3BVOA

Crystal structure of human co-chaperone protein hscb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
197
Chain Sequence
PRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Co-chaperone protein HscB, mitochondrial precursor
publication title Structure of human J-type co-chaperone HscB reveals a tetracysteine metal-binding domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
A PF18256 HscB_4_cys Co-chaperone HscB tetracysteine metal binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3bvoA01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3bvoA02
3BVOA 2KQXA 2QWPB 2QWQB 3AG7A 1NZ6A 2QWRB 2Y4TA 1N1CA 3UCSC 1BQ0A 2OCHA 2DN9A 2LO1A 3UO3A 1GH6A 2YS8A 4IT5A 1FAFA 2GUZB 2YUAA 1FPOA 2Y4UA 2N04A 2CUGA 3UO2A 2LGWA 1HDJA 1WJZA 2GUZA 2CTRA 2N05A 2QWOB 1N4CA 1BQZA 2CTWA 2EJ7A 4J7ZA 2PF4E 2QWNB 2RKHA 2CTPA 2DMXA 1IURA 2QSAA 2M6YA 4RWUA 1XBLA 3APOA 3APQA 4J80A 2L6LA 2CTQA
chains in the Genus database with same CATH superfamily
4DTMA 4YJ2B 2B7MA 5IJ9B 1JW2A 4J2DA 1TUBA 1FS1A 4DO2A 4DRXA 1Y66A 1NT2B 4FM2A 4I55B 4B7EA 1VQNV 1ZAUA 4DV5O 2BOCC 2OCCC 2YEVB 4GLXA 5JWPA 3N1EA 3QO7A 1NTZH 4LFBB 3CJHA 3SQ0A 5CA0B 3LDEA 4ZKIA 1GRJA 1BL8A 1K34A 1HNWB 1XHZA 2QJ1A 5D5QA 1ZL8A 5GONA 2Z5UA 1WPBA 4W4LA 3FB8C 2BTQA 1UFIA 1GM8A 4FJ7A 3K2OA 4DRXB 3ASNB 1F4NA 3DC6A 3JATA 3O9OA 3T4ZA 1BQ0A 1B6QA 3FB7C 2VWKA 1H2SB 5LHHA 1MMOG 5L3BA 3LZIA 2EIKB 1B04A 5K1XA 4DTRA 3E35A 5GONB 2QWNB 1KQSU 2ZR2A 3SI6A 4JI2O 2BTQB 2Q9LA 4I7ZB 4FLUA 5FLXN 2R9RB 4QNDA 4ZOLA 3E89A 1AI6A 2B8IA 3MHHC 3JATB 5IYDO 1PP9H 4KL1A 2JK5C 1GK9A 5DN6G 5KA5A 1HNZB 4H0LB 2DWEC 4TWKA 2CTRA 2ZE8A 2P6JA 3J27A 4DV0B 3RVYA 1GN2A 1X59A 1R6TA 4ZOLB 4DR4B 5LGNA 4AQYB 3BEHA 2GV9A 5EYPA 4MTGA 3EHBB 3EXAA 1W59A 2BOBC 4B3MO 1DLBA 1KP3A 4PA9A 4DV6O 4JI8B 4J10A 3WSOA 1NEXB 5LGTA 4FJ8A 4U3FH 4RUEA 2QE7G 3IAYA 2DOSA 4QE9A 3BRCA 2QXFA 3CMEV 3FAVA 3BAAA 4N21A 4RAIA 2OYQA 3JCUZ 3K5LA 4FZ0A 5EK0A 1FZ9E 2F93B 3K9SA 4FVMA 5LMUO 1PD3A 1I94B 3JAMN 3JASA 2GDSA 5IZ7A 2AXTZ 1J95A 3W7WA 1VF6A 1DK1A 3SNNA 2DYRC 1SQFA 4JI1O 3FAVB 4PA3A 3H1LH 3K5NA 5EBMC 1XOUA 1Q43A 1FZ0E 3HKDA 3ZJZA 1N34O 1RM1C 2N74A 3KKYA 4LFAB 4GKKB 1N33B 1WAJA 5DM6V 2UUBO 2VRZA 4DR7O 2Y48A 3UO3A 1SKVA 1YJ9V 4P9OA 4FJCC 2Q7EA 1VQOV 1IBMB 1XVEE 4DTSA 2OT5A 3JSNA 4X64O 3LD8A 3IC9A 1Q7YW 4ADNA 3J2PA 3CXHF 3HKDB 4JI6O 1BMFG 4DW1A 4J2BA 5CA1B 2GTSA 5IYCO 4CC6A 2CE4A 4CS3A 3AG1B 4UCRA 2IM9A 2FYUH 3OAAG 3ZMVA 1M56B 2JH8A 1TVKA 1XVBE 1HNXB 3TABA 3CCMV 3DGEA 1NH2D 1XREA 5BXZA 2HD0A 3ZHVA 3DSQA 2CH7A 1N36B 5B1AC 3TJYA 4AI8A 1EN5A 2ZDIC 4AHCA 1TVKB 1B3QA 5FL7G 1VIBA 5LP6A 3RT3C 3OW2U 3ABKB 1JR9A 1R3IC 2CTWA 3UT5B 1BT8A 3SYAA 4NXMO 4OX9B 1YJWV 3SJAC 2A06H 3QTCA 3H1KH 2RMKB 1BE3H 4B3RB 4X62B 4G2KA 1AI7A 1LUWA 3SJJA 3HKCA 2AZ2A 2JJ2G 5CBHA 1SQXH 2ILMA 1QLNA 5B3SB 4YIOA 4YY3B 1L8DA 1HR0O 2QM7A 2E5LO 2YXHA 5B66Z 2P7TC 4ZIBA 2A79B 1WA8B 2GTAA 2B1GA 4TUYA 4X66B 1URFA 2EINB 4UV8A 3MDSA 4NYKA 3OGMB 1V54C 2ITCC 2WPDG 1LUVA 3STLC 4B3TO 1XVFE 3GVMA 4O2AA 4MT8A 5H9CA 1SA0A 3DC5A 3AG2C 4FJXA 3LDDA 3G4SV 3E4WA 3JALB 1FZ6E 2F4VB 4KHYA 3H01A 4LF4O 4TUYB 4FJ5A 4DR5O 1SRYA 5KAIZ 3M8AA 3RMDA 4LF8O 3T1HB 2VQFO 4O2AB 1AROP 2AW9A 1SA0B 3ZN0A 3RN4A 2ARHA 3ASOC 3MAQA 3RYHA 3CX5F 2QR4A 3CRMA 3UQ8A 2EBOA 4F6RB 4RUFA 2V1DA 3SCXA 4AKHA 1XU5E 4J80A 1XNRO 4PA4A 4PV1B 1O9GA 2LF6A 4I6JB 5L3GA 2JJ1G 1BHAA 1K73W 3U0ZA 4JZGA 1RSOA 5B1NA 2PYJA 2VJ4A 3RYHB 1YSCA 4DU3A 2L35A 4B3SB 3BPZA 4JTDB 1XQ8A 4JI5O 5H5NA 4LFBO 4TQFA 3TETA 1XHXA 1DF5A 1S5JA 3S9HA 3Q4HA 3AEIA 3UKMA 4X1YA 3CMAV 5E1AC 1RSOB 5IE9A 1MABG 2JHAA 3FX7A 1WB8A 5JCOC 4X65B 2OWOA 5HFMA 2JEUA 2VQEB 1B06A 4EB6A 2ZIMA 4GX2A 3E83A 3P3NA 4GAMC 4BIOA 3CC7V 3Q4HB 5GTHZ 5GW7A 4LWSB 4LF5B 1VQ4V 3NGIA 4LF7O 4YXWG 4X1YB 2JHPA 4UVAA 4DUYO 4DR3O 4J41A 4MS2A 4CC5A 4JF3A 3OTFA 5DECA 3N1BA 1L1FA 3W7SA 5D5PA 1YJNV 1JPXA 3ZN1A 1QVGU 4KI6A 2CDYA 3AG4B 1BQZA 1VQ9V 4GX5A 1SS3A 2YIAA 1W2BU 3HKBA 2EIMC 1ZWIC 4FFBB 1AR5A 2IW5A 1VF7A 4FJGA 2WA3A 3CFOA 3SGIA 3E22A 1FZ8E 5ITZB 4X5MA 1ZUQA 4K0KB 2WLMA 3TGUH 4CH6A 2RNBA 4XDKA 3E8HA 3AK2A 4PA7A 1NQTA 1S5LZ 4LF9O 1K5QA 5IYBO 1X4TA 5IREA 3E22B 1N32B 3JAKA 3C6OB 2ZIOA 4ZHQA 5LHGA 4KI4A 4FJIA 2UUCB 3NHGA 1MSWD 4GKJO 2EIJB 3EFFK 5J9PC 2H8PC 3ETDA 4X1IA 4DK1A 1S72V 1QU7A 4HCCA 1SZTA 3W7TA 4LF6O 1K4DC 1LR1A 2OTJV 3CE2A 1AP5A 1P7BA 2C2AA 4R50A 3VOUA 2UXDB 1Y6XA 3RWUA 1M4UA 1OCOC 1QQCA 4JI0O 4RQFA 5JQGA 3JAKB 4PELA 3E4YA 4ZHQB 3QESA 4DV7O 