3BVOA

Crystal structure of human co-chaperone protein hscb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
197
Chain Sequence
PRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human J-type co-chaperone HscB reveals a tetracysteine metal-binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Co-chaperone protein HscB, mitochondrial precursor
total genus 66
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
A PF18256 HscB_4_cys Co-chaperone HscB tetracysteine metal binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3bvoA01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3bvoA02
2QWOB 2PF4E 3BVOA 4J7ZA 1GH6A 1N1CA 1BQZA 2Y4TA 2DMXA 3UCSC 2KQXA 2Y4UA 2OCHA 2L6LA 1FPOA 2CTRA 1HDJA 2N05A 2CTPA 2N04A 1XBLA 2QSAA 1FAFA 2QWPB 3UO3A 2QWNB 2M6YA 1IURA 2YS8A 2CTWA 1BQ0A 2DN9A 1WJZA 1NZ6A 2YUAA 3UO2A 3APOA 2LO1A 2QWQB 2LGWA 4IT5A 2GUZB 4RWUA 1N4CA 3AG7A 2CUGA 2EJ7A 2QWRB 4J80A 2GUZA 2RKHA 3APQA 2CTQA
chains in the Genus database with same CATH superfamily
3ZRWA 5LGNA 1XQ8A 3BPZA 3UQ8A 2E75B 3EFFK 3QO8A 2DOSA 2XAJA 4Z2WA 1G4YB 4CS2A 3JALB 1IXBA 4FZ0A 2QJ1A 2QWNB 3K79A 4B08A 3ETDA 4U7NA 5B1AB 5KAFZ 2IJHA 1V54B 4JTAB 2DTUA 2IW5A 3OM3B 2CTQA 3WU2Z 1LNQA 3NGIA 1VEWA 1GH6A 5KX5A 2V7QG 2VJ4A 3D8CA 2OVQB 4DR3O 3OGIB 3I56V 2QR4A 4KI6A 3OTOO 2MW2A 4ZHQB 3K5LA 3OUFA 5IE9A 3T1HO 2LGWA 2BOBC 3HL8A 4R8CA 2KG7A 2VQFO 1EZJA 4DV4B 1YIJV 3H1LH 2P4KA 4AQYB 4O2BB 1Q82W 4JI3B 2ITDC 3DTUB 4DYLA 1FD9A 3HKBA 4J10A 2P06A 5J2TA 1XBLA 3H9VA 4JV5B 2QDOA 2QGNA 2ZINA 4MVMA 1XL6A 2H8PC 1CEZA 1B6QA 3S9HA 3OT7A 1KECA 5EC1C 5IY5B 2PF4E 4J7ZA 4DV6B 4C7UA 4LF9B 1PP9H 1YTFD 4YY3O 3S3WA 1NH2D 1HNWO 1ZWIC 1K92A 2YICA 2JHAA 3U0ZA 4DTXA 2MW2B 1MOFA 4MVUA 1WN7A 2JVDA 1RPOA 2EIKB 1DK1A 2KSDA 4B3MB 1N36O 4CBCA 4BIUA 1QR9A 3CX5F 1K8AW 5LBQA 2CGOA 4DV1B 3JCZA 4WFGA 3VQXA 2QE7G 4JI6B 4B7KA 3E4WA 4D7TA 3RMAA 4DR6O 4U3JA 1VQMV 1VMGA 1MSDA 2GBOA 2QKAA 4RUEA 1SQXH 4G27B 4OPHA 3B2EE 4EB6A 4EEQA 4X5NA 4JAAA 3T1YB 2EX3A 1XL3C 4GUNA 2XAFA 3CJHB 4IYHA 2QEXV 1ENVA 1GKFA 1URFA 3TCUA 3UCSC 2AW9A 3CJHA 4DK1A 3JASA 2L6LA 2EZOA 1VF6C 2XAGA 2UXDB 4TUYA 3U11A 4I4TB 1AI7A 2P4VA 5IYZA 4TUYB 3RYFB 2UUAB 1U96A 1N32B 5GONB 1Y66A 2XASA 1R3LC 2EIKC 2GUZA 4K0KO 2E5LO 2DQ0A 2AZ0A 1N33O 3E8GA 2Z3YA 4NTXA 5D5QA 4UV9A 1VQNV 3RMBA 1WP8A 3L8BA 2R70A 2B7MA 3QESA 5LA6A 1GK9A 3RMDA 2D3OW 1E79G 4PJ0Z 1K4CC 5LA6B 1R3JC 5LYJA 2LQTA 5FPOA 5LHGA 3QTCA 1LUWA 3ASNC 3SJCC 3SR2C 1OHHG 1Y6XA 3O9OA 4DR2O 1MMOG 3RBZA 3OTFA 1NT2B 4Q20A 2QM4A 4ABMA 2M7WA 2FYUH 3OD4A 3SYPA 3L2OB 3NDKA 3TAEA 3VQWA 2Q7HA 4BW5A 3CCMV 4M3YA 3W7TA 5BMVA 1L1FA 3SQ4A 2FTKA 5JH7B 1NZ6A 5FPRA 3QNEA 5IJ9A 4X88A 3NHGA 1XMQO 3OR6C 1FZ9E 3LNNA 3RN4A 5HFLA 4DV2O 3C6OB 3CHXA 1VQKV 3MAQA 1UFIA 1W0JG 2P67A 4LFBO 1JPXA 2BE3A 1N0NA 1G8MA 2E74B 2UXCO 4M3RA 4B3TB 3K9SA 1QLEB 4DV7O 3J2PA 2DYSB 1XNRB 4I6JB 3JATA 3I55V 2OTLV 4RUFA 5HFMA 1VF7A 1US6A 2LO1A 1K9MW 3JATB 1PNKA 3RFRA 1V54C 1GN2A 5KHGA 3RMCA 1GM8A 1SQPH 4MVOA 2QKSA 3IJ4A 1JJOA 1GMGA 2HLDG 3ABTA 3QEPA 3P32A 3H1KH 4NR1A 1J95A 5BXZA 5H6QA 1BT8A 1THZA 1Q43A 2QWQB 3WG7C 3K04A 1KD1W 5LOVB 1UJWB 5IT9N 2VWKA 3CPWU 1H2LA 4M3TA 4UCOA 3OGLB 5LOVA 4CS4A 3LDSA 3J80N 1N1CA 1KMIZ 2X0LA 2OTJV 1AJNA 3KZIZ 2Q4PA 4FFBA 1SS3A 3BFRA 3QNNA 3JD3A 1NI8A 3F5WC 2LFSA 1IBLB 3CFPA 1FZ3E 1HNXO 3SUOA 1E1RG 3FD9A 4WFBV 4DR5B 3SUNA 3DGEA 5GTHZ 3SQ2A 2DQ3A 1WAJA 5IREA 3CC2V 2WLIB 1K3EA 5KHIA 3BVOA 1N34B 2PGGA 2ZDIC 4GT1A 5B3SC 2VQFB 4DU3A 3VOUA 3WB2A 4GLXA 1AJQA 1O9HA 3B09A 4DTSA 3BCCH 4I0XA 3CXCU 4G2KA 4GX5A 1XHXA 2ZCEA 1I94O 4I0XB 3SDLA 2CUGA 2KG7B 2K9PA 3CB2A 3PN1A 3HB3B 5JJJB 4UVAA 3SUQA 4TV9A 3M8AA 4R7CA 1VQOV 4KHQA 3N27A 4LCUC 1QU7A 2AZ2A 2UU9O 3JALA 5DECA 4QNDA 2D2CB 4NVPA 1WAZA 2ZM6O 3RYHA 3G4SV 4JI1O 4KHPO 3UKMA 1AVMA 2YI8A 4LFBB 3OGMB 2XUMA 5J9PC 5B3SB 4AKHA 3NR7A 2DEBA 3H1IH 4WFHA 3E22A 1FS1A 1QLNA 3QETA 3B8NA 3HP9A 1WLEA 2ZT9B 1SA0B 4XDLA 3LNMB 4RQFA 4JI8B 3JAKB 2CTWA 3RWUA 5LGTA 4RQEA 3L1NA 4LF8B 2HVJC 4ZI7B 4JYYA 1GN3A 5A2QN 5CN0A 3K2OA 1MNGA 3LD8A 2AGAA 4UCTA 1XVFE 4W4LA 5IWAB 4TV8B 3T4ZA 1I5XA 2EINB 1NTKH 4UFZA 3WB0A 2VQEB 2E5LB 2HR3A 3ZHRA 5EBLC 1MHZG 3FB5C 4M3ZA 5CMUA 1HNZO 3ZHTA 2ZR2A 4I50A 4X20B 4H44B 3TETA 3BABA 4K0KB 2IM9A 4LH7A 1MMMA 3RGBA 4DV5B 4QE9A 2IU3A 1U97A 4DU4A 2BSKA 2UXNA 5KA5A 4O4IB 1IG9A 1NH2B 3VBBA 1Q6UA 3AK3A 5H6RA 4JI1B 2HD0A 1IZ3A 2DYSC 2YIDA 1COWG 1JFFB 1GM7A 4ZOLB 2EINC 4KP4A 3K0DA 3OUSA 4ZOLA 2OVRB 2JH9A 3TXQA 