 3JATB 1HNXB 1FZ3E 4AQYO 1SQXH 4JS4A 4Q6GA 3CD6V 2EJRA 1FZ0E 3QO7A 3SPJA 2A7WA 4PA6A 4DR6O 5LXTB 3WB0A 1N32B 1XVBE 3CFOA 1S5HC 2P67A 2N05A 4ZBMA 4DV4B 1M1KW 5LL6Y 3K5MA 1HNZB 4RQFA 1KYOF 2CGOA 3AK2A 3I56V 4DR7O 1V55B 4I55A 4DV3O 4CZZA 3H1IH 4LF5O 4CS4A 3DXRA 3AG4B 5IJ9B 4WFEA 4J9ZB 4O4HB 3OR7C 1QVGU 3CPWU 4JI4O 3PJSK 2VQEO 3UO3A 1VIBA 1FYZE 2PY5A 3E86A 1Q43A 2JGUA 4FIPC 3QTCA 4FLXA 4M3ZA 2X6AA 4NYKA 1ZX3A 2P1NB 3K3WA 2AW9A 4X20A 3SJQC 2B5UA 4LR3A 1PD3A 5KHKA 2BTQA 4DYLA 4DV4O 4R6ZA 4DK1A 1COWG 3JASB 5HFMA 3RW0A 3JCUZ 4DTOA 2OCHA 4R50A 2DYSB 2JEUA 3G6EV 3K5NA 1WPBA 1MZEA 4QE7A 4JI4B 3FD9A 5IYCO 1V54C 2HP8A 2LW1A 3ZMUA 1J95A 4DV1O 3DSQA 4MVRA 1S0VA 1XMFE 1OV9A 5DECA 2Y4UA 1N34B 4NXMO 4BR6A 3H1HH 4J42A 3CCQV 4OXSA 1BSMA 2DQ0A 2PUSA 3BCCH 1WPXA 1X59A 2VQFO 1VQ8V 2KG7A 1G4YB 5KMGB 3LUTB 1F4MA 5FPOA 4KHUA 2UUCB 1L1FA 2H4TA 2ZT9B 3AK1A 4GX2A 3G4SV 3CCRV 1Y74B 3DGEA 3KKYA 2YXHA 2EIJC 3LZIA 2ZIOA 4LC1A 3RFRA 1VF5B 5LBQA 2C2AA 5JQGA 2E76B 1AP5A 3N2GB 2RCUA 3OMIB 1DTOA 1XL6A 4DV6B 4JAUA 2UXCO 3OT7A 3CMEV 4DV1B 4P2ZA 1EN4A 1SESA 1EZVH 4F4LA 2CTQA 3JAKA 3GB7C 2D3OW 2PYLA 1BL8A 4ZKIA 3ZN1A 5L3FA 2WA3A 1ZLZA 3JSNA 3SUOA 2QTSA 2ZDIC 3D36A 4I0XB 3ABKC 3TL8B 3E4WA 3C3TA 1XEQA 1BHAA 3OGLB 3E22A 4PA7A 1AR5A 3SPIA 2A0LA 2B7MA 1KMIZ 1SRYA 5KUKA 3ZRVA 4JI7O 1VARA 1Q5OA 3E8BA 5EBLC 4HYOA 1TA8A 3CRRA 4LNUA 3ETDA 1IURA 3CC7V 3HKBA 2F93B 4HNAB 3UKMA 1YHQV 3E22B 3U11A 2QWQB 1DF4A 1FJGO 1Q6HA 1AVMA 1IX9A 1VQPV 4JI0O 3JAWB 1QQCA 5C93A 4O4JA 1G1XB 1L8DA 1ZWIC 3RT3C 4BWAA 2HHHO 1MA1A 1GN4A 2HJFC 1XNRO 4DUYO 4MTGA 4UB8Z 5BY1A 3EFFK 3BA8A 2LQTA 4J2AA 1D2DA 2R9IA 2X6CA 4X8AA 3IJ4A 1FFTB 1N36O 1Z5VA 3F7VC 4NXMB 1AROP 5H5NA 4AHCA 3CQ8A 4LF4O 4JI5B 3U10A 5CBFA 4MW8A 3SUNA 1FXKA 3OMAB 4TQDA 4CH5A 1NS1A 2UUCO 5H6RA 2ZE5A 4JRPA 4NXNB 3ZBHA 3SJAC 4DTNA 2Q73A 4FJMA 5JVDB 2HVJC 3BA9A 4FJGA 4HAMA 1S3JA 2XUMA 2NN4A 1FFXB 2R9RB 4FLVA 1FZHE 1N33B 1CXZB 4DUYB 2GTAA 3RVYA 5B1OA 1TGOA 1P84F 1PNLA 2B8IA 1YTFD 4TUYB 1MABG 5B66Z 2CE4A 1Y6XA 4DTPA 1QLNA 4CS2A 1E1QG 1I94B 4PA4A 2LGQA 4MT8A 2YSUB 2HR3A 1TUBB 4FJ5A 4B3SB 5B5EZ 4FLYA 4QPKA 2JH9A 3AG1C 2F1MA 1GKFA 4WFGA 4DTSA 2GSMB 3R66A 3HKEA 4FJHA 4DTUA 1Q81W 5LOVA 3CC2V 1TVKB 4O4IA 3SJJA 5DM6V 3TXQA 1XVCE 4NR1A 1PP9H 4MVZA 5BZBA 5AG2A 1IDSA 4ZIBA 2E3CA 3SGIA 2MMBA 1TVKA 3SI6A 3CWBH 3QF7A 3J81N 1N34O 1YCIA 3JATA 3HKEB 4RUFA 2BSKA 1PL0A 2RCVA 5BMVB 5J2TA 5B1BC 2UXDB 4B3SO 4LF7B 4IYHA 1NH2D 3UM7A 1L0LH 4JI8O 4JYAO 4FK2A 1JMKC 1I0HA 3K9AA 2BCCH 3QNEA 1S5JA 2EJ7A 5EZYB 3Q4HA 4J41A 1V9PA 1QR9A 4DTXA 4M3YA 1Q82W 5LP6B 1GM7A 3TK1A 1RSOA 2VQFB 3BFRA 5B1AC 5EBWC 1I5YA 2FW3A 3GWKC 3JARA 4MVQA 2ZM6O 4MTOA 3N27A 5IWAO 3DC5A 4D6TH 3FX7A 4I5SA 4B3MB 2P4KA 3AG2C 2YI8A 3T4DA 3CEIA 2PZSA 3D3IA 4NVPA 4DU3A 4WFAV 3CMAV 1JOYA 5LHHA 3B8NA 3ZHQA 2F4VO 3QNNA 5CBGA 2Q6AA 4IHJB 4Q20A 3QEPA 1DK1A 5IDJA 1XQ8A 1M9NA 1Q6IA 4WBNB 3VQVA 1GAXA 2MW2A 1TAEA 1K3EA 2ZXWB 4UVBA 2RN9A 3ZRSA 1NI8A 3J2PA 4A5UB 4FK4A 1H2NA 3FFQA 3RYCA 5IWAB 4IHJA 4UCVA 4FK5C 5CB4B 2ZKOA 1KKDA 1JA8A 1OHHG 1XVEE 1M4UA 2X0LA 4H0LB 3OGCC 3WFVA 1H2GA 1K4CC 5KMGA 3UT5A 3FB5C 3JD1A 3RYIB 2L35A 1HP8A 2YEVA 1JX9A 3P3PA 3FAVA 1KUQA 2Y0IA 4TUYA 4QJFB 4N23A 4KHSA 4I50A 1TUBA 5KHIA 2LGWA 3LDSA 5IJ9A 2NNUA 5H9CA 1YXBA 4QGPA 1V54B 5CB4A 4DR5B 1FKAO 3N2KA 1UJWB 2F23A 1N4CA 5E79Z 3CCMV 3SQ4A 2JQTA 5CA1A 4M41A 2EIKB 2H8PC 4YXWG 3E4YA 4YJ2A 2ITDC 1TUEB 1P22A 1IXMA 1YITV 5LGTA 1WNSA 4KXRA 1FFXA 2KQXA 5KHJA 4JI1B 4M3WA 2ETNA 4FJ7A 2A9HA 3JASA 1NZ6A 4ZHQA 1IVSA 4GX5A 1IBMO 1N32O 3SJCC 3TAGA 4X65O 1LNQA 5H6QA 2JS5A 4GAMC 1UPGA 4NTXA 2D2CB 3HKCB 2QWNB 2UXXA 2XOKG 4UCRA 2WLNA 1NQTA 4B3TB 2AHZA 1K5QA 5IT9N 4ZOLB 2XAGA 4DR3O 5J2UA 3QEIA 1WAFA 1Q9XA 2QE7G 4FMTA 2IM9A 5IYDO 4DK0A 1NR7A 3K06A 2LW7A 1NKDA 