3SYPA 4CH3A 3SQ1A 1PV0A 3JARA 1Q81W 3ZS8C 4ICGA 1SC5B 4RL5A 1TA8A 1CXZB 2P4VA 4JV5B 1NU1H 1G1XB 3OTOO 4WBNB 4QNCA 4UCVA 3L1NA 3CC2V 3KZIZ 1Q82W 3OE7G 4LCUC 2ATQA 2YI8A 3JARB 2P4KA 3RMAA 3NDKA 1AI5A 3LSUA 5LGUA 3AG3C 3J80N 1US6A 3UM7A 1KP2A 4DR6O 2F23A 2DMXA 2A0LA 1YZBA 1NI8A 1AJNA 1N1CA 5KX5A 5KMGB 1FFXA 1F51A 4N23A 4GCZA 1GAXA 3WFVA 1FXXA 2YICA 4F6EA 1EZVH 4DUZB 2B1EA 2N05A 4L87A 1GM7A 4J2EA 3MD0A 3K04A 5H37A 4RG8A 5KX5B 2GHYA 1FFXB 3IC7A 4JYAO 2YIDA 4FK4A 4OX9O 1XI1A 2HFEC 4WCEV 4IGGA 5LP6C 4DV1O 1FZ1E 1N0NA 2DJVA 1FJGO 1ZX3A 2YDEA 2UU9O 4DTOA 2IJKA 3K08A 1FZ4E 2WLNA 4JRPA 4JI3B 3WU2Z 2P90A 2DQ0A 2Z3YA 4M3RA 4EEQA 1L0NH 2UXNA 1JA8A 2ZXWB 2JDIG 3OM3B 4UCUA 4FJKA 4Z1VA 2JGUA 2Q5ZA 3P3PA 1BHBA 2Y69B 3A2FA 2YEVA 3F5WC 5LMNO 2FMLA 4IIJB 3K59A 1S0VA 5CA0A 2AGAA 4LNUB 4QJFB 3K9AA 1OCZC 1K92A 1K9MW 3C3SA 3OGIB 4ADOA 3J7AU 4BIUA 3ZMTA 3FB5C 3OMNB 2Q73A 4OPAA 5LXTA 4YHHO 4PDVA 1NVPB 1XVGE 4DR1B 1YEWA 2E74B 4GZRB 1VARA 1M57C 2XAHA 3C90A 2LFRA 3FKSG 3SUOA 3SPJA 1WPXA 3ABMC 1TGOA 3X2QC 3RMCA 2ZE7A 5AG2A 1Q8IA 2CK3G 2R9IA 5LXTB 4J7KA 1R6NA 3WB1A 2EILC 3T1CA 3CP1A 2ZD9A 3I56V 3OT7A 1Q9XA 5EBLC 1W0KG 3G6BA 2WAMA 2H3OA 2B5UA 4JYBA 4CZZA 2Q7HA 2DYSB 1XBLA 4LH6A 2KG7B 2ITDC 4WFBV 3QEVA 1YIJV 4TSFG 4O4JA 1G4YB 2Q67A 1M90W 3A0HZ 1XMQO 2Q0OC 4NB5A 2DY4A 2XOKG 4I9LA 2CUGA 4DTJA 3H9VA 3WG7B 1I7FA 1YTFB 2PFVA 1JVMA 1D5AA 2YXLA 2UXCO 2PF4E 1T5EA 2LW7A 3H1IH 3PJSK 5H2FZ 1AB3A 1F4MA 2LP7A 2DTUA 4FFKA 4DV3B 4O4JB 1IX9A 2R70A 4JTAB 4M3WA 1P84F 5KA6A 2ZKOA 3M99B 1FZ2E 1JX9A 3ABTA 3SPCA 1QR8A 4O4LA 2PTMA 5IJ0A 2DE0X 2XHBA 3L75H 2OTLV 2P06A 4X9QA 4NXNB 1K97A 5IY5C 3THOA 4FK0A 4M3UA 4TT3G 1WP7A 2XTAA 4PI2A 3K06A 5LBQA 5CA3A 3K57A 2X7RB 3SPYA 4O4LB 5IJ0B 2R9AA 2JS3A 4WFAV 2ODMA 2DEBA 4QGPA 3K5MA 1D2DA 3TL8B 4X89A 1FXKC 3CD6V 2D2CB 2IBZH 2VJ5A 1KB9F 3ML0A 4QNHB 5KUMA 2QGNA 4NVPA 4KHQA 2OVPB 1I5XA 3RFRA 5CA1A 1SQBH 4FIPC 1NS1A 5L3FA 4H13B 4JASA 2WWWA 3CRAA 2XASA 2BTOA 1V55B 4Q20A 3LUTB 2IH3C 4QPJA 1XMGE 3D36C 4PD4F 1OV9A 3GWOA 2ZT9B 4FLYA 1P49A 4BW9A 4DK0A 3FYIB 4M3TA 3U11A 1QBZA 2GUZA 2OZMA 5E79Z 1IBKB 2JPNA 1OCCC 3QF7A 2HVKC 5KHHA 4WFEA 2OVQB 3JD4A 4JI4O 4PDRA 4MTXA 2V7QG 3UT5A 2YI9A 4I5SA 5B1BC 1QLEB 1BSMA 1JJOA 5B5EZ 1J5EB 1N0JA 4LFCB 2EZOA 4FLTA 5BR8B 2GUZB 5KLVH 3T1YO 4F4LA 2YXYA 1A32A 2G38A 3ABLC 5KHIA 1H8HG 4DV2O 4IHJA 3RWRD 3TK1A 1QHTA 1KD1W 4UVBA 1Y67A 1FZ3E 3L9DA 1R6KA 3CFPA 1Q9YA 1OCRC 3K03A 1WA8A 3AG7A 2QWRB 2M7WA 4DV4B 4MTOA 3K58A 3QO5A 4B08A 1AI4A 2EJRA 2HHHO 2RCUA 1MA1A 1M1KW 1WJZA 2ZE5A 3E8FA 4JAVA 1SQQH 4IHJB 4O4IA 1KUQA 4KHPO 1CPYA 3JALA 2XAFA 3NCIA 3BFRA 4NR1A 4E4BA 3ZHUA 5H6QA 4H37A 1PNKA 4IL6Z 2LO1A 1CLQA 1XEQA 3E2EA 4O4IB 2BSKA 5EC1C 2UXBB 1YXBA 4CBCA 2H4TA 1JJ2U 4RWUA 2HKOA 4FK5C 4MVSA 4F6RA 4DR2O 4E4EA 2VS0A 2AZ0A 3C6PB 1EM1A 1XDCA 3OEHG 3ZMZA 1WAZA 2PUSA 2MK3A 2JS5A 1FS0G 2BSKB 1OCZB 1R1BA 1NR7A 3CWBH 5A9GA 2P1QB 2P22C 1AR1B 4LP8A 2F43G 1WAFA 1PL4A 2F95B 1GKFA 4DV5B 3OFNG 3CXCU 3NR7A 3OUFA 2FTKA 5FNVB 2OCCB 4I4TA 3JD2A 4IT5A 3QERA 1OJHA 5CBGA 2WLLA 2RJZA 4RNGA 4DR1O 5JJNB 3TAGA 2LFSA 3C6NB 3APQA 2LJ2A 4LBEC 5BZBA 4KP4A 1SETA 2XAJA 1FZHE 5LL6Y 1PNLA 1HNWO 1Y76A 4LWSA 2Y4TA 2YB5A 4I4TB 4CH5A 2OVRB 3ASNC 3IJ4A 2PZSA 4JI2B 1G6UA 2RQ6A 3ICXA 4Z1MG 2WLLB 2P1MB 2ZM6B 4BWAA 2EIKC 4UXNA 3QEIA 4EFEA 4JPRA 2XUMA 1VQ5V 1ROPA 1Y76B 4FFBA 3F5TA 4O4HA 4XDJA 1QVFU 2K9PA 5ITZA 1Q90D 4MVOA 1O9HA 2LW1A 1AJPA 4I9WA 1HDJA 3K79A 4NKGB 3CFRA 1XVDE 1K33A 4DU1A 1HNZO 4B3MB 3L73H 3APOA 4DV6B 5KAFZ 1DF4A 1Z2GA 4DV0O 5KHJA 4O4HB 2QWPB 4QIWF 2QTOA 2LF3A 1ZLZA 2X6CA 2A3QA 1WB7A 1XL3C 5JJJB 4DR4O 4AQYO 4U3JA 2KKWA 4PJ0Z 1IVSA 2MZWB 3NE6A 1SQGA 4FK2A 1TAEA 3DTUB 4RO2A 5C8YB 5LMUB 3TXSA 2RCVA 4JI8O 2HEPA 3HP9A 1ZSPA 1YF2A 4FM1A 1M9NA 4CS2A 5KUKA 5FPOA 2X6BA 2EZPA 1EZJA 5FPRA 4HCBA 1XL4A 1VQ7V 4U3JB 4JI1B 1UJWB 1R3JC 1NJIW 2OZSA 2E76B 2QKSA 4J42A 2K5SA 1N34B 2DYRB 1XL6A 1RFYA 1I94O 5H6RA 1MMMA 3M7MX 3S3XA 4GYCB 2VWJA 2UUBB 1DGSA 2PYLA 1WP8A 1RM1B 4FJJA 1RPRA 2EULA 3MHSC 4M3XA 4WBNA 5BY1A 4G27B 2HP8A 3CRCA 1I0HA 1NR1A 4X64B 4DW0A 5K1PA 5J2UA 2XAGA 3SPZA 2NR5A 4JI6B 1F23A 3QNOA 4LFAO 1N33O 4GKKO 4BAYA 1VF6C 5IYZB 2CTPA 1ZTEA 4GT1A 1FYJA 5IBKB 3JAWA 4EKWA 1IBMO 5KMGA 3ETEA 5EZYA 3HPLC 5J2UB 3A0RA 2D3OW 4JZ2A 3UIQA 2ZDIA 1EN6A 3AG1C 3SYCA 3QETA 1SQVH 2P1NB 1N4CA 3BHPA 1M56C 4Z2WA 2IU3A 3CCLV 3MKSB 1GN3A 3JAWB 1MNGA 4U7NA 2Q7GA 4JI7B 1HNXO 3KCYA 2QDOA 3OUSA 4J9YB 5EZYB 5B1AB 2Y0PA 4FMTA 5KHKA 4M42A 