3P3NA 1VQ6V 3G6BA 5L3CA 3UM7A 1XILA 4WBNB 5LXTB 1VF6A 2UUBB 3D3IA 1YDXA 1GTOA 5DEDA 3HKDB 2ILMA 4KHWA 1FFTB 5EIBD 3FYIB 1RSOB 1PPJH 5LMNB 2HVKC 4JS4A 2OIGA 1KKCA 2P5GA 3AG7A 1YJNV 1YZBA 2YIAA 2DWEC 2GTSA 3ABMB 4DR7O 1DGSA 4MW8A 2BTOA 4DUZO 4NXMB 5DN6G 1XMHE 4DV2B 2EIJC 4KHNA 1FYJA 1XREA 1FFXB 1HDJA 1OV9A 3E8BA 1PKXA 1MZFA 2N05A 4DTNA 4J9YB 1D2DA 4DTMA 1S77D 3CC4V 3H1JH 4DR5O 5EC2C 2YC0A 2YI9A 4K3AA 3ZN0A 4I9QA 1YTFB 2Y0PA 4AKIA 1B3QA 1VQLV 2F66C 5JJNB 5F2VO 4DUYB 4HCBA 3MDSA 4AI6A 1VARA 3NCIA 4U7OA 5EIBC 2W6JG 3LDDA 1F23A 1NVPB 2Y4TA 3G80A 4GZRB 4X65B 2B1IA 4FJJA 4FFKA 4CC6A 3D36C 3CFOA 3B40A 2JRIA 3FAVA 2FYOA 2JPNA 3A0RA 2P5OA 4JI8O 3E8HA 2DW4A 3KG2A 2GSMB 4FJKA 3A0HZ 2HHHB 1FXKC 2LFRA 1JMKC 1M57C 5IYBO 5ITZB 1GN4A 3KCXA 4FLUA 4DRXA 1FYZE 3HKBB 4UUJC 3ZMVA 5JH7A 2QWPB 1BZKA 4PDVA 2P1NB 4BWAA 4PI0A 1XVBE 3CFRA 4WF9V 4DTUA 3K5OA 3AK1A 4X1IA 4NB5A 3JSNA 2UU9B 1SQVH 1H8EG 3QEVA 4MVSA 3CP1A 1CXZB 3HKCB 4KHSA 4ADNA 4UXNA 2EILC 3ABLC 4FFBB 4O4JA 3LZIA 4ZIBA 4LF6B 4K35A 1ZSPA 3ETQA 1BQ0A 5FNVA 4DTPA 3E89A 1DF5A 3JYCA 2P1MB 1VQ4V 3LDBA 4LNUA 1FJGO 1XMFE 2RJZA 2ETNA 4DR1O 4LNUB 3CRCA 1XU5E 4LFAB 2CH7B 1PV0A 2OCCB 3E86A 3K5NA 1HNXB 2P6JA 1X4TA 2JHPA 4EFBA 1BE3H 4MVZA 5KA6A 2UXBO 4FK2A 1BCCH 1IX9A 2Y69B 3BAAA 4O4HA 1VQ8V 4X1IB 3W7SA 1R6KA 1YVWA 4O4HB 4FLZA 4JI5O 2ZE8A 5K1XA 4AILC 2CTPA 4BIOA 1PM9A 4X66B 1XDCA 1IXMA 3MHHC 1OCCB 3ZEDA 1XVEE 4IIJB 1F4NA 3CRQA 2RKHA 3CXHF 2Z0AA 1LDKE 4B3RB 1JX9A 4CH5A 2QTSA 4O2AA 2F4VO 4DW1A 2DYRC 2QM8A 4PI2A 1XNQB 3C90A 1F4MA 3D3QA 2EULA 1S0VA 4X8AA 4GKKO 4FVMA 5LHHA 5J2UA 4H0LB 3HR0A 3C3TA 1R73A 3F7VC 2WLLB 1ZLZA 5CA3A 2FMLA 4DR3B 1MG1A 4GX1A 5CBHA 4DV7B 1LUVA 4WFAV 3N2GB 1P7GA 2HG5C 4YJ3B 3E83A 2P1OB 2VIXA 3C6NB 4P9PA 5E1AC 1AI6A 4EFEA 2VWJA 1XMOO 5TISZ 1Q3EA 4MTXA 1AJPA 4FM2A 3BY6A 3GVMA 1FAFA 1HW7A 4J11A 4MT8A 2B8IA 5KUKA 2ATQA 1SERA 2ZE5A 4B3TO 3RYIA 3EHBB 4GCZA 1S72V 5E79Z 4LF7B 4G28B 1S5LZ 4X1KA 3JARA 1AI4A 1JW2A 2IJKA 5CA1A 2OCHA 1J5EO 2BSKB 2OVPB 5KMGB 5H2FZ 1M57B 1S5JA 1Q8IA 3ICXA 4JZGA 1QQCA 4FJXA 4UCSA 4PDRA 5IJ0A 1R6NA 3W7WA 1FKAO 4IT5A 2A0LA 4QGPA 4RG8A 4I5SA 4DV3O 4FZ1A 4GAMC 1PL4A 3HPLC 4MVRA 5LMUO 2BTQB 2AHYA 2X6CA 2H4TA 3F5TA 4IL6Z 3IC9A 3K5MA 1WAFA 2QKCA 2EJ7A 1AR5A 5B1BB 2LP7A 1BHBA 1M93A 4F6EA 3L71H 3W7XA 4DUYO 1XI1A 3DC5A 2X6BA 1KBHA 3QEXA 3ZHSA 5J2TB 4ZBMA 4GX2A 4FJGA 4FJ8A 4X5MA 1ZL8B 3IAYA 3C94A 1R6TA 3ZMUA 1ZL8A 5BZBA 3FB7C 1EN6A 2A3QA 2YIBD 1XMGE 2RCVA 4TOIA 4P30A 2V1DA 1YJ9V 5KX5B 4M42A 4JGSA 3UT5A 3CCVV 3JAMN 3T1YO 4DV1O 3HGKE 4FK0A 2WWWA 5JCOC 5IYCO 3SNNA 2OZSA 1JCHA 4KHUA 4MS2A 2JEXA 1NR7A 1RSOA 1SF9A 3BA8A 4QE7A 1ZAUA 1AILA 4RL5A 1I08A 4FJMA 4LWSB 2UUBO 4UV8A 3SVIA 1OCRC 4GKJB 3ZRVA 1NR1A 3F7YC 1XHZA 4FJLA 5K1PA 3STZC 1Y74B 5GTIZ 3K08A 2F4VB 3SI6A 1N36B 3K59A 1QVFU 2A79B 5CA0B 1M1KW 3AK2A 3IFXA 2R9IA 4JZ2A 4EKWA 4F6RA 3E8FA 1IBLO 1XU3E 5EZYB 3RYCA 3T1CA 4J41A 1H8HG 1XNQO 1SZXA 2Q8VA 3B4SA 4J2EA 4M3UA 3IGAC 1Q5OA 3M99B 2V4DA 4JV5O 2F43G 1QBZA 3OMIB 4X66O 1WB7A 1K4DC 1SESA 3QO5A 4I55B 1F7YA 5IYZB 1OCOC 2FB5A 4LWSA 2JGUA 3CCSV 4YJ2B 2ITCC 2ZE7A 4QNHB 4YJ2A 3NE6A 4RNGA 5ITZA 4FJ5A 1W59A 4X1YA 4JI4B 3JAWA 4Q6GA 2CH7A 3P3PA 2VRZA 4U3JB 4PA7A 3JAWB 3CYOA 4F6RB 3APOA 4JPRA 5EYPB 5EZYA 4FJ7A 1J5EB 4AKGA 3CEIA 5L3GA 4LC1A 1FJGB 2UXCB 1P22A 4QPJA 3SPJA 2KQXA 1Q9XA 1MA1A 2CTRA 1L0NH 2WLNA 3T2MA 4RAIA 1OCZB 4J42A 3CCLV 3QVNA 4LF6O 3RYFA 2W6IG 5LL6Y 4DV0O 4IIJA 4RWUA 1CP9A 2EIMB 1FXHA 4ASUG 2RNBA 5IDJA 4NXNO 4PD4F 3SYAA 1K5QA 1ROPA 1V55B 2YXLA 1TGOA 1HWYA 2H3OA 4F4LA 3CMAV 2QA4V 2PY5A 1IBMB 3FB8C 3RVZA 4H13B 4DR2B 1GAXA 3TAFA 5JJEB 1M90W 2QSAA 1WA8A 3DXRB 3UO3A 2G38A 2YUAA 4CH3A 3GWKC 3G71V 1VQ7V 3N2GA 1KYOF 2BOCC 2GDSA 3CD6V 5KHHA 2EJRA 3L70H 4BAYA 2IJIA 2W0XA 3TXSA 3JASB 3LZJA 2WLKA 2IBZH 5JQGA 1JA8A 5JQGB 2XT9A 3THOA 2ADPA 3AEIA 1GM9A 1Q90D 3SQ0A 3RVYA 1FZHE 3OE7G 3RW0A 4FLTA 3WG7B 3WSOA 3RWRD 4E3SA 2NR5A 1K7DA 2JJ2G 4FIPC 2CE4A 1K33A 4MSWC 5AG2A 1I0HA 1QVGU 4ICGC 4E2LA 1NTZH 5BR8B 4FLXA 3DXRA 2P22C 5LMNO 3CRRA 1ZTEA 4DR1B 1SQBH 4ZKIA 3ZMSA 3ZX6A 4DR7B 3I5DA 1SRYA 2R9AA 1JOYA 3KD5E 3GB7C 2JH8A 1TA8A 2B9ZA 1NS1A 4ZHQA 2PI5A 3ZBHA 2ZD9A 1AR4A 1XUQA 1XVCE 5BMVB 2PFTA 4NKGB 2QWRB 4H37A 4B3SB 1K73W 3GWOA 4PDMA 3QEIA 1WB8A 2RCUA 4JAVA 4LF9O 1D5NA 3BHPA 3ZRWB 1RM1B 1Q6IA 3AG3C 2BCCH 3ETEA 1OCZC 4OPAA 2FL4A 4DTJA 2F1MA 5FLXN 2C2AA 2XHBA 3TJYA 3OEHG 2JGDB 2A7WA 1FZ6E 2E76B 4X64B 5JVDA 4FM1A 3ETGA 4JI2O 4OX9B 1M5IA 3ZHQA 