1J5EO 4ADNA 3L0MA 1DLBA 4OX9B 4P9PA 2ODMA 3CCLV 2QGNA 2Q9LA 4PDVA 2X7RB 3L74H 1FZ4E 2YEVB 1K5SA 5L3CA 2A79B 4JZ2A 2Q69A 3BAAA 4BW5A 5DN6G 2Y69C 1VQNV 4EB6B 2IW5A 3ETEA 1IXBA 3RWUA 3B8MA 1QVFU 4KP4A 2F66C 3A8TA 1KECA 1RP3B 1SC5B 3K0DA 2A3QA 4RO2A 5LP6C 3SQ1A 4DR3B 4EPHA 5EK0A 3ZRWB 3HGLA 4FZ1A 2YUAA 4LFBO 1XI1A 2DN9A 1S77D 2DOSA 4O4LB 5H2FZ 1H2SB 3C6OB 4LFAB 2GDSA 1JFFB 4O2AB 1IBLO 5JJEB 2JHCA 4N21A 2WLLB 4PDLA 4J2DA 1ZAUA 1MSWD 4EKWA 5EZYA 5TISZ 3LDDA 2YS8A 4G28B 4XBFA 3JD2A 1BGYH 4X1IB 4WFFA 4KI4A 5EIBD 1FXHA 4DR6B 3ETQA 1V55C 2CAZC 2LF3A 4JTDB 1XNQO 2FYOA 2ADQB 4J7JA 3UCSC 4DV7B 5FNVA 3BEHA 1OCOC 1WAZA 3SYAA 1K4DC 1FZ6E 2FB5A 3A0HZ 1JVMA 4JI8B 3JYCA 5CN0A 2PFTA 2Q7EA 2QM8A 2KB1A 1GN3A 1S5LZ 2QKSA 4PI2A 3K5OA 3JALA 3ZX6A 4DV5B 2P7TC 4UVAA 4ICGA 1XU5E 4LF6O 4M45A 3KD1E 3FB7C 2RQ6A 1MNGA 2PI5A 3K58A 4X5NA 5B3SC 2QM4A 1XMQB 1BHBA 4JI2B 4KHYA 5CA3A 4KFMA 1FZ7E 2DY4A 3CJHA 3LSSA 4CC6A 4GKJB 4E3SA 3I5DA 4DR4O 1M56C 4CC5A 1SZXA 3ABKB 1KC8W 4L87A 2Z0AA 2VS0A 1OCCC 1AI7A 3JAWA 2WPDG 4F6EA 4FJXA 1IG9A 3CJHB 4X66B 1VP7A 4LP8A 2HEPA 3T1YO 1Q8IA 1DF5A 1B06A 4UFZA 5GONB 3HB3B 4K35A 3K5LA 3ZS8C 4OPAA 1I7FA 4FLWA 4TQFA 1KB9F 4B3RB 2YIBA 4PDMA 1H38A 3QETA 2PGGA 1VEWA 4DW0A 1BCCH 1VQ5V 3NHGA 1YJNV 2UXDO 5H37A 3K03A 1VQMV 4PV1B 2IJKA 4JI6B 4RNGA 3ABUA 2QKAA 3ABTA 2DYRB 4MW3A 3B09A 4I9WA 3AG3C 5J2UB 3LSQA 4LF8O 3T1YB 4J2EA 1FYJA 4LWSB 3D8CA 1JCHA 5L3BA 4DXWA 2QDOA 4TOIA 2ZQMA 4ZHQB 2WA4A 3TETA 3QG5A 3MHHC 4J11A 4PELA 2RNBA 1HW7A 1M56B 1NTZH 1FJGB 4DU1A 3W7SA 5LMNB 4L8JA 2EBOA 3B2EE 4I4TA 1M93A 4K0KB 1LDKE 2WLIA 4B7KA 1FZ5E 1EN6A 3ASNC 5FNVB 2OWOA 3JCZA 3ZEDA 4JF3A 2PFVA 4KHQA 2E31A 5GONA 3RYHB 4BAYA 3EHBB 1QNMA 2OT5A 2OVRB 4BIZA 3E35A 4KI6A 1YSCA 4QPJA 3O65A 2E32A 2MZWB 5FLXN 5JJJB 2WLLA 3T1HB 5IREA 3H1LH 3KCYA 3CC4V 3L1NA 4DR4B 1PKXA 5K1PA 1X4TA 3F5WC 5LGNA 1AI4A 5LMNO 2DE0X 3AG4C 3T4ZA 4CH6A 4G2KA 4MVSA 4LF9O 4MVUA 1XDCA 3VBBA 4M3TA 1W0JG 1H2LA 4O2BA 3SPYA 2DQ3A 3IGAC 4UV9A 4DV3B 4K8XA 3TAFA 2Q0AA 4NKGB 2EX3A 4U3JA 2ZR2A 1THZA 1SQBH 1KD1W 3OTFA 3C6PB 4JV5B 3BPZA 1BE3H 1OCZB 4I9LA 3C95A 5LYJB 1XMOB 4DO2A 3TJTA 3R65A 3JALB 4AKGA 2FTKA 2P4VA 1K8AW 2EINC 4EYWA 2F4VB 4X65B 3FB8C 1AI6A 2UXBO 4AKIA 3L2OB 4H13B 4FLZA 4FM1A 3S9HA 4ABMA 4M42A 3L8BA 2Q67A 4EFBA 3L70H 2XNDG 1URFA 2QTOA 4B3TO 1PL4A 1XNQB 2WWWA 4B3MO 2RDCA 4TT3G 2QWOB 4H44B 3FYIB 1E1RG 3ZHTA 4DU4A 1Y67A 5CBHA 3IAYA 1EZJA 4GX0A 1MTYG 3RYFB 3RYIA 1FZ8E 1FAFA 4QNDA 5J2TB 3JSLA 5BMVA 3M8AA 1OCOB 4DV5O 4EFEA 1XL4A 3M99B 1RFYA 3ZIAG 5KAIZ 1FXKB 2BOCC 3UQ8A 3N1EA 5EC1C 3WG7B 3RMCA 1MMMA 1JJ2U 2QKCA 2QSAA 2FMLA 2DWEC 4DV7O 4J7KA 5J9PC 1O9GA 4J80A 4LFCO 4M3UA 3VQXA 2Y69B 4K3AA 2BE3A 4GYCB 3G80A 5CA0B 3OM3B 2QEXV 3W7XA 3D36C 4U3JB 3CRQA 2ZM6B 1KBHA 1Q3EA 3LDEA 1PNMA 1B3QA 2ATKC 4O4IB 2B1GA 4JI1O 3NXSA 4DV6O 3W7TA 2QM7A 1BT8A 2LP7A 3NR7A 2YIAA 1MG1A 4DUZB 3LDCA 4DR5O 3OAAG 4CH4A 1GO3F 1W59A 1H8EG 2FYUH 4JPRA 2HVKC 4JGSA 4YIPA 3HKDA 2BTOA 3HPLC 3E8GA 4FFBA 1NT2B 2RKHA 5KLVH 5L3GA 4FJNA 1EM1A 3LNMB 1R3JC 3OEHG 3OUSA 4EEQA 2EILC 2UU9O 2Y4TA 2PI4A 2ILMA 4X64O 4JAAA 1F23A 4LFCB 1FXKC 1NH2B 5EBMC 5GTIZ 1CP9A 1XVFE 4JI6O 3TXSA 4PHZA 2IH1C 4TSFG 3E89A 1GM9A 2VJ4A 1K73W 2JDIG 2BSKB 2YI9A 3UIQA 1PNKA 4DW1A 2W0XA 4TV9B 3CS5A 3GVMA 2K5SA 1WB7A 1XMQO 3P32A 3U0ZA 3H9VA 4Z2WA 1JQ0A 4I50B 1FD9A 5BR8O 3S3WA 3FB6C 3N2KB 2ZINA 4OPHA 4FK0A 1F51A 3SQ2A 1FZ9E 1K33A 3TABA 4HNAA 2K1EA 2EINB 2HLDG 3AG3B 2OIGA 1WA8B 5KA5A 3T1HO 4DV2O 3A2FA 2CGNA 1VQ9V 3SYQA 1SA0B 3L72H 4JI5O 2IJHA 2QWPB 3HKBB 3ICXA 3OGMB 2P06A 5GTHZ 1IH7A 4E4BA 4CBCA 4X1IA 4PJ0Z 4PDRA 3OTOO 4GCZA 1YZBA 1I08A 3SPGA 3TGUH 4BIOA 1US6A 1K97A 2ZE6A 2B1EA 3S3XA 4LFAO 4G27B 1JPXA 3SUPA 2N04A 2DYRC 1N33O 5KAFZ 1JR9A 3IC7A 4GX1A 4PA9A 3SPZA 2Q4PA 2YIDA 