4NXMB 1NTMH 2W0XA 5JVDA 2MW2A 3AK1A 4NTWA 4TQDA 3OR6C 1R3LC 2Q69A 1MOFA 3G6EV 1N36O 3ABKC 3G71V 2FW3A 4UB6Z 4YJ3B 4K8ZA 4KHWA 2R72A 1JFFA 1VQLV 1DTOA 1Q3EA 1S5HC 1FXVA 2UUAB 4O2BA 1V9PA 1HR0B 4KHUA 4LR3A 1YITV 1MTYG 2V4DA 5JVDB 2WLIA 2MW2B 4B3RO 4X62O 4JTCB 5EBWC 2KB1A 1GN6A 1JFFB 4IIJA 2QM4A 1WNSA 4LNUA 5IWAB 4GX0A 1KKDA 4YY3O 4EP9A 2A9HA 4B3TB 2JGDA 4O2BB 3ZMSA 2QWQB 1V54B 3N2KB 1GN4A 3OGKB 3E8BA 2EINC 3I5DA 2WLIB 4J9ZB 3CCEV 2NLJC 2ZINA 1JOYA 3AG2B 4LF4B 4JRQA 2FKXA 4X66O 1N8RW 1YHQV 3JYCA 1VF5B 4MVUA 4DR5B 3ZHRA 1IBLB 1XMOB 4LF8B 3FFQA 2P1OB 2BCCH 2JGDB 4J11A 4GUNA 3L0MA 2PI5A 3DXRB 1XU3E 2UXBO 5JH7B 2F4VO 3I55V 1KYOF 3VQYA 2DQ3A 4MTFA 3ZHSA 2F66C 3ASOB 2YIBA 1XNRB 2IJHA 3B09A 1FD9A 3T1HO 2M6YA 1K8AW 5HFLA 2HJFC 1IDSA 4NTYA 3LNNA 5GTIZ 4FJ9A 4D6TH 2XT9A 4PHZA 2KG7A 3R65A 1XILA 3C95A 2RDCA 1WLEA 4P30A 4JI5B 2ZR3A 2ETNA 4JS5A 1FPOA 3SPHA 1OHHG 5JCOA 1VQ6V 3RBZA 3QNNA 1NBMG 4WF9V 2FB5A 2AHYA 4ZBMA 1TUBB 4B3SO 4Q6GA 1YDXA 2Q4PA 4FLVA 3LZJA 1BS3A 4YIPA 3CJHB 1LNQA 4OGQB 1SF9A 1XNQB 1Q6UA 1QCEA 1Q6HA 1ZL8B 4LF7B 4I0XA 4XDLA 4DUYB 4DR3B 2QSAA 3H1HH 1GMGA 4AKGA 2ZM6O 3SUNA 1Q5OA 4X65O 2CGOA 1FZ7E 1SZXA 3F7VC 4TV8A 2VQEO 3WB2A 3LDSA 4WFGA 3T2MA 1YCIA 3O65A 1KU9A 4LF5O 1EN4A 1Q86W 4I0XB 3OMIB 2AHZA 4H33A 3CRQA 3AG4C 3QG5A 3VQXA 3C94A 2EIMB 3D3IA 1IZ3A 3KD1E 4HZ3A 2IJJA 4TV8B 5LOVA 2JIZG 4MW3A 1RP3B 2WSSG 4K35A 1K7DA 1QNMA 4BIZA 4IYIA 2B1IA 2E31A 4HAMA 1G8MA 4M3YA 4LF9B 3JD0A 1MHYG 4UCOA 4K0KO 1PNMA 2RKHA 4EFBA 5EYPB 5LOVB 4TV9A 2HG5C 3WB0A 4GKJB 3STZC 1FYZE 2LGQA 4FPPA 4LF6B 1P22A 2W0FC 3B8MA 1XMFE 2YC0A 2Q68A 1SERA 1N32O 2KSDA 1S76D 5KHGA 3RYFA 2EIJC 4FLWA 4JI0B 4M45A 3LNMB 5L3CA 3RMBA 2UUCO 3SYOA 4DV7B 1Q6IA 3ZHQA 4TV9B 4FJLA 1OCOB 1KC8W 5A2QN 3SJQC 5IT9N 2HR3A 2Q8VA 4P9PA 3JASB 4E2LA 4X20A 4KHNA 1NTKH 2UXDO 1U97A 1Y74A 2PGGA 4KXRA 2Q0AA 3RYFB 3OTOB 4I50A 3OR7C 3CCRV 1W0JG 3T4DA 1K3EA 4HBNA 4KUMA 4J7ZA 5JJEB 4H44B 4UB8Z 2H94A 4XBFA 3CC4V 1FAFA 4DU4A 4U7OA 5F2VO 3SQ2A 3BVOA 4JV5O 4X20B 4DR6B 1FXHA 4M3ZA 1Y74B 4KHSA 1IXBA 3A0BZ 4I50B 3AG3B 4ICGC 2ZE6A 3SVIA 3TAFA 1IXMA 2E3CA 4X88A 4JS4A 1P7GA 2PY5A 5CN0A 3ZRVA 3CCUV 3CQ8A 4E3SA 3IFXA 1P4RA 4BW5A 3QEXA 3K0DA 2QM8A 3OMAB 4WFHA 2CGNA 3QVNA 3P30A 1UPGA 1H38A 1AR4A 1H2GA 2CAZC 3SJCC 3HR0A 3N2GA 4JI7O 4FJMA 4QPKA 2A7WA 2IH1C 3TJTA 1MSDA 2ZCEA 5LYJA 4R7CA 3SPGA 1JMKC 4JYAB 1VQ8V 3B8NA 1NKDA 2JRIA 1YI2V 1M93A 5B1OA 3ETGA 2CTQA 4PI0A 2X6AA 1H2MA 4DUZO 1I5YA 4DV1B 4X8AA 3L8BA 2X0LA 2CH7B 3L72H 3N2GB 1FJGB 2UU9B 1EFRG 4UFZA 5LP6B 2UUAO 1FFTB 3JD1A 5LYJB 3L2OB 1E1RG 4JYCA 1FZIE 2QWOB 3LDCA 3QO8A 2HVJC 1H2KA 3G67A 3CRRA 2Y0IA 2L6LA 5EC2C 1THZA 3BA9A 2Z0AA 3HKCB 4W4KA 3ZX6A 5LMNB 4OXSA 3CCSV 5IWAO 2WLJA 4JAAA 2ZXWC 2VIXA 4JI3O 5FNVA 1I08A 3KG2A 4OPHA 2DN9A 1E79G 4JGSA 1IH7A 5EIBC 4AKIA 2O57A 2Y69C 4FLZA 3BABA 1VP7A 1OZ0A 3HGKE 4ASUG 5J2TA 2XAQA 4YHHB 1HW7A 1KECA 1R3KC 3OGLB 3CB2A 3CYOA 2WLKA 3RYCA 1IBLO 1XMOO 3ZCCA 1PPJH 4MVZA 2JHCA 4UUJC 2QA4V 1PM9A 2ADPA 1M57B 2YUAA 1RPOA 2LGWA 1COWG 2QKCA 2LQTA 3SJBC 5J2TB 1QR9A 4D7TA 4J7JA 1XVCE 3SR2C 3ABMB 3X2QB 5C93A 3JSLA 3FYEB 3RYCB 2DW4A 3CCJV 2IU0A 2KQXA 2FL4A 2EILB 4FJHA 3UCSC 1NH2B 4MW8A 3B40A 3OD4A 3SDLA 3D3QA 4DTXA 5TISZ 3CEIA 3VQVA 3RW0A 3K5OA 1XMQB 1GO3F 2DYSC 3SUPA 2RN9A 3A8TA 3BCCH 2ADQB 3NXSA 3W7UA 3V7DB 1MHZG 2UXCB 5L3EA 4M41A 3FD9A 2YS8A 1ORQC 2EX3A 1VQMV 2N04A 4K3AA 5BMVA 1CEZA 1Z5WA 5CBFA 3WG7C 2ATKC 3RGBA 3R66A 4DXWA 1XNQO 5C8YA 2GSMB 1XUQA 3H1JH 3AK3A 4WFFA 1ENVA 2ZNJA 3CHXA 2HJDA 2P5GA 1PL0A 3W7XA 2K1EA 4DV3O 3CPWU 2Y4UA 3UO2A 4EB6B 5BMVB 3TCUA 3ZHTA 2F1MA 3QEPA 2GBOA 2EJ7A 1XMHE 4FM0A 5IY5B 4G28B 1WN7A 1AJQA 4EYWA 1FXKA 4BR6A 2JVDA 3ZRSA 2QKAA 4A5UB 4R6ZA 1F7YA 3C3TA 1E1QG 2HLDG 1IG9A 3BA8A 4DTNA 1H8EG 5CB4A 4NXNO 3ZBHA 1VQKV 1S3JA 4MVMA 1HP8A 3OGCC 1MG1A 4JAUA 4CS4A 3L71H 4PDLA 3HKBB 1YVWA 4LH7A 3SPIA 1JQ0A 1FXKB 5IYZA 3PN1A 5DEDA 5EIBD 4DR7B 1CP9A 2QTSA 4AI6A 3D36A 1KMIZ 3QNEA 5CB4B 2FYOA 4HNAA 3LSQA 4FLXA 3SUQA 3F7YC 3P32A 2JEXA 2IJIA 4RQEA 1SESA 3JCZA 4B7KA 1H2NA 4X5NA 5LA6A 4QE7A 3EVKA 2OIEA 3GWKC 1NVPD 3QEWA 3CCVV 4PA6A 3S3WA 1BZKA 1V55C 3FB6C 3L70H 4HNAB 5LHIA 3RYIA 2PI4A 4K8XA 2E32A 2E75B 2OCHA 4X1IB 4HYOA 2P67A 4P2ZA 4JI4B 3G80A 3ZRXA 2W6JG 1OCCB 5LA6B 1GTOA 2Q6AA 2BE3A 4FJNA 1KKCA 4CH4A 3J81N 5JQGB 2YIBD 4YJ3A 2OIGA 1IBKO 3T1YB 3RYIB 4I9QA 5B1BB 3HGLA 4J2AA 1VMGA 4DV2B 4PDMA 3JD3A 4DYLA 1QLEC 5CMUA 3K3WA 3B77A 4KFMA 3TXQA 3ABLB 1H2LA 3LSSA 1AVMA 3B4SA 