3RT3C 3O65A 1JVMA 1NEXB 2PYLA 3AG3B 1RP3B 1NVPD 4PA3A 3PJSK 1FXKA 3D36A 2E31A 5LP6A 1NBMG 4ZI7A 3ABLB 3L74H 4K8XA 1NQTA 1PNMA 2AHZA 1KP3A 4I9WA 1DTOA 1N32O 5L3BA 2NNUA 3K06A 3MHSC 5LP6C 4JASA 1K34A 4N23A 1IBKO 3UO2A 2IJJA 2OCCC 4X62O 4PHZA 3ASNB 4PV1B 2LJ2A 5B1AC 4M45A 1XMOB 4X20A 4J2AA 4CS3A 2WLIA 5JVDB 1YI2V 2CGNA 1YITV 4B3SO 5EBMC 5B1NA 4EYWA 3CQ8A 4JI0B 2Y0IA 4I4TA 3ZMZA 2XAHA 5H5NA 4DR6B 4AHCA 4LR3A 4NYKA 2GUZB 2OIEA 1YEWA 1OCRB 4UB6Z 1TUBB 2H94A 4BR6A 1FXXA 3X2QB 3SGIA 4YIPA 4IGGA 3STLC 2B1GA 2WA4A 1XOUA 2WPDG 3P30A 4K8ZA 4WBNA 3ASOC 5JCOA 3K0GA 1TVKA 5GW7A 2WSSG 1AB3A 2P1QB 4CC5A 3SPZA 1TVKB 3SPGA 3EXAA 4DV5O 4E4EA 1R1BA 3ZIAG 4EB6B 5LGUA 3SQ1A 4B3RO 3JARB 3OW2U 3J7AU 1Q7YW 2P7TC 4JI5B 5BY1A 5KHKA 3SJAC 4DK0A 3S3XA 4NTYA 4X9QA 2GV9A 4I55A 2UXBB 3CCUV 2KKWA 1EBOA 4A5UB 4FK5C 4J2BA 1IURA 5IJ9B 4WFFA 1YF2A 4H33A 2L35A 3A2FA 1TUBA 4UCUA 2XTAA 4HAMA 2ZE6A 5LXTA 2YEVA 2Y69C 3B8MA 3FKSG 1KC8W 4TV8A 3TL8B 4JS5A 2YEVB 2N04A 1WPBA 1FZ0E 1M56C 3N2KA 1Q86W 4LFCO 1QHTA 3JD1A 3L0MA 3SPIA 3T4DA 5LYJB 4KI4A 5B5EZ 3K9AA 4LFAO 3KCYA 4YXWG 1Q81W 2P1PB 4YHHO 3JCUZ 4J7KA 2HEPA 3V7DB 3OMAB 2QWOB 2MK3A 1B04A 2YB5A 1Y67A 4KHPB 4QJFB 5H37A 1FFXA 2JS3A 3QERA 3U10A 1RPRA 2UXXA 2Q69A 2E3CA 4WCEV 2F95B 1MZEA 3ZJZA 2Q73A 2KB1A 1IVSA 3E4YA 4JTCB 3ZS8C 1YSCA 4FMTA 5D5PA 2Q7GA 4TQDA 3FX7A 2YXYA 1L8DA 2DMXA 2WLHA 3HKCA 4UB8Z 3C95A 4MTGA 3Q4HA 2Q7EA 3C3SA 5EK0A 2AXTZ 1BS3A 1ORQC 1A32A 3N2KB 4I7ZB 4W4KA 1FZ7E 2HKOA 1GN6A 3WFVA 3HKEA 3AG2B 2WLMA 1XEQA 2K1EA 5DM6V 4HCCA 2VQEO 2VS0A 1OJHA 4X65O 3B77A 4IHJA 2HHHO 4JI2B 4MTOA 3JD4A 5JWPA 2Q0AA 1N33B 4OXSA 2CK3G 2DWDC 4JAUA 3ML0A 5EBWC 1V55C 4J7JA 4LF8O 1F51A 1VIBA 4PDLA 3N1EA 4CZZA 2ZDIA 4QPKA 5KUMA 4FK4A 1RM1C 4DTRA 3M7MX 3SYOA 3L9DA 1MTYG 2ZIMA 4O4LB 4EP9A 4NXMO 4BW9A 2MMBA 3KD1E 4P2ZA 1H2SB 2UUAO 2JIZG 3ZHUA 1G1XB 1H2NA 3RYHB 1Z5WA 1XVDE 1WJZA 4DW0A 4D7SA 3CSXA 3SPYA 1S76D 1K97A 2EBOA 4PA9A 3N1BA 3AG4C 2LF3A 2ZKOA 4JF3A 3H1HH 1JR9A 2JK5C 3J81N 3QO7A 2A9HA 1Z2GA 5C8YB 2X6AA 1YHQV 1CLQA 4IYIA 3L73H 2DE0X 3QEWA 4XBFA 2OZMA 3JAKA 3VQVA 1XNRO 5J2UB 4YHHB 2ARHA 2K5SA 3MKSB 4LFCB 3NXSA 1T5EA 1BMFG 4DO2A 3ASOB 5EYPA 1MSWD 5KAIZ 1EZVH 4O2BA 4X89A 3FB6C 2GHYA 4TV9B 2XAQA 4R6ZA 5IZ7A 4B3MO 3K58A 2LGQA 1XL4A 1NTMH 2EILB 1AROP 2UUCB 4E4BA 3R66A 5H9CA 3CWBH 3CCRV 4GYCB 5A9GA 3OAAG 3TJTA 4RO2A 1I7FA 4KFMA 3SYCA 2JDIG 1JJ2U 3QG5A 1IDSA 3VQYA 2B1EA 4Z1MG 4HYOA 5L3FA 3E22B 4DV4O 1FZ2E 1BL8A 5KMGA 1N0JA 4HBNA 2MZWB 2WLLA 3SPHA 1FXKB 1TAEA 3T1HB 4M3WA 1M56B 5LP6B 1QLEC 1KU9A 1LR1A 3QNOA 4OX9O 4J80A 5IWAO 1NU1H 4J2DA 3R65A 2X7RB 4HZ3A 1WNSA 3LUTB 2RMKB 3BEHA 1EN5A 1GRJA 1SQFA 1H2GA 3KKYA 3SJBC 4AI8A 4LF5B 2OWOA 2RQ6A 3HKDA 1FZ1E 2GTAA 2E32A 4KL1A 3IC7A 4FLYA 4WFEA 2UXDO 2PUSA 4J9ZB 1DLBA 1AI5A 1GO3F 4UVBA 4LP8A 2IH1C 1FZ4E 1KQSU 4JI0O 3CE2A 5CA1B 3OMNB 4PA6A 1FPOA 2LF6A 1SETA 4XDJA 3FFQA 1Q6HA 2ZM6B 1SA0A 3CRMA 2IH3C 3OGKB 1XMQB 3SJJA 4B7EA 1I94B 5IBKB 1FZIE 1FXVA 2YXHA 4UCRA 5B1BC 3H01A 3NAEA 2ATKC 1I5YA 4JYAB 1Q9YA 4TWKA 3X2QC 2DJVA 2JJ1G 3LDEA 3K57A 1N34O 1AP5A 1MHYG 4M3XA 2ODMA 1QNMA 1FS0G 2YS8A 3ABUA 2HJDA 3OGCC 4DXWA 4GKKB 1B06A 4JI4O 2PZSA 4DV6O 3A8TA 2VJ5A 1UPGA 2FKXA 4QNCA 2Q67A 4KUMA 4LF4O 2Q5ZA 3ABKC 3BRCA 4O4IA 3CCJV 5CA0A 5CBGA 1BSMA 4R50A 1NJIW 4FPPA 2CAZC 4JYCA 1EFRG 4JRQA 1KP2A 3CRAA 1YCIA 5IJ0B 3G6EV 2O57A 1PNLA 2Z5UA 4YIOA 2UUCO 3TAGA 5FL7G 3RYCB 3W7UA 2JGDA 4AQYO 1P49A 3A0BZ 3ZRSA 1H38A 2HFEC 2W0FC 3SCXA 1N8RW 2ZNJA 5L3DA 2WAMA 2FW3A 2EIMC 3FYEB 1CPYA 3LSSA 4CH6A 3MD0A 3FAVB 3OR7C 5CB4B 4JTDB 4DTOA 3DSQA 2ADQB 4UCVA 5CB4A 1IBMO 1SQQH 1PL0A 4JI6O 1RFYA 1JQ0A 4NTWA 1Y74A 3TGUH 3ZN1A 3TABA 1BQZA 1YXBA 4X1YB 1VF5B 1Y4MA 1R3IC 4DV0B 3ABKB 4DRXB 4X62B 4L87A 2YDEA 2NN4A 1EN4A 2HP8A 2ZQMA 2DN9A 4TQFA 3SPCA 4Z1VA 1XVGE 2R72A 2YIBA 2DY4A 1KB9F 2NLJC 2N74A 3AG2C 3OEEG 1HNWB 4YY3B 3L75H 4FJHA 3LDCA 2LW1A 3SUPA 3AG1C 4MTFA 4FJNA 2JS5A 4MVQA 4FLWA 1X59A 2JEUA 1SQGA 4O4JB 1IBKB 1OCOB 4JI7B 4I9LA 2PFVA 2M6YA 2JHCA 3HKEB 4DU1A 2CDYA 2F23A 4LH6A 2P90A 4LF5O 4IHJB 4M41A 4O2AB 2XNDG 3JD0A 4PELA 1BHAA 1VQ5V 1QR8A 2Q68A 4JI3O 1L0LH 3G67A 5C8YA 1H2MA 3JSLA 1S5HC 4D6TH 1WPXA 2IU0A 1DF4A 1ZX3A 4DV3B 5IYDO 1SZTA 1P4RA 2B5UA 1QCEA 4EPHA 2QXFA 3ZMTA 2EIJB 1VQPV 1O9GA 1E1QG 5LMUB 4FLVA 3ABMC 4ICGA 1VQ9V 3APQA 1VP7A 1FZ8E 3L72H 4O4LA 4X64O 1K5SA 2QM7A 1NKDA 4OGQB 4PA4A 1HP8A 3SYQA 4NXNB 3SJQC 4TSFG 1PD3A 3CCQV 4JI7O 4LF7O 3DC6A 1G6UA 5FNVB 1HR0B 4GX0A 5KLVH 3UIQA 2QTOA 