4DV2B 3RBZA 2EIMB 3JARB 3ABLC 3SNNA 1KU9A 4FJCC 2PTMA 2EIMC 4DR2B 5KX5A 2ATQA 3CCJV 4AQYB 3ML0A 1FZIE 1WP8A 1ORQC 3N2GA 3STZC 1IBMB 1NBMG 2ZD9A 3M7MX 2R9AA 3IFXA 4X64B 3TJYA 3CRCA 1R3IC 4LF9B 1FXXA 4I6JB 1SQGA 5JQGB 3QEVA 4W4KA 5LYJA 1M57B 1AI5A 1G8MA 3ASNB 2VRZA 1WA8A 1OCRB 1CPYA 1GTOA 3ABMB 3SDLA 3CCVV 2P1MB 1B6QA 2BOBC 1JJOA 1M5IA 5CA0A 3ZMTA 1HR0B 1Y4MA 3VQYA 5KX5B 3K57A 2MW2B 4IYIA 4WBNA 3X2QB 1XUQA 3ZCCA 5JH7B 1Q6UA 3JD3A 1BS3A 4GLXA 4FPPA 2B9ZA 4FJ9A 2AGAA 1S72V 1R6TA 1NU1H 1MZFA 3B40A 1H2MA 1Z2GA 2GUZA 4FFKA 4MVOA 3QEXA 2GTSA 4PI0A 4LF8B 1R3KC 5IBKB 2UUBO 2IBZH 2YXYA 2HG5C 4LCUC 1ENVA 1BQ0A 4H37A 4E4EA 2JEXA 1IZ3A 3WG7C 3RYHA 1EFRG 3K79A 5LP6A 3LNNA 2EZPA 2WLJA 2CH7B 3CRAA 1FZ2E 3GWOA 2Z5UA 3JAMN 3A0RA 3G6BA 3K9SA 3QEWA 2R72A 2KSDA 1SZTA 1L0NH 4JYBA 1CLQA 3ZRXA 1Q7YW 1H8HG 2DW4A 2ITCC 1SQPH 4NTYA 4QIWF 5KA6A 4QE9A 4HBNA 3NDKA 4X62O 4U3FH 2GUZB 3UT5B 2AZ0A 3J7AU 2UUAO 2LF6A 2OVQB 5B3SB 2P5OA 2WLHA 4EP9A 3RMAA 5D5QA 4LF5B 1AR4A 3CFPA 3T1CA 2WSSG 3HKCA 5FL7G 1QR8A 4OX9O 2XTAA 1YIJV 3ZMZA 1K9MW 5LOVB 4WFHA 2JHAA 1MSDA 1Q86W 1M57C 4FM0A 1H2KA 1KKCA 3ABLB 1P7BA 4XDKA 2P90A 4O4JB 4BIUA 3BVOA 2E75B
chains in the Genus database with same CATH topology
1FPOA 1FAFA 2LGWA 2M6YA 1IURA 1HDJA 2CUGA 4RWUA 2QWPB 2RKHA 3UCSC 2DMXA 2QWQB 1NZ6A 2EJ7A 1BQZA 1N4CA 1BQ0A 1N1CA 2LO1A 3APQA 2CTQA 2CTPA 2Y4TA 3AG7A 4J7ZA 3APOA 2GUZB 2QWOB 2CTWA 1XBLA 2YUAA 3UO3A 2CTRA 2QWNB 4IT5A 3UO2A 2QSAA 1GH6A 2DN9A 2N05A 2YS8A 2GUZA 2N04A 2OCHA 1WJZA 2Y4UA 3BVOA 2PF4E 2QWRB 4J80A 2L6LA 2KQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPO A;  1FAF A;  2LGW A;  2M6Y A;  1IUR A;  1HDJ A;  2CUG A;  4RWU A;  2QWP B;  2RKH A;  3UCS C;  2DMX A;  2QWQ B;  1NZ6 A;  2EJ7 A;  1BQZ A;  1N4C A;  1BQ0 A;  1N1C A;  2LO1 A;  3APQ A;  2CTQ A;  2CTP A;  2Y4T A;  3AG7 A;  4J7Z A;  3APO A;  2GUZ B;  2QWO B;  2CTW A;  1XBL A;  2YUA A;  3UO3 A;  2CTR A;  2QWN B;  4IT5 A;  3UO2 A;  2QSA A;  1GH6 A;  2DN9 A;  2N05 A;  2YS8 A;  2GUZ A;  2N04 A;  2OCH A;  1WJZ A;  2Y4U A;  3BVO A;  2PF4 E;  2QWR B;  4J80 A;  2L6L A;  2KQX A; 
#chains in the Genus database with same CATH topology
 3QES A;  3MD0 A;  1XL3 C;  2XT9 A;  2OCC B;  4ADO A;  5CMU A;  4NXN O;  3OEE G;  3THO A;  1WN7 A;  2JIZ G;  1LUW A;  4AIL C;  1ZL8 B;  2EIJ B;  5IYB O;  1XOU A;  1SER A;  2V1D A;  2WLK A;  2ZE7 A;  2ZR3 A;  1P49 A;  3MAQ A;  4FM2 A;  4D7S A;  4D7T A;  3SYC A;  4X89 A;  4AKH A;  3O9O A;  4O4H A;  3OE7 G;  3NGI A;  2YC0 A;  4U7O A;  4X5M A;  4X1Y A;  3B77 A;  4I9Q A;  1BZK A;  3SJB C;  4CH3 A;  1JFF A;  3PN1 A;  1RPO A;  2VIX A;  3RMB A;  3K2O A;  5BR8 B;  1SKV A;  4JYC A;  3JD4 A;  3X2Q C;  1ZSP A;  5L3D A;  2QXF A;  1QHT A;  5LGU A;  4PD4 F;  3WSO A;  1VF7 A;  5IZ7 A;  2WAM A;  1N8R W;  4TV8 B;  4MTF A;  4DR1 O;  1WAJ A;  1O9H A;  2UXB B;  2B1I A;  4JI2 O;  2OZM A;  3HR0 A;  1N36 B;  3RYF A;  4DR2 O;  4DTJ A;  4ASU G;  3EXA A;  3FYE B;  5EYP B;  1YTF B;  2AZ2 A;  4RWU A;  1XMH E;  3ETG A;  4I55 B;  1RSO B;  3L75 H;  2Y48 A;  1R73 A;  4J10 A;  1XHZ A;  1QBZ A;  3SUQ A;  3APO A;  3AK3 A;  3STL C;  1FS1 A;  1Q90 D;  2CTW A;  3HKD B;  2CTR A;  1HNX O;  1EBO A;  4R7C A;  4X66 O;  3VQW A;  4P9O A;  2PF4 E;  4IT5 A;  2RMK B;  3CCE V;  5LXT A;  1GM8 A;  5LMU B;  2JRI A;  4TV9 A;  2R70 A;  1N0J A;  1Z5W A;  4XDJ A;  4GKK B;  1GN6 A;  5DED A;  1SET A;  3QER A;  4JI3 B;  4DTR A;  3RYC B;  4B7E A;  4JYY A;  4DRX A;  1YEW A;  3WB1 A;  1NR1 A;  3G67 A;  1AB3 A;  3KZI Z;  4EB6 A;  3CRM A;  3TAE A;  1AR1 B;  4DV0 O;  3B4S A;  4JAS A;  1FS0 G;  2VQE B;  2QJ1 A;  1G6U A;  2LJ2 A;  3NAE A;  2AXT Z;  1ZUQ A;  4HCC A;  5IYZ B;  4UCO A;  3L9D A;  1ROP A;  5JCO C;  3QO5 A;  1HNW O;  2IU0 A;  2YIC A;  4LF4 