4D7SA 1S77D 3K0GA 4ABMA 3U10A 1J5EO 4LFCO 1AP6A 5BR8O 1VEWA 3ABUA 4TOIA 3E86A 1BGYH 1OCRB 2XNDG 2HHHB 2WLHA 1L0LH 2W6IG 5IDJA 4NTXA 1NZ6A 1VQPV 1YTFD 3CSXA 4UV9A 3E8GA 2P5OA 3ZRWA 2E5LB 2ZQMA 3N2KA 4MVRA 4KHPB 4L8JA 2JQTA 4JYYA 4X1KA 4DV4O 5B3SC 3KD5E 2B9ZA 1IURA 4DTUA 4R8CA 2UXXA 3N27A 3HL8A 3NAEA 3VQWA 1BCCH 2WA4A 3OEEG 4UCTA 1U96A 4DTPA 1MZFA 1PKXA 3ETQA 1SQPH 3ZRWB 3ZEDA 3B2EE 3TAEA 3DXRA 4ZI7A 1JCHA 3LDBA 3SQ4A 3CCQV 2MMBA 1R73A 3HKEA 5L3DA 1Z5VA 3KCXA 5JH7A 3BY6A 2PFTA 4X1KB 4GX1A 4DR2B 1LDKE 1MZEA 4AILC 1HWYA 2P1PB 2NNUA 1K5SA 1FZ5E 1D5NA 4UVCA 1EBOA 4UCSA 2VQFB 3D8CA 3IGAC 4YJ2A 1KBHA 2YSUB 4ZI7B 3CS5A 5IJ9A 1Y4MA 2QEXV 3HKEB 4MVQA 4FZ1A 3ZIAG 1K4CC 3GB7C 4MSWC 4I55A 1GH6A 3VBBA 1AILA 4EPHA 2JH9A 3HB3B 3ZMUA 4C7UA 3L74H 1TUEB 2ZNIA 2DWDC 3SYQA 4IYHA 1GM9A 2NN4A 3RVZA 4LC1A 1M5IA 1FKAO
chains in the Genus database with same CATH topology
3BVOA 2KQXA 2QWPB 2QWQB 3AG7A 1NZ6A 2QWRB 2Y4TA 1N1CA 3UCSC 1BQ0A 2OCHA 2DN9A 2LO1A 3UO3A 1GH6A 2YS8A 4IT5A 1FAFA 2GUZB 2YUAA 1FPOA 2Y4UA 2N04A 2CUGA 3UO2A 2LGWA 1HDJA 1WJZA 2GUZA 2CTRA 2N05A 2QWOB 1N4CA 1BQZA 2CTWA 2EJ7A 4J7ZA 2PF4E 2QWNB 2RKHA 2CTPA 2DMXA 1IURA 2QSAA 2M6YA 4RWUA 1XBLA 3APOA 3APQA 4J80A 2L6LA 2CTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BVO A;  2KQX A;  2QWP B;  2QWQ B;  3AG7 A;  1NZ6 A;  2QWR B;  2Y4T A;  1N1C A;  3UCS C;  1BQ0 A;  2OCH A;  2DN9 A;  2LO1 A;  3UO3 A;  1GH6 A;  2YS8 A;  4IT5 A;  1FAF A;  2GUZ B;  2YUA A;  1FPO A;  2Y4U A;  2N04 A;  2CUG A;  3UO2 A;  2LGW A;  1HDJ A;  1WJZ A;  2GUZ A;  2CTR A;  2N05 A;  2QWO B;  1N4C A;  1BQZ A;  2CTW A;  2EJ7 A;  4J7Z A;  2PF4 E;  2QWN B;  2RKH A;  2CTP A;  2DMX A;  1IUR A;  2QSA A;  2M6Y A;  4RWU A;  1XBL A;  3APO A;  3APQ A;  4J80 A;  2L6L A;  2CTQ A; 
#chains in the Genus database with same CATH topology
 4DTM A;  4YJ2 B;  2B7M A;  5IJ9 B;  1JW2 A;  4J2D A;  1TUB A;  1FS1 A;  4DO2 A;  4DRX A;  1Y66 A;  1NT2 B;  4FM2 A;  4I55 B;  4B7E A;  1VQN V;  1ZAU A;  4DV5 O;  2BOC C;  2OCC C;  2YEV B;  4GLX A;  5JWP A;  3N1E A;  3QO7 A;  1NTZ H;  4LFB B;  3CJH A;  3SQ0 A;  5CA0 B;  3LDE A;  4ZKI A;  1GRJ A;  1BL8 A;  1K34 A;  1HNW B;  1XHZ A;  2QJ1 A;  5D5Q A;  1ZL8 A;  5GON A;  2Z5U A;  1WPB A;  4W4L A;  3FB8 C;  2BTQ A;  1UFI A;  1GM8 A;  4FJ7 A;  3K2O A;  4DRX B;  3ASN B;  1F4N A;  3DC6 A;  3JAT A;  3O9O A;  3T4Z A;  1BQ0 A;  1B6Q A;  3FB7 C;  2VWK A;  1H2S B;  5LHH A;  1MMO G;  5L3B A;  3LZI A;  2EIK B;  1B04 A;  5K1X A;  4DTR A;  3E35 A;  5GON B;  2QWN B;  1KQS U;  2ZR2 A;  3SI6 A;  4JI2 O;  2BTQ B;  2Q9L A;  4I7Z B;  4FLU A;  5FLX N;  2R9R B;  4QND A;  4ZOL A;  3E89 A;  1AI6 A;  2B8I A;  3MHH C;  3JAT B;  5IYD O;  1PP9 H;  4KL1 A;  2JK5 C;  1GK9 A;  5DN6 G;  5KA5 A;  1HNZ B;  4H0L B;  2DWE C;  4TWK A;  2CTR A;  2ZE8 A;  2P6J A;  3J27 A;  4DV0 B;  3RVY A;  1GN2 A;  1X59 A;  1R6T A;  4ZOL B;  4DR4 B;  5LGN A;  4AQY B;  3BEH A;  2GV9 A;  5EYP A;  4MTG A;  3EHB B;  3EXA A;  1W59 A;  2BOB C;  4B3M O;  1DLB A;  1KP3 A;  4PA9 A;  4DV6 O;  4JI8 B;  4J10 A;  3WSO A;  1NEX B;  5LGT A;  4FJ8 A;  4U3F H;  4RUE A;  2QE7 G;  3IAY A;  2DOS A;  4QE9 A;  3BRC A;  2QXF A;  3CME V;  3FAV A;  3BAA A;  4N21 A;  4RAI A;  2OYQ A;  3JCU Z;  3K5L A;  4FZ0 A;  5EK0 A;  1FZ9 E;  2F93 B;  3K9S A;  4FVM A;  5LMU O;  1PD3 A;  1I94 B;  3JAM N;  3JAS A;  2GDS A;  5IZ7 A;  2AXT Z;  1J95 A;  3W7W A;  1VF6 A;  1DK1 A;  3SNN A;  2DYR C;  1SQF A;  4JI1 O;  3FAV B;  4PA3 A;  3H1L H;  3K5N A;  5EBM C;  1XOU A;  1Q43 A;  1FZ0 E;  3HKD A;  3ZJZ A;  1N34 O;  1RM1 C;  2N74 A;  3KKY A;  4LFA B;  4GKK B;  1N33 B;  1WAJ A;  5DM6 V;  2UUB O;  2VRZ A;  4DR7 O;  2Y48 A;  3UO3 A;  1SKV A;  1YJ9 V;  4P9O A;  4FJC C;  2Q7E A;  1VQO V;  1IBM B;  1XVE E;  4DTS A;  2OT5 A;  3JSN A;  4X64 O;  3LD8 A;  3IC9 A;  1Q7Y W;  4ADN A;  3J2P A;  3CXH F;  3HKD B;  4JI6 O;  1BMF G;  4DW1 A;  4J2B A;  5CA1 B;  2GTS A;  5IYC O;  4CC6 A;  2CE4 A;  4CS3 A;  3AG1 B;  4UCR A;  2IM9 A;  2FYU H;  3OAA G;  3ZMV A;  1M56 B;  2JH8 A;  1TVK A;  1XVB E;  1HNX B;  3TAB A;  3CCM V;  3DGE A;  1NH2 D;  1XRE A;  5BXZ A;  2HD0 A;  3ZHV A;  3DSQ A;  2CH7 A;  1N36 B;  5B1A C;  3TJY A;  4AI8 A;  1EN5 A;  2ZDI C;  4AHC A;  1TVK B;  1B3Q A;  5FL7 G;  1VIB A;  5LP6 A;  3RT3 C;  3OW2 U;  3ABK B;  1JR9 A;  1R3I C;  2CTW A;  3UT5 B;  1BT8 A;  3SYA A;  4NXM O;  4OX9 B;  1YJW V;  3SJA C;  2A06 H;  3QTC A;  3H1K H;  2RMK B;  1BE3 H;  