1WP7A 1H2KA 4X1KB 5GONA 4BIZA 2HJFC 4MW3A 4DUZB 1YJWV 2JQTA 2Q6AA 2RDCA 4GKJO 2Q9LA 3OFNG 3C6PB 2Q0OC 1BGYH 3ZHVA 4LBEC 2ZXWB 4ADOA 1S3JA 1WA8B 2A06H 1FZ5E 1R3KC 3ZCCA 1M9NA 3QF7A 5B1OA 5LHIA 2YSUB 4HNAA 1W0KG 2ZIOA 5BR8O 1N4CA 4HNAB 1AR1B 3CC7V 3AG4B 4QIWF 3ZRXA 2DYRB 4KXRA 1Y76B 3EVKA 2OYQA 5L3EA 2BTQA 2R9RB 2Y4UA 1P7BA 4XDKA 2PTMA 1HR0O 3BA9A 1OCCC 3LSQA 4FJ9A 1TUEB 2LW7A 5KHJA 3WB1A 2Y48A 4UVCA 4U3FH 4TT3G 4JRPA 4I50B 4DR4O 1MABG 2WA3A 3TK1A 5B66Z 3CCEV 1ZUQA 4LF4B 1W2BU 1SC5B 3AG1B 5C93A 3E35A 5IY5C 1HNZB 1AP6A 1EM1A 2OT5A 4FJCC 4FJIA 3J27A 1KUQA 3CMEV 3CS5A 3Q4HB 4DR4B 3E2EA 1JFFA 1M4UA 4CH4A 1OZ0A 1KKDA 2ZNIA 1V9PA 5CBFA 3JD2A 2ZXWC 4YJ3A 3OTOB 2EZPA 2ZR3A 3UT5B 1D5AA 3LSUA 4FM0A 4P9OA 3HGLA 1SKVA 2RN9A 1Y76A 2F93B 2XOKG 3K03A 4L8JA 4N21A 1P84F 4JYBA 4KHYA 2WLJA 1IH7A 3RYIB 2PYJA 1Z5VA 2PI4A 4JYAO 3K3WA
chains in the Genus database with same CATH topology
2QWOB 2PF4E 3BVOA 4J7ZA 1GH6A 1N1CA 1BQZA 2Y4TA 2DMXA 3UCSC 2KQXA 2Y4UA 2OCHA 2L6LA 1FPOA 2CTRA 1HDJA 2N05A 2CTPA 2N04A 1XBLA 2QSAA 1FAFA 2QWPB 3UO3A 2QWNB 2M6YA 1IURA 2YS8A 2CTWA 1BQ0A 2DN9A 1WJZA 1NZ6A 2YUAA 3UO2A 3APOA 2LO1A 2QWQB 2LGWA 4IT5A 2GUZB 4RWUA 1N4CA 3AG7A 2CUGA 2EJ7A 2QWRB 4J80A 2GUZA 2RKHA 3APQA 2CTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWO B;  2PF4 E;  3BVO A;  4J7Z A;  1GH6 A;  1N1C A;  1BQZ A;  2Y4T A;  2DMX A;  3UCS C;  2KQX A;  2Y4U A;  2OCH A;  2L6L A;  1FPO A;  2CTR A;  1HDJ A;  2N05 A;  2CTP A;  2N04 A;  1XBL A;  2QSA A;  1FAF A;  2QWP B;  3UO3 A;  2QWN B;  2M6Y A;  1IUR A;  2YS8 A;  2CTW A;  1BQ0 A;  2DN9 A;  1WJZ A;  1NZ6 A;  2YUA A;  3UO2 A;  3APO A;  2LO1 A;  2QWQ B;  2LGW A;  4IT5 A;  2GUZ B;  4RWU A;  1N4C A;  3AG7 A;  2CUG A;  2EJ7 A;  2QWR B;  4J80 A;  2GUZ A;  2RKH A;  3APQ A;  2CTQ A; 
#chains in the Genus database with same CATH topology
 3ZRW A;  5LGN A;  1XQ8 A;  3BPZ A;  3UQ8 A;  2E75 B;  3EFF K;  3QO8 A;  2DOS A;  2XAJ A;  4Z2W A;  1G4Y B;  4CS2 A;  3JAL B;  1IXB A;  4FZ0 A;  2QJ1 A;  2QWN B;  3K79 A;  4B08 A;  3ETD A;  4U7N A;  5B1A B;  5KAF Z;  2IJH A;  1V54 B;  4JTA B;  2DTU A;  2IW5 A;  3OM3 B;  2CTQ A;  3WU2 Z;  1LNQ A;  3NGI A;  1VEW A;  1GH6 A;  5KX5 A;  2V7Q G;  2VJ4 A;  3D8C A;  2OVQ B;  4DR3 O;  3OGI B;  3I56 V;  2QR4 A;  4KI6 A;  3OTO O;  2MW2 A;  4ZHQ B;  3K5L A;  3OUF A;  5IE9 A;  3T1H O;  2LGW A;  2BOB C;  3HL8 A;  4R8C A;  2KG7 A;  2VQF O;  1EZJ A;  4DV4 B;  1YIJ V;  3H1L H;  2P4K A;  4AQY B;  4O2B B;  1Q82 W;  4JI3 B;  2ITD C;  3DTU B;  4DYL A;  1FD9 A;  3HKB A;  4J10 A;  2P06 A;  5J2T A;  1XBL A;  3H9V A;  4JV5 B;  2QDO A;  2QGN A;  2ZIN A;  4MVM A;  1XL6 A;  2H8P C;  1CEZ A;  1B6Q A;  3S9H A;  3OT7 A;  1KEC A;  5EC1 C;  5IY5 B;  2PF4 E;  4J7Z A;  4DV6 B;  4C7U A;  4LF9 B;  1PP9 H;  1YTF D;  4YY3 O;  3S3W A;  1NH2 D;  1HNW O;  1ZWI C;  1K92 A;  2YIC A;  2JHA A;  3U0Z A;  4DTX A;  2MW2 B;  1MOF A;  4MVU A;  1WN7 A;  2JVD A;  1RPO A;  2EIK B;  1DK1 A;  2KSD A;  4B3M B;  1N36 O;  4CBC A;  4BIU A;  1QR9 A;  3CX5 F;  1K8A W;  5LBQ A;  2CGO A;  4DV1 B;  3JCZ A;  4WFG A;  3VQX A;  2QE7 G;  4JI6 B;  4B7K A;  3E4W A;  4D7T A;  3RMA A;  4DR6 O;  4U3J A;  1VQM V;  1VMG A;  1MSD A;  2GBO A;  2QKA A;  4RUE A;  1SQX H;  4G27 B;  4OPH A;  3B2E E;  4EB6 A;  4EEQ A;  4X5N A;  4JAA A;  3T1Y B;  2EX3 A;  1XL3 C;  4GUN A;  2XAF A;  3CJH B;  4IYH A;  2QEX V;  1ENV A;  1GKF A;  1URF A;  3TCU A;  3UCS C;  2AW9 A;  3CJH A;  4DK1 A;  3JAS A;  2L6L A;  2EZO A;  1VF6 C;  2XAG A;  2UXD B;  4TUY A;  3U11 A;  4I4T B;  1AI7 A;  2P4V A;  5IYZ A;  4TUY B;  3RYF B;  2UUA B;  1U96 A;  1N32 B;  5GON B;  1Y66 A;  2XAS A;  1R3L C;  2EIK C;  2GUZ A;  4K0K O;  2E5L O;  2DQ0 A;  2AZ0 A;  1N33 O;  3E8G A;  2Z3Y A;  4NTX A;  5D5Q A;  4UV9 A;  1VQN V;  3RMB A;  1WP8 A;  3L8B A;  2R70 A;  2B7M A;  3QES A;  5LA6 A;  1GK9 A;  3RMD A;  2D3O W;  1E79 G;  4PJ0 Z;  1K4C C;  5LA6 B;  1R3J C;  5LYJ A;  2LQT A;  5FPO A;  5LHG A;  3QTC A;  1LUW A;  3ASN C;  3SJC C;  3SR2 C;  1OHH G;  1Y6X A;  3O9O A;  4DR2 O;  1MMO G;  3RBZ A;  3OTF A;  1NT2 B;  4Q20 A;  2QM4 A;  4ABM A;  2M7W A;  2FYU H;  3OD4 A;  3SYP A;  3L2O B;  3NDK A;  3TAE A;  3VQW A;  2Q7H A;  4BW5 A;  3CCM V;  4M3Y A;  3W7T A;  5BMV A;  1L1F A;  3SQ4 A;  2FTK A;  5JH7 B;  1NZ6 A;  5FPR A;  3QNE A;  5IJ9 A;  4X88 A;  3NHG A;  1XMQ O;  3OR6 C;  1FZ9 E;  3LNN A;  3RN4 A;  5HFL A;  4DV2 O;  3C6O B;  3CHX A;  1VQK V;  3MAQ A;  1UFI