B;  4GKK O;  4X1Y B;  1Y76 A;  3CXH F;  2ZNJ A;  4GKJ O;  4JI3 O;  3OGI B;  3CYO A;  3OW2 U;  2E5L O;  3V7D B;  1YI2 V;  3E83 A;  4LFB B;  3A0B Z;  5LHG A;  5IJ0 B;  3C6N B;  4J7Z A;  2K9P A;  4IL6 Z;  3K59 A;  5JWP A;  2JGD B;  4DV0 B;  5EYP A;  1NEX B;  2W0F C;  5C8Y A;  1KP2 A;  4NB5 A;  3H1K H;  3E8H A;  2Q5Z A;  4KUM A;  2ADP A;  1AIL A;  5FPR A;  1VQL V;  1YVW A;  4DR1 B;  2JGD A;  1AJP A;  3FKS G;  5K1X A;  1JW2 A;  1M90 W;  1MMO G;  3WU2 Z;  5B1B B;  1OCZ C;  4XDL A;  5CA1 B;  2ZXW C;  5A2Q N;  4AI6 A;  3E2E A;  2LFS A;  3OR6 C;  3LSU A;  4J2B A;  1WB8 A;  3RVZ A;  3JAK B;  2EZO A;  2OVP B;  4WF9 V;  1XVD E;  1E79 G;  4X62 B;  5A9G A;  5LA6 A;  2XAS A;  3HGK E;  2OYQ A;  2CK3 G;  3DC6 A;  2GHY A;  1QLE B;  2Q0O C;  2JJ1 G;  1NTK H;  3EVK A;  2KKW A;  4X1K B;  2FL4 A;  1I5X A;  4F6R A;  1U97 A;  1PM9 A;  2DTU A;  1YF2 A;  1ZL8 A;  3OFN G;  2QR4 A;  3NE6 A;  2JJ2 G;  1R6K A;  3ASO B;  4TV8 A;  4ZI7 B;  3ZJZ A;  2CH7 A;  2EIL B;  5KUM A;  5GW7 A;  4C7U A;  4X88 A;  4QNH B;  4X9Q A;  5ITZ A;  2NLJ C;  2P1O B;  1MHY G;  2CTP A;  3C94 A;  1IBK O;  3CP1 A;  5JVD A;  2P6J A;  4W4L A;  3RN4 A;  3SPC A;  1N0N A;  4BW9 A;  4MS2 A;  3VOU A;  1F7Y A;  2P1P B;  4K8Z A;  4UCS A;  1NVP D;  4IIJ B;  4IIJ A;  5IE9 A;  4U7N A;  3SR2 C;  2O57 A;  5L3E A;  4MSW C;  4B3R O;  4IGG A;  1K92 A;  1NVP B;  1FZ1 E;  4YJ2 B;  4JTA B;  3JD0 A;  2F43 G;  1KQS U;  1IBL B;  4JZG A;  2UXC B;  3ZMS A;  3D3Q A;  2OZS A;  3G71 V;  1OCR C;  2YB5 A;  5IY5 B;  2OTL V;  3SQ0 A;  1DGS A;  1HWY A;  3BHP A;  2IJJ A;  2VWJ A;  5IY5 C;  3ZMV A;  4Z1V A;  4JS5 A;  1VMG A;  1F4N A;  3SYO A;  3W7U A;  2DMX A;  3P30 A;  3Q4H B;  4LBE C;  2X6B A;  1AP6 A;  2WLI B;  4PA3 A;  2YXL A;  3E8F A;  3C3S A;  5B1A B;  1XNR B;  4GT1 A;  3RWR D;  3ABM C;  1LR1 A;  4X1K A;  2ZIM A;  4YJ3 A;  4RUE A;  1AJQ A;  3DXR B;  4KHW A;  2V7Q G;  4YY3 B;  1YJW V;  4JV5 O;  3P3N A;  2AHY A;  2H3O A;  4YIO A;  5LA6 B;  4UCT A;  3ZHR A;  2KG7 B;  1MHZ G;  5F2V O;  5LHI A;  3CE2 A;  2OCC C;  4O2B B;  2UXN A;  4DRX B;  3ZHV A;  1S76 D;  2ZDI A;  2RJZ A;  3AG1 B;  4JTC B;  2XAQ A;  2JPN A;  1Y66 A;  2EUL A;  1XBL A;  2MK3 A;  2Q68 A;  4RAI A;  3T2M A;  3RGB A;  3UO2 A;  2G38 A;  5BXZ A;  1RPR A;  3OTO B;  2UU9 B;  1VQ4 V;  1WP7 A;  1NJI W;  5KHH A;  2CUG A;  4UB6 Z;  4QNC A;  4B08 A;  5B1N A;  3OD4 A;  2V4D A;  1FXV A;  4FJ8 A;  1W0K G;  5KHG A;  3CCS V;  1HR0 O;  5D5P A;  1CEZ A;  3LDB A;  4JRQ A;  2W6I G;  1PPJ H;  1OJH A;  2JVD A;  4J9Y B;  3IC9 A;  4LNU B;  4LH6 A;  3ZRW A;  1R1B A;  1ZTE A;  1MOF A;  2XAF A;  2DJV A;  1R6N A;  4H33 A;  4RL5 A;  5IJ0 A;  1LUV A;  1OCC B;  3LD8 A;  2IH3 C;  2GV9 A;  4FVM A;  4YJ3 B;  3SYP A;  3CHX A;  1Y74 A;  3J27 A;  4UCU A;  2JS3 A;  2IU3 A;  4RQE A;  1VF6 A;  1BQZ A;  2JH8 A;  1N1C A;  3ASO C;  3LZJ A;  1KP3 A;  2HJD A;  3SVI A;  1D5A A;  3H1J H;  3W7W A;  1QLE C;  2A06 H;  4HZ3 A;  2E5L B;  3OGK B;  2UUB B;  5IYZ A;  3BRC A;  4MTX A;  1SS3 A;  2DWD C;  4HCB A;  4LWS A;  4UXN A;  5JH7 A;  1GN2 A;  3L73 H;  4DUZ O;  2F95 B;  1K34 A;  5LMU O;  1XU3 E;  2N74 A;  1SQQ H;  2ZCE A;  2ARH A;  2P1Q B;  3MDS A;  2DYS C;  2XAH A;  5C8Y B;  3CCU V;  1FPO A;  1GK9 A;  3K04 A;  2QA4 V;  4UV8 A;  2UUA B;  4JAV A;  4FJK A;  4P30 A;  1YDX A;  3APQ A;  1SQF A;  4FLU A;  4X20 B;  4TWK A;  4YY3 O;  4WFB V;  3I55 V;  4GUN A;  4ZI7 A;  3J80 N;  3K08 A;  4CS3 A;  1Y76 B;  2P5G A;  1QU7 A;  2OTJ V;  3AEI A;  1GH6 A;  2PYJ A;  1R3L C;  2E74 B;  3QVN A;  2Q7H A;  2XHB A;  4E2L A;  5E1A C;  3AG2 B;  4OGQ B;  1VQK V;  1VQO V;  2W6J G;  3TCU A;  2Q7G A;  3ZN0 A;  5JJN B;  5JCO A;  1XVG E;  1VF6 C;  4MVM A;  1UFI A;  3ZHS A;  1K7D A;  3QO8 A;  2YDE A;  4I0X A;  1AJN A;  