4B3R B;  4X62 B;  4G2K A;  1AI7 A;  1LUW A;  3SJJ A;  3HKC A;  2AZ2 A;  2JJ2 G;  5CBH A;  1SQX H;  2ILM A;  1QLN A;  5B3S B;  4YIO A;  4YY3 B;  1L8D A;  1HR0 O;  2QM7 A;  2E5L O;  2YXH A;  5B66 Z;  2P7T C;  4ZIB A;  2A79 B;  1WA8 B;  2GTA A;  2B1G A;  4TUY A;  4X66 B;  1URF A;  2EIN B;  4UV8 A;  3MDS A;  4NYK A;  3OGM B;  1V54 C;  2ITC C;  2WPD G;  1LUV A;  3STL C;  4B3T O;  1XVF E;  3GVM A;  4O2A A;  4MT8 A;  5H9C A;  1SA0 A;  3DC5 A;  3AG2 C;  4FJX A;  3LDD A;  3G4S V;  3E4W A;  3JAL B;  1FZ6 E;  2F4V B;  4KHY A;  3H01 A;  4LF4 O;  4TUY B;  4FJ5 A;  4DR5 O;  1SRY A;  5KAI Z;  3M8A A;  3RMD A;  4LF8 O;  3T1H B;  2VQF O;  4O2A B;  1ARO P;  2AW9 A;  1SA0 B;  3ZN0 A;  3RN4 A;  2ARH A;  3ASO C;  3MAQ A;  3RYH A;  3CX5 F;  2QR4 A;  3CRM A;  3UQ8 A;  2EBO A;  4F6R B;  4RUF A;  2V1D A;  3SCX A;  4AKH A;  1XU5 E;  4J80 A;  1XNR O;  4PA4 A;  4PV1 B;  1O9G A;  2LF6 A;  4I6J B;  5L3G A;  2JJ1 G;  1BHA A;  1K73 W;  3U0Z A;  4JZG A;  1RSO A;  5B1N A;  2PYJ A;  2VJ4 A;  3RYH B;  1YSC A;  4DU3 A;  2L35 A;  4B3S B;  3BPZ A;  4JTD B;  1XQ8 A;  4JI5 O;  5H5N A;  4LFB O;  4TQF A;  3TET A;  1XHX A;  1DF5 A;  1S5J A;  3S9H A;  3Q4H A;  3AEI A;  3UKM A;  4X1Y A;  3CMA V;  5E1A C;  1RSO B;  5IE9 A;  1MAB G;  2JHA A;  3FX7 A;  1WB8 A;  5JCO C;  4X65 B;  2OWO A;  5HFM A;  2JEU A;  2VQE B;  1B06 A;  4EB6 A;  2ZIM A;  4GX2 A;  3E83 A;  3P3N A;  4GAM C;  4BIO A;  3CC7 V;  3Q4H B;  5GTH Z;  5GW7 A;  4LWS B;  4LF5 B;  1VQ4 V;  3NGI A;  4LF7 O;  4YXW G;  4X1Y B;  2JHP A;  4UVA A;  4DUY O;  4DR3 O;  4J41 A;  4MS2 A;  4CC5 A;  4JF3 A;  3OTF A;  5DEC A;  3N1B A;  1L1F A;  3W7S A;  5D5P A;  1YJN V;  1JPX A;  3ZN1 A;  1QVG U;  4KI6 A;  2CDY A;  3AG4 B;  1BQZ A;  1VQ9 V;  4GX5 A;  1SS3 A;  2YIA A;  1W2B U;  3HKB A;  2EIM C;  1ZWI C;  4FFB B;  1AR5 A;  2IW5 A;  1VF7 A;  4FJG A;  2WA3 A;  3CFO A;  3SGI A;  3E22 A;  1FZ8 E;  5ITZ B;  4X5M A;  1ZUQ A;  4K0K B;  2WLM A;  3TGU H;  4CH6 A;  2RNB A;  4XDK A;  3E8H A;  3AK2 A;  4PA7 A;  1NQT A;  1S5L Z;  4LF9 O;  1K5Q A;  5IYB O;  1X4T A;  5IRE A;  3E22 B;  1N32 B;  3JAK A;  3C6O B;  2ZIO A;  4ZHQ A;  5LHG A;  4KI4 A;  4FJI A;  2UUC B;  3NHG A;  1MSW D;  4GKJ O;  2EIJ B;  3EFF K;  5J9P C;  2H8P C;  3ETD A;  4X1I A;  4DK1 A;  1S72 V;  1QU7 A;  4HCC A;  1SZT A;  3W7T A;  4LF6 O;  1K4D C;  1LR1 A;  2OTJ V;  3CE2 A;  1AP5 A;  1P7B A;  2C2A A;  4R50 A;  3VOU A;  2UXD B;  1Y6X A;  3RWU A;  1M4U A;  1OCO C;  1QQC A;  4JI0 O;  4RQF A;  5JQG A;  3JAK B;  4PEL A;  3E4Y A;  4ZHQ B;  3QES A;  4DV7 O;  3SYP A;  4CH3 A;  3SQ1 A;  1PV0 A;  3JAR A;  1Q81 W;  3ZS8 C;  4ICG A;  1SC5 B;  4RL5 A;  1TA8 A;  1CXZ B;  2P4V A;  4JV5 B;  1NU1 H;  1G1X B;  3OTO O;  4WBN B;  4QNC A;  4UCV A;  3L1N A;  3CC2 V;  3KZI Z;  1Q82 W;  3OE7 G;  4LCU C;  2ATQ A;  2YI8 A;  3JAR B;  2P4K A;  3RMA A;  3NDK A;  1AI5 A;  3LSU A;  5LGU A;  3AG3 C;  3J80 N;  1US6 A;  3UM7 A;  1KP2 A;  4DR6 O;  2F23 A;  2DMX A;  2A0L A;  1YZB A;  1NI8 A;  1AJN A;  1N1C A;  5KX5 A;  5KMG B;  1FFX A;  1F51 A;  4N23 A;  4GCZ A;  1GAX A;  3WFV A;  1FXX A;  2YIC A;  4F6E A;  1EZV H;  4DUZ B;  2B1E A;  2N05 A;  4L87 A;  1GM7 A;  4J2E A;  3MD0 A;  3K04 A;  5H37 A;  4RG8 A;  5KX5 B;  2GHY A;  1FFX B;  3IC7 A;  4JYA O;  2YID A;  4FK4 A;  4OX9 O;  1XI1 A;  2HFE C;  4WCE V;  4IGG A;  5LP6 C;  4DV1 O;  1FZ1 E;  1N0N A;  2DJV A;  1FJG O;  1ZX3 A;  2YDE A;  2UU9 O;  4DTO A;  2IJK A;  3K08 A;  1FZ4 E;  2WLN A;  4JRP A;  4JI3 B;  3WU2 Z;  2P90 A;  2DQ0 A;  2Z3Y A;  4M3R A;  4EEQ A;  1L0N H;  2UXN A;  1JA8 A;  2ZXW B;  2JDI G;  3OM3 B;  4UCU A;  4FJK A;  4Z1V A;  2JGU A;  2Q5Z A;  3P3P A;  1BHB A;  2Y69 B;  3A2F A;  2YEV A;  3F5W C;  5LMN O;  2FML A;  4IIJ B;  3K59 A;  1S0V A;  5CA0 A;  2AGA A;  4LNU B;  4QJF B;  3K9A A;  1OCZ C;  1K92 A;  1K9M W;  3C3S A;  3OGI B;  4ADO A;  3J7A U;  4BIU A;  3ZMT A;  3FB5 C;  3OMN B;  2Q73 A;  4OPA A;  5LXT A;  4YHH O;  4PDV A;  1NVP B;  1XVG E;  4DR1 B;  1YEW A;  2E74 B;  4GZR B;  1VAR A;  1M57 C;  2XAH A;  3C90 A;  2LFR A;  3FKS G;  3SUO A;  3SPJ A;  1WPX A;  3ABM C;  1TGO A;  3X2Q C;  3RMC A;  2ZE7 A;  5AG2 A;  1Q8I A;  2CK3 G;  2R9I A;  5LXT B;  4J7K A;  1R6N A;  3WB1 A;  2EIL C;  3T1C A;  3CP1 A;  2ZD9 A;  3I56 V;  3OT7 A;  1Q9X A;  5EBL C;  1W0K G;  3G6B A;  2WAM A;  2H3O A;  2B5U A;  4JYB A;  4CZZ A;  2Q7H A;  2DYS B;  1XBL A;  4LH6 A;  2KG7 B;  2ITD C;  4WFB V;  3QEV A;  1YIJ V;  