A;  1W0J G;  2P67 A;  4LFB O;  1JPX A;  2BE3 A;  1N0N A;  1G8M A;  2E74 B;  2UXC O;  4M3R A;  4B3T B;  3K9S A;  1QLE B;  4DV7 O;  3J2P A;  2DYS B;  1XNR B;  4I6J B;  3JAT A;  3I55 V;  2OTL V;  4RUF A;  5HFM A;  1VF7 A;  1US6 A;  2LO1 A;  1K9M W;  3JAT B;  1PNK A;  3RFR A;  1V54 C;  1GN2 A;  5KHG A;  3RMC A;  1GM8 A;  1SQP H;  4MVO A;  2QKS A;  3IJ4 A;  1JJO A;  1GMG A;  2HLD G;  3ABT A;  3QEP A;  3P32 A;  3H1K H;  4NR1 A;  1J95 A;  5BXZ A;  5H6Q A;  1BT8 A;  1THZ A;  1Q43 A;  2QWQ B;  3WG7 C;  3K04 A;  1KD1 W;  5LOV B;  1UJW B;  5IT9 N;  2VWK A;  3CPW U;  1H2L A;  4M3T A;  4UCO A;  3OGL B;  5LOV A;  4CS4 A;  3LDS A;  3J80 N;  1N1C A;  1KMI Z;  2X0L A;  2OTJ V;  1AJN A;  3KZI Z;  2Q4P A;  4FFB A;  1SS3 A;  3BFR A;  3QNN A;  3JD3 A;  1NI8 A;  3F5W C;  2LFS A;  1IBL B;  3CFP A;  1FZ3 E;  1HNX O;  3SUO A;  1E1R G;  3FD9 A;  4WFB V;  4DR5 B;  3SUN A;  3DGE A;  5GTH Z;  3SQ2 A;  2DQ3 A;  1WAJ A;  5IRE A;  3CC2 V;  2WLI B;  1K3E A;  5KHI A;  3BVO A;  1N34 B;  2PGG A;  2ZDI C;  4GT1 A;  5B3S C;  2VQF B;  4DU3 A;  3VOU A;  3WB2 A;  4GLX A;  1AJQ A;  1O9H A;  3B09 A;  4DTS A;  3BCC H;  4I0X A;  3CXC U;  4G2K A;  4GX5 A;  1XHX A;  2ZCE A;  1I94 O;  4I0X B;  3SDL A;  2CUG A;  2KG7 B;  2K9P A;  3CB2 A;  3PN1 A;  3HB3 B;  5JJJ B;  4UVA A;  3SUQ A;  4TV9 A;  3M8A A;  4R7C A;  1VQO V;  4KHQ A;  3N27 A;  4LCU C;  1QU7 A;  2AZ2 A;  2UU9 O;  3JAL A;  5DEC A;  4QND A;  2D2C B;  4NVP A;  1WAZ A;  2ZM6 O;  3RYH A;  3G4S V;  4JI1 O;  4KHP O;  3UKM A;  1AVM A;  2YI8 A;  4LFB B;  3OGM B;  2XUM A;  5J9P C;  5B3S B;  4AKH A;  3NR7 A;  2DEB A;  3H1I H;  4WFH A;  3E22 A;  1FS1 A;  1QLN A;  3QET A;  3B8N A;  3HP9 A;  1WLE A;  2ZT9 B;  1SA0 B;  4XDL A;  3LNM B;  4RQF A;  4JI8 B;  3JAK B;  2CTW A;  3RWU A;  5LGT A;  4RQE A;  3L1N A;  4LF8 B;  2HVJ C;  4ZI7 B;  4JYY A;  1GN3 A;  5A2Q N;  5CN0 A;  3K2O A;  1MNG A;  3LD8 A;  2AGA A;  4UCT A;  1XVF E;  4W4L A;  5IWA B;  4TV8 B;  3T4Z A;  1I5X A;  2EIN B;  1NTK H;  4UFZ A;  3WB0 A;  2VQE B;  2E5L B;  2HR3 A;  3ZHR A;  5EBL C;  1MHZ G;  3FB5 C;  4M3Z A;  5CMU A;  1HNZ O;  3ZHT A;  2ZR2 A;  4I50 A;  4X20 B;  4H44 B;  3TET A;  3BAB A;  4K0K B;  2IM9 A;  4LH7 A;  1MMM A;  3RGB A;  4DV5 B;  4QE9 A;  2IU3 A;  1U97 A;  4DU4 A;  2BSK A;  2UXN A;  5KA5 A;  4O4I B;  1IG9 A;  1NH2 B;  3VBB A;  1Q6U A;  3AK3 A;  5H6R A;  4JI1 B;  2HD0 A;  1IZ3 A;  2DYS C;  2YID A;  1COW G;  1JFF B;  1GM7 A;  4ZOL B;  2EIN C;  4KP4 A;  3K0D A;  3OUS A;  4ZOL A;  2OVR B;  2JH9 A;  3TXQ A;  3P3N A;  1VQ6 V;  3G6B A;  5L3C A;  3UM7 A;  1XIL A;  4WBN B;  5LXT B;  1VF6 A;  2UUB B;  3D3I A;  1YDX A;  1GTO A;  5DED A;  3HKD B;  2ILM A;  4KHW A;  1FFT B;  5EIB D;  3FYI B;  1RSO B;  1PPJ H;  5LMN B;  2HVK C;  4JS4 A;  2OIG A;  1KKC A;  2P5G A;  3AG7 A;  1YJN V;  1YZB A;  2YIA A;  2DWE C;  2GTS A;  3ABM B;  4DR7 O;  1DGS A;  4MW8 A;  2BTO A;  4DUZ O;  4NXM B;  5DN6 G;  1XMH E;  4DV2 B;  2EIJ C;  4KHN A;  1FYJ A;  1XRE A;  1FFX B;  1HDJ A;  1OV9 A;  3E8B A;  1PKX A;  1MZF A;  2N05 A;  4DTN A;  4J9Y B;  1D2D A;  4DTM A;  1S77 D;  3CC4 V;  3H1J H;  4DR5 O;  5EC2 C;  2YC0 A;  2YI9 A;  4K3A A;  3ZN0 A;  4I9Q A;  1YTF B;  2Y0P A;  4AKI A;  1B3Q A;  1VQL V;  2F66 C;  5JJN B;  5F2V O;  4DUY B;  4HCB A;  3MDS A;  4AI6 A;  1VAR A;  3NCI A;  4U7O A;  5EIB C;  2W6J G;  3LDD A;  1F23 A;  1NVP B;  2Y4T A;  3G80 A;  4GZR B;  4X65 B;  2B1I A;  4FJJ A;  4FFK A;  4CC6 A;  3D36 C;  3CFO A;  3B40 A;  2JRI A;  3FAV A;  2FYO A;  2JPN A;  3A0R A;  2P5O A;  4JI8 O;  3E8H A;  2DW4 A;  3KG2 A;  2GSM B;  4FJK A;  3A0H Z;  2HHH B;  1FXK C;  2LFR A;  1JMK C;  1M57 C;  5IYB O;  5ITZ B;  1GN4 A;  3KCX A;  4FLU A;  4DRX A;  1FYZ E;  3HKB B;  4UUJ C;  3ZMV A;  5JH7 A;  2QWP B;  1BZK A;  4PDV A;  2P1N B;  4BWA A;  4PI0 A;  1XVB E;  3CFR A;  4WF9 V;  4DTU A;  3K5O A;  3AK1 A;  4X1I A;  4NB5 A;  3JSN A;  2UU9 B;  1SQV H;  1H8E G;  3QEV A;  4MVS A;  3CP1 A;  1CXZ B;  3HKC B;  4KHS A;  4ADN A;  4UXN A;  2EIL C;  3ABL C;  4FFB B;  4O4J A;  3LZI A;  4ZIB A;  4LF6 B;  4K35 A;  1ZSP A;  3ETQ A;  1BQ0 A;  5FNV A;  4DTP A;  3E89 A;  1DF5 A;  3JYC A;  2P1M B;  1VQ4 V;  3LDB A;  4LNU A;  1FJG O;  1XMF E;  2RJZ A;  2ETN A;  4DR1 O;  4LNU B;  3CRC A;  1XU5 E;  4LFA B;  2CH7 B;  1PV0 A;  2OCC B;  3E86 A;  3K5N A;  1HNX B;  2P6J A;  1X4T A;  2JHP A;  4EFB A;  1BE3 H;  4MVZ A;  5KA6 A;  2UXB O;  4FK2 A;  1BCC H;  1IX9 A;  2Y69 