4FLT A;  3SCX A;  3N1B A;  2VWK A;  2HFE C;  1T5E A;  5EIB C;  4M3R A;  2M7W A;  1XIL A;  1EN5 A;  2JK5 C;  3F7Y C;  3C90 A;  3WB2 A;  5ITZ B;  3MKS B;  3RMD A;  4RG8 A;  4FZ0 A;  4Z1M G;  1WLE A;  2FKX A;  4NTW A;  1SA0 A;  3OMN B;  1RM1 C;  2ZE8 A;  2ZNI A;  1XMG E;  1I94 O;  1NTM H;  1A32 A;  4I7Z B;  1XMO O;  3KG2 A;  1YJ9 V;  3L71 H;  3KCX A;  1GRJ A;  3NCI A;  3BAB A;  4FJI A;  4FJJ A;  4LF7 O;  2LO1 A;  4R8C A;  3SPH A;  1P7G A;  3AG7 A;  1HNZ O;  4ZOL A;  2P22 C;  2LFR A;  4FFB B;  2OIE A;  4UUJ C;  4ICG C;  2GBO A;  1Q9Y A;  4O2A A;  3FAV B;  1GMG A;  4KL1 A;  4FJL A;  4LH7 A;  4JI7 B;  2CDY A;  4KHN A;  2BTQ B;  2EIK C;  4YHH B;  1B04 A;  2XAJ A;  4KHP O;  1SQV H;  1RM1 B;  4JYA B;  2HKO A;  5HFL A;  5EC2 C;  4UVC A;  1IBK B;  1BMF G;  3BY6 A;  4DTM A;  2Z3Y A;  4GZR B;  1VQ7 V;  1HDJ A;  3CB2 A;  2H94 A;  1U96 A;  1P4R A;  4F6R B;  3CXC U;  4LF6 B;  2VJ5 A;  2WLM A;  1HNW B;  1QCE A;  3ZHU A;  3QNO A;  4WCE V;  4M3X A;  2YIB D;  3MHS C;  1WJZ A;  3CFR A;  1PV0 A;  2QWR B;  4AI8 A;  2L6L A;  2Q8V A;  3OUF A;  3CX5 F;  4KHP B;  4YHH O;  1XRE A;  3H01 A;  2Y0P A;  3DTU B;  3CSX A;  2HHH B;  3HL8 A;  1VQ6 V;  1W2B U;  4K0K O;  2DEB A;  4I4T B;  3K0G A;  2NR5 A;  4DR7 B;  1SF9 A;  4JI0 B;  2HD0 A;  3KD5 E;  1OZ0 A;  2IJI A;  1J5E B;  4O4L A;  2M6Y A;  1XHX A;  3F5T A;  2JHP A;  3HP9 A;  1D5N A;  3JAT B;  1HNX B;  1FZ3 E;  4AQY O;  1SQX H;  4JS4 A;  4Q6G A;  3CD6 V;  2EJR A;  1FZ0 E;  3QO7 A;  3SPJ A;  2A7W A;  4PA6 A;  4DR6 O;  5LXT B;  3WB0 A;  1N32 B;  1XVB E;  3CFO A;  1S5H C;  2P67 A;  2N05 A;  4ZBM A;  4DV4 B;  1M1K W;  5LL6 Y;  3K5M A;  1HNZ B;  4RQF A;  1KYO F;  2CGO A;  3AK2 A;  3I56 V;  4DR7 O;  1V55 B;  4I55 A;  4DV3 O;  4CZZ A;  3H1I H;  4LF5 O;  4CS4 A;  3DXR A;  3AG4 B;  5IJ9 B;  4WFE A;  4J9Z B;  4O4H B;  3OR7 C;  1QVG U;  3CPW U;  4JI4 O;  3PJS K;  2VQE O;  3UO3 A;  1VIB A;  1FYZ E;  2PY5 A;  3E86 A;  1Q43 A;  2JGU A;  4FIP C;  3QTC A;  4FLX A;  4M3Z A;  2X6A A;  4NYK A;  1ZX3 A;  2P1N B;  3K3W A;  2AW9 A;  4X20 A;  3SJQ C;  2B5U A;  4LR3 A;  1PD3 A;  5KHK A;  2BTQ A;  4DYL A;  4DV4 O;  4R6Z A;  4DK1 A;  1COW G;  3JAS B;  5HFM A;  3RW0 A;  3JCU Z;  4DTO A;  2OCH A;  4R50 A;  2DYS B;  2JEU A;  3G6E V;  3K5N A;  1WPB A;  1MZE A;  4QE7 A;  4JI4 B;  3FD9 A;  5IYC O;  1V54 C;  2HP8 A;  2LW1 A;  3ZMU A;  1J95 A;  4DV1 O;  3DSQ A;  4MVR A;  1S0V A;  1XMF E;  1OV9 A;  5DEC A;  2Y4U A;  1N34 B;  4NXM O;  4BR6 A;  3H1H H;  4J42 A;  3CCQ V;  4OXS A;  1BSM A;  2DQ0 A;  2PUS A;  3BCC H;  1WPX A;  1X59 A;  2VQF O;  1VQ8 V;  2KG7 A;  1G4Y B;  5KMG B;  3LUT B;  1F4M A;  5FPO A;  4KHU A;  2UUC B;  1L1F A;  2H4T A;  2ZT9 B;  3AK1 A;  4GX2 A;  3G4S V;  3CCR V;  1Y74 B;  3DGE A;  3KKY A;  2YXH A;  2EIJ C;  3LZI A;  2ZIO A;  4LC1 A;  3RFR A;  1VF5 B;  5LBQ A;  2C2A A;  5JQG A;  2E76 B;  1AP5 A;  3N2G B;  2RCU A;  3OMI B;  1DTO A;  1XL6 A;  4DV6 B;  4JAU A;  2UXC O;  3OT7 A;  3CME V;  4DV1 B;  4P2Z A;  1EN4 A;  1SES A;  1EZV H;  4F4L A;  2CTQ A;  3JAK A;  3GB7 C;  2D3O W;  2PYL A;  1BL8 A;  4ZKI A;  3ZN1 A;  5L3F A;  2WA3 A;  1ZLZ A;  3JSN A;  3SUO A;  2QTS A;  2ZDI C;  3D36 A;  4I0X B;  3ABK C;  3TL8 B;  3E4W A;  3C3T A;  1XEQ A;  1BHA A;  3OGL B;  3E22 A;  4PA7 A;  1AR5 A;  3SPI A;  2A0L A;  2B7M A;  1KMI Z;  1SRY A;  5KUK A;  3ZRV A;  4JI7 O;  1VAR A;  1Q5O A;  3E8B A;  5EBL C;  4HYO A;  1TA8 A;  3CRR A;  4LNU A;  3ETD A;  1IUR A;  3CC7 V;  3HKB A;  2F93 B;  4HNA B;  3UKM A;  1YHQ V;  3E22 B;  3U11 A;  2QWQ B;  1DF4 A;  1FJG O;  1Q6H A;  1AVM A;  1IX9 A;  1VQP V;  4JI0 O;  3JAW B;  1QQC A;  5C93 A;  4O4J A;  1G1X B;  1L8D A;  1ZWI C;  3RT3 C;  4BWA A;  2HHH O;  1MA1 A;  1GN4 A;  2HJF C;  1XNR O;  4DUY O;  4MTG