4TSF G;  4O4J A;  1G4Y B;  2Q67 A;  1M90 W;  3A0H Z;  1XMQ O;  2Q0O C;  4NB5 A;  2DY4 A;  2XOK G;  4I9L A;  2CUG A;  4DTJ A;  3H9V A;  3WG7 B;  1I7F A;  1YTF B;  2PFV A;  1JVM A;  1D5A A;  2YXL A;  2UXC O;  2PF4 E;  1T5E A;  2LW7 A;  3H1I H;  3PJS K;  5H2F Z;  1AB3 A;  1F4M A;  2LP7 A;  2DTU A;  4FFK A;  4DV3 B;  4O4J B;  1IX9 A;  2R70 A;  4JTA B;  4M3W A;  1P84 F;  5KA6 A;  2ZKO A;  3M99 B;  1FZ2 E;  1JX9 A;  3ABT A;  3SPC A;  1QR8 A;  4O4L A;  2PTM A;  5IJ0 A;  2DE0 X;  2XHB A;  3L75 H;  2OTL V;  2P06 A;  4X9Q A;  4NXN B;  1K97 A;  5IY5 C;  3THO A;  4FK0 A;  4M3U A;  4TT3 G;  1WP7 A;  2XTA A;  4PI2 A;  3K06 A;  5LBQ A;  5CA3 A;  3K57 A;  2X7R B;  3SPY A;  4O4L B;  5IJ0 B;  2R9A A;  2JS3 A;  4WFA V;  2ODM A;  2DEB A;  4QGP A;  3K5M A;  1D2D A;  3TL8 B;  4X89 A;  1FXK C;  3CD6 V;  2D2C B;  2IBZ H;  2VJ5 A;  1KB9 F;  3ML0 A;  4QNH B;  5KUM A;  2QGN A;  4NVP A;  4KHQ A;  2OVP B;  1I5X A;  3RFR A;  5CA1 A;  1SQB H;  4FIP C;  1NS1 A;  5L3F A;  4H13 B;  4JAS A;  2WWW A;  3CRA A;  2XAS A;  2BTO A;  1V55 B;  4Q20 A;  3LUT B;  2IH3 C;  4QPJ A;  1XMG E;  3D36 C;  4PD4 F;  1OV9 A;  3GWO A;  2ZT9 B;  4FLY A;  1P49 A;  4BW9 A;  4DK0 A;  3FYI B;  4M3T A;  3U11 A;  1QBZ A;  2GUZ A;  2OZM A;  5E79 Z;  1IBK B;  2JPN A;  1OCC C;  3QF7 A;  2HVK C;  5KHH A;  4WFE A;  2OVQ B;  3JD4 A;  4JI4 O;  4PDR A;  4MTX A;  2V7Q G;  3UT5 A;  2YI9 A;  4I5S A;  5B1B C;  1QLE B;  1BSM A;  1JJO A;  5B5E Z;  1J5E B;  1N0J A;  4LFC B;  2EZO A;  4FLT A;  5BR8 B;  2GUZ B;  5KLV H;  3T1Y O;  4F4L A;  2YXY A;  1A32 A;  2G38 A;  3ABL C;  5KHI A;  1H8H G;  4DV2 O;  4IHJ A;  3RWR D;  3TK1 A;  1QHT A;  1KD1 W;  4UVB A;  1Y67 A;  1FZ3 E;  3L9D A;  1R6K A;  3CFP A;  1Q9Y A;  1OCR C;  3K03 A;  1WA8 A;  3AG7 A;  2QWR B;  2M7W A;  4DV4 B;  4MTO A;  3K58 A;  3QO5 A;  4B08 A;  1AI4 A;  2EJR A;  2HHH O;  2RCU A;  1MA1 A;  1M1K W;  1WJZ A;  2ZE5 A;  3E8F A;  4JAV A;  1SQQ H;  4IHJ B;  4O4I A;  1KUQ A;  4KHP O;  1CPY A;  3JAL A;  2XAF A;  3NCI A;  3BFR A;  4NR1 A;  4E4B A;  3ZHU A;  5H6Q A;  4H37 A;  1PNK A;  4IL6 Z;  2LO1 A;  1CLQ A;  1XEQ A;  3E2E A;  4O4I B;  2BSK A;  5EC1 C;  2UXB B;  1YXB A;  4CBC A;  2H4T A;  1JJ2 U;  4RWU A;  2HKO A;  4FK5 C;  4MVS A;  4F6R A;  4DR2 O;  4E4E A;  2VS0 A;  2AZ0 A;  3C6P B;  1EM1 A;  1XDC A;  3OEH G;  3ZMZ A;  1WAZ A;  2PUS A;  2MK3 A;  2JS5 A;  1FS0 G;  2BSK B;  1OCZ B;  1R1B A;  1NR7 A;  3CWB H;  5A9G A;  2P1Q B;  2P22 C;  1AR1 B;  4LP8 A;  2F43 G;  1WAF A;  1PL4 A;  2F95 B;  1GKF A;  4DV5 B;  3OFN G;  3CXC U;  3NR7 A;  3OUF A;  2FTK A;  5FNV B;  2OCC B;  4I4T A;  3JD2 A;  4IT5 A;  3QER A;  1OJH A;  5CBG A;  2WLL A;  2RJZ A;  4RNG A;  4DR1 O;  5JJN B;  3TAG A;  2LFS A;  3C6N B;  3APQ A;  2LJ2 A;  4LBE C;  5BZB A;  4KP4 A;  1SET A;  2XAJ A;  1FZH E;  5LL6 Y;  1PNL A;  1HNW O;  1Y76 A;  4LWS A;  2Y4T A;  2YB5 A;  4I4T B;  4CH5 A;  2OVR B;  3ASN C;  3IJ4 A;  2PZS A;  4JI2 B;  1G6U A;  2RQ6 A;  3ICX A;  4Z1M G;  2WLL B;  2P1M B;  2ZM6 B;  4BWA A;  2EIK C;  4UXN A;  3QEI A;  4EFE A;  4JPR A;  2XUM A;  1VQ5 V;  1ROP A;  1Y76 B;  4FFB A;  3F5T A;  4O4H A;  4XDJ A;  1QVF U;  2K9P A;  5ITZ A;  1Q90 D;  4MVO A;  1O9H A;  2LW1 A;  1AJP A;  4I9W A;  1HDJ A;  3K79 A;  4NKG B;  3CFR A;  1XVD E;  1K33 A;  4DU1 A;  1HNZ O;  4B3M B;  3L73 H;  3APO A;  4DV6 B;  5KAF Z;  1DF4 A;  1Z2G A;  4DV0 O;  5KHJ A;  4O4H B;  2QWP B;  4QIW F;  2QTO A;  2LF3 A;  1ZLZ A;  2X6C A;  2A3Q A;  1WB7 A;  1XL3 C;  5JJJ B;  4DR4 O;  4AQY O;  4U3J A;  2KKW A;  4PJ0 Z;  1IVS A;  2MZW B;  3NE6 A;  1SQG A;  4FK2 A;  1TAE A;  3DTU B;  4RO2 A;  5C8Y B;  5LMU B;  3TXS A;  2RCV A;  4JI8 O;  2HEP A;  3HP9 A;  1ZSP A;  1YF2 A;  4FM1 A;  1M9N A;  4CS2 A;  5KUK A;  5FPO A;  2X6B A;  2EZP A;  1EZJ A;  5FPR A;  4HCB A;  1XL4 A;  1VQ7 V;  4U3J B;  4JI1 B;  1UJW B;  1R3J C;  1NJI W;  2OZS A;  2E76 B;  2QKS A;  4J42 A;  2K5S A;  1N34 B;  2DYR B;  1XL6 A;  1RFY A;  1I94 O;  5H6R A;  1MMM A;  3M7M X;  3S3X A;  4GYC B;  2VWJ A;  2UUB B;  1DGS A;  2PYL A;  1WP8 A;  1RM1 B;  4FJJ A;  1RPR A;  2EUL A;  3MHS C;  4M3X A;  4WBN A;  5BY1 A;  4G27 B;  2HP8 A;  3CRC A;  1I0H A;  1NR1 A;  4X64 B;  4DW0 A;  5K1P A;  5J2U A;  2XAG A;  3SPZ A;  2NR5 A;  4JI6 B;  1F23 A;  3QNO A;  4LFA O;  1N33 O;  4GKK O;  4BAY A;  1VF6 C;  5IYZ B;  2CTP A;  1ZTE A;  4GT1 A;  1FYJ A;  5IBK B;  3JAW A;  4EKW A;  1IBM O;  5KMG A;  3ETE A;  5EZY A;  3HPL