B;  3BAA A;  4O4H A;  1VQ8 V;  4X1I B;  3W7S A;  1R6K A;  1YVW A;  4O4H B;  4FLZ A;  4JI5 O;  2ZE8 A;  5K1X A;  4AIL C;  2CTP A;  4BIO A;  1PM9 A;  4X66 B;  1XDC A;  1IXM A;  3MHH C;  1OCC B;  3ZED A;  1XVE E;  4IIJ B;  1F4N A;  3CRQ A;  2RKH A;  3CXH F;  2Z0A A;  1LDK E;  4B3R B;  1JX9 A;  4CH5 A;  2QTS A;  4O2A A;  2F4V O;  4DW1 A;  2DYR C;  2QM8 A;  4PI2 A;  1XNQ B;  3C90 A;  1F4M A;  3D3Q A;  2EUL A;  1S0V A;  4X8A A;  4GKK O;  4FVM A;  5LHH A;  5J2U A;  4H0L B;  3HR0 A;  3C3T A;  1R73 A;  3F7V C;  2WLL B;  1ZLZ A;  5CA3 A;  2FML A;  4DR3 B;  1MG1 A;  4GX1 A;  5CBH A;  4DV7 B;  1LUV A;  4WFA V;  3N2G B;  1P7G A;  2HG5 C;  4YJ3 B;  3E83 A;  2P1O B;  2VIX A;  3C6N B;  4P9P A;  5E1A C;  1AI6 A;  4EFE A;  2VWJ A;  1XMO O;  5TIS Z;  1Q3E A;  4MTX A;  1AJP A;  4FM2 A;  3BY6 A;  3GVM A;  1FAF A;  1HW7 A;  4J11 A;  4MT8 A;  2B8I A;  5KUK A;  2ATQ A;  1SER A;  2ZE5 A;  4B3T O;  3RYI A;  3EHB B;  4GCZ A;  1S72 V;  5E79 Z;  4LF7 B;  4G28 B;  1S5L Z;  4X1K A;  3JAR A;  1AI4 A;  1JW2 A;  2IJK A;  5CA1 A;  2OCH A;  1J5E O;  2BSK B;  2OVP B;  5KMG B;  5H2F Z;  1M57 B;  1S5J A;  1Q8I A;  3ICX A;  4JZG A;  1QQC A;  4FJX A;  4UCS A;  4PDR A;  5IJ0 A;  1R6N A;  3W7W A;  1FKA O;  4IT5 A;  2A0L A;  4QGP A;  4RG8 A;  4I5S A;  4DV3 O;  4FZ1 A;  4GAM C;  1PL4 A;  3HPL C;  4MVR A;  5LMU O;  2BTQ B;  2AHY A;  2X6C A;  2H4T A;  3F5T A;  4IL6 Z;  3IC9 A;  3K5M A;  1WAF A;  2QKC A;  2EJ7 A;  1AR5 A;  5B1B B;  2LP7 A;  1BHB A;  1M93 A;  4F6E A;  3L71 H;  3W7X A;  4DUY O;  1XI1 A;  3DC5 A;  2X6B A;  1KBH A;  3QEX A;  3ZHS A;  5J2T B;  4ZBM A;  4GX2 A;  4FJG A;  4FJ8 A;  4X5M A;  1ZL8 B;  3IAY A;  3C94 A;  1R6T A;  3ZMU A;  1ZL8 A;  5BZB A;  3FB7 C;  1EN6 A;  2A3Q A;  2YIB D;  1XMG E;  2RCV A;  4TOI A;  4P30 A;  2V1D A;  1YJ9 V;  5KX5 B;  4M42 A;  4JGS A;  3UT5 A;  3CCV V;  3JAM N;  3T1Y O;  4DV1 O;  3HGK E;  4FK0 A;  2WWW A;  5JCO C;  5IYC O;  3SNN A;  2OZS A;  1JCH A;  4KHU A;  4MS2 A;  2JEX A;  1NR7 A;  1RSO A;  1SF9 A;  3BA8 A;  4QE7 A;  1ZAU A;  1AIL A;  4RL5 A;  1I08 A;  4FJM A;  4LWS B;  2UUB O;  4UV8 A;  3SVI A;  1OCR C;  4GKJ B;  3ZRV A;  1NR1 A;  3F7Y C;  1XHZ A;  4FJL A;  5K1P A;  3STZ C;  1Y74 B;  5GTI Z;  3K08 A;  2F4V B;  3SI6 A;  1N36 B;  3K59 A;  1QVF U;  2A79 B;  5CA0 B;  1M1K W;  3AK2 A;  3IFX A;  2R9I A;  4JZ2 A;  4EKW A;  4F6R A;  3E8F A;  1IBL O;  1XU3 E;  5EZY B;  3RYC A;  3T1C A;  4J41 A;  1H8H G;  1XNQ O;  1SZX A;  2Q8V A;  3B4S A;  4J2E A;  4M3U A;  3IGA C;  1Q5O A;  3M99 B;  2V4D A;  4JV5 O;  2F43 G;  1QBZ A;  3OMI B;  4X66 O;  1WB7 A;  1K4D C;  1SES A;  3QO5 A;  4I55 B;  1F7Y A;  5IYZ B;  1OCO C;  2FB5 A;  4LWS A;  2JGU A;  3CCS V;  4YJ2 B;  2ITC C;  2ZE7 A;  4QNH B;  4YJ2 A;  3NE6 A;  4RNG A;  5ITZ A;  4FJ5 A;  1W59 A;  4X1Y A;  4JI4 B;  3JAW A;  4Q6G A;  2CH7 A;  3P3P A;  2VRZ A;  4U3J B;  4PA7 A;  3JAW B;  3CYO A;  4F6R B;  3APO A;  4JPR A;  5EYP B;  5EZY A;  4FJ7 A;  1J5E B;  4AKG A;  3CEI A;  5L3G A;  4LC1 A;  1FJG B;  2UXC B;  1P22 A;  4QPJ A;  3SPJ A;  2KQX A;  1Q9X A;  1MA1 A;  2CTR A;  1L0N H;  2WLN A;  3T2M A;  4RAI A;  1OCZ B;  4J42 A;  3CCL V;  3QVN A;  4LF6 O;  3RYF A;  2W6I G;  5LL6 Y;  4DV0 O;  4IIJ A;  4RWU A;  1CP9 A;  2EIM B;  1FXH A;  4ASU G;  2RNB A;  5IDJ A;  4NXN O;  4PD4 F;  3SYA A;  1K5Q A;  1ROP A;  1V55 B;  2YXL A;  1TGO A;  1HWY A;  2H3O A;  4F4L A;  3CMA V;  2QA4 V;  2PY5 A;  1IBM B;  3FB8 C;  3RVZ A;  4H13 B;  4DR2 B;  1GAX A;  3TAF A;  5JJE B;  1M90 W;  2QSA A;  1WA8 A;  3DXR B;  3UO3 A;  2G38 A;  2YUA A;  4CH3 A;  3GWK C;  3G71 V;  1VQ7 V;  3N2G A;  1KYO F;  2BOC C;  2GDS A;  3CD6 V;  5KHH A;  2EJR A;  3L70 H;  4BAY A;  2IJI A;  2W0X A;  3TXS A;  3JAS B;  3LZJ A;  2WLK A;  2IBZ H;  5JQG A;  1JA8 A;  5JQG B;  2XT9 A;  3THO A;  2ADP A;  3AEI A;  1GM9 A;  1Q90 D;  3SQ0 A;  3RVY A;  1FZH E;  3OE7 G;  3RW0 A;  4FLT A;  3WG7 B;  3WSO A;  3RWR D;  4E3S A;  2NR5 A;  1K7D A;  2JJ2 G;  4FIP C;  2CE4 A;  1K33 A;  4MSW C;  5AG2 A;  1I0H A;  1QVG U;  4ICG C;  4E2L A;  1NTZ H;  5BR8 B;  4FLX A;  3DXR A;  2P22 C;  5LMN O;  3CRR A;  1ZTE A;  4DR1 B;  1SQB H;  4ZKI A;  3ZMS A;  3ZX6 A;  4DR7 B;  3I5D A;  1SRY A;  2R9A A;  1JOY A;  3KD5 E;  3GB7 C;  2JH8 A;  1TA8 A;  2B9Z A;  1NS1 A;  4ZHQ A;  2PI5 A;  3ZBH A;  2ZD9 A;  1AR4 A;  1XUQ A;  1XVC E;  5BMV B;  2PFT A;  4NKG B;  2QWR B;  4H37 A;  4B3S B;  1K73 W;  3GWO A;  4PDM A;  3QEI A;  1WB8 A;  