A;  4UB8 Z;  5BY1 A;  3EFF K;  3BA8 A;  2LQT A;  4J2A A;  1D2D A;  2R9I A;  2X6C A;  4X8A A;  3IJ4 A;  1FFT B;  1N36 O;  1Z5V A;  3F7V C;  4NXM B;  1ARO P;  5H5N A;  4AHC A;  3CQ8 A;  4LF4 O;  4JI5 B;  3U10 A;  5CBF A;  4MW8 A;  3SUN A;  1FXK A;  3OMA B;  4TQD A;  4CH5 A;  1NS1 A;  2UUC O;  5H6R A;  2ZE5 A;  4JRP A;  4NXN B;  3ZBH A;  3SJA C;  4DTN A;  2Q73 A;  4FJM A;  5JVD B;  2HVJ C;  3BA9 A;  4FJG A;  4HAM A;  1S3J A;  2XUM A;  2NN4 A;  1FFX B;  2R9R B;  4FLV A;  1FZH E;  1N33 B;  1CXZ B;  4DUY B;  2GTA A;  3RVY A;  5B1O A;  1TGO A;  1P84 F;  1PNL A;  2B8I A;  1YTF D;  4TUY B;  1MAB G;  5B66 Z;  2CE4 A;  1Y6X A;  4DTP A;  1QLN A;  4CS2 A;  1E1Q G;  1I94 B;  4PA4 A;  2LGQ A;  4MT8 A;  2YSU B;  2HR3 A;  1TUB B;  4FJ5 A;  4B3S B;  5B5E Z;  4FLY A;  4QPK A;  2JH9 A;  3AG1 C;  2F1M A;  1GKF A;  4WFG A;  4DTS A;  2GSM B;  3R66 A;  3HKE A;  4FJH A;  4DTU A;  1Q81 W;  5LOV A;  3CC2 V;  1TVK B;  4O4I A;  3SJJ A;  5DM6 V;  3TXQ A;  1XVC E;  4NR1 A;  1PP9 H;  4MVZ A;  5BZB A;  5AG2 A;  1IDS A;  4ZIB A;  2E3C A;  3SGI A;  2MMB A;  1TVK A;  3SI6 A;  3CWB H;  3QF7 A;  3J81 N;  1N34 O;  1YCI A;  3JAT A;  3HKE B;  4RUF A;  2BSK A;  1PL0 A;  2RCV A;  5BMV B;  5J2T A;  5B1B C;  2UXD B;  4B3S O;  4LF7 B;  4IYH A;  1NH2 D;  3UM7 A;  1L0L H;  4JI8 O;  4JYA O;  4FK2 A;  1JMK C;  1I0H A;  3K9A A;  2BCC H;  3QNE A;  1S5J A;  2EJ7 A;  5EZY B;  3Q4H A;  4J41 A;  1V9P A;  1QR9 A;  4DTX A;  4M3Y A;  1Q82 W;  5LP6 B;  1GM7 A;  3TK1 A;  1RSO A;  2VQF B;  3BFR A;  5B1A C;  5EBW C;  1I5Y A;  2FW3 A;  3GWK C;  3JAR A;  4MVQ A;  2ZM6 O;  4MTO A;  3N27 A;  5IWA O;  3DC5 A;  4D6T H;  3FX7 A;  4I5S A;  4B3M B;  2P4K A;  3AG2 C;  2YI8 A;  3T4D A;  3CEI A;  2PZS A;  3D3I A;  4NVP A;  4DU3 A;  4WFA V;  3CMA V;  1JOY A;  5LHH A;  3B8N A;  3ZHQ A;  2F4V O;  3QNN A;  5CBG A;  2Q6A A;  4IHJ B;  4Q20 A;  3QEP A;  1DK1 A;  5IDJ A;  1XQ8 A;  1M9N A;  1Q6I A;  4WBN B;  3VQV A;  1GAX A;  2MW2 A;  1TAE A;  1K3E A;  2ZXW B;  4UVB A;  2RN9 A;  3ZRS A;  1NI8 A;  3J2P A;  4A5U B;  4FK4 A;  1H2N A;  3FFQ A;  3RYC A;  5IWA B;  4IHJ A;  4UCV A;  4FK5 C;  5CB4 B;  2ZKO A;  1KKD A;  1JA8 A;  1OHH G;  1XVE E;  1M4U A;  2X0L A;  4H0L B;  3OGC C;  3WFV A;  1H2G A;  1K4C C;  5KMG A;  3UT5 A;  3FB5 C;  3JD1 A;  3RYI B;  2L35 A;  1HP8 A;  2YEV A;  1JX9 A;  3P3P A;  3FAV A;  1KUQ A;  2Y0I A;  4TUY A;  4QJF B;  4N23 A;  4KHS A;  4I50 A;  1TUB A;  5KHI A;  2LGW A;  3LDS A;  5IJ9 A;  2NNU A;  5H9C A;  1YXB A;  4QGP A;  1V54 B;  5CB4 A;  4DR5 B;  1FKA O;  3N2K A;  1UJW B;  2F23 A;  1N4C A;  5E79 Z;  3CCM V;  3SQ4 A;  2JQT A;  5CA1 A;  4M41 A;  2EIK B;  2H8P C;  4YXW G;  3E4Y A;  4YJ2 A;  2ITD C;  1TUE B;  1P22 A;  1IXM A;  1YIT V;  5LGT A;  1WNS A;  4KXR A;  1FFX A;  2KQX A;  5KHJ A;  4JI1 B;  4M3W A;  2ETN A;  4FJ7 A;  2A9H A;  3JAS A;  1NZ6 A;  4ZHQ A;  1IVS A;  4GX5 A;  1IBM O;  1N32 O;  3SJC C;  3TAG A;  4X65 O;  1LNQ A;  5H6Q A;  2JS5 A;  4GAM C;  1UPG A;  4NTX A;  2D2C B;  3HKC B;  2QWN B;  2UXX A;  2XOK G;  4UCR A;  2WLN A;  1NQT A;  4B3T B;  2AHZ A;  1K5Q A;  5IT9 N;  4ZOL B;  2XAG A;  4DR3 O;  5J2U A;  3QEI A;  1WAF A;  1Q9X A;  2QE7 G;  4FMT A;  2IM9 A;  5IYD O;  4DK0 A;  1NR7 A;  3K06 A;  2LW7 A;  1NKD A;  1J5E O;  4ADN A;  3L0M A;  1DLB A;  4OX9 B;  4P9P A;  2ODM A;  3CCL V;  2QGN A;  2Q9L A;  4PDV A;  2X7R B;  3L74 H;  1FZ4 E;  2YEV B;  1K5S A;  5L3C A;  2A79 B;  4JZ2 A;  2Q69 A;  3BAA A;  4BW5 A;  5DN6 G;  2Y69 C;  1VQN V;  4EB6 B;  2IW5 A;  3ETE A;  1IXB A;  3RWU A;  3B8M A;  1QVF U;  4KP4 A;  2F66 C;  3A8T A;  1KEC A;  1RP3 B;  1SC5 B;  3K0D A;  2A3Q A;  4RO2 A;  5LP6 C;  3SQ1 A;  4DR3 B;  4EPH A;  5EK0 A;  3ZRW B;  3HGL A;  4FZ1 A;  2YUA A;  4LFB O;  1XI1 A;  