C;  5J2U B;  3A0R A;  2D3O W;  4JZ2 A;  3UIQ A;  2ZDI A;  1EN6 A;  3AG1 C;  3SYC A;  3QET A;  1SQV H;  2P1N B;  1N4C A;  3BHP A;  1M56 C;  4Z2W A;  2IU3 A;  3CCL V;  3MKS B;  1GN3 A;  3JAW B;  1MNG A;  4U7N A;  2Q7G A;  4JI7 B;  1HNX O;  3KCY A;  2QDO A;  3OUS A;  4J9Y B;  5EZY B;  5B1A B;  2Y0P A;  4FMT A;  5KHK A;  4M42 A;  4NXM B;  1NTM H;  2W0X A;  5JVD A;  2MW2 A;  3AK1 A;  4NTW A;  4TQD A;  3OR6 C;  1R3L C;  2Q69 A;  1MOF A;  3G6E V;  1N36 O;  3ABK C;  3G71 V;  2FW3 A;  4UB6 Z;  4YJ3 B;  4K8Z A;  4KHW A;  2R72 A;  1JFF A;  1VQL V;  1DTO A;  1Q3E A;  1S5H C;  1FXV A;  2UUA B;  4O2B A;  1V9P A;  1HR0 B;  4KHU A;  4LR3 A;  1YIT V;  1MTY G;  2V4D A;  5JVD B;  2WLI A;  2MW2 B;  4B3R O;  4X62 O;  4JTC B;  5EBW C;  2KB1 A;  1GN6 A;  1JFF B;  4IIJ A;  2QM4 A;  1WNS A;  4LNU A;  5IWA B;  4GX0 A;  1KKD A;  4YY3 O;  4EP9 A;  2A9H A;  4B3T B;  2JGD A;  4O2B B;  3ZMS A;  2QWQ B;  1V54 B;  3N2K B;  1GN4 A;  3OGK B;  3E8B A;  2EIN C;  3I5D A;  2WLI B;  4J9Z B;  3CCE V;  2NLJ C;  2ZIN A;  1JOY A;  3AG2 B;  4LF4 B;  4JRQ A;  2FKX A;  4X66 O;  1N8R W;  1YHQ V;  3JYC A;  1VF5 B;  4MVU A;  4DR5 B;  3ZHR A;  1IBL B;  1XMO B;  4LF8 B;  3FFQ A;  2P1O B;  2BCC H;  2JGD B;  4J11 A;  4GUN A;  3L0M A;  2PI5 A;  3DXR B;  1XU3 E;  2UXB O;  5JH7 B;  2F4V O;  3I55 V;  1KYO F;  3VQY A;  2DQ3 A;  4MTF A;  3ZHS A;  2F66 C;  3ASO B;  2YIB A;  1XNR B;  2IJH A;  3B09 A;  1FD9 A;  3T1H O;  2M6Y A;  1K8A W;  5HFL A;  2HJF C;  1IDS A;  4NTY A;  3LNN A;  5GTI Z;  4FJ9 A;  4D6T H;  2XT9 A;  4PHZ A;  2KG7 A;  3R65 A;  1XIL A;  3C95 A;  2RDC A;  1WLE A;  4P30 A;  4JI5 B;  2ZR3 A;  2ETN A;  4JS5 A;  1FPO A;  3SPH A;  1OHH G;  5JCO A;  1VQ6 V;  3RBZ A;  3QNN A;  1NBM G;  4WF9 V;  2FB5 A;  2AHY A;  4ZBM A;  1TUB B;  4B3S O;  4Q6G A;  1YDX A;  2Q4P A;  4FLV A;  3LZJ A;  1BS3 A;  4YIP A;  3CJH B;  1LNQ A;  4OGQ B;  1SF9 A;  1XNQ B;  1Q6U A;  1QCE A;  1Q6H A;  1ZL8 B;  4LF7 B;  4I0X A;  4XDL A;  4DUY B;  4DR3 B;  2QSA A;  3H1H H;  1GMG A;  4AKG A;  2ZM6 O;  3SUN A;  1Q5O A;  4X65 O;  2CGO A;  1FZ7 E;  1SZX A;  3F7V C;  4TV8 A;  2VQE O;  3WB2 A;  3LDS A;  4WFG A;  3T2M A;  1YCI A;  3O65 A;  1KU9 A;  4LF5 O;  1EN4 A;  1Q86 W;  4I0X B;  3OMI B;  2AHZ A;  4H33 A;  3CRQ A;  3AG4 C;  3QG5 A;  3VQX A;  3C94 A;  2EIM B;  3D3I A;  1IZ3 A;  3KD1 E;  4HZ3 A;  2IJJ A;  4TV8 B;  5LOV A;  2JIZ G;  4MW3 A;  1RP3 B;  2WSS G;  4K35 A;  1K7D A;  1QNM A;  4BIZ A;  4IYI A;  2B1I A;  2E31 A;  4HAM A;  1G8M A;  4M3Y A;  4LF9 B;  3JD0 A;  1MHY G;  4UCO A;  4K0K O;  1PNM A;  2RKH A;  4EFB A;  5EYP B;  5LOV B;  4TV9 A;  2HG5 C;  3WB0 A;  4GKJ B;  3STZ C;  1FYZ E;  2LGQ A;  4FPP A;  4LF6 B;  1P22 A;  2W0F C;  3B8M A;  1XMF E;  2YC0 A;  2Q68 A;  1SER A;  1N32 O;  2KSD A;  1S76 D;  5KHG A;  3RYF A;  2EIJ C;  4FLW A;  4JI0 B;  4M45 A;  3LNM B;  5L3C A;  3RMB A;  2UUC O;  3SYO A;  4DV7 B;  1Q6I A;  3ZHQ A;  4TV9 B;  4FJL A;  1OCO B;  1KC8 W;  5A2Q N;  3SJQ C;  5IT9 N;  2HR3 A;  2Q8V A;  4P9P A;  3JAS B;  4E2L A;  4X20 A;  4KHN A;  1NTK H;  2UXD O;  1U97 A;  1Y74 A;  2PGG A;  4KXR A;  2Q0A A;  3RYF B;  3OTO B;  4I50 A;  3OR7 C;  3CCR V;  1W0J G;  3T4D A;  1K3E A;  4HBN A;  4KUM A;  4J7Z A;  5JJE B;  4H44 B;  4UB8 Z;  2H94 A;  4XBF A;  3CC4 V;  1FAF A;  4DU4 A;  4U7O A;  5F2V O;  3SQ2 A;  3BVO A;  4JV5 O;  4X20 B;  4DR6 B;  1FXH A;  4M3Z A;  1Y74 B;  4KHS A;  1IXB A;  3A0B Z;  4I50 B;  3AG3 B;  4ICG C;  2ZE6 A;  3SVI A;  3TAF A;  1IXM A;  2E3C A;  4X88 A;  4JS4 A;  1P7G A;  2PY5 A;  5CN0 A;  3ZRV A;  3CCU V;  3CQ8 A;  4E3S A;  3IFX A;  1P4R A;  4BW5 A;  3QEX A;  3K0D A;  2QM8 A;  3OMA B;  4WFH A;  2CGN A;  3QVN A;  3P30 A;  1UPG A;  1H38 A;  1AR4 A;  1H2G A;  2CAZ C;  3SJC C;  3HR0 A;  3N2G A;  4JI7 O;  4FJM A;  4QPK A;  2A7W A;  2IH1 C;  3TJT A;  1MSD A;  2ZCE A;  5LYJ A;  4R7C A;  3SPG A;  1JMK C;  4JYA B;  1VQ8 V;  3B8N A;  1NKD A;  2JRI A;  1YI2 V;  1M93 A;  5B1O A;  3ETG A;  2CTQ A;  4PI0 A;  2X6A A;  1H2M A;  4DUZ O;  1I5Y A;  4DV1 B;  4X8A A;  3L8B A;  2X0L A;  2CH7 B;  3L72 H;  3N2G B;  1FJG B;  2UU9 B;  1EFR G;  4UFZ A;  5LP6 B;  2UUA O;  1FFT B;  3JD1 A;  5LYJ B;  3L2O B;  1E1R G;  4JYC A;  1FZI E;  2QWO B;  3LDC A;  3QO8 A;  2HVJ C;  1H2K A;  3G67 A;  3CRR A;  2Y0I A;  2L6L A;  5EC2 C;  1THZ A;  3BA9 A;  2Z0A A;  3HKC B;  4W4K A;  3ZX6 A;  5LMN B;  4OXS A;  3CCS V;  5IWA O;  2WLJ A;  4JAA A;  2ZXW C;  2VIX A;  4JI3 