2RCU A;  4JAV A;  4LF9 O;  1D5N A;  3BHP A;  3ZRW B;  1RM1 B;  1Q6I A;  3AG3 C;  2BCC H;  3ETE A;  1OCZ C;  4OPA A;  2FL4 A;  4DTJ A;  2F1M A;  5FLX N;  2C2A A;  2XHB A;  3TJY A;  3OEH G;  2JGD B;  2A7W A;  1FZ6 E;  2E76 B;  4X64 B;  5JVD A;  4FM1 A;  3ETG A;  4JI2 O;  4OX9 B;  1M5I A;  3ZHQ A;  3RT3 C;  3O65 A;  1JVM A;  1NEX B;  2PYL A;  3AG3 B;  1RP3 B;  1NVP D;  4PA3 A;  3PJS K;  1FXK A;  3D36 A;  2E31 A;  5LP6 A;  1NBM G;  4ZI7 A;  3ABL B;  3L74 H;  4K8X A;  1NQT A;  1PNM A;  2AHZ A;  1KP3 A;  4I9W A;  1DTO A;  1N32 O;  5L3B A;  2NNU A;  3K06 A;  3MHS C;  5LP6 C;  4JAS A;  1K34 A;  4N23 A;  1IBK O;  3UO2 A;  2IJJ A;  2OCC C;  4X62 O;  4PHZ A;  3ASN B;  4PV1 B;  2LJ2 A;  5B1A C;  4M45 A;  1XMO B;  4X20 A;  4J2A A;  4CS3 A;  2WLI A;  5JVD B;  1YI2 V;  2CGN A;  1YIT V;  4B3S O;  5EBM C;  5B1N A;  4EYW A;  3CQ8 A;  4JI0 B;  2Y0I A;  4I4T A;  3ZMZ A;  2XAH A;  5H5N A;  4DR6 B;  4AHC A;  4LR3 A;  4NYK A;  2GUZ B;  2OIE A;  1YEW A;  1OCR B;  4UB6 Z;  1TUB B;  2H94 A;  4BR6 A;  1FXX A;  3X2Q B;  3SGI A;  4YIP A;  4IGG A;  3STL C;  2B1G A;  2WA4 A;  1XOU A;  2WPD G;  3P30 A;  4K8Z A;  4WBN A;  3ASO C;  5JCO A;  3K0G A;  1TVK A;  5GW7 A;  2WSS G;  1AB3 A;  2P1Q B;  4CC5 A;  3SPZ A;  1TVK B;  3SPG A;  3EXA A;  4DV5 O;  4E4E A;  1R1B A;  3ZIA G;  4EB6 B;  5LGU A;  3SQ1 A;  4B3R O;  3JAR B;  3OW2 U;  3J7A U;  1Q7Y W;  2P7T C;  4JI5 B;  5BY1 A;  5KHK A;  3SJA C;  4DK0 A;  3S3X A;  4NTY A;  4X9Q A;  2GV9 A;  4I55 A;  2UXB B;  3CCU V;  2KKW A;  1EBO A;  4A5U B;  4FK5 C;  4J2B A;  1IUR A;  5IJ9 B;  4WFF A;  1YF2 A;  4H33 A;  2L35 A;  3A2F A;  1TUB A;  4UCU A;  2XTA A;  4HAM A;  2ZE6 A;  5LXT A;  2YEV A;  2Y69 C;  3B8M A;  3FKS G;  1KC8 W;  4TV8 A;  3TL8 B;  4JS5 A;  2YEV B;  2N04 A;  1WPB A;  1FZ0 E;  1M56 C;  3N2K A;  1Q86 W;  4LFC O;  1QHT A;  3JD1 A;  3L0M A;  3SPI A;  3T4D A;  5LYJ B;  4KI4 A;  5B5E Z;  3K9A A;  4LFA O;  3KCY A;  4YXW G;  1Q81 W;  2P1P B;  4YHH O;  3JCU Z;  4J7K A;  2HEP A;  3V7D B;  3OMA B;  2QWO B;  2MK3 A;  1B04 A;  2YB5 A;  1Y67 A;  4KHP B;  4QJF B;  5H37 A;  1FFX A;  2JS3 A;  3QER A;  3U10 A;  1RPR A;  2UXX A;  2Q69 A;  2E3C A;  4WCE V;  2F95 B;  1MZE A;  3ZJZ A;  2Q73 A;  2KB1 A;  1IVS A;  3E4Y A;  4JTC B;  3ZS8 C;  1YSC A;  4FMT A;  5D5P A;  2Q7G A;  4TQD A;  3FX7 A;  2YXY A;  1L8D A;  2DMX A;  2WLH A;  3HKC A;  4UB8 Z;  3C95 A;  4MTG A;  3Q4H A;  2Q7E A;  3C3S A;  5EK0 A;  2AXT Z;  1BS3 A;  1ORQ C;  1A32 A;  3N2K B;  4I7Z B;  4W4K A;  1FZ7 E;  2HKO A;  1GN6 A;  3WFV A;  3HKE A;  3AG2 B;  2WLM A;  1XEQ A;  2K1E A;  5DM6 V;  4HCC A;  2VQE O;  2VS0 A;  1OJH A;  4X65 O;  3B77 A;  4IHJ A;  2HHH O;  4JI2 B;  4MTO A;  3JD4 A;  5JWP A;  2Q0A A;  1N33 B;  4OXS A;  2CK3 G;  2DWD C;  4JAU A;  3ML0 A;  5EBW C;  1V55 C;  4J7J A;  4LF8 O;  1F51 A;  1VIB A;  4PDL A;  3N1E A;  4CZZ A;  2ZDI A;  4QPK A;  5KUM A;  4FK4 A;  1RM1 C;  4DTR A;  3M7M X;  3SYO A;  3L9D A;  1MTY G;  2ZIM A;  4O4L B;  4EP9 A;  4NXM O;  4BW9 A;  2MMB A;  3KD1 E;  4P2Z A;  1H2S B;  2UUA O;  2JIZ G;  3ZHU A;  1G1X B;  1H2N A;  3RYH B;  1Z5W A;  1XVD E;  1WJZ A;  4DW0 A;  4D7S A;  3CSX A;  3SPY A;  1S76 D;  1K97 A;  2EBO A;  4PA9 A;  3N1B A;  3AG4 C;  2LF3 A;  2ZKO A;  4JF3 A;  3H1H H;  1JR9 A;  2JK5 C;  3J81 N;  3QO7 A;  2A9H A;  1Z2G A;  5C8Y B;  2X6A A;  1YHQ V;  1CLQ A;  4IYI A;  3L73 H;  2DE0 X;  3QEW A;  4XBF A;  2OZM A;  3JAK A;  3VQV A;  1XNR O;  5J2U B;  4YHH B;  2ARH A;  2K5S A;  3MKS B;  4LFC B;  3NXS A;  1T5E A;  1BMF G;  4DO2 A;  3ASO B;  5EYP A;  1MSW D;  5KAI Z;  1EZV H;  4O2B A;  4X89 A;  3FB6 C;  2GHY A;  4TV9 B;  2XAQ A;  4R6Z A;  5IZ7 A;  4B3M O;  3K58 A;  2LGQ A;  1XL4 A;  1NTM H;  2EIL B;  1ARO P;  2UUC B;  4E4B A;  3R66 A;  5H9C A;  3CWB H;  3CCR V;  4GYC B;  5A9G A;  3OAA G;  3TJT A;  4RO2 A;  1I7F A;  4KFM A;  3SYC A;  2JDI G;  1JJ2 U;  3QG5 A;  1IDS A;  3VQY A;  2B1E A;  4Z1M G;  4HYO A;  5L3F A;  3E22 B;  4DV4 O;  1FZ2 E;  1BL8 A;  5KMG A;  1N0J A;  4HBN A;  2MZW B;  2WLL A;  3SPH A;  1FXK B;  1TAE A;  3T1H B;  4M3W A;  1M56 B;  5LP6 B;  1QLE C;  1KU9 A;  1LR1 A;  3QNO A;  4OX9 O;  4J80 A;  5IWA O;  1NU1 H;  4J2D A;  3R65 A;  2X7R B;  4HZ3 A;  1WNS A;  3LUT B;  2RMK B;  3BEH A;  1EN5 A;  1GRJ A;  1SQF A;  1H2G A;  3KKY A;  3SJB C;  4AI8 A;  4LF5 B;  2OWO A;  2RQ6 A;  3HKD A;  1FZ1 E;  2GTA A;  2E32 A;  4KL1 A;  3IC7 A;  4FLY A;  4WFE A;  2UXD O;  2PUS A;  4J9Z