2DN9 A;  1S77 D;  2DOS A;  4O4L B;  5H2F Z;  1H2S B;  3C6O B;  4LFA B;  2GDS A;  1JFF B;  4O2A B;  1IBL O;  5JJE B;  2JHC A;  4N21 A;  2WLL B;  4PDL A;  4J2D A;  1ZAU A;  1MSW D;  4EKW A;  5EZY A;  5TIS Z;  3LDD A;  2YS8 A;  4G28 B;  4XBF A;  3JD2 A;  1BGY H;  4X1I B;  4WFF A;  4KI4 A;  5EIB D;  1FXH A;  4DR6 B;  3ETQ A;  1V55 C;  2CAZ C;  2LF3 A;  4JTD B;  1XNQ O;  2FYO A;  2ADQ B;  4J7J A;  3UCS C;  4DV7 B;  5FNV A;  3BEH A;  1OCO C;  1WAZ A;  3SYA A;  1K4D C;  1FZ6 E;  2FB5 A;  3A0H Z;  1JVM A;  4JI8 B;  3JYC A;  5CN0 A;  2PFT A;  2Q7E A;  2QM8 A;  2KB1 A;  1GN3 A;  1S5L Z;  2QKS A;  4PI2 A;  3K5O A;  3JAL A;  3ZX6 A;  4DV5 B;  2P7T C;  4UVA A;  4ICG A;  1XU5 E;  4LF6 O;  4M45 A;  3KD1 E;  3FB7 C;  2RQ6 A;  1MNG A;  2PI5 A;  3K58 A;  4X5N A;  5B3S C;  2QM4 A;  1XMQ B;  1BHB A;  4JI2 B;  4KHY A;  5CA3 A;  4KFM A;  1FZ7 E;  2DY4 A;  3CJH A;  3LSS A;  4CC6 A;  4GKJ B;  4E3S A;  3I5D A;  4DR4 O;  1M56 C;  4CC5 A;  1SZX A;  3ABK B;  1KC8 W;  4L87 A;  2Z0A A;  2VS0 A;  1OCC C;  1AI7 A;  3JAW A;  2WPD G;  4F6E A;  4FJX A;  1IG9 A;  3CJH B;  4X66 B;  1VP7 A;  4LP8 A;  2HEP A;  3T1Y O;  1Q8I A;  1DF5 A;  1B06 A;  4UFZ A;  5GON B;  3HB3 B;  4K35 A;  3K5L A;  3ZS8 C;  4OPA A;  1I7F A;  4FLW A;  4TQF A;  1KB9 F;  4B3R B;  2YIB A;  4PDM A;  1H38 A;  3QET A;  2PGG A;  1VEW A;  4DW0 A;  1BCC H;  1VQ5 V;  3NHG A;  1YJN V;  2UXD O;  5H37 A;  3K03 A;  1VQM V;  4PV1 B;  2IJK A;  4JI6 B;  4RNG A;  3ABU A;  2QKA A;  3ABT A;  2DYR B;  4MW3 A;  3B09 A;  4I9W A;  3AG3 C;  5J2U B;  3LSQ A;  4LF8 O;  3T1Y B;  4J2E A;  1FYJ A;  4LWS B;  3D8C A;  1JCH A;  5L3B A;  4DXW A;  2QDO A;  4TOI A;  2ZQM A;  4ZHQ B;  2WA4 A;  3TET A;  3QG5 A;  3MHH C;  4J11 A;  4PEL A;  2RNB A;  1HW7 A;  1M56 B;  1NTZ H;  1FJG B;  4DU1 A;  3W7S A;  5LMN B;  4L8J A;  2EBO A;  3B2E E;  4I4T A;  1M93 A;  4K0K B;  1LDK E;  2WLI A;  4B7K A;  1FZ5 E;  1EN6 A;  3ASN C;  5FNV B;  2OWO A;  3JCZ A;  3ZED A;  4JF3 A;  2PFV A;  4KHQ A;  2E31 A;  5GON A;  3RYH B;  4BAY A;  3EHB B;  1QNM A;  2OT5 A;  2OVR B;  4BIZ A;  3E35 A;  4KI6 A;  1YSC A;  4QPJ A;  3O65 A;  2E32 A;  2MZW B;  5FLX N;  5JJJ B;  2WLL A;  3T1H B;  5IRE A;  3H1L H;  3KCY A;  3CC4 V;  3L1N A;  4DR4 B;  1PKX A;  5K1P A;  1X4T A;  3F5W C;  5LGN A;  1AI4 A;  5LMN O;  2DE0 X;  3AG4 C;  3T4Z A;  4CH6 A;  4G2K A;  4MVS A;  4LF9 O;  4MVU A;  1XDC A;  3VBB A;  4M3T A;  1W0J G;  1H2L A;  4O2B A;  3SPY A;  2DQ3 A;  3IGA C;  4UV9 A;  4DV3 B;  4K8X A;  3TAF A;  2Q0A A;  4NKG B;  2EX3 A;  4U3J A;  2ZR2 A;  1THZ A;  1SQB H;  1KD1 W;  3OTF A;  3C6P B;  4JV5 B;  3BPZ A;  1BE3 H;  1OCZ B;  4I9L A;  3C95 A;  5LYJ B;  1XMO B;  4DO2 A;  3TJT A;  3R65 A;  3JAL B;  4AKG A;  2FTK A;  2P4V A;  1K8A W;  2EIN C;  4EYW A;  2F4V B;  4X65 B;  3FB8 C;  1AI6 A;  2UXB O;  4AKI A;  3L2O B;  4H13 B;  4FLZ A;  4FM1 A;  3S9H A;  4ABM A;  4M42 A;  3L8B A;  2Q67 A;  4EFB A;  3L70 H;  2XND G;  1URF A;  2QTO A;  4B3T O;  1PL4 A;  1XNQ B;  2WWW A;  4B3M O;  2RDC A;  4TT3 G;  2QWO B;  4H44 B;  3FYI B;  1E1R G;  3ZHT A;  4DU4 A;  1Y67 A;  5CBH A;  3IAY A;  1EZJ A;  4GX0 A;  1MTY G;  3RYF B;  3RYI A;  1FZ8 E;  1FAF A;  4QND A;  5J2T B;  3JSL A;  5BMV A;  3M8A A;  1OCO B;  4DV5 O;  4EFE A;  1XL4 A;  3M99 B;  1RFY A;  3ZIA G;  5KAI Z;  1FXK B;  2BOC C;  3UQ8 A;  3N1E A;  5EC1 C;  3WG7 B;  3RMC A;  1MMM A;  1JJ2 U;  2QKC A;  2QSA A;  2FML A;  2DWE C;  4DV7 O;  4J7K A;  5J9P C;  1O9G A;  4J80 A;  4LFC O;  4M3U A;  3VQX A;  2Y69 B;  4K3A A;  2BE3 A;  4GYC B;  3G80 A;  5CA0 B;  3OM3 B;  2QEX V;  3W7X A;  3D36 C;  4U3J B;  3CRQ A;  2ZM6 B;  1KBH A;  1Q3E A;  3LDE A;  1PNM A;  1B3Q A;  2ATK C;  4O4I B;  2B1G A;  4JI1 O;  3NXS A;  4DV6 O;  3W7T A;  2QM7 A;  