O;  5FNV A;  1I08 A;  3KG2 A;  4OPH A;  2DN9 A;  1E79 G;  4JGS A;  1IH7 A;  5EIB C;  4AKI A;  2O57 A;  2Y69 C;  4FLZ A;  3BAB A;  1VP7 A;  1OZ0 A;  3HGK E;  4ASU G;  5J2T A;  2XAQ A;  4YHH B;  1HW7 A;  1KEC A;  1R3K C;  3OGL B;  3CB2 A;  3CYO A;  2WLK A;  3RYC A;  1IBL O;  1XMO O;  3ZCC A;  1PPJ H;  4MVZ A;  2JHC A;  4UUJ C;  2QA4 V;  1PM9 A;  2ADP A;  1M57 B;  2YUA A;  1RPO A;  2LGW A;  1COW G;  2QKC A;  2LQT A;  3SJB C;  5J2T B;  1QR9 A;  4D7T A;  4J7J A;  1XVC E;  3SR2 C;  3ABM B;  3X2Q B;  5C93 A;  3JSL A;  3FYE B;  3RYC B;  2DW4 A;  3CCJ V;  2IU0 A;  2KQX A;  2FL4 A;  2EIL B;  4FJH A;  3UCS C;  1NH2 B;  4MW8 A;  3B40 A;  3OD4 A;  3SDL A;  3D3Q A;  4DTX A;  5TIS Z;  3CEI A;  3VQV A;  3RW0 A;  3K5O A;  1XMQ B;  1GO3 F;  2DYS C;  3SUP A;  2RN9 A;  3A8T A;  3BCC H;  2ADQ B;  3NXS A;  3W7U A;  3V7D B;  1MHZ G;  2UXC B;  5L3E A;  4M41 A;  3FD9 A;  2YS8 A;  1ORQ C;  2EX3 A;  1VQM V;  2N04 A;  4K3A A;  5BMV A;  1CEZ A;  1Z5W A;  5CBF A;  3WG7 C;  2ATK C;  3RGB A;  3R66 A;  4DXW A;  1XNQ O;  5C8Y A;  2GSM B;  1XUQ A;  3H1J H;  3AK3 A;  4WFF A;  1ENV A;  2ZNJ A;  3CHX A;  2HJD A;  2P5G A;  1PL0 A;  3W7X A;  2K1E A;  4DV3 O;  3CPW U;  2Y4U A;  3UO2 A;  4EB6 B;  5BMV B;  3TCU A;  3ZHT A;  2F1M A;  3QEP A;  2GBO A;  2EJ7 A;  1XMH E;  4FM0 A;  5IY5 B;  4G28 B;  1WN7 A;  1AJQ A;  4EYW A;  1FXK A;  4BR6 A;  2JVD A;  3ZRS A;  2QKA A;  4A5U B;  4R6Z A;  1F7Y A;  3C3T A;  1E1Q G;  2HLD G;  1IG9 A;  3BA8 A;  4DTN A;  1H8E G;  5CB4 A;  4NXN O;  3ZBH A;  1VQK V;  1S3J A;  4MVM A;  1HP8 A;  3OGC C;  1MG1 A;  4JAU A;  4CS4 A;  3L71 H;  4PDL A;  3HKB B;  1YVW A;  4LH7 A;  3SPI A;  1JQ0 A;  1FXK B;  5IYZ A;  3PN1 A;  5DED A;  5EIB D;  4DR7 B;  1CP9 A;  2QTS A;  4AI6 A;  3D36 A;  1KMI Z;  3QNE A;  5CB4 B;  2FYO A;  4HNA A;  3LSQ A;  4FLX A;  3SUQ A;  3F7Y C;  3P32 A;  2JEX A;  2IJI A;  4RQE A;  1SES A;  3JCZ A;  4B7K A;  1H2N A;  4X5N A;  5LA6 A;  4QE7 A;  3EVK A;  2OIE A;  3GWK C;  1NVP D;  3QEW A;  3CCV V;  4PA6 A;  3S3W A;  1BZK A;  1V55 C;  3FB6 C;  3L70 H;  4HNA B;  5LHI A;  3RYI A;  2PI4 A;  4K8X A;  2E32 A;  2E75 B;  2OCH A;  4X1I B;  4HYO A;  2P67 A;  4P2Z A;  4JI4 B;  3G80 A;  3ZRX A;  2W6J G;  1OCC B;  5LA6 B;  1GTO A;  2Q6A A;  2BE3 A;  4FJN A;  1KKC A;  4CH4 A;  3J81 N;  5JQG B;  2YIB D;  4YJ3 A;  2OIG A;  1IBK O;  3T1Y B;  3RYI B;  4I9Q A;  5B1B B;  3HGL A;  4J2A A;  1VMG A;  4DV2 B;  4PDM A;  3JD3 A;  4DYL A;  1QLE C;  5CMU A;  3K3W A;  3B77 A;  4KFM A;  3TXQ A;  3ABL B;  1H2L A;  3LSS A;  1AVM A;  3B4S A;  4D7S A;  1S77 D;  3K0G A;  4ABM A;  3U10 A;  1J5E O;  4LFC O;  1AP6 A;  5BR8 O;  1VEW A;  3ABU A;  4TOI A;  3E86 A;  1BGY H;  1OCR B;  2XND G;  2HHH B;  2WLH A;  1L0L H;  2W6I G;  5IDJ A;  4NTX A;  1NZ6 A;  1VQP V;  1YTF D;  3CSX A;  4UV9 A;  3E8G A;  2P5O A;  3ZRW A;  2E5L B;  2ZQM A;  3N2K A;  4MVR A;  4KHP B;  4L8J A;  2JQT A;  4JYY A;  4X1K A;  4DV4 O;  5B3S C;  3KD5 E;  2B9Z A;  1IUR A;  4DTU A;  4R8C A;  2UXX A;  3N27 A;  3HL8 A;  3NAE A;  3VQW A;  1BCC H;  2WA4 A;  3OEE G;  4UCT A;  1U96 A;  4DTP A;  1MZF A;  1PKX A;  3ETQ A;  1SQP H;  3ZRW B;  3ZED A;  3B2E E;  3TAE A;  3DXR A;  4ZI7 A;  1JCH A;  3LDB A;  3SQ4 A;  3CCQ V;  2MMB A;  1R73 A;  3HKE A;  5L3D A;  1Z5V A;  3KCX A;  5JH7 A;  3BY6 A;  2PFT A;  4X1K B;  4GX1 A;  4DR2 B;  1LDK E;  1MZE A;  4AIL C;  1HWY A;  2P1P B;  2NNU A;  1K5S A;  1FZ5 E;  1D5N A;  4UVC A;  1EBO A;  4UCS A;  2VQF B;  3D8C A;  3IGA C;  4YJ2 A;  1KBH A;  2YSU B;  4ZI7 B;  3CS5 A;  5IJ9 A;  1Y4M A;  2QEX V;  3HKE B;  4MVQ A;  4FZ1 A;  3ZIA G;  1K4C C;  3GB7 C;  4MSW C;  4I55 A;  1GH6 A;  3VBB A;  1AIL A;  4EPH A;  2JH9 A;  3HB3 B;  3ZMU A;  4C7U A;  3L74 H;  1TUE B;  2ZNI A;  2DWD C;  3SYQ A;  4IYH A;  1GM9 A;  2NN4 A;  3RVZ A;  4LC1 A;  1M5I A;  1FKA O; 
#chains in the Genus database with same CATH homology
 3BVO A;  2KQX A;  2QWP B;  2QWQ B;  3AG7 A;  1NZ6 A;  2QWR B;  2Y4T A;  1N1C A;  3UCS C;  1BQ0 A;  2OCH A;  2DN9 A;  2LO1 A;  3UO3 A;  1GH6 A;  2YS8 A;  4IT5 A;  1FAF A;  2GUZ B;  2YUA A;  1FPO A;  2Y4U A;  2N04 A;  2CUG A;  3UO2 A;  2LGW A;  1HDJ A;  1WJZ A;  2GUZ A;  2CTR A;  2N05 A;  2QWO B;  1N4C A;  1BQZ A;  2CTW A;  2EJ7 A;  4J7Z A;  2PF4 E;  2QWN B;  2RKH A;  2CTP A;  2DMX A;  1IUR A;  2QSA A;  2M6Y A;  4RWU A;  1XBL A;  3APO A;  3APQ A;  4J80 A;  2L6L A;  2CTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...