B;  1DLB A;  1AI5 A;  1GO3 F;  4UVB A;  4LP8 A;  2IH1 C;  1FZ4 E;  1KQS U;  4JI0 O;  3CE2 A;  5CA1 B;  3OMN B;  4PA6 A;  1FPO A;  2LF6 A;  1SET A;  4XDJ A;  3FFQ A;  1Q6H A;  2ZM6 B;  1SA0 A;  3CRM A;  2IH3 C;  3OGK B;  1XMQ B;  3SJJ A;  4B7E A;  1I94 B;  5IBK B;  1FZI E;  1FXV A;  2YXH A;  4UCR A;  5B1B C;  3H01 A;  3NAE A;  2ATK C;  1I5Y A;  4JYA B;  1Q9Y A;  4TWK A;  3X2Q C;  2DJV A;  2JJ1 G;  3LDE A;  3K57 A;  1N34 O;  1AP5 A;  1MHY G;  4M3X A;  2ODM A;  1QNM A;  1FS0 G;  2YS8 A;  3ABU A;  2HJD A;  3OGC C;  4DXW A;  4GKK B;  1B06 A;  4JI4 O;  2PZS A;  4DV6 O;  3A8T A;  2VJ5 A;  1UPG A;  2FKX A;  4QNC A;  2Q67 A;  4KUM A;  4LF4 O;  2Q5Z A;  3ABK C;  3BRC A;  4O4I A;  3CCJ V;  5CA0 A;  5CBG A;  1BSM A;  4R50 A;  1NJI W;  4FPP A;  2CAZ C;  4JYC A;  1EFR G;  4JRQ A;  1KP2 A;  3CRA A;  1YCI A;  5IJ0 B;  3G6E V;  2O57 A;  1PNL A;  2Z5U A;  4YIO A;  2UUC O;  3TAG A;  5FL7 G;  3RYC B;  3W7U A;  2JGD A;  4AQY O;  1P49 A;  3A0B Z;  3ZRS A;  1H38 A;  2HFE C;  2W0F C;  3SCX A;  1N8R W;  2ZNJ A;  5L3D A;  2WAM A;  2FW3 A;  2EIM C;  3FYE B;  1CPY A;  3LSS A;  4CH6 A;  3MD0 A;  3FAV B;  3OR7 C;  5CB4 B;  4JTD B;  4DTO A;  3DSQ A;  2ADQ B;  4UCV A;  5CB4 A;  1IBM O;  1SQQ H;  1PL0 A;  4JI6 O;  1RFY A;  1JQ0 A;  4NTW A;  1Y74 A;  3TGU H;  3ZN1 A;  3TAB A;  1BQZ A;  1YXB A;  4X1Y B;  1VF5 B;  1Y4M A;  1R3I C;  4DV0 B;  3ABK B;  4DRX B;  4X62 B;  4L87 A;  2YDE A;  2NN4 A;  1EN4 A;  2HP8 A;  2ZQM A;  2DN9 A;  4TQF A;  3SPC A;  4Z1V A;  1XVG E;  2R72 A;  2YIB A;  2DY4 A;  1KB9 F;  2NLJ C;  2N74 A;  3AG2 C;  3OEE G;  1HNW B;  4YY3 B;  3L75 H;  4FJH A;  3LDC A;  2LW1 A;  3SUP A;  3AG1 C;  4MTF A;  4FJN A;  2JS5 A;  4MVQ A;  4FLW A;  1X59 A;  2JEU A;  1SQG A;  4O4J B;  1IBK B;  1OCO B;  4JI7 B;  4I9L A;  2PFV A;  2M6Y A;  2JHC A;  3HKE B;  4DU1 A;  2CDY A;  2F23 A;  4LH6 A;  2P90 A;  4LF5 O;  4IHJ B;  4M41 A;  4O2A B;  2XND G;  3JD0 A;  4PEL A;  1BHA A;  1VQ5 V;  1QR8 A;  2Q68 A;  4JI3 O;  1L0L H;  3G67 A;  5C8Y A;  1H2M A;  3JSL A;  1S5H C;  4D6T H;  1WPX A;  2IU0 A;  1DF4 A;  1ZX3 A;  4DV3 B;  5IYD O;  1SZT A;  1P4R A;  2B5U A;  1QCE A;  4EPH A;  2QXF A;  3ZMT A;  2EIJ B;  1VQP V;  1O9G A;  1E1Q G;  5LMU B;  4FLV A;  3ABM C;  4ICG A;  1VQ9 V;  3APQ A;  1VP7 A;  1FZ8 E;  3L72 H;  4O4L A;  4X64 O;  1K5S A;  2QM7 A;  1NKD A;  4OGQ B;  4PA4 A;  1HP8 A;  3SYQ A;  4NXN B;  3SJQ C;  4TSF G;  1PD3 A;  3CCQ V;  4JI7 O;  4LF7 O;  3DC6 A;  1G6U A;  5FNV B;  1HR0 B;  4GX0 A;  5KLV H;  3UIQ A;  2QTO A;  1WP7 A;  1H2K A;  4X1K B;  5GON A;  4BIZ A;  2HJF C;  4MW3 A;  4DUZ B;  1YJW V;  2JQT A;  2Q6A A;  2RDC A;  4GKJ O;  2Q9L A;  3OFN G;  3C6P B;  2Q0O C;  1BGY H;  3ZHV A;  4LBE C;  2ZXW B;  4ADO A;  1S3J A;  1WA8 B;  2A06 H;  1FZ5 E;  1R3K C;  3ZCC A;  1M9N A;  3QF7 A;  5B1O A;  5LHI A;  2YSU B;  4HNA A;  1W0K G;  2ZIO A;  5BR8 O;  1N4C A;  4HNA B;  1AR1 B;  3CC7 V;  3AG4 B;  4QIW F;  3ZRX A;  2DYR B;  4KXR A;  1Y76 B;  3EVK A;  2OYQ A;  5L3E A;  2BTQ A;  2R9R B;  2Y4U A;  1P7B A;  4XDK A;  2PTM A;  1HR0 O;  3BA9 A;  1OCC C;  3LSQ A;  4FJ9 A;  1TUE B;  2LW7 A;  5KHJ A;  3WB1 A;  2Y48 A;  4UVC A;  4U3F H;  4TT3 G;  4JRP A;  4I50 B;  4DR4 O;  1MAB G;  2WA3 A;  3TK1 A;  5B66 Z;  3CCE V;  1ZUQ A;  4LF4 B;  1W2B U;  1SC5 B;  3AG1 B;  5C93 A;  3E35 A;  5IY5 C;  1HNZ B;  1AP6 A;  1EM1 A;  2OT5 A;  4FJC C;  4FJI A;  3J27 A;  1KUQ A;  3CME V;  3CS5 A;  3Q4H B;  4DR4 B;  3E2E A;  1JFF A;  1M4U A;  4CH4 A;  1OZ0 A;  1KKD A;  2ZNI A;  1V9P A;  5CBF A;  3JD2 A;  2ZXW C;  4YJ3 A;  3OTO B;  2EZP A;  2ZR3 A;  3UT5 B;  1D5A A;  3LSU A;  4FM0 A;  4P9O A;  3HGL A;  1SKV A;  2RN9 A;  1Y76 A;  2F93 B;  2XOK G;  3K03 A;  4L8J A;  4N21 A;  1P84 F;  4JYB A;  4KHY A;  2WLJ A;  1IH7 A;  3RYI B;  2PYJ A;  1Z5V A;  2PI4 A;  4JYA O;  3K3W A; 
#chains in the Genus database with same CATH homology
 2QWO B;  2PF4 E;  3BVO A;  4J7Z A;  1GH6 A;  1N1C A;  1BQZ A;  2Y4T A;  2DMX A;  3UCS C;  2KQX A;  2Y4U A;  2OCH A;  2L6L A;  1FPO A;  2CTR A;  1HDJ A;  2N05 A;  2CTP A;  2N04 A;  1XBL A;  2QSA A;  1FAF A;  2QWP B;  3UO3 A;  2QWN B;  2M6Y A;  1IUR A;  2YS8 A;  2CTW A;  1BQ0 A;  2DN9 A;  1WJZ A;  1NZ6 A;  2YUA A;  3UO2 A;  3APO A;  2LO1 A;  2QWQ B;  2LGW A;  4IT5 A;  2GUZ B;  4RWU A;  1N4C A;  3AG7 A;  2CUG A;  2EJ7 A;  2QWR B;  4J80 A;  2GUZ A;  2RKH A;  3APQ A;  2CTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...