1BT8 A;  2LP7 A;  3NR7 A;  2YIA A;  1MG1 A;  4DUZ B;  3LDC A;  4DR5 O;  3OAA G;  4CH4 A;  1GO3 F;  1W59 A;  1H8E G;  2FYU H;  4JPR A;  2HVK C;  4JGS A;  4YIP A;  3HKD A;  2BTO A;  3HPL C;  3E8G A;  4FFB A;  1NT2 B;  2RKH A;  5KLV H;  5L3G A;  4FJN A;  1EM1 A;  3LNM B;  1R3J C;  3OEH G;  3OUS A;  4EEQ A;  2EIL C;  2UU9 O;  2Y4T A;  2PI4 A;  2ILM A;  4X64 O;  4JAA A;  1F23 A;  4LFC B;  1FXK C;  1NH2 B;  5EBM C;  5GTI Z;  1CP9 A;  1XVF E;  4JI6 O;  3TXS A;  4PHZ A;  2IH1 C;  4TSF G;  3E89 A;  1GM9 A;  2VJ4 A;  1K73 W;  2JDI G;  2BSK B;  2YI9 A;  3UIQ A;  1PNK A;  4DW1 A;  2W0X A;  4TV9 B;  3CS5 A;  3GVM A;  2K5S A;  1WB7 A;  1XMQ O;  3P32 A;  3U0Z A;  3H9V A;  4Z2W A;  1JQ0 A;  4I50 B;  1FD9 A;  5BR8 O;  3S3W A;  3FB6 C;  3N2K B;  2ZIN A;  4OPH A;  4FK0 A;  1F51 A;  3SQ2 A;  1FZ9 E;  1K33 A;  3TAB A;  4HNA A;  2K1E A;  2EIN B;  2HLD G;  3AG3 B;  2OIG A;  1WA8 B;  5KA5 A;  3T1H O;  4DV2 O;  3A2F A;  2CGN A;  1VQ9 V;  3SYQ A;  1SA0 B;  3L72 H;  4JI5 O;  2IJH A;  2QWP B;  3HKB B;  3ICX A;  3OGM B;  2P06 A;  5GTH Z;  1IH7 A;  4E4B A;  4CBC A;  4X1I A;  4PJ0 Z;  4PDR A;  3OTO O;  4GCZ A;  1YZB A;  1I08 A;  3SPG A;  3TGU H;  4BIO A;  1US6 A;  1K97 A;  2ZE6 A;  2B1E A;  3S3X A;  4LFA O;  4G27 B;  1JPX A;  3SUP A;  2N04 A;  2DYR C;  1N33 O;  5KAF Z;  1JR9 A;  3IC7 A;  4GX1 A;  4PA9 A;  3SPZ A;  2Q4P A;  2YID A;  4DV2 B;  3RBZ A;  2EIM B;  3JAR B;  3ABL C;  3SNN A;  1KU9 A;  4FJC C;  2PTM A;  2EIM C;  4DR2 B;  5KX5 A;  2ATQ A;  3CCJ V;  4AQY B;  3ML0 A;  1FZI E;  1WP8 A;  1ORQ C;  3N2G A;  3STZ C;  1IBM B;  1NBM G;  2ZD9 A;  3M7M X;  2R9A A;  3IFX A;  4X64 B;  3TJY A;  3CRC A;  1R3I C;  4LF9 B;  1FXX A;  4I6J B;  1SQG A;  5JQG B;  3QEV A;  4W4K A;  5LYJ A;  1M57 B;  1AI5 A;  1G8M A;  3ASN B;  2VRZ A;  1WA8 A;  1OCR B;  1CPY A;  1GTO A;  3ABM B;  3SDL A;  3CCV V;  2P1M B;  1B6Q A;  2BOB C;  1JJO A;  1M5I A;  5CA0 A;  3ZMT A;  1HR0 B;  1Y4M A;  3VQY A;  5KX5 B;  3K57 A;  2MW2 B;  4IYI A;  4WBN A;  3X2Q B;  1XUQ A;  3ZCC A;  5JH7 B;  1Q6U A;  3JD3 A;  1BS3 A;  4GLX A;  4FPP A;  2B9Z A;  4FJ9 A;  2AGA A;  1S72 V;  1R6T A;  1NU1 H;  1MZF A;  3B40 A;  1H2M A;  1Z2G A;  2GUZ A;  4FFK A;  4MVO A;  3QEX A;  2GTS A;  4PI0 A;  4LF8 B;  1R3K C;  5IBK B;  2UUB O;  2IBZ H;  2YXY A;  2HG5 C;  4LCU C;  1ENV A;  1BQ0 A;  4H37 A;  4E4E A;  2JEX A;  1IZ3 A;  3WG7 C;  3RYH A;  1EFR G;  3K79 A;  5LP6 A;  3LNN A;  2EZP A;  2WLJ A;  2CH7 B;  3CRA A;  1FZ2 E;  3GWO A;  2Z5U A;  3JAM N;  3A0R A;  3G6B A;  3K9S A;  3QEW A;  2R72 A;  2KSD A;  1SZT A;  1L0N H;  4JYB A;  1CLQ A;  3ZRX A;  1Q7Y W;  1H8H G;  2DW4 A;  2ITC C;  1SQP H;  4NTY A;  4QIW F;  5KA6 A;  4QE9 A;  4HBN A;  3NDK A;  4X62 O;  4U3F H;  2GUZ B;  3UT5 B;  2AZ0 A;  3J7A U;  2UUA O;  2LF6 A;  2OVQ B;  5B3S B;  2P5O A;  2WLH A;  4EP9 A;  3RMA A;  5D5Q A;  4LF5 B;  1AR4 A;  3CFP A;  3T1C A;  2WSS G;  3HKC A;  5FL7 G;  1QR8 A;  4OX9 O;  2XTA A;  1YIJ V;  3ZMZ A;  1K9M W;  5LOV B;  4WFH A;  2JHA A;  1MSD A;  1Q86 W;  1M57 C;  4FM0 A;  1H2K A;  1KKC A;  3ABL B;  1P7B A;  4XDK A;  2P90 A;  4O4J B;  4BIU A;  3BVO A;  2E75 B; 
#chains in the Genus database with same CATH homology
 1FPO A;  1FAF A;  2LGW A;  2M6Y A;  1IUR A;  1HDJ A;  2CUG A;  4RWU A;  2QWP B;  2RKH A;  3UCS C;  2DMX A;  2QWQ B;  1NZ6 A;  2EJ7 A;  1BQZ A;  1N4C A;  1BQ0 A;  1N1C A;  2LO1 A;  3APQ A;  2CTQ A;  2CTP A;  2Y4T A;  3AG7 A;  4J7Z A;  3APO A;  2GUZ B;  2QWO B;  2CTW A;  1XBL A;  2YUA A;  3UO3 A;  2CTR A;  2QWN B;  4IT5 A;  3UO2 A;  2QSA A;  1GH6 A;  2DN9 A;  2N05 A;  2YS8 A;  2GUZ A;  2N04 A;  2OCH A;  1WJZ A;  2Y4U A;  3BVO A;  2PF4 E;  2QWR B